3KFUG

Crystal structure of the transamidosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
ELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 15
structure length 86
sequence length 86
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.990 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kfuG02
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kfuG01
3A1KA 3KFUG 3H0MC 3H0LC 4WJ3C 3AL0C 3IP4C 2F2AC 2G5HC 3H0RC 3A1IA 2G5IC 2DF4C 2DQNC
chains in the Genus database with same CATH superfamily
5B32B 3L26A 2HHHM 2VQRA 4WU9D 1ZAEA 4X23D 2ZY5A 2KA6B 2UU9M 1Z5AA 5DNYA 2DWNA 5BNXA 1P3OC 3BBZA 3EPLA 2L4FA 5B1MA 3AN2C 1KX4B 3H4JA 3AV0A 1G71A 4MGYE 1EIJA 2CWEA 1G4AE 2ZY3A 2P5TA 1HQ3C 3LVWA 2G5GX 4LF9M 5KDMA 1QDTA 3KWQA 5IZ7D 3SYKA 3EG5B 5B31C 4ZPXA 3WTPC 5DNMC 3MNNB 1TAFA 4IJEA 1P3AA 1TZYC 2Y0QA 1QYRA 2ZM6M 1QAMA 1HT2E 4BB9A 4G4QA 2JY6B 3LZ0C 4YY3M 3U6EA 1XXHB 5JI3E 5B0YD 3U6MA 3CF0A 4ZUXC 4FW9A 2D7HA 2W82A 5DYGA 1P3PB 3REJD 4WU9C 2JSSA 2RKOA 5EP4A 1BVSA 3HX3A 4X23C 4DV2M 3GPUA 1F66C 2QCUA 1HR0M 3PXGA 3GP1A 4G91B 1E32A 2JCHA 4NL4H 5B1LB 5ITRA 3L2AA 1BH8A 4CSRA 4AWLB 4YHHM 4LF8M 1QZMA 1PJSA 3RELB 5EXTA 3HU2A 5B40D 4L8RC 3A1IA 1XHBA 2L6OA 3F6TA 4GEWA 4PDIA 3NBXX 3KW6A 4PT5A 2DNAA 4DUZM 4NRWA 5H37D 3B7QA 4NE6A 4AQYM 3AZLD 2NZDD 4I81A 1KX3B 3X1VA 4Z66D 2DF4C 1P3LA 5FTMA 3FD9A 3A6NA 1P34A 4H9QB 5F99B 1R7RA 2EKKA 5B0YC 2OOBA 4LD9D 3REJC 3P5JB 3B0BA 4D82A 3L28A 1M19D 3R45B 5FTJA 5G49A 4NXMM 1E94E 2DAGA 2M5ZA 3T1HM 3GRVA 1BH9A 2QQ8A 4KHPM 2BYKA 3U60B 5B32G 3W99A 2ZTDA 1PJTA 3GPPA 3AV2D 4IBGA 1TF0B 2R18A 3U6QA 3WHKA 4OU7A 2DZLA 3UTBB 5EP1A 2FJ7D 3KOXE 2V1UA 1EQZB 2QZ4A 1P3FA 2X8AA 1F4IA 2HIOB 3AZLC 2NZDC 2XSZD 3AJIB 5AV8B 1U35A 4H9PB 1IY0A 4KUDD 2F4VM 5B0ZB 4Z6YA 2Z7JA 1JFIA 3A1KA 3AFAB 2I7PA 1ZLAA 5AVBB 4LD9C 3CF6E 1C7YA 3WTPE 2UXCM 2QNJA 1R4VA 5AV5D 3X1UD 3TWKA 1DO0A 3AZHD 3KUYB 4YS3A 5JRGD 2W8SA 4IBJA 2OQ4A 3T15A 1A5TA 1Q39A 4QHSA 3VK8A 3VH5W 4L78A 2R6FA 4M9SA 3AYWD 2WZJA 3AZMB 2O5RA 3RE8A 4LJ6A 2L7IA 3C1CC 4L4UA 3FUXA 5GT0D 2C9CA 4DV7M 4XUJD 2FJ7C 1P3OA 3HHZA 3J81S 3AZKA 3LELB 1WHCA 3WKJB 4IIWA 3NBIA 4JI3M 3MGRB 4KUDC 5C3IC 5LMUM 2KRKA 3KP1E 5ITXE 3E46A 1HQ3A 1QUTA 4XZQA 3AZJD 4WU8C 1KX5A 1P3IB 2JZ1A 5B31A 3GQ4A 5DNMA 3UTAB 2R46A 3REHD 3AZHC 3QYEA 1YSYA 2N35A 5JRGC 1T43A 3O62B 2ZBKB 2EKFA 2CE7A 3AZFB 2F5SA 5GXQD 3LZ0A 1DGBA 3AYWC 1T6OA 1G3IA 1YLAA 5ITYA 3V9RA 3DZDA 2QBYB 4ZUXA 3J80S 1ZMUA 1N36M 4OX9M 2MJ5B 2Y2HA 5JI2E 4KGCA 3KSYA 4JJNB 5GT0C 4Z2MH 1F66A 4DUYM 4XUJC 4LJ8A 4ZBJB 1D2NA 1OTRA 3KWQD 4DV3M 1WIVA 2X49A 4D81A 4HGAB 3MK6A 3UK6A 3TPZA 2R45A 1QVRA 4AW4A 1P3AD 3KXBB 3UT9B 5FSWA 3AZEB 3LQQA 4MM3B 2F5OA 3W98B 2YFWA 3REHC 3C1BB 5CP6C 2X4AA 4NSOB 3VKGA 4LFCM 5GXQC 4H9SC 4EO5B 4LJAA 5FTLA 4W5WA 3REJA 2AHMA 2CV5B 2V6ZM 3KSJA 3A98B 1R2ZA 4E45A 4B7FA 1HTAA 1S32B 3UJNA 4CIZA 4UPKA 2QENA 4JV5M 2MGWA 4Q7JA 4J8UB 2CHGA 2KNVA 2LBCA 2Y2IA 2CEAA 1IN4A 1NV9A 1UFZA 4DV4M 1P3LD 3GLIA 3HU1A 1I94M 4JN6A 4DR7M 2WSFF 4FD2A 4Z5TC 2DVWB 4LF5M 3AZLA 2NZDA 2G3QA 2YFVA 4GH9A 3W68A 4FWDA 1L1ZA 2E5LM 4QLCB 3H0RC 4B08A 3ILKA 2UUBM 2F8NA 1XNQM 4J8WB 2LVAA 4M6BA 2YQZA 2K0BX 2XFTA 1XB2B 3W67A 2RGOA 3W96B 2HL7A 4RF1A 3W99D 1EE8A 1KU5A 1WXQA 2O25A 3TQSA 1L1TA 3C3EA 4DR2M 5GKNA 3IG8A 4ITQA 4DBGB 3MGQB 2EA0A 3REKB 4PDGA 5KPTA 3RGPA 3SAUA 5B2JB 3FE3A 3E9SA 3GLFE 1P3FD 3GRYA 4MB7A 2EJSA 3MNNC 1P3GB 2XD5A 3C1CA 1P3LC 3U6PA 1WGLA 3B74A 3GQ5A 3WAAA 3VH6W 2FJ7A 4M0DA 2UWXA 1ZLAD 4HEOA 4LG2A 2Y2KA 1N1JB 3KFUG 2IO5B 5AY8B 2C99A 3JR4A 3GLGE 4WU8A 4LRSA 4JYAM 3H4MA 2OO9A 3GLHA 5EXXA 3W99C 3AV1B 2DAMA 1M18A 5B1LC 3KOZE 5DNNB 4CGYB 1GO5A 4AWLC 1JB0F 3AZHA 1W5TA 5JRGA 2AROA 5E5AB 3FYDA 1VDLA 2RIQA 4UUZB 3AFHA 4H9NB 2JWSA 2R44A 3AZIB 2DWZB 5AVCB 4MGKE 5BO0B 3RGSA 1Q9CA 3AZKD 3WA9B 1P3FC 4IBCA 4JI5M 4DR3M 3IG5A 4XK8F 3U5ZA 3CTWB 3HJQA 1LV7A 3QWLA 2K6BA 3FTCA 1KX3C 1IXSA 4XZQD 1KX5D 3LJAD 5B0ZD 4PCZA 4JI7M 2FOIC 1R4GA 3ZCBB 1P3MA 1ZMVA 3JAMS 5CHLB 3AZGA 5FTNA 3L27A 1AOIA 5B2IB 2DAEA 3FUVA 3REIB 3QAUA 4H9RA 4QOSA 4NFTA 3TU4B 5FUGA 3KOYE 3REHA 4M0WA 5CP6A 3C58A 4KGCD 2L4EA 3MGSD 4LJ4A 2CHQA 2R62A 3GPYA 3AZNB 3J7BA 1F66D 3SMSA 3B0CT 2A5YB 5GXQA 3C9PA 3FYCA 4H9SA 2LY8A 3AZKC 1NJFA 4GHLA 5CPKB 2JY7A 4II7A 4B3RM 3MGPA 4F2LA 4FVMA 4MGHA 3LELD 3X1SD 1DV0A 3IECA 3HJSA 2MR9A 4XZQC 3X1TB 1Q02A 4IBKA 3MGRD 5AV8C 2PYOA 1KX5C 1SG9A 3T1YM 3LJAC 4CSRB 3U61B 5B0ZC 3LZ1B 3PVSA 2DAKA 1QZEA 1Z6TA 3SAVA 1G59A 4AKIA 4DV1M 5AV6B 2WSEF 2R65A 4J8XB 1KYIA 1HJPA 2L2DA 1UM8A 1TTEA 5CPIA 3GO8A 2HUEC 4YM6B 3U6CA 1ID3A 1L2CA 4CISA 5GT3B 4Z5TA 4CHTB 4R8PA 3X1VB 5CPJB 4LJ7A 3AZMC 3A6NB 1P34B 4KGCC 2H1RA 4JI0M 3W0LB 3SAWA 3MGSC 5B32A 5KPRA 1QANA 3TE6A 1VEGA 3PNVA 3B6FB 3R8FA 1FJGM 2WSCF 3WHLA 3VFDA 4CAYB 3SARA 3F92A 3LELC 3K92A 3X1SC 3W97B 1NO1A 1KX4A 3MGRC 4M9ZA 4QNMA 4G6ZA 3PFIA 3B6GB 4H9OB 1TH2A 3KXBD 2XH9A 4OVZB 3TWLA 1W5SA 1M1AD 2NQBB 2JY8A 3MJ5A 1IN8A 5AV9B 3MNNA 1V33A 4E44A 1BFMA 1IBMM 2Y2OA 2ZANA 3O62C 2DKLA 2F8ND 1GL6A 4LGYA 1DGFA 1N77A 3I4VA 2FNAA 1L2BA 4IBIA 1C1KA 4MH0E 1P3PA 2CV5D 1J09A 4JJNC 4WJ3C 2L7HA 2YFQA 1B67A 2LHGA 1SXJD 4NE5A 2JNHA 5B1LA 3C1CD 3RELA 1PJQA 5JA4A 2VQEM 3WAAD 1D0KA 4LCBA 1VQ1A 1K82A 3KXBC 2BG1A 2Q2EB 1M1AC 1AUAA 4XGIA 1DGHB 2Y21A 3C1BC 5GSUB 1P3OB 5B33D 3MVDB 1OAIA 1KX3A 4G92C 2JA2A 4WU8D 4JI1M 5E26A 3AN2B 1N32M 4J8WD 1M18D 4KODA 1NSFA 1XWIA 4J8VD 3K2LA 1K3XA 1IBLM 1P3KB 1IXZA 1VEJA 2CV5C 2AROD 3E21A 3WTPB 1SXJC 2VF8A 3T38A 4QOZC 2F8NH 4KHAA 1TZYB 3LW5F 3KS4A 3ZH9B 2BNKA 3FUTA 3UZUA 3WAAC 1XNRM 1Q3BA 3LVVA 3UTBA 4WU9B 5B24B 3LMMA 5BNVA 1EQZA 3K1JA 4X23B 1S3SA 3FRIA 1P3MD 3M6AA 5FLXS 1ULYA 5B33C 3AZGD 2DHYA 1AOID 2BJWA 4QLCC 5AV8A 3LJAA 4H9PA 1ZMWA 5B0ZA 4OW0A 4J8WC 1M18C 4MGIE 1WWSA 4J8VC 2FFJA 3AFAA 1JR3A 2XZUA 5AVBA 4Z8XA 1XC8A 3HY5A 5CP6D 4I8OA 2O01F 2AROC 4DQYB 4JI6M 3KUYA 3MGQC 2YFWB 3CGWA 1KFVA 4P17A 3BOSA 1TH4A 1VEKA 3MGPD 3AZMA 1WWIA 3MGSA 1N75A 5B0YB 2PYOD 1HNZM 3NQJB 1RU3A 4X65M 4L6V6 1R5LA 4DRAA 5C18A 1P3MC 3LELA 3NWLA 3WKJA 3X1SA 3AZGC 1AOIC 3GLIE 2D7GA 3MGRA 5CPID 4LZJA 1G8PA 1NY6A 2Z8YM 2Z3XA 2QP9X 1ID3D 2R4EA 3EIHA 3EPJA 2BYMB 4Z5TD 4LF7M 3FTEA 5B40B 1K3WA 4R8PD 3K9OA 1P3BD 5EJCA 1NNUC 5EXPA 2MH8A 3TU4D 5B32D 4GITA 4X66M 4CJ6A 1H6UA 1OIPA 5IT9S 3O62A 1X37A 3AZFA 1PRBA 1OFIA 2Y2LA 4Z66B 4QHTA 3MGPC 2QBYA 1MJGM 1H3OB 1KX4D 1F1EA 1Z2CB 2PYOC 4Y28F 5B31G 4JJNA 4LD9B 2FS1A 2ZY4A 3FTFA 1M19B 5KO3A 5IREB 2ZTCA 3SHGB 1WJ7A 2J8PA 3MNND 2XGNA 5CPIC 4LF6M 2KRUA 1ID3C 3KXBA 3UT9A 3AV2B 2LH0A 1MX0A 4LJ5A 1M1AA 4R8PC 1P3BC 