3KFUG

Crystal structure of the transamidosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
b'ELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
total genus 15
structure length 86
sequence length 86
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.990 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kfuG02
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kfuG01
3AL0C 2F2AC 3H0MC 2DQNC 2G5IC 3H0LC 4WJ3C 2G5HC 2DF4C 3A1IA 3H0RC 3IP4C 3A1KA 3KFUG
chains in the Genus database with same CATH superfamily
2JCHA 2Q2EB 4LJ9A 3B0DC 1M18A 1DV0A 3HHXA 3T1HM 3K1JA 1M19D 4D80A 2CV2A 2PYOC 5ITXA 5CPJC 3C1BA 3B7NA 2RIQA 1AOIB 1L2CA 1M1AA 1OFIA 2CV1A 5GXQA 4CAYB 4X23B 1YE9A 5AV6A 3W97B 2JY8A 4P16A 3R8FA 4KHAA 5F99B 1NVMA 5KO3A 3X1TB 2ZY4A 5B2IB 4GITA 4P17A 1P3PD 5DNNC 3WKJD 3AYWB 3SMPA 3SASA 3AZKC 1N75A 5CPKB 4BBAA 4WJ3C 4UUZA 4HGAC 4JI5M 1TGUA 2JY6B 3WTPE 1P3LA 3AV2A 1WWSA 1P3AD 3LZ0A 4MGIE 1I4WA 4ITQA 3TU4B 4AW4A 3GLGA 4FW9A 2QBYA 2AROC 2DAIA 2ZTCA 1W2EA 4Z2MH 4J8VC 4K0KM 2DAGA 4M9ZA 4XZQC 4D81A 4J8WB 4GC5A 3LJAA 2R4JA 1S32B 3AZIA 1TAFA 2H5XA 2KNZA 4ZBJB 2QP9X 1JB0F 3AZNB 1FJGM 1KX4D 2VQRA 2BYMA 3T6PA 5KDMB 3AZHD 5AV5B 5AY8A 1Q9CA 4IBDA 3AL0C 1GJTA 5ITRA 4Z66A 3AFAA 4LJAA 3GQ4A 2XZUA 4G6ZA 4YS3B 2D7EA 1HQYE 5GXQD 5C3IB 3OTOM 3W0FA 3FUWA 2J7OA 1J5EM 2F2AC 4DV7M 2FJ7D 2XEPA 3WTPA 3ZQJA 4WU8B 2DWLA 3AZEC 5JRGA 2R46A 1KX3B 4AKHA 1U35C 4LJ8A 2GQFA 5LMUM 5E5AD 3WA9D 3O62A 4J8UD 3A46A 3LQRA 4H9OA 4QLCC 2Y21A 3FD9A 1P3LD 1OKSA 4M0WA 2YQZA 1HNZM 1R4VA 2CE7A 4AKIA 2L7IA 3GRVA 3L28A 4KGCC 3KSYA 4H9PA 3VKGA 5CPJA 1VEJA 4L78A 4L16A 2ZAOA 5B0YA 1AOID 3AKZA 3MGPC 3HJQA 4H9QA 4X23D 4DV0M 1G71A 2QENA 3REIB 4G4NA 5BNVB 5F99D 4L15A 1ZQ9A 2UUAM 2RGOA 3X1TD 5B2ID 2X8AA 2Y2OA 3GLHA 4FD2A 1ZV1A 3FUVA 4LCBA 2XF3A 1SXJD 2D7GA 5DNNA 3AYWD 2YFVA 3KW6A 3HU2A 5CPKD 3AZKA 2BWEA 1QQWA 5AVBC 2CV5A 1K3XA 1ZLAC 2CWBA 1MN3A 3L26A 2DWNA 1NHWC 1N34M 4WU9D 3NBIA 4F2LA 1D0KA 5B31B 