4IJFA 3W98A 2C98A 1AIPC 2Y0TA 3B0DC 3TU4C 5B32C 2VDBB 3VLFB 3C1BA 2D7EA 4R3DA 1P3PD 5CPJD 2KNZA 2FJ7B 1NHWC 4WV4B 3AZNC 3A42A 1B6WA 3K9PA 4DV5M 3GLHE 2DWLA 2UUCM 5B1LD 3K8ZA 2LVNC 4KUDB 2QSFX 1OKSA 1Y8GA 3A45A 4L16A 1KX4C 1YE9A 2CV5A 3Q8XA 4WURA 3RELD 4R7GA 3W97D 3NQUB 2XLJA 1GKIA 1S32A 5AV5B 3X1UB 2B3TA 1SXJA 3LZ1C 5E6JA 3SHFA 2KNAA 4J8XC 5AV9D 3LQRA 2UXBM 3AYWB 5BS7C 1KX3D 3HJ8A 5DFLA 3GLFB 5F99D 1T3TA 1N34M 1OQYA 4KLNA 3C3DA 4WNNB 5ITQA 5GT0B 3L25A 2Z4SA 1PZRA 3VH5T 1J7KA 1P3PC 3AKZA 4XUJB 5CPJC 1XMQM 5B33A 1D0LA 4QLCA 4G91C 1ZV1A 4J8WA 4J8VA 4QNRA 1OAOC 3W96A 2LNHC 2L5AA 3AZJB 3GLGB 2DI0A 3RELC 5FTKA 3W97C 2ZM5A 3GRRA 4X62M 3GRUA 3MGQA 2F5QA 3M0EA 3REKA 3J27B 3B6GC 3REHB 1QUSA 3UTBD 3IP4C 1Q3CA 5B2JA 1EQZD 1EFUB 3J2PB 2NQBC 4G4NA 5AV9C 2HIOD 3B89A 5BNXB 4S12A 1P3GA 5AV8D 5B1MB 5F99C 3MVDD 1PGYA 2VIIA 1IM2A 3AFAD 1JR3D 5KQDA 5AVBD 2XZFA 3OTOM 2RGHA 2HCBA 5KDMB 1N1JA 3CF2A 3MHVC 5AY8A 3KWQB 2ZAMA 3DA1A 3KUYD 3FTDA 2FH0A 2CHVA 3HU3A 4B7HA 1TAFB 1P3AB 1A7WA 1D0MA 3U6LA 2CFOA 5DNNA 4R71A 3AZMD 1TR8A 4JI2M 2CV1A 2RRUA 5EP2A 1KSFX 4UUZA 3FRHA 2BJVA 1V92A 3UTBC 3AZIA 4DR4M 3GQ3A 1EQZC 5AVCA 5BO0A 4GC9A 2XEPA 5KPZA 4NE3A 3WA9A 1PJJA 5B24D 2HIOC 3WKJD 1E9SA 2FFFB 2KDLA 2KZUA 4NXNM 4JI4M 5GSUC 2HKJA 4Z2MG 1BH8B 3MVDC 1WGNA 2Y2JA 1VDDA 3AFAC 1P3ID 3IHPA 5AVBC 3RFWA 1ZQ9A 3Q8GA 3UGJA 3UTAD 1P3KC 3KUYC 3L29A 2KEBA 3HWSA 2GQFA 2QHOB 3O62D 2F2AC 3HHYA 1NNJA 5B2IA 3REIA 3AZFD 2V1CA 1XXHE 1P3BA 1P3LB 4GMQA 1DGGA 3TU4A 1E9RA 2YNMD 3R9XB 2JXNA 3U6OA 4JJND 4DV6M 4JI8M 1TDHA 3PNYA 2G5HC 3AZNA 2DENA 1IN6A 4JXJA 5DYIA 4TUWA 2Y2QA 4GKKM 3TWMA 5B24C 5G49B 3TL4X 5CPKA 3WKJC 2LHCA 1GABA 1BH9B 5EXSA 2BYKB 4I4LA 3W99B 2Y20A 3X1TA 3UT9D 2CRUA 3U61A 1P3IC 2VF7A 3LZ1A 1QQWA 3AZED 4AI6A 4LFAM 1TH3A 3SASA 3W98D 5AV6A 5JA4B 3UTAC 4B3SM 4J8XA 3C1BD 3J7AS 3QYBA 5BS7A 3B7ZA 3FDDA 1P3FB 3AZFC 4YM6A 4LRTA 2DAIA 5LMNM 3E4RA 1XXHA 1DO2A 1Z5CA 3ZC7B 1U35B 2Z4RA 2FE8A 4HLQA 5GT3A 1HT1E 3VKHA 4LF4M 2XF3A 5CPJA 1JFIB 2Y2GA 3KS8A 3DFZA 1ZLAB 1IXRC 2OPFA 2Y2PA 1S32D 4ZBJC 3B6FA 2EO2A 4K0KM 4HGAC 3VH6T 4XBOA 4YS3B 5EP3A 4D80A 1R2YA 2APLA 4J8UD 4CAYA 4IBFA 2NQ8C 1L2DA 3W97A 2J7OA 4DR1M 1IY1A 1GVNA 3UT9C 4REZA 4KHAB 3VDPA 4I5SA 3B6GA 5ITTA 1OFHA 4H9OA 3AZEC 1FNNA 1J5EM 3W98C 4OVZA 4DRBA 5B40C 2NQBA 3HHXA 5AV9A 4GHAA 5BT1D 4FWGA 3AZKB 4QLCD 2LVPC 4AG6A 3KXEC 5BNVB 4H9QA 5F99A 2DXIA 4EO5C 2JE5A 1QAQA 1JR3E 3KP0E 3W96D 4XZQB 4B3MM 1HQ3B 4Z66C 4GC5A 1KX5B 3LJAB 1XMOM 3R45A 1S32C 5B31B 3MGQD 5DNMB 3REKD 3EIEA 5BPVA 4DR5M 5C1BA 3U60A 5B2JD 4J8UC 1IBKM 1M19C 1IN7A 4UN2B 2HUEB 3LZ0B 1P3GD 3V9RB 2XD1A 2HAKA 4ZUXB 5KQ8A 4DR6M 3W0FA 2ERCA 1JQJC 1L8QA 3AOGA 3AV2C 1ORYB 4B7GA 3I51A 4KGCB 3MGSB 2DZOB 2I7NA 4FWHA 1F66B 1V34A 2OOAA 2HIOA 3V76A 1DGHA 2LWXA 5BT1C 5AY8D 5GSUA 3D8BA 4F1IA 2F5PA 3MVDA 2DQNC 2JUJA 3W96C 3X1SB 3AN2A 4IBEA 3FKEA 3AV1D 5DNND 1Z59A 3MMPA 4LFBM 1P3KA 2Y2MA 2BWBA 2RVQD 4NRVA 5E5AD 3REKC 1YUBA 1HNWM 3AZID 3VK7A 5AV5C 3X1UC 3WTPA 4KT0F 5B2JC 5AVCD 4LY6A 3WA9D 4GRIA 1TZYA 1Z5BA 4NOOB 2LTUA 3I01M 1R6BX 1P3GC 1NJGA 4NSRA 3AL0C 2JZ0A 1NY5A 3REJB 3JR5A 2UXDM 5B1MD 3I04M 2LXEA 3HGIA 4RNAA 4WU9A 5B24A 4X23A 2J5YA 5AY8C 2IO5C 2BWEA 2CV2A 4AKGA 4BBAA 1HQCA 3VH5A 3D8LA 5B2ID 3REID 1P3IA 4FCWA 3AV1C 3HZJA 3A46A 3B0CW 4EIWA 3AOEC 3GLIB 5DNNC 3UTAA 1TGUA 3AZJC 2KXEA 3I4YA 2DWMA 5ITXA 2RVQC 5E5AC 1HNXM 2G5IC 5F3WA 1M1AB 3AZND 3AZIC 4LGMA 7CATA 3AZLB 2NZDB 2YFVB 4MGZE 5AVCC 3B7NA 5BR8M 3WA9C 1IFYA 1MU5A 5CPKD 2F8NB 2J7NA 4G92B 4DV0M 4RKUF 2DHRA 1MN3A 3DOAA 5B0YA 3X1TD 3T6PA 1SXJE 4GIPA 2G8LA 1N33M 5B1MC 4NC6A 3NQJA 4L15A 3LZ1D 2CUZA 5AV6D 1IQPA 3EPHA 1NV8A 4J8XD 2MROB 4FCVA 3H0LC 2VQFM 2K47A 5IWAM 1SXJB 3KWQC 5B2IC 2LVOC 3REIC 3GPXA 1IN5A 4YM6D 4IBDA 3AZEA 3C1CB 1P3AC 2BYMA 2CWBA 5GT3D 8CATA 3WAAB 5B40A 3X1VD 3A6ND 4AG5A 1P34D 3VDUA 4B3TM 3U6DA 3B6FD 1GLNA 1QAOA 4G3OA 3KSXA 4WW0A 2UUAM 3M7GA 5CPKC 5C3IB 5B33B 4WU8B 4WZSB 4Z66A 2DZNB 3GLHB 1H3OA 1OIZA 1M18B 3X1TC 4J8VB 3HKPA 3B6GD 3AZHB 4LD9A 1IY2A 1TDZA 5JRGB 2AROB 5AV6C 4J8UA 2NQBD 1M19A 1GJSA 2R0IA 2KW0A 3KDSE 2XFSA 3THGA 4LJ9A 3SBJA 4AZFA 3U6SA 4A3VB 3SFZA 2C96A 4YM6C 4KO8A 2QPAA 2H5XA 4P16A 3U5ZB 4ANRA 3AV2A 5GT3C 1IXSB 3X1VC 2KHHA 1T3UA 1U35D 3A6NC 1P34C 1PM5A 4G4OA 1CUKA 4PD2A 1LTMA 3EPKA 3B6FC 2CP8A 3H0MC 1P3MB 2C9OA 3AZGB 2XSZA 1AOIB 2JY5A 4G4RA 4KUDA 4YS3D 1OJLA 2EUCA 4WP2A 4LZZA 3HHWA 4GKJM 4H9RB 5EQTA 2F5NA 2ZAOA 1QDRA 3SC3A 3KVWA 1N78A 2ZY2A 5FUGB 3NQUA 1NVMA 4IBBA 5CP6B 5AV5A 3X1UA 2F8NG 5L8RF 1HQYE 4X64M 3LCVB 1NHGC 2K9DA 2F8NK 2M60A 3B9PA 5GXQB 3SYLA 5GSUD 2LVQD 1WR1B 1P3OD 4HL4A 3AYWA 2HWJA 3MGPB 1VG5A 2YR0A 3GLFA 3SATA 2Y2NA 3AN2D 2R4JA 5ITUA 2PYOB 4WNNA 1U35C 5GT0A 2L09A 3LCUA 1P3QQ 4XUJA 1P3KD 1HQ3D 1W2EA 3SMPA 3UMMA 1ZLAC 3FUWA 1GL7A 1GJTA 1I4WA 3ZQJA 5B31D 3WTPD 5DNMD 3BXWA 3AV1A 1PJIA 3AOEA 5CPIB 4YS3C 4M9XA 1TZYD 4BLCA 2CV0A 2KZSA 3AZJA 1ID3B 3GLGA 5E5AA 3VH6A 3FUUA 4FCTA 4Z5TB 2GNOA 3LZ0D 1G41A 3KOWE 4H9NA 4R8PB 2C5RA 1P3BB 5A2QS 2JP7A 4AKHA 4ZUXD 3B0DB 4RF0A
chains in the Genus database with same CATH topology
5B32B 3L26A 2HHHM 2VQRA 4WU9D 1ZAEA 4X23D 2ZY5A 2KA6B 2UU9M 1Z5AA 5DNYA 2DWNA 5BNXA 1P3OC 3EPLA 5B1MA 3AN2C 1KX4B 3AV0A 4MGYE 2CWEA 1G4AE 2ZY3A 2P5TA 1HQ3C 3LVWA 2G5GX 4LF9M 5KDMA 3KWQA 5IZ7D 3SYKA 3EG5B 5B31C 4ZPXA 3WTPC 5DNMC 3MNNB 1TAFA 4IJEA 1P3AA 1TZYC 2Y0QA 1QYRA 2ZM6M 1QAMA 1HT2E 4BB9A 4G4QA 3LZ0C 4YY3M 3U6EA 1XXHB 5JI3E 5B0YD 3U6MA 3CF0A 4ZUXC 4FW9A 2D7HA 2W82A 5DYGA 1P3PB 3REJD 4WU9C 2JSSA 2RKOA 5EP4A 4X23C 4DV2M 3GPUA 1F66C 2QCUA 1HR0M 3PXGA 3GP1A 4G91B 1E32A 2JCHA 4NL4H 5B1LB 5ITRA 3L2AA 1BH8A 4CSRA 4AWLB 4YHHM 4LF8M 1QZMA 3RELB 5EXTA 3HU2A 5B40D 4L8RC 3A1IA 1XHBA 2L6OA 3F6TA 4PDIA 3KW6A 4PT5A 4NRWA 4DUZM 5H37D 4NE6A 4AQYM 3AZLD 2NZDD 4I81A 1KX3B 3X1VA 4Z66D 2DF4C 1P3LA 5FTMA 3FD9A 3A6NA 1P34A 4H9QB 5F99B 1R7RA 5B0YC 4LD9D 3REJC 3P5JB 3B0BA 4D82A 3L28A 1M19D 3R45B 5FTJA 5G49A 4NXMM 1E94E 2M5ZA 3T1HM 3GRVA 1BH9A 4KHPM 2BYKA 3U60B 5B32G 3W99A 3GPPA 3AV2D 4IBGA 2R18A 3U6QA 3WHKA 4OU7A 3UTBB 5EP1A 2FJ7D 3KOXE 2V1UA 1EQZB 2QZ4A 1P3FA 2X8AA 2HIOB 3AZLC 2NZDC 2XSZD 3AJIB 5AV8B 1U35A 4H9PB 1IY0A 4KUDD 2F4VM 5B0ZB 4Z6YA 2Z7JA 1JFIA 3A1KA 3AFAB 2I7PA 1ZLAA 5AVBB 4LD9C 3CF6E 3WTPE 2UXCM 1R4VA 5AV5D 3X1UD 3TWKA 1DO0A 3AZHD 3KUYB 4YS3A 5JRGD 2W8SA 4IBJA 2OQ4A 3T15A 1Q39A 4QHSA 3VK8A 3VH5W 4L78A 4M9SA 3AYWD 3AZMB 2O5RA 3RE8A 4LJ6A 2L7IA 3C1CC 4L4UA 3FUXA 5GT0D 2C9CA 4DV7M 4XUJD 2FJ7C 1P3OA 3HHZA 3J81S 3AZKA 3LELB 3WKJB 4IIWA 3NBIA 4JI3M 3MGRB 4KUDC 5C3IC 5LMUM 2KRKA 3KP1E 5ITXE 4XZQA 1HQ3A 3AZJD 4WU8C 1KX5A 1P3IB 5B31A 3GQ4A 5DNMA 3UTAB 2R46A 3REHD 3AZHC 1YSYA 5JRGC 3O62B 2ZBKB 3AZFB 2CE7A 2F5SA 5GXQD 3LZ0A 1DGBA 3AYWC 1G3IA 5ITYA 3V9RA 3DZDA 2QBYB 4ZUXA 3J80S 1N36M 4OX9M 2Y2HA 5JI2E 4KGCA 3KSYA 4JJNB 5GT0C 4Z2MH 1F66A 4DUYM 4XUJC 4LJ8A 4ZBJB 1D2NA 3KWQD 4DV3M 2X49A 4D81A 4HGAB 3MK6A 3UK6A 3TPZA 2R45A 1QVRA 4AW4A 1P3AD 3KXBB 3UT9B 5FSWA 3AZEB 3LQQA 4MM3B 2F5OA 3W98B 2YFWA 3REHC 3C1BB 5CP6C 2X4AA 4NSOB 3VKGA 4LFCM 5GXQC 4H9SC 4EO5B 4LJAA 5FTLA 4W5WA 3REJA 2AHMA 2CV5B 2V6ZM 3KSJA 3A98B 1R2ZA 4E45A 4B7FA 1HTAA 1S32B 3UJNA 4UPKA 2QENA 4JV5M 4J8UB 2CHGA 2Y2IA 2CEAA 1IN4A 4DV4M 1P3LD 3GLIA 3HU1A 1I94M 4JN6A 4DR7M 4FD2A 4Z5TC 2DVWB 4LF5M 3AZLA 2NZDA 2YFVA 4GH9A 4FWDA 1L1ZA 2E5LM 4QLCB 3H0RC 4B08A 3ILKA 2UUBM 2F8NA 1XNQM 4J8WB 4M6BA 2YQZA 2XFTA 2RGOA 3W96B 2HL7A 4RF1A 3W99D 1EE8A 1KU5A 1WXQA 3TQSA 1L1TA 4DR2M 5GKNA 3IG8A 4ITQA 3MGQB 2EA0A 3REKB 4PDGA 5KPTA 3RGPA 3SAUA 5B2JB 3E9SA 1P3FD 3GRYA 4MB7A 3MNNC 1P3GB 2XD5A 3C1CA 1P3LC 3U6PA 3WAAA 3GQ5A 3VH6W 2FJ7A 4M0DA 2UWXA 1ZLAD 4LG2A 2Y2KA 1N1JB 3KFUG 2IO5B 5AY8B 2C99A 3JR4A 4WU8A 4LRSA 4JYAM 3H4MA 3GLHA 5EXXA 3W99C 3AV1B 1M18A 5B1LC 3KOZE 5DNNB 4CGYB 4AWLC 3AZHA 1W5TA 5JRGA 2AROA 5E5AB 3FYDA 2RIQA 4UUZB 3AFHA 4H9NB 3AZIB 2DWZB 5AVCB 4MGKE 5BO0B 3RGSA 1Q9CA 3AZKD 3WA9B 1P3FC 4IBCA 4JI5M 4DR3M 3IG5A 3U5ZA 3CTWB 3HJQA 1LV7A 3QWLA 3FTCA 1KX3C 4XZQD 1KX5D 3LJAD 5B0ZD 4PCZA 4JI7M 2FOIC 3ZCBB 1P3MA 3JAMS 5CHLB 3AZGA 5FTNA 3L27A 1AOIA 5B2IB 3FUVA 3REIB 3QAUA 4H9RA 4QOSA 4NFTA 3TU4B 5FUGA 3KOYE 3REHA 4M0WA 5CP6A 3C58A 4KGCD 3MGSD 4LJ4A 2CHQA 2R62A 3GPYA 3AZNB 3J7BA 1F66D 3SMSA 3B0CT 2A5YB 5GXQA 3FYCA 4H9SA 2LY8A 3AZKC 1NJFA 4GHLA 5CPKB 4II7A 4B3RM 3MGPA 4FVMA 4MGHA 3LELD 3X1SD 3HJSA 4XZQC 3X1TB 4IBKA 3MGRD 5AV8C 2PYOA 1KX5C 3T1YM 3LJAC 4CSRB 3U61B 5B0ZC 3LZ1B 3PVSA 1Z6TA 3SAVA 1G59A 4AKIA 4DV1M 5AV6B 2R65A 4J8XB 1KYIA 1UM8A 5CPIA 3GO8A 2HUEC 4YM6B 3U6CA 1ID3A 1L2CA 4CISA 5GT3B 4Z5TA 4CHTB 4R8PA 3X1VB 5CPJB 4LJ7A 3AZMC 3A6NB 1P34B 4KGCC 2H1RA 4JI0M 3W0LB 3SAWA 3MGSC 5B32A 5KPRA 1QANA 3TE6A 3PNVA 3B6FB 3R8FA 1FJGM 3WHLA 3VFDA 4CAYB 3SARA 3LELC 3K92A 3X1SC 3W97B 1KX4A 3MGRC 4M9ZA 4QNMA 4G6ZA 3PFIA 3B6GB 4H9OB 1TH2A 3KXBD 2XH9A 4OVZB 3TWLA 1W5SA 1M1AD 2NQBB 3MJ5A 1IN8A 5AV9B 3MNNA 4E44A 1BFMA 1IBMM 2Y2OA 2ZANA 3O62C 2F8ND 1GL6A 4LGYA 1DGFA 1N77A 3I4VA 2FNAA 1L2BA 4IBIA 1C1KA 4MH0E 1P3PA 2CV5D 1J09A 4JJNC 4WJ3C 2L7HA 2YFQA 1B67A 1SXJD 4NE5A 5B1LA 3C1CD 3RELA 5JA4A 2VQEM 3WAAD 4LCBA 1K82A 3KXBC 2BG1A 2Q2EB 1M1AC 4XGIA 1DGHB 2Y21A 3C1BC 5GSUB 1P3OB 5B33D 3MVDB 1KX3A 4G92C 2JA2A 4WU8D 4JI1M 5E26A 3AN2B 1N32M 4J8WD 1M18D 4KODA 1NSFA 1XWIA 4J8VD 3K2LA 1K3XA 1IBLM 1P3KB 1IXZA 2CV5C 2AROD 3WTPB 1SXJC 3T38A 4QOZC 2F8NH 4KHAA 1TZYB 3KS4A 3ZH9B 2BNKA 3FUTA 3UZUA 3WAAC 1XNRM 1Q3BA 3LVVA 3UTBA 4WU9B 5B24B 3LMMA 5BNVA 1EQZA 3K1JA 4X23B 1S3SA 1P3MD 3M6AA 5FLXS 1ULYA 5B33C 3AZGD 1AOID 2BJWA 4QLCC 5AV8A 3LJAA 4H9PA 5B0ZA 4OW0A 4J8WC 1M18C 4MGIE 1WWSA 4J8VC 2FFJA 3AFAA 1JR3A 2XZUA 5AVBA 4Z8XA 1XC8A 5CP6D 4I8OA 2AROC 4DQYB 4JI6M 3KUYA 3MGQC 2YFWB 1KFVA 3BOSA 1TH4A 3MGPD 3AZMA 1WWIA 3MGSA 1N75A 5B0YB 2PYOD 1HNZM 3NQJB 4X65M 4DRAA 5C18A 1P3MC 3LELA 3NWLA 3WKJA 3X1SA 3AZGC 1AOIC 2D7GA 3MGRA 5CPID 4LZJA 1G8PA 1NY6A 2Z3XA 2QP9X 1ID3D 2R4EA 3EIHA 3EPJA 2BYMB 4Z5TD 4LF7M 3FTEA 5B40B 1K3WA 4R8PD 1P3BD 5EJCA 1NNUC 5EXPA 3TU4D 5B32D 4GITA 4X66M 1H6UA 5IT9S 3O62A 1X37A 3AZFA 1OFIA 2Y2LA 4Z66B 4QHTA 3MGPC 2QBYA 1H3OB 1KX4D 1F1EA 1Z2CB 2PYOC 5B31G 4JJNA 4LD9B 2ZY4A 3FTFA 1M19B 5KO3A 5IREB 3SHGB 2J8PA 3MNND 2XGNA 5CPIC 4LF6M 2KRUA 1ID3C 3KXBA 3UT9A 3AV2B 2LH0A 1MX0A 4LJ5A 1M1AA 4R8PC 1P3BC 4IJFA 3W98A 2C98A 2Y0TA 3B0DC 3TU4C 5B32C 3VLFB 3C1BA 2D7EA 4R3DA 1P3PD 5CPJD 2FJ7B 1NHWC 4WV4B 3AZNC 3A42A 1B6WA 4DV5M 2DWLA 2UUCM 5B1LD 3K8ZA 4KUDB 3A45A 4L16A 1KX4C 1YE9A 2CV5A 3Q8XA 4WURA 3RELD 4R7GA 3W97D 3NQUB 2XLJA 1GKIA 1S32A 5AV5B 3X1UB 1SXJA 3LZ1C 5E6JA 3SHFA 4J8XC 5AV9D 3LQRA 2UXBM 3AYWB 5BS7C 1KX3D 3HJ8A 3GLFB 5F99D 1T3TA 1N34M 4KLNA 4WNNB 5ITQA 5GT0B 3L25A 2Z4SA 1PZRA 3VH5T 1J7KA 1P3PC 3AKZA 4XUJB 5CPJC 1XMQM 5B33A 4QLCA 4G91C 4J8WA 4J8VA 4QNRA 3W96A 2LNHC 2L5AA 3AZJB 3GLGB 3RELC 5FTKA 3W97C 2ZM5A 3GRRA 4X62M 3GRUA 3MGQA 2F5QA 3M0EA 3REKA 3J27B 3B6GC 3REHB 3UTBD 3IP4C 1Q3CA 5B2JA 1EQZD 3J2PB 2NQBC 4G4NA 5AV9C 2HIOD 5BNXB 4S12A 1P3GA 5AV8D 5B1MB 5F99C 3MVDD 2VIIA 1IM2A 3AFAD 1JR3D 5KQDA 5AVBD 2XZFA 3OTOM 2RGHA 2HCBA 5KDMB 1N1JA 3CF2A 3MHVC 5AY8A 3KWQB 2ZAMA 3DA1A 3KUYD 3FTDA 2CHVA 3HU3A 4B7HA 1TAFB 1P3AB 1A7WA 3U6LA 2CFOA 5DNNA 3AZMD 4JI2M 2CV1A 5EP2A 1KSFX 4UUZA 2BJVA 3UTBC 3AZIA 4DR4M 3GQ3A 1EQZC 5AVCA 5BO0A 4GC9A 2XEPA 5KPZA 4NE3A 3WA9A 1PJJA 5B24D 2HIOC 3WKJD 1E9SA 2FFFB 2KZUA 4NXNM 4JI4M 5GSUC 2HKJA 4Z2MG 1BH8B 3MVDC 2Y2JA 1VDDA 3AFAC 1P3ID 5AVBC 3RFWA 1ZQ9A 3UGJA 3UTAD 1P3KC 3KUYC 3L29A 2KEBA 3HWSA 3O62D 2F2AC 3HHYA 1NNJA 5B2IA 3REIA 3AZFD 2V1CA 1P3BA 1P3LB 4GMQA 1DGGA 3TU4A 1E9RA 2YNMD 3R9XB 3U6OA 4JJND 4DV6M 4JI8M 1TDHA 3PNYA 2G5HC 3AZNA 1IN6A 4JXJA 5DYIA 4TUWA 2Y2QA 4GKKM 3TWMA 5B24C 5G49B 3TL4X 5CPKA 3WKJC 1BH9B 5EXSA 2BYKB 4I4LA 3W99B 2Y20A 3X1TA 3UT9D 3U61A 1P3IC 3LZ1A 1QQWA 3AZED 4AI6A 4LFAM 1TH3A 3SASA 3W98D 5AV6A 5JA4B 3UTAC 4B3SM 4J8XA 3C1BD 3J7AS 5BS7A 3FDDA 1P3FB 3AZFC 4YM6A 4LRTA 5LMNM 3E4RA 1XXHA 1DO2A 1Z5CA 3ZC7B 1U35B 2Z4RA 2FE8A 4HLQA 5GT3A 1HT1E 3VKHA 4LF4M 2XF3A 5CPJA 1JFIB 2Y2GA 3KS8A 3DFZA 1ZLAB 1IXRC 2OPFA 2Y2PA 1S32D 4ZBJC 3B6FA 2EO2A 4K0KM 4HGAC 3VH6T 4XBOA 4YS3B 5EP3A 4D80A 1R2YA 4J8UD 4CAYA 4IBFA 2NQ8C 1L2DA 3W97A 2J7OA 4DR1M 1IY1A 1GVNA 3UT9C 4REZA 4KHAB 3VDPA 4I5SA 3B6GA 5ITTA 1OFHA 4H9OA 3AZEC 1FNNA 1J5EM 3W98C 4OVZA 4DRBA 5B40C 2NQBA 3HHXA 5AV9A 4GHAA 5BT1D 4FWGA 3AZKB 4QLCD 4AG6A 3KXEC 5BNVB 4H9QA 5F99A 2DXIA 4EO5C 2JE5A 1QAQA 3KP0E 3W96D 4XZQB 4B3MM 1HQ3B 4Z66C 4GC5A 1KX5B 3LJAB 1XMOM 3R45A 1S32C 5B31B 3MGQD 5DNMB 3REKD 3EIEA 5BPVA 4DR5M 5C1BA 3U60A 5B2JD 4J8UC 1IBKM 1M19C 1IN7A 2HUEB 3LZ0B 1P3GD 3V9RB 2XD1A 4ZUXB 5KQ8A 4DR6M 3W0FA 2ERCA 1JQJC 1L8QA 3AOGA 3AV2C 1ORYB 4B7GA 3I51A 4KGCB 3MGSB 2DZOB 2I7NA 4FWHA 1F66B 2HIOA 1DGHA 2LWXA 5BT1C 5AY8D 5GSUA 3D8BA 2F5PA 3MVDA 2DQNC 3W96C 3X1SB 3AN2A 4IBEA 3FKEA 3AV1D 5DNND 1Z59A 4LFBM 1P3KA 2Y2MA 2RVQD 4NRVA 5E5AD 3REKC 1YUBA 1HNWM 3AZID 3VK7A 5AV5C 3X1UC 3WTPA 5B2JC 5AVCD 4LY6A 3WA9D 4GRIA 1TZYA 1Z5BA 4NOOB 1R6BX 1P3GC 1NJGA 4NSRA 3AL0C 1NY5A 3REJB 3JR5A 2UXDM 5B1MD 2LXEA 3HGIA 4RNAA 4WU9A 5B24A 4X23A 5AY8C 2IO5C 2CV2A 4AKGA 4BBAA 1HQCA 3VH5A 3D8LA 5B2ID 3REID 1P3IA 4FCWA 3AV1C 3A46A 3B0CW 4EIWA 3AOEC 3GLIB 5DNNC 3UTAA 1TGUA 3AZJC 2KXEA 3I4YA 2DWMA 5ITXA 2RVQC 5E5AC 1HNXM 2G5IC 5F3WA 1M1AB 3AZND 3AZIC 4LGMA 7CATA 3AZLB 2NZDB 2YFVB 4MGZE 5AVCC 5BR8M 3WA9C 1MU5A 5CPKD 2F8NB 2J7NA 4G92B 4DV0M 2DHRA 3DOAA 5B0YA 3X1TD 1SXJE 4GIPA 2G8LA 1N33M 5B1MC 3NQJA 4L15A 3LZ1D 2CUZA 5AV6D 1IQPA 3EPHA 4J8XD 4FCVA 3H0LC 2VQFM 2K47A 5IWAM 1SXJB 3KWQC 5B2IC 3REIC 3GPXA 1IN5A 4YM6D 4IBDA 3AZEA 3C1CB 1P3AC 2BYMA 5GT3D 8CATA 3WAAB 5B40A 3X1VD 3A6ND 4AG5A 1P34D 3VDUA 4B3TM 3U6DA 3B6FD 1GLNA 1QAOA 3KSXA 4WW0A 2UUAM 3M7GA 5CPKC 5C3IB 5B33B 4WU8B 4WZSB 4Z66A 2DZNB 3GLHB 1H3OA 1M18B 3X1TC 4J8VB 3HKPA 3B6GD 3AZHB 4LD9A 1IY2A 1TDZA 5JRGB 2AROB 5AV6C 4J8UA 2NQBD 1M19A 2KW0A 3KDSE 2XFSA 3THGA 4LJ9A 3SBJA 4AZFA 3U6SA 4A3VB 3SFZA 2C96A 4YM6C 4KO8A 2QPAA 4P16A 3U5ZB 3AV2A 5GT3C 1IXSB 3X1VC 1T3UA 1U35D 3A6NC 1P34C 1PM5A 4G4OA 4PD2A 3EPKA 3B6FC 3H0MC 1P3MB 2C9OA 3AZGB 2XSZA 1AOIB 4G4RA 4KUDA 4YS3D 1OJLA 2EUCA 4LZZA 3HHWA 4GKJM 4H9RB 5EQTA 2F5NA 2ZAOA 3SC3A 3KVWA 1N78A 2ZY2A 5FUGB 3NQUA 1NVMA 4IBBA 5CP6B 5AV5A 3X1UA 2F8NG 1HQYE 4X64M 1NHGC 2F8NK 2M60A 3B9PA 5GXQB 3SYLA 5GSUD 1P3OD 4HL4A 3AYWA 3MGPB 2YR0A 3GLFA 3SATA 2Y2NA 3AN2D 2R4JA 5ITUA 2PYOB 4WNNA 1U35C 5GT0A 2L09A 4XUJA 1P3KD 1HQ3D 1W2EA 3SMPA 3UMMA 1ZLAC 3FUWA 1GL7A 1I4WA 5B31D 3WTPD 5DNMD 3AV1A 1PJIA 3AOEA 5CPIB 4YS3C 4M9XA 1TZYD 4BLCA 2CV0A 2KZSA 3AZJA 1ID3B 3GLGA 5E5AA 3VH6A 3FUUA 4FCTA 4Z5TB 3LZ0D 1G41A 3KOWE 4H9NA 4R8PB 2C5RA 1P3BB 5A2QS 4AKHA 4ZUXD 3B0DB 4RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1K A;  3KFU G;  3H0M C;  3H0L C;  4WJ3 C;  3AL0 C;  3IP4 C;  2F2A C;  2G5H C;  3H0R C;  3A1I A;  2G5I C;  2DF4 C;  2DQN C; 
#chains in the Genus database with same CATH topology
 5B32 B;  3L26 A;  2HHH M;  2VQR A;  4WU9 D;  1ZAE A;  4X23 D;  2ZY5 A;  2KA6 B;  2UU9 M;  1Z5A A;  5DNY A;  2DWN A;  5BNX A;  1P3O C;  3BBZ A;  3EPL A;  2L4F A;  5B1M A;  3AN2 C;  1KX4 B;  3H4J A;  3AV0 A;  1G71 A;  4MGY E;  1EIJ A;  2CWE A;  1G4A E;  2ZY3 A;  2P5T A;  1HQ3 C;  3LVW A;  2G5G X;  4LF9 M;  5KDM A;  1QDT A;  3KWQ A;  5IZ7 D;  3SYK A;  3EG5 B;  5B31 C;  4ZPX A;  3WTP C;  5DNM C;  3MNN B;  1TAF A;  4IJE A;  1P3A A;  1TZY C;  2Y0Q A;  1QYR A;  2ZM6 M;  1QAM A;  1HT2 E;  4BB9 A;  4G4Q A;  2JY6 B;  3LZ0 C;  4YY3 M;  3U6E A;  1XXH B;  5JI3 E;  5B0Y D;  3U6M A;  3CF0 A;  4ZUX C;  4FW9 A;  2D7H A;  2W82 A;  5DYG A;  1P3P B;  3REJ D;  4WU9 C;  2JSS A;  2RKO A;  5EP4 A;  1BVS A;  3HX3 A;  4X23 C;  4DV2 M;  3GPU A;  1F66 C;  2QCU A;  1HR0 M;  3PXG A;  3GP1 A;  4G91 B;  1E32 A;  2JCH A;  4NL4 H;  5B1L B;  5ITR A;  3L2A A;  1BH8 A;  4CSR A;  4AWL B;  4YHH M;  4LF8 M;  1QZM A;  1PJS A;  3REL B;  5EXT A;  3HU2 A;  5B40 D;  4L8R C;  3A1I A;  1XHB A;  2L6O A;  3F6T A;  4GEW A;  4PDI A;  3NBX X;  3KW6 A;  4PT5 A;  2DNA A;  4DUZ M;  4NRW A;  5H37 D;  3B7Q A;  4NE6 A;  4AQY M;  3AZL D;  2NZD D;  4I81 A;  1KX3 B;  3X1V A;  4Z66 D;  2DF4 C;  1P3L A;  5FTM A;  3FD9 A;  3A6N A;  1P34 A;  4H9Q B;  5F99 B;  1R7R A;  2EKK A;  5B0Y C;  2OOB A;  4LD9 D;  3REJ C;  3P5J B;  3B0B A;  4D82 A;  3L28 A;  1M19 D;  3R45 B;  5FTJ A;  5G49 A;  4NXM M;  1E94 E;  2DAG A;  2M5Z A;  3T1H M;  3GRV A;  1BH9 A;  2QQ8 A;  4KHP M;  2BYK A;  3U60 B;  5B32 G;  3W99 A;  2ZTD A;  1PJT A;  3GPP A;  3AV2 D;  4IBG A;  1TF0 B;  2R18 A;  3U6Q A;  3WHK A;  4OU7 A;  2DZL A;  3UTB B;  5EP1 A;  2FJ7 D;  3KOX E;  2V1U A;  1EQZ B;  2QZ4 A;  1P3F A;  2X8A A;  1F4I A;  2HIO B;  3AZL C;  2NZD C;  2XSZ D;  3AJI B;  5AV8 B;  1U35 A;  4H9P B;  1IY0 A;  4KUD D;  2F4V M;  5B0Z B;  4Z6Y A;  2Z7J A;  1JFI A;  3A1K A;  3AFA B;  2I7P A;  1ZLA A;  5AVB B;  4LD9 C;  3CF6 E;  1C7Y A;  3WTP E;  2UXC M;  2QNJ A;  1R4V A;  5AV5 D;  3X1U D;  3TWK A;  1DO0 A;  3AZH D;  3KUY B;  4YS3 A;  5JRG D;  2W8S A;  4IBJ A;  2OQ4 A;  3T15 A;  1A5T A;  1Q39 A;  4QHS A;  3VK8 A;  3VH5 W;  4L78 A;  2R6F A;  4M9S A;  3AYW D;  2WZJ A;  3AZM B;  2O5R A;  3RE8 A;  4LJ6 A;  2L7I A;  3C1C C;  4L4U A;  3FUX A;  5GT0 D;  2C9C A;  4DV7 M;  4XUJ D;  2FJ7 C;  1P3O A;  3HHZ A;  3J81 S;  3AZK A;  3LEL B;  1WHC A;  3WKJ B;  4IIW A;  3NBI A;  4JI3 M;  3MGR B;  4KUD C;  5C3I C;  5LMU M;  2KRK A;  3KP1 E;  5ITX E;  3E46 A;  1HQ3 A;  1QUT A;  4XZQ A;  3AZJ D;  4WU8 C;  1KX5 A;  1P3I B;  2JZ1 A;  5B31 A;  3GQ4 A;  5DNM A;  3UTA B;  2R46 A;  3REH D;  3AZH C;  3QYE A;  1YSY A;  2N35 A;  5JRG C;  1T43 A;  3O62 B;  2ZBK B;  2EKF A;  2CE7 A;  3AZF B;  2F5S A;  5GXQ D;  3LZ0 A;  1DGB A;  3AYW C;  1T6O A;  1G3I A;  1YLA A;  5ITY A;  3V9R A;  3DZD A;  2QBY B;  4ZUX A;  3J80 S;  1ZMU A;  1N36 M;  4OX9 M;  2MJ5 B;  2Y2H A;  5JI2 E;  4KGC A;  3KSY A;  4JJN B;  5GT0 C;  4Z2M H;  1F66 A;  4DUY M;  4XUJ C;  4LJ8 A;  4ZBJ B;  1D2N A;  1OTR A;  3KWQ D;  4DV3 M;  1WIV A;  2X49 A;  4D81 A;  4HGA B;  3MK6 A;  3UK6 A;  3TPZ A;  2R45 A;  1QVR A;  4AW4 A;  1P3A D;  3KXB B;  3UT9 B;  5FSW A;  3AZE B;  3LQQ A;  4MM3 B;  2F5O A;  3W98 B;  2YFW A;  3REH C;  3C1B B;  5CP6 C;  2X4A A;  4NSO B;  3VKG A;  4LFC M;  5GXQ C;  4H9S C;  4EO5 B;  4LJA A;  5FTL A;  4W5W A;  3REJ A;  2AHM A;  2CV5 B;  2V6Z M;  3KSJ A;  3A98 B;  1R2Z A;  4E45 A;  4B7F A;  1HTA A;  1S32 B;  3UJN A;  4CIZ A;  4UPK A;  2QEN A;  4JV5 M;  2MGW A;  4Q7J A;  4J8U B;  2CHG A;  2KNV A;  2LBC A;  2Y2I A;  2CEA A;  1IN4 A;  1NV9 A;  1UFZ A;  4DV4 M;  1P3L D;  3GLI A;  3HU1 A;  1I94 M;  4JN6 A;  4DR7 M;  2WSF F;  4FD2 A;  4Z5T C;  2DVW B;  4LF5 M;  3AZL A;  2NZD A;  2G3Q A;  2YFV A;  4GH9 A;  3W68 A;  4FWD A;  1L1Z A;  2E5L M;  4QLC B;  3H0R C;  4B08 A;  3ILK A;  2UUB M;  2F8N A;  1XNQ M;  4J8W B;  2LVA A;  4M6B A;  2YQZ A;  2K0B X;  2XFT A;  1XB2 B;  3W67 A;  2RGO A;  3W96 B;  2HL7 A;  4RF1 A;  3W99 D;  1EE8 A;  1KU5 A;  1WXQ A;  2O25 A;  3TQS A;  1L1T A;  3C3E A;  4DR2 M;  5GKN A;  3IG8 A;  4ITQ A;  4DBG B;  3MGQ B;  2EA0 A;  3REK B;  4PDG A;  5KPT A;  3RGP A;  3SAU A;  5B2J B;  3FE3 A;  3E9S A;  3GLF E;  1P3F D;  3GRY A;  4MB7 A;  2EJS A;  3MNN C;  1P3G B;  2XD5 A;  3C1C A;  1P3L C;  3U6P A;  1WGL A;  3B74 A;  3GQ5 A;  3WAA A;  3VH6 W;  2FJ7 A;  4M0D A;  2UWX A;  1ZLA D;  4HEO A;  4LG2 A;  2Y2K A;  1N1J B;  3KFU G;  2IO5 B;  5AY8 B;  2C99 A;  3JR4 A;  3GLG E;  4WU8 A;  4LRS A;  4JYA M;  3H4M A;  2OO9 A;  3GLH A;  5EXX A;  3W99 C;  3AV1 B;  2DAM A;  1M18 A;  5B1L C;  3KOZ E;  5DNN B;  4CGY B;  1GO5 A;  4AWL C;  1JB0 F;  3AZH A;  1W5T A;  5JRG A;  2ARO A;  5E5A B;  3FYD A;  1VDL A;  2RIQ A;  4UUZ B;  3AFH A;  4H9N B;  2JWS A;  2R44 A;  3AZI B;  2DWZ B;  5AVC B;  4MGK E;  5BO0 B;  3RGS A;  1Q9C A;  3AZK D;  3WA9 B;  1P3F C;  4IBC A;  4JI5 M;  4DR3 M;  3IG5 A;  4XK8 F;  3U5Z A;  3CTW B;  3HJQ A;  1LV7 A;  3QWL A;  2K6B A;  3FTC A;  1KX3 C;  1IXS A;  4XZQ D;  1KX5 D;  3LJA D;  5B0Z D;  4PCZ A;  4JI7 M;  2FOI C;  1R4G A;  3ZCB B;  1P3M A;  1ZMV A;  3JAM S;  5CHL B;  3AZG A;  5FTN A;  3L27 A;  1AOI A;  5B2I B;  2DAE A;  3FUV A;  3REI B;  3QAU A;  4H9R A;  4QOS A;  4NFT A;  3TU4 B;  5FUG A;  3KOY E;  3REH A;  4M0W A;  5CP6 A;  3C58 A;  4KGC D;  2L4E A;  3MGS D;  4LJ4 A;  2CHQ A;  2R62 A;  3GPY A;  3AZN B;  3J7B A;  1F66 D;  3SMS A;  3B0C T;  2A5Y B;  5GXQ A;  3C9P A;  3FYC A;  4H9S A;  2LY8 A;  3AZK C;  1NJF A;  4GHL A;  5CPK B;  2JY7 A;  4II7 A;  4B3R M;  3MGP A;  4F2L A;  4FVM A;  4MGH A;  3LEL D;  3X1S D;  1DV0 A;  3IEC A;  3HJS A;  2MR9 A;  4XZQ C;  3X1T B;  1Q02 A;  4IBK A;  3MGR D;  5AV8 C;  2PYO A;  1KX5 C;  1SG9 A;  3T1Y M;  3LJA C;  4CSR B;  3U61 B;  5B0Z C;  3LZ1 B;  3PVS A;  2DAK A;  1QZE A;  1Z6T A;  3SAV A;  1G59 A;  4AKI A;  4DV1 M;  5AV6 B;  2WSE F;  2R65 A;  4J8X B;  1KYI A;  1HJP A;  2L2D A;  1UM8 A;  1TTE A;  5CPI A;  3GO8 A;  2HUE C;  4YM6 B;  3U6C A;  1ID3 A;  1L2C A;  4CIS A;  5GT3 B;  4Z5T A;  4CHT B;  4R8P A;  3X1V B;  5CPJ B;  4LJ7 A;  3AZM C;  3A6N B;  1P34 B;  4KGC C;  2H1R A;  4JI0 M;  3W0L B;  3SAW A;  3MGS C;  5B32 A;  5KPR A;  1QAN A;  3TE6 A;  1VEG A;  3PNV A;  3B6F B;  3R8F A;  1FJG M;  2WSC F;  3WHL A;  3VFD A;  4CAY B;  3SAR A;  3F92 A;  3LEL C;  3K92 A;  3X1S C;  3W97 B;  1NO1 A;  1KX4 A;  3MGR C;  4M9Z A;  4QNM A;  4G6Z A;  3PFI A;  3B6G B;  4H9O B;  1TH2 A;  3KXB D;  2XH9 A;  4OVZ B;  3TWL A;  1W5S A;  1M1A D;  2NQB B;  2JY8 A;  3MJ5 A;  1IN8 A;  5AV9 B;  3MNN A;  1V33 A;  4E44 A;  1BFM A;  1IBM M;  2Y2O A;  2ZAN A;  3O62 C;  2DKL A;  2F8N D;  1GL6 A;  4LGY A;  1DGF A;  1N77 A;  3I4V A;  2FNA A;  1L2B A;  4IBI A;  1C1K A;  4MH0 E;  1P3P A;  2CV5 D;  1J09 A;  4JJN C;  4WJ3 C;  2L7H A;  2YFQ A;  1B67 A;  2LHG A;  1SXJ D;  4NE5 A;  2JNH A;  5B1L A;  3C1C D;  3REL A;  1PJQ A;  5JA4 A;  2VQE M;  3WAA D;  1D0K A;  4LCB A;  1VQ1 A;  1K82 A;  3KXB C;  2BG1 A;  2Q2E B;  1M1A C;  1AUA A;  4XGI A;  1DGH B;  2Y21 A;  3C1B C;  5GSU B;  1P3O B;  5B33 D;  3MVD B;  1OAI A;  1KX3 A;  4G92 C;  2JA2 A;  4WU8 D;  4JI1 M;  5E26 A;  3AN2 B;  1N32 M;  4J8W D;  1M18 D;  4KOD A;  1NSF A;  1XWI A;  4J8V D;  3K2L A;  1K3X A;  1IBL M;  1P3K B;  1IXZ A;  1VEJ A;  2CV5 C;  2ARO D;  3E21 A;  3WTP B;  1SXJ C;  2VF8 A;  3T38 A;  4QOZ C;  2F8N H;  4KHA A;  1TZY B;  3LW5 F;  3KS4 A;  3ZH9 B;  2BNK A;  3FUT A;  3UZU A;  3WAA C;  1XNR M;  1Q3B A;  3LVV A;  3UTB A;  4WU9 B;  5B24 B;  3LMM A;  5BNV A;  1EQZ A;  3K1J A;  4X23 B;  1S3S A;  3FRI A;  1P3M D;  3M6A A;  5FLX S;  1ULY A;  5B33 C;  3AZG D;  2DHY A;  1AOI D;  2BJW A;  4QLC C;  5AV8 A;  3LJA A;  4H9P A;  1ZMW A;  5B0Z A;  4OW0 A;  4J8W C;  1M18 C;  4MGI E;  1WWS A;  4J8V C;  2FFJ A;  3AFA A;  1JR3 A;  2XZU A;  5AVB A;  4Z8X A;  1XC8 A;  3HY5 A;  5CP6 D;  4I8O A;  2O01 F;  2ARO C;  4DQY B;  4JI6 M;  3KUY A;  3MGQ C;  2YFW B;  3CGW A;  1KFV A;  4P17 A;  3BOS A;  1TH4 A;  1VEK A;  3MGP D;  3AZM A;  1WWI A;  3MGS A;  1N75 A;  5B0Y B;  2PYO D;  1HNZ M;  3NQJ B;  1RU3 A;  4X65 M;  4L6V 6;  1R5L A;  4DRA A;  5C18 A;  1P3M C;  3LEL A;  3NWL A;  3WKJ A;  3X1S A;  3AZG C;  1AOI C;  3GLI E;  2D7G A;  3MGR A;  5CPI D;  4LZJ A;  1G8P A;  1NY6 A;  2Z8Y M;  2Z3X A;  2QP9 X;  1ID3 D;  2R4E A;  3EIH A;  3EPJ A;  2BYM B;  4Z5T D;  4LF7 M;  3FTE A;  5B40 B;  1K3W A;  4R8P D;  3K9O A;  1P3B D;  5EJC A;  1NNU C;  5EXP A;  2MH8 A;  3TU4 D;  5B32 D;  4GIT A;  4X66 M;  4CJ6 A;  1H6U A;  1OIP A;  5IT9 S;  3O62 A;  1X37 A;  3AZF A;  1PRB A;  1OFI A;  2Y2L A;  4Z66 B;  4QHT A;  3MGP C;  2QBY A;  1MJG M;  1H3O B;  1KX4 D;  1F1E A;  1Z2C B;  2PYO C;  4Y28 F;  5B31 G;  4JJN A;  4LD9 B;  2FS1 A;  2ZY4 A;  3FTF A;  1M19 B;  5KO3 A;  5IRE B;  2ZTC A;  3SHG B;  1WJ7 A;  2J8P A;  3MNN D;  2XGN A;  5CPI C;  4LF6 M;  2KRU A;  1ID3 C;  3KXB A;  3UT9 A;  3AV2 B;  2LH0 A;  1MX0 A;  4LJ5 A;  1M1A A;  4R8P C;  1P3B C;  4IJF A;  3W98 A;  2C98 A;  1AIP C;  2Y0T A;  3B0D C;  3TU4 C;  5B32 C;  2VDB B;  3VLF B;  3C1B A;  2D7E A;  4R3D A;  1P3P D;  5CPJ D;  2KNZ A;  2FJ7 B;  1NHW C;  4WV4 B;  3AZN C;  3A42 A;  1B6W A;  3K9P A;  4DV5 M;  3GLH E;  2DWL A;  2UUC M;  5B1L D;  3K8Z A;  2LVN C;  4KUD B;  2QSF X;  1OKS A;  1Y8G A;  3A45 A;  4L16 A;  1KX4 C;  1YE9 A;  2CV5 A;  3Q8X A;  4WUR A;  3REL D;  4R7G A;  3W97 D;  3NQU B;  2XLJ A;  1GKI A;  1S32 A;  5AV5 B;  3X1U B;  2B3T A;  1SXJ A;  3LZ1 C;  5E6J A;  3SHF A;  2KNA A;  4J8X C;  5AV9 D;  3LQR A;  2UXB M;  3AYW B;  5BS7 C;  1KX3 D;  3HJ8 A;  5DFL A;  3GLF B;  5F99 D;  1T3T A;  1N34 M;  1OQY A;  4KLN A;  3C3D A;  4WNN B;  5ITQ A;  5GT0 B;  3L25 A;  2Z4S A;  1PZR A;  3VH5 T;  1J7K A;  1P3P C;  3AKZ A;  4XUJ B;  5CPJ C;  1XMQ M;  5B33 A;  1D0L A;  4QLC A;  4G91 C;  1ZV1 A;  4J8W A;  4J8V A;  4QNR A;  1OAO C;  3W96 A;  2LNH C;  2L5A A;  3AZJ B;  3GLG B;  2DI0 A;  3REL C;  5FTK A;  3W97 C;  2ZM5 A;  3GRR A;  4X62 M;  3GRU A;  3MGQ A;  2F5Q A;  3M0E A;  3REK A;  3J27 B;  3B6G C;  3REH B;  1QUS A;  3UTB D;  3IP4 C;  1Q3C A;  5B2J A;  1EQZ D;  1EFU B;  3J2P B;  2NQB C;  4G4N A;  5AV9 C;  2HIO D;  3B89 A;  5BNX B;  4S12 A;  1P3G A;  5AV8 D;  5B1M B;  5F99 C;  3MVD D;  1PGY A;  2VII A;  1IM2 A;  3AFA D;  1JR3 D;  5KQD A;  5AVB D;  2XZF A;  3OTO M;  2RGH A;  2HCB A;  5KDM B;  1N1J A;  3CF2 A;  3MHV C;  5AY8 A;  3KWQ B;  2ZAM A;  3DA1 A;  3KUY D;  3FTD A;  2FH0 A;  2CHV A;  3HU3 A;  4B7H A;  1TAF B;  1P3A B;  1A7W A;  1D0M A;  3U6L A;  2CFO A;  5DNN A;  4R71 A;  3AZM D;  1TR8 A;  4JI2 M;  2CV1 A;  2RRU A;  5EP2 A;  1KSF X;  4UUZ A;  3FRH A;  2BJV A;  1V92 A;  3UTB C;  3AZI A;  4DR4 M;  3GQ3 A;  1EQZ C;  5AVC A;  5BO0 A;  4GC9 A;  2XEP A;  5KPZ A;  4NE3 A;  3WA9 A;  1PJJ A;  5B24 D;  2HIO C;  3WKJ D;  1E9S A;  2FFF B;  2KDL A;  2KZU A;  4NXN M;  4JI4 M;  5GSU C;  2HKJ A;  4Z2M G;  1BH8 B;  3MVD C;  1WGN A;  2Y2J A;  1VDD A;  3AFA C;  1P3I D;  3IHP A;  5AVB C;  3RFW A;  1ZQ9 A;  3Q8G A;  3UGJ A;  3UTA D;  1P3K C;  3KUY C;  3L29 A;  2KEB A;  3HWS A;  2GQF A;  2QHO B;  3O62 D;  2F2A C;  3HHY A;  1NNJ A;  5B2I A;  3REI A;  3AZF D;  2V1C A;  1XXH E;  1P3B A;  1P3L B;  4GMQ A;  1DGG A;  3TU4 A;  1E9R A;  2YNM D;  3R9X B;  2JXN A;  3U6O A;  4JJN D;  4DV6 M;  4JI8 M;  1TDH A;  3PNY A;  2G5H C;  3AZN A;  2DEN A;  1IN6 A;  4JXJ A;  5DYI A;  4TUW A;  2Y2Q A;  4GKK M;  3TWM A;  5B24 C;  5G49 B;  3TL4 X;  5CPK A;  3WKJ C;  2LHC A;  1GAB A;  1BH9 B;  5EXS A;  2BYK B;  4I4L A;  3W99 B;  2Y20 A;  3X1T A;  3UT9 D;  2CRU A;  3U61 A;  1P3I C;  2VF7 A;  3LZ1 A;  1QQW A;  3AZE D;  4AI6 A;  4LFA M;  1TH3 A;  3SAS A;  3W98 D;  5AV6 A;  5JA4 B;  3UTA C;  4B3S M;  4J8X A;  3C1B D;  3J7A S;  3QYB A;  5BS7 A;  3B7Z A;  3FDD A;  1P3F B;  3AZF C;  4YM6 A;  4LRT A;  2DAI A;  5LMN M;  3E4R A;  1XXH A;  1DO2 A;  1Z5C A;  3ZC7 B;  1U35 B;  2Z4R A;  2FE8 A;  4HLQ A;  5GT3 A;  1HT1 E;  3VKH A;  4LF4 M;  2XF3 A;  5CPJ A;  1JFI B;  2Y2G A;  3KS8 A;  3DFZ A;  1ZLA B;  1IXR C;  2OPF A;  2Y2P A;  1S32 D;  4ZBJ C;  3B6F A;  2EO2 A;  4K0K M;  4HGA C;  3VH6 T;  4XBO A;  4YS3 B;  5EP3 A;  4D80 A;  1R2Y A;  2APL A;  4J8U D;  4CAY A;  4IBF A;  2NQ8 C;  1L2D A;  3W97 A;  2J7O A;  4DR1 M;  1IY1 A;  1GVN A;  3UT9 C;  4REZ A;  4KHA B;  3VDP A;  4I5S A;  3B6G A;  5ITT A;  1OFH A;  4H9O A;  3AZE C;  1FNN A;  1J5E M;  3W98 C;  4OVZ A;  4DRB A;  5B40 C;  2NQB A;  3HHX A;  5AV9 A;  4GHA A;  5BT1 D;  4FWG A;  3AZK B;  4QLC D;  2LVP C;  4AG6 A;  3KXE C;  5BNV B;  4H9Q A;  5F99 A;  2DXI A;  4EO5 C;  2JE5 A;  1QAQ A;  1JR3 E;  3KP0 E;  3W96 D;  4XZQ B;  4B3M M;  1HQ3 B;  4Z66 C;  4GC5 A;  1KX5 B;  3LJA B;  1XMO M;  3R45 A;  1S32 C;  5B31 B;  3MGQ D;  5DNM B;  3REK D;  3EIE A;  5BPV A;  4DR5 M;  5C1B A;  3U60 A;  5B2J D;  4J8U C;  1IBK M;  1M19 C;  1IN7 A;  4UN2 B;  2HUE B;  3LZ0 B;  1P3G D;  3V9R B;  2XD1 A;  2HAK A;  4ZUX B;  5KQ8 A;  4DR6 M;  3W0F A;  2ERC A;  1JQJ C;  1L8Q A;  3AOG A;  3AV2 C;  1ORY B;  4B7G A;  3I51 A;  4KGC B;  3MGS B;  2DZO B;  2I7N A;  4FWH A;  1F66 B;  1V34 A;  2OOA A;  2HIO A;  3V76 A;  1DGH A;  2LWX A;  5BT1 C;  5AY8 D;  5GSU A;  3D8B A;  4F1I A;  2F5P A;  3MVD A;  2DQN C;  2JUJ A;  3W96 C;  3X1S B;  3AN2 A;  4IBE A;  3FKE A;  3AV1 D;  5DNN D;  1Z59 A;  3MMP A;  4LFB M;  1P3K A;  2Y2M A;  2BWB A;  2RVQ D;  4NRV A;  5E5A D;  3REK C;  1YUB A;  1HNW M;  3AZI D;  3VK7 A;  5AV5 C;  3X1U C;  3WTP A;  4KT0 F;  5B2J C;  5AVC D;  4LY6 A;  3WA9 D;  4GRI A;  1TZY A;  1Z5B A;  4NOO B;  2LTU A;  3I01 M;  1R6B X;  1P3G C;  1NJG A;  4NSR A;  3AL0 C;  2JZ0 A;  1NY5 A;  3REJ B;  3JR5 A;  2UXD M;  5B1M D;  3I04 M;  2LXE A;  3HGI A;  4RNA A;  4WU9 A;  5B24 A;  4X23 A;  2J5Y A;  5AY8 C;  2IO5 C;  2BWE A;  2CV2 A;  4AKG A;  4BBA A;  1HQC A;  3VH5 A;  3D8L A;  5B2I D;  3REI D;  1P3I A;  4FCW A;  3AV1 C;  3HZJ A;  3A46 A;  3B0C W;  4EIW A;  3AOE C;  3GLI B;  5DNN C;  3UTA A;  1TGU A;  3AZJ C;  2KXE A;  3I4Y A;  2DWM A;  5ITX A;  2RVQ C;  5E5A C;  1HNX M;  2G5I C;  5F3W A;  1M1A B;  3AZN D;  3AZI C;  4LGM A;  7CAT A;  3AZL B;  2NZD B;  2YFV B;  4MGZ E;  5AVC C;  3B7N A;  5BR8 M;  3WA9 C;  1IFY A;  1MU5 A;  5CPK D;  2F8N B;  2J7N A;  4G92 B;  4DV0 M;  4RKU F;  2DHR A;  1MN3 A;  3DOA A;  5B0Y A;  3X1T D;  3T6P A;  1SXJ E;  4GIP A;  2G8L A;  1N33 M;  5B1M C;  4NC6 A;  3NQJ A;  4L15 A;  3LZ1 D;  2CUZ A;  5AV6 D;  1IQP A;  3EPH A;  1NV8 A;  4J8X D;  2MRO B;  4FCV A;  3H0L C;  2VQF M;  2K47 A;  5IWA M;  1SXJ B;  3KWQ C;  5B2I C;  2LVO C;  3REI C;  3GPX A;  1IN5 A;  4YM6 D;  4IBD A;  3AZE A;  3C1C B;  1P3A C;  2BYM A;  2CWB A;  5GT3 D;  8CAT A;  3WAA B;  5B40 A;  3X1V D;  3A6N D;  4AG5 A;  1P34 D;  3VDU A;  4B3T M;  3U6D A;  3B6F D;  1GLN A;  1QAO A;  4G3O A;  3KSX A;  4WW0 A;  2UUA M;  3M7G A;  5CPK C;  5C3I B;  5B33 B;  4WU8 B;  4WZS B;  4Z66 A;  2DZN B;  3GLH B;  1H3O A;  1OIZ A;  1M18 B;  3X1T C;  4J8V B;  3HKP A;  3B6G D;  3AZH B;  4LD9 A;  1IY2 A;  1TDZ A;  5JRG B;  2ARO B;  5AV6 C;  4J8U A;  2NQB D;  1M19 A;  1GJS A;  2R0I A;  2KW0 A;  3KDS E;  2XFS A;  3THG A;  4LJ9 A;  3SBJ A;  4AZF A;  3U6S A;  4A3V B;  3SFZ A;  2C96 A;  4YM6 C;  4KO8 A;  2QPA A;  2H5X A;  4P16 A;  3U5Z B;  4ANR A;  3AV2 A;  5GT3 C;  1IXS B;  3X1V C;  2KHH A;  1T3U A;  1U35 D;  3A6N C;  1P34 C;  1PM5 A;  4G4O A;  1CUK A;  4PD2 A;  1LTM A;  3EPK A;  3B6F C;  2CP8 A;  3H0M C;  1P3M B;  2C9O A;  3AZG B;  2XSZ A;  1AOI B;  2JY5 A;  4G4R A;  4KUD A;  4YS3 D;  1OJL A;  2EUC A;  4WP2 A;  4LZZ A;  3HHW A;  4GKJ M;  4H9R B;  5EQT A;  2F5N A;  2ZAO A;  1QDR A;  3SC3 A;  3KVW A;  1N78 A;  2ZY2 A;  5FUG B;  3NQU A;  1NVM A;  4IBB A;  5CP6 B;  5AV5 A;  3X1U A;  2F8N G;  5L8R F;  1HQY E;  4X64 M;  3LCV B;  1NHG C;  2K9D A;  2F8N K;  2M60 A;  3B9P A;  5GXQ B;  3SYL A;  5GSU D;  2LVQ D;  1WR1 B;  1P3O D;  4HL4 A;  3AYW A;  2HWJ A;  3MGP B;  1VG5 A;  2YR0 A;  3GLF A;  3SAT A;  2Y2N A;  3AN2 D;  2R4J A;  5ITU A;  2PYO B;  4WNN A;  1U35 C;  5GT0 A;  2L09 A;  3LCU A;  1P3Q Q;  4XUJ A;  1P3K D;  1HQ3 D;  1W2E A;  3SMP A;  3UMM A;  1ZLA C;  3FUW A;  1GL7 A;  1GJT A;  1I4W A;  3ZQJ A;  5B31 D;  3WTP D;  5DNM D;  3BXW A;  3AV1 A;  1PJI A;  3AOE A;  5CPI B;  4YS3 C;  4M9X A;  1TZY D;  4BLC A;  2CV0 A;  2KZS A;  3AZJ A;  1ID3 B;  3GLG A;  5E5A A;  3VH6 A;  3FUU A;  4FCT A;  4Z5T B;  2GNO A;  3LZ0 D;  1G41 A;  3KOW E;  4H9N A;  4R8P B;  2C5R A;  1P3B B;  5A2Q S;  2JP7 A;  4AKH A;  4ZUX D;  3B0D B;  4RF0 A; 
#chains in the Genus database with same CATH homology
 5B32 B;  3L26 A;  2HHH M;  2VQR A;  4WU9 D;  1ZAE A;  4X23 D;  2ZY5 A;  2KA6 B;  2UU9 M;  1Z5A A;  5DNY A;  2DWN A;  5BNX A;  1P3O C;  3EPL A;  5B1M A;  3AN2 C;  1KX4 B;  3AV0 A;  4MGY E;  2CWE A;  1G4A E;  2ZY3 A;  2P5T A;  1HQ3 C;  3LVW A;  2G5G X;  4LF9 M;  5KDM A;  3KWQ A;  5IZ7 D;  3SYK A;  3EG5 B;  5B31 C;  4ZPX A;  3WTP C;  5DNM C;  3MNN B;  1TAF A;  4IJE A;  1P3A A;  1TZY C;  2Y0Q A;  1QYR A;  2ZM6 M;  1QAM A;  1HT2 E;  4BB9 A;  4G4Q A;  3LZ0 C;  4YY3 M;  3U6E A;  1XXH B;  5JI3 E;  5B0Y D;  3U6M A;  3CF0 A;  4ZUX C;  4FW9 A;  2D7H A;  2W82 A;  5DYG A;  1P3P B;  3REJ D;  4WU9 C;  2JSS A;  2RKO A;  5EP4 A;  4X23 C;  4DV2 M;  3GPU A;  1F66 C;  2QCU A;  1HR0 M;  3PXG A;  3GP1 A;  4G91 B;  1E32 A;  2JCH A;  4NL4 H;  5B1L B;  5ITR A;  3L2A A;  1BH8 A;  4CSR A;  4AWL B;  4YHH M;  4LF8 M;  1QZM A;  3REL B;  5EXT A;  3HU2 A;  5B40 D;  4L8R C;  3A1I A;  1XHB A;  2L6O A;  3F6T A;  4PDI A;  3KW6 A;  4PT5 A;  4NRW A;  4DUZ M;  5H37 D;  4NE6 A;  4AQY M;  3AZL D;  2NZD D;  4I81 A;  1KX3 B;  3X1V A;  4Z66 D;  2DF4 C;  1P3L A;  5FTM A;  3FD9 A;  3A6N A;  1P34 A;  4H9Q B;  5F99 B;  1R7R A;  5B0Y C;  4LD9 D;  3REJ C;  3P5J B;  3B0B A;  4D82 A;  3L28 A;  1M19 D;  3R45 B;  5FTJ A;  5G49 A;  4NXM M;  1E94 E;  2M5Z A;  3T1H M;  3GRV A;  1BH9 A;  4KHP M;  2BYK A;  3U60 B;  5B32 G;  3W99 A;  3GPP A;  3AV2 D;  4IBG A;  2R18 A;  3U6Q A;  3WHK A;  4OU7 A;  3UTB B;  5EP1 A;  2FJ7 D;  3KOX E;  2V1U A;  1EQZ B;  2QZ4 A;  1P3F A;  2X8A A;  2HIO B;  3AZL C;  2NZD C;  2XSZ D;  3AJI B;  5AV8 B;  1U35 A;  4H9P B;  1IY0 A;  4KUD D;  2F4V M;  5B0Z B;  4Z6Y A;  2Z7J A;  1JFI A;  3A1K A;  3AFA B;  2I7P A;  1ZLA A;  5AVB B;  4LD9 C;  3CF6 E;  3WTP E;  2UXC M;  1R4V A;  5AV5 D;  3X1U D;  3TWK A;  1DO0 A;  3AZH D;  3KUY B;  4YS3 A;  5JRG D;  2W8S A;  4IBJ A;  2OQ4 A;  3T15 A;  1Q39 A;  4QHS A;  3VK8 A;  3VH5 W;  4L78 A;  4M9S A;  3AYW D;  3AZM B;  2O5R A;  3RE8 A;  4LJ6 A;  2L7I A;  3C1C C;  4L4U A;  3FUX A;  5GT0 D;  2C9C A;  4DV7 M;  4XUJ D;  2FJ7 C;  1P3O A;  3HHZ A;  3J81 S;  3AZK A;  3LEL B;  3WKJ B;  4IIW A;  3NBI A;  4JI3 M;  3MGR B;  4KUD C;  5C3I C;  5LMU M;  2KRK A;  3KP1 E;  5ITX E;  4XZQ A;  1HQ3 A;  3AZJ D;  4WU8 C;  1KX5 A;  1P3I B;  5B31 A;  3GQ4 A;  5DNM A;  3UTA B;  2R46 A;  3REH D;  3AZH C;  1YSY A;  5JRG C;  3O62 B;  2ZBK B;  3AZF B;  2CE7 A;  2F5S A;  5GXQ D;  3LZ0 A;  1DGB A;  3AYW C;  1G3I A;  5ITY A;  3V9R A;  3DZD A;  2QBY B;  4ZUX A;  3J80 S;  1N36 M;  4OX9 M;  2Y2H A;  5JI2 E;  4KGC A;  3KSY A;  4JJN B;  5GT0 C;  4Z2M H;  1F66 A;  4DUY M;  4XUJ C;  4LJ8 A;  4ZBJ B;  1D2N A;  3KWQ D;  4DV3 M;  2X49 A;  4D81 A;  4HGA B;  3MK6 A;  3UK6 A;  3TPZ A;  2R45 A;  1QVR A;  4AW4 A;  1P3A D;  3KXB B;  3UT9 B;  5FSW A;  3AZE B;  3LQQ A;  4MM3 B;  2F5O A;  3W98 B;  2YFW A;  3REH C;  3C1B B;  5CP6 C;  2X4A A;  4NSO B;  3VKG A;  4LFC M;  5GXQ C;  4H9S C;  4EO5 B;  4LJA A;  5FTL A;  4W5W A;  3REJ A;  2AHM A;  2CV5 B;  2V6Z M;  3KSJ A;  3A98 B;  1R2Z A;  4E45 A;  4B7F A;  1HTA A;  1S32 B;  3UJN A;  4UPK A;  2QEN A;  4JV5 M;  4J8U B;  2CHG A;  2Y2I A;  2CEA A;  1IN4 A;  4DV4 M;  1P3L D;  3GLI A;  3HU1 A;  1I94 M;  4JN6 A;  4DR7 M;  4FD2 A;  4Z5T C;  2DVW B;  4LF5 M;  3AZL A;  2NZD A;  2YFV A;  4GH9 A;  4FWD A;  1L1Z A;  2E5L M;  4QLC B;  3H0R C;  4B08 A;  3ILK A;  2UUB M;  2F8N A;  1XNQ M;  4J8W B;  4M6B A;  2YQZ A;  2XFT A;  2RGO A;  3W96 B;  2HL7 A;  4RF1 A;  3W99 D;  1EE8 A;  1KU5 A;  1WXQ A;  3TQS A;  1L1T A;  4DR2 M;  5GKN A;  3IG8 A;  4ITQ A;  3MGQ B;  2EA0 A;  3REK B;  4PDG A;  5KPT A;  3RGP A;  3SAU A;  5B2J B;  3E9S A;  1P3F D;  3GRY A;  4MB7 A;  3MNN C;  1P3G B;  2XD5 A;  3C1C A;  1P3L C;  3U6P A;  3WAA A;  3GQ5 A;  3VH6 W;  2FJ7 A;  4M0D A;  2UWX A;  1ZLA D;  4LG2 A;  2Y2K A;  1N1J B;  3KFU G;  2IO5 B;  5AY8 B;  2C99 A;  3JR4 A;  4WU8 A;  4LRS A;  4JYA M;  3H4M A;  3GLH A;  5EXX A;  3W99 C;  3AV1 B;  1M18 A;  5B1L C;  3KOZ E;  5DNN B;  4CGY B;  4AWL C;  3AZH A;  1W5T A;  5JRG A;  2ARO A;  5E5A B;  3FYD A;  2RIQ A;  4UUZ B;  3AFH A;  4H9N B;  3AZI B;  2DWZ B;  5AVC B;  4MGK E;  5BO0 B;  3RGS A;  1Q9C A;  3AZK D;  3WA9 B;  1P3F C;  4IBC A;  4JI5 M;  4DR3 M;  3IG5 A;  3U5Z A;  3CTW B;  3HJQ A;  1LV7 A;  3QWL A;  3FTC A;  1KX3 C;  4XZQ D;  1KX5 D;  3LJA D;  5B0Z D;  4PCZ A;  4JI7 M;  2FOI C;  3ZCB B;  1P3M A;  3JAM S;  5CHL B;  3AZG A;  5FTN A;  3L27 A;  1AOI A;  5B2I B;  3FUV A;  3REI B;  3QAU A;  4H9R A;  4QOS A;  4NFT A;  3TU4 B;  5FUG A;  3KOY E;  3REH A;  4M0W A;  5CP6 A;  3C58 A;  4KGC D;  3MGS D;  4LJ4 A;  2CHQ A;  2R62 A;  3GPY A;  3AZN B;  3J7B A;  1F66 D;  3SMS A;  3B0C T;  2A5Y B;  5GXQ A;  3FYC A;  4H9S A;  2LY8 A;  3AZK C;  1NJF A;  4GHL A;  5CPK B;  4II7 A;  4B3R M;  3MGP A;  4FVM A;  4MGH A;  3LEL D;  3X1S D;  3HJS A;  4XZQ C;  3X1T B;  4IBK A;  3MGR D;  5AV8 C;  2PYO A;  1KX5 C;  3T1Y M;  3LJA C;  4CSR B;  3U61 B;  5B0Z C;  3LZ1 B;  3PVS A;  1Z6T A;  3SAV A;  1G59 A;  4AKI A;  4DV1 M;  5AV6 B;  2R65 A;  4J8X B;  1KYI A;  1UM8 A;  5CPI A;  3GO8 A;  2HUE C;  4YM6 B;  3U6C A;  1ID3 A;  1L2C A;  4CIS A;  5GT3 B;  4Z5T A;  4CHT B;  4R8P A;  3X1V B;  5CPJ B;  4LJ7 A;  3AZM C;  3A6N B;  1P34 B;  4KGC C;  2H1R A;  4JI0 M;  3W0L B;  3SAW A;  3MGS C;  5B32 A;  5KPR A;  1QAN A;  3TE6 A;  3PNV A;  3B6F B;  3R8F A;  1FJG M;  3WHL A;  3VFD A;  4CAY B;  3SAR A;  3LEL C;  3K92 A;  3X1S C;  3W97 B;  1KX4 A;  3MGR C;  4M9Z A;  4QNM A;  4G6Z A;  3PFI A;  3B6G B;  4H9O B;  1TH2 A;  3KXB D;  2XH9 A;  4OVZ B;  3TWL A;  1W5S A;  1M1A D;  2NQB B;  3MJ5 A;  1IN8 A;  5AV9 B;  3MNN A;  4E44 A;  1BFM A;  1IBM M;  2Y2O A;  2ZAN A;  3O62 C;  2F8N D;  1GL6 A;  4LGY A;  1DGF A;  1N77 A;  3I4V A;  2FNA A;  1L2B A;  4IBI A;  1C1K A;  4MH0 E;  1P3P A;  2CV5 D;  1J09 A;  4JJN C;  4WJ3 C;  2L7H A;  2YFQ A;  1B67 A;  1SXJ D;  4NE5 A;  5B1L A;  3C1C D;  3REL A;  5JA4 A;  2VQE M;  3WAA D;  4LCB A;  1K82 A;  3KXB C;  2BG1 A;  2Q2E B;  1M1A C;  4XGI A;  1DGH B;  2Y21 A;  3C1B C;  5GSU B;  1P3O B;  5B33 D;  3MVD B;  1KX3 A;  4G92 C;  2JA2 A;  4WU8 D;  4JI1 M;  5E26 A;  3AN2 B;  1N32 M;  4J8W D;  1M18 D;  4KOD A;  1NSF A;  1XWI A;  4J8V D;  3K2L A;  1K3X A;  1IBL M;  1P3K B;  1IXZ A;  2CV5 C;  2ARO D;  3WTP B;  1SXJ C;  3T38 A;  4QOZ C;  2F8N H;  4KHA A;  1TZY B;  3KS4 A;  3ZH9 B;  2BNK A;  3FUT A;  3UZU A;  3WAA C;  1XNR M;  1Q3B A;  3LVV A;  3UTB A;  4WU9 B;  5B24 B;  3LMM A;  5BNV A;  1EQZ A;  3K1J A;  4X23 B;  1S3S A;  1P3M D;  3M6A A;  5FLX S;  1ULY A;  5B33 C;  3AZG D;  1AOI D;  2BJW A;  4QLC C;  5AV8 A;  3LJA A;  4H9P A;  5B0Z A;  4OW0 A;  4J8W C;  1M18 C;  4MGI E;  1WWS A;  4J8V C;  2FFJ A;  3AFA A;  1JR3 A;  2XZU A;  5AVB A;  4Z8X A;  1XC8 A;  5CP6 D;  4I8O A;  2ARO C;  4DQY B;  4JI6 M;  3KUY A;  3MGQ C;  2YFW B;  1KFV A;  3BOS A;  1TH4 A;  3MGP D;  3AZM A;  1WWI A;  3MGS A;  1N75 A;  5B0Y B;  2PYO D;  1HNZ M;  3NQJ B;  4X65 M;  4DRA A;  5C18 A;  1P3M C;  3LEL A;  3NWL A;  3WKJ A;  3X1S A;  3AZG C;  1AOI C;  2D7G A;  3MGR A;  5CPI D;  4LZJ A;  1G8P A;  1NY6 A;  2Z3X A;  2QP9 X;  1ID3 D;  2R4E A;  3EIH A;  3EPJ A;  2BYM B;  4Z5T D;  4LF7 M;  3FTE A;  5B40 B;  1K3W A;  4R8P D;  1P3B D;  5EJC A;  1NNU C;  5EXP A;  3TU4 D;  5B32 D;  4GIT A;  4X66 M;  1H6U A;  5IT9 S;  3O62 A;  1X37 A;  3AZF A;  1OFI A;  2Y2L A;  4Z66 B;  4QHT A;  3MGP C;  2QBY A;  1H3O B;  1KX4 D;  1F1E A;  1Z2C B;  2PYO C;  5B31 G;  4JJN A;  4LD9 B;  2ZY4 A;  3FTF A;  1M19 B;  5KO3 A;  5IRE B;  3SHG B;  2J8P A;  3MNN D;  2XGN A;  5CPI C;  4LF6 M;  2KRU A;  1ID3 C;  3KXB A;  3UT9 A;  3AV2 B;  2LH0 A;  1MX0 A;  4LJ5 A;  1M1A A;  4R8P C;  1P3B C;  4IJF A;  3W98 A;  2C98 A;  2Y0T A;  3B0D C;  3TU4 C;  5B32 C;  3VLF B;  3C1B A;  2D7E A;  4R3D A;  1P3P D;  5CPJ D;  2FJ7 B;  1NHW C;  4WV4 B;  3AZN C;  3A42 A;  1B6W A;  4DV5 M;  2DWL A;  2UUC M;  5B1L D;  3K8Z A;  4KUD B;  3A45 A;  4L16 A;  1KX4 C;  1YE9 A;  2CV5 A;  3Q8X A;  4WUR A;  3REL D;  4R7G A;  3W97 D;  3NQU B;  2XLJ A;  1GKI A;  1S32 A;  5AV5 B;  3X1U B;  1SXJ A;  3LZ1 C;  5E6J A;  3SHF A;  4J8X C;  5AV9 D;  3LQR A;  2UXB M;  3AYW B;  5BS7 C;  1KX3 D;  3HJ8 A;  3GLF B;  5F99 D;  1T3T A;  1N34 M;  4KLN A;  4WNN B;  5ITQ A;  5GT0 B;  3L25 A;  2Z4S A;  1PZR A;  3VH5 T;  1J7K A;  1P3P C;  3AKZ A;  4XUJ B;  5CPJ C;  1XMQ M;  5B33 A;  4QLC A;  4G91 C;  4J8W A;  4J8V A;  4QNR A;  3W96 A;  2LNH C;  2L5A A;  3AZJ B;  3GLG B;  3REL C;  5FTK A;  3W97 C;  2ZM5 A;  3GRR A;  4X62 M;  3GRU A;  3MGQ A;  2F5Q A;  3M0E A;  3REK A;  3J27 B;  3B6G C;  3REH B;  3UTB D;  3IP4 C;  1Q3C A;  5B2J A;  1EQZ D;  3J2P B;  2NQB C;  4G4N A;  5AV9 C;  2HIO D;  5BNX B;  4S12 A;  1P3G A;  5AV8 D;  5B1M B;  5F99 C;  3MVD D;  2VII A;  1IM2 A;  3AFA D;  1JR3 D;  5KQD A;  5AVB D;  2XZF A;  3OTO M;  2RGH A;  2HCB A;  5KDM B;  1N1J A;  3CF2 A;  3MHV C;  5AY8 A;  3KWQ B;  2ZAM A;  3DA1 A;  3KUY D;  3FTD A;  2CHV A;  3HU3 A;  4B7H A;  1TAF B;  1P3A B;  1A7W A;  3U6L A;  2CFO A;  5DNN A;  3AZM D;  4JI2 M;  2CV1 A;  5EP2 A;  1KSF X;  4UUZ A;  2BJV A;  3UTB C;  3AZI A;  4DR4 M;  3GQ3 A;  1EQZ C;  5AVC A;  5BO0 A;  4GC9 A;  2XEP A;  5KPZ A;  4NE3 A;  3WA9 A;  1PJJ A;  5B24 D;  2HIO C;  3WKJ D;  1E9S A;  2FFF B;  2KZU A;  4NXN M;  4JI4 M;  5GSU C;  2HKJ A;  4Z2M G;  1BH8 B;  3MVD C;  2Y2J A;  1VDD A;  3AFA C;  1P3I D;  5AVB C;  3RFW A;  1ZQ9 A;  3UGJ A;  3UTA D;  1P3K C;  3KUY C;  3L29 A;  2KEB A;  3HWS A;  3O62 D;  2F2A C;  3HHY A;  1NNJ A;  5B2I A;  3REI A;  3AZF D;  2V1C A;  1P3B A;  1P3L B;  4GMQ A;  1DGG A;  3TU4 A;  1E9R A;  2YNM D;  3R9X B;  3U6O A;  4JJN D;  4DV6 M;  4JI8 M;  1TDH A;  3PNY A;  2G5H C;  3AZN A;  1IN6 A;  4JXJ A;  5DYI A;  4TUW A;  2Y2Q A;  4GKK M;  3TWM A;  5B24 C;  5G49 B;  3TL4 X;  5CPK A;  3WKJ C;  1BH9 B;  5EXS A;  2BYK B;  4I4L A;  3W99 B;  2Y20 A;  3X1T A;  3UT9 D;  3U61 A;  1P3I C;  3LZ1 A;  1QQW A;  3AZE D;  4AI6 A;  4LFA M;  1TH3 A;  3SAS A;  3W98 D;  5AV6 A;  5JA4 B;  3UTA C;  4B3S M;  4J8X A;  3C1B D;  3J7A S;  5BS7 A;  3FDD A;  1P3F B;  3AZF C;  4YM6 A;  4LRT A;  5LMN M;  3E4R A;  1XXH A;  1DO2 A;  1Z5C A;  3ZC7 B;  1U35 B;  2Z4R A;  2FE8 A;  4HLQ A;  5GT3 A;  1HT1 E;  3VKH A;  4LF4 M;  2XF3 A;  5CPJ A;  1JFI B;  2Y2G A;  3KS8 A;  3DFZ A;  1ZLA B;  1IXR C;  2OPF A;  2Y2P A;  1S32 D;  4ZBJ C;  3B6F A;  2EO2 A;  4K0K M;  4HGA C;  3VH6 T;  4XBO A;  4YS3 B;  5EP3 A;  4D80 A;  1R2Y A;  4J8U D;  4CAY A;  4IBF A;  2NQ8 C;  1L2D A;  3W97 A;  2J7O A;  4DR1 M;  1IY1 A;  1GVN A;  3UT9 C;  4REZ A;  4KHA B;  3VDP A;  4I5S A;  3B6G A;  5ITT A;  1OFH A;  4H9O A;  3AZE C;  1FNN A;  1J5E M;  3W98 C;  4OVZ A;  4DRB A;  5B40 C;  2NQB A;  3HHX A;  5AV9 A;  4GHA A;  5BT1 D;  4FWG A;  3AZK B;  4QLC D;  4AG6 A;  3KXE C;  5BNV B;  4H9Q A;  5F99 A;  2DXI A;  4EO5 C;  2JE5 A;  1QAQ A;  3KP0 E;  3W96 D;  4XZQ B;  4B3M M;  1HQ3 B;  4Z66 C;  4GC5 A;  1KX5 B;  3LJA B;  1XMO M;  3R45 A;  1S32 C;  5B31 B;  3MGQ D;  5DNM B;  3REK D;  3EIE A;  5BPV A;  4DR5 M;  5C1B A;  3U60 A;  5B2J D;  4J8U C;  1IBK M;  1M19 C;  1IN7 A;  2HUE B;  3LZ0 B;  1P3G D;  3V9R B;  2XD1 A;  4ZUX B;  5KQ8 A;  4DR6 M;  3W0F A;  2ERC A;  1JQJ C;  1L8Q A;  3AOG A;  3AV2 C;  1ORY B;  4B7G A;  3I51 A;  4KGC B;  3MGS B;  2DZO B;  2I7N A;  4FWH A;  1F66 B;  2HIO A;  1DGH A;  2LWX A;  5BT1 C;  5AY8 D;  5GSU A;  3D8B A;  2F5P A;  3MVD A;  2DQN C;  3W96 C;  3X1S B;  3AN2 A;  4IBE A;  3FKE A;  3AV1 D;  5DNN D;  1Z59 A;  4LFB M;  1P3K A;  2Y2M A;  2RVQ D;  4NRV A;  5E5A D;  3REK C;  1YUB A;  1HNW M;  3AZI D;  3VK7 A;  5AV5 C;  3X1U C;  3WTP A;  5B2J C;  5AVC D;  4LY6 A;  3WA9 D;  4GRI A;  1TZY A;  1Z5B A;  4NOO B;  1R6B X;  1P3G C;  1NJG A;  4NSR A;  3AL0 C;  1NY5 A;  3REJ B;  3JR5 A;  2UXD M;  5B1M D;  2LXE A;  3HGI A;  4RNA A;  4WU9 A;  5B24 A;  4X23 A;  5AY8 C;  2IO5 C;  2CV2 A;  4AKG A;  4BBA A;  1HQC A;  3VH5 A;  3D8L A;  5B2I D;  3REI D;  1P3I A;  4FCW A;  3AV1 C;  3A46 A;  3B0C W;  4EIW A;  3AOE C;  3GLI B;  5DNN C;  3UTA A;  1TGU A;  3AZJ C;  2KXE A;  3I4Y A;  2DWM A;  5ITX A;  2RVQ C;  5E5A C;  1HNX M;  2G5I C;  5F3W A;  1M1A B;  3AZN D;  3AZI C;  4LGM A;  7CAT A;  3AZL B;  2NZD B;  2YFV B;  4MGZ E;  5AVC C;  5BR8 M;  3WA9 C;  1MU5 A;  5CPK D;  2F8N B;  2J7N A;  4G92 B;  4DV0 M;  2DHR A;  3DOA A;  5B0Y A;  3X1T D;  1SXJ E;  4GIP A;  2G8L A;  1N33 M;  5B1M C;  3NQJ A;  4L15 A;  3LZ1 D;  2CUZ A;  5AV6 D;  1IQP A;  3EPH A;  4J8X D;  4FCV A;  3H0L C;  2VQF M;  2K47 A;  5IWA M;  1SXJ B;  3KWQ C;  5B2I C;  3REI C;  3GPX A;  1IN5 A;  4YM6 D;  4IBD A;  3AZE A;  3C1C B;  1P3A C;  2BYM A;  5GT3 D;  8CAT A;  3WAA B;  5B40 A;  3X1V D;  3A6N D;  4AG5 A;  1P34 D;  3VDU A;  4B3T M;  3U6D A;  3B6F D;  1GLN A;  1QAO A;  3KSX A;  4WW0 A;  2UUA M;  3M7G A;  5CPK C;  5C3I B;  5B33 B;  4WU8 B;  4WZS B;  4Z66 A;  2DZN B;  3GLH B;  1H3O A;  1M18 B;  3X1T C;  4J8V B;  3HKP A;  3B6G D;  3AZH B;  4LD9 A;  1IY2 A;  1TDZ A;  5JRG B;  2ARO B;  5AV6 C;  4J8U A;  2NQB D;  1M19 A;  2KW0 A;  3KDS E;  2XFS A;  3THG A;  4LJ9 A;  3SBJ A;  4AZF A;  3U6S A;  4A3V B;  3SFZ A;  2C96 A;  4YM6 C;  4KO8 A;  2QPA A;  4P16 A;  3U5Z B;  3AV2 A;  5GT3 C;  1IXS B;  3X1V C;  1T3U A;  1U35 D;  3A6N C;  1P34 C;  1PM5 A;  4G4O A;  4PD2 A;  3EPK A;  3B6F C;  3H0M C;  1P3M B;  2C9O A;  3AZG B;  2XSZ A;  1AOI B;  4G4R A;  4KUD A;  4YS3 D;  1OJL A;  2EUC A;  4LZZ A;  3HHW A;  4GKJ M;  4H9R B;  5EQT A;  2F5N A;  2ZAO A;  3SC3 A;  3KVW A;  1N78 A;  2ZY2 A;  5FUG B;  3NQU A;  1NVM A;  4IBB A;  5CP6 B;  5AV5 A;  3X1U A;  2F8N G;  1HQY E;  4X64 M;  1NHG C;  2F8N K;  2M60 A;  3B9P A;  5GXQ B;  3SYL A;  5GSU D;  1P3O D;  4HL4 A;  3AYW A;  3MGP B;  2YR0 A;  3GLF A;  3SAT A;  2Y2N A;  3AN2 D;  2R4J A;  5ITU A;  2PYO B;  4WNN A;  1U35 C;  5GT0 A;  2L09 A;  4XUJ A;  1P3K D;  1HQ3 D;  1W2E A;  3SMP A;  3UMM A;  1ZLA C;  3FUW A;  1GL7 A;  1I4W A;  5B31 D;  3WTP D;  5DNM D;  3AV1 A;  1PJI A;  3AOE A;  5CPI B;  4YS3 C;  4M9X A;  1TZY D;  4BLC A;  2CV0 A;  2KZS A;  3AZJ A;  1ID3 B;  3GLG A;  5E5A A;  3VH6 A;  3FUU A;  4FCT A;  4Z5T B;  3LZ0 D;  1G41 A;  3KOW E;  4H9N A;  4R8P B;  2C5R A;  1P3B B;  5A2Q S;  4AKH A;  4ZUX D;  3B0D B;  4RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...