4LD9C 4NE6A 3REHC 4OVZA 1P3FC 1L2DA 1HQ3C 5B40B 2LHCA 4YY3M 4OW0A 4GC9A 5FSWA 3HZJA 3B6GC 4J8VA 1XB2B 1TH2A 4G4QA 2WSCF 3SYKA 2K6BA 1YUBA 5JI3E 3MJ5A 1K3WA 4R7GA 1DGGA 1S32D 3X1SB 1WIVA 1T3UA 2EO2A 1P34D 5BS7A 3AV1B 3WAAD 2X4AA 3A1KA 4KHPM 3NQUA 3AZND 2XSZD 2DKLA 3M0EA 5AV5D 1G59A 3MGRC 3PFIA 4W5WA 4B3RM 4FWGA 2YR0A 4JJND 1JR3D 1BH8A 3CTWB 3W96C 4YS3D 5BT1C 2XLJA 4LF9M 5AV9C 4IBEA 4DQYB 2QQ8A 5IWAM 3KWQA 3SYLA 4RKUF 2D7HA 3REKC 1NV8A 3FUXA 2XFSA 4WU8D 1TR8A 1C1KA 4NXNM 3U6LA 3AZEA 1R5LA 4DV5M 3LVWA 4NRVA 2RVQD 4G92C 1U35A 2XGNA 3AZGB 4LJ7A 4DV6M 5DNMB 4B7FA 1GL7A 5B1MD 4E45A 4QOZC 2LY8A 3KXEC 4QLCA 5B33B 2HUEC 3UTAA 4GKJM 3KP0E 3VH5A 2F8NB 1TTEA 1N77A 1PGYA 1T6OA 3C9PA 4Z5TA 4LFBM 2HAKA 4WNNA 2JXNA 3GLFE 3MGPA 2G3QA 4LZZA 4JI0M 3U6OA 2ERCA 3REID 1P3IB 4G3OA 5B0ZB 3EIHA 3TL4X 1MU5A 2QSFX 3GPXA 3H4JA 1BH9A 2XD5A 3WHKA 3V9RA 3AZMB 1P3PC 2UUCM 1TDZA 4LZJA 3WKJC 3H0MC 3PXGA 5AVBA 3GRYA 1KX5B 3X1VC 3RELA 2LXEA 3EPLA 5B31D 4LD9A 4GEWA 1IBLM 1OAIA 1P3KD 1HQ3A 4TUWA 2CRUA 4DR7M 3B6GA 3NWLA 2ZBKB 3KXBB 4AI6A 4IBFA 4G4OA 2H1RA 1IXSA 3X1SD 4DR6M 4R8PB 2RRUA 4QOSA 3AV1D 3H0RC 1N33M 5C18A 2LBCA 4CSRA 5AV8C 4FCWA 2G5GX 2F5SA 3UTAD 3C58A 2LVOC 1ORYB 5EP4A 4LF8M 4KUDB 1ULYA 1F66B 1PRBA 1KX4C 3SMSA 3FTEA 2KHHA 4M9SA 3AZHC 3LCUA 2YFWB 3C1CB 2J7NA 1XXHB 1NO1A 4IBKA 3AZLB 3QYBA 3B6FA 4DBGB 2O5RA 2LVQD 2LNHC 5AV9A 5GT0B 5GXQC 1KFVA 3SBJA 2XD1A 3X1UB 1DO0A 1LTMA 3U61B 2WSFF 3TWKA 3UJNA 4EO5B 5DNYA 1G8PA 3GQ3A 3REKA 2M60A 4YM6B 3AZGD 1TZYB 4G91C 5E5AC 3WA9C 3M6AA 3MVDA 4J8UC 5B33D 3ZCBB 1DGHA 2F8ND 3J27B 1P3LC 4WURA 4DUYM 3AV2C 3VH5T 3GLIE 2KZSA 2HL7A 5B2JB 1M19A 1T43A 5CP6B 1R4GA 2Z7JA 2JZ0A 2JP7A 3EPKA 5CPIB 5FLXS 1JFIB 4FWHA 5BNXB 4B3MM 2FFFB 4X23C 3LJAC 4Y28F 1WR1B 4PCZA 3FRHA 1P3ID 3W99B 3MMPA 5B24B 5B0ZD 2JY5A 5F99C 4XGIA 3X1TC 2LVAA 5B2IC 3PNVA 4DUZM 2JE5A 5C1BA 4JI2M 3DA1A 1SXJC 4R71A 1L2BA 3AZMD 2UUBM 3MGQD 1P3MB 1P3PA 2OO9A 3U6DA 5BO0A 3WKJA 4II7A 2DWMA 5CPKC 3AZJB 2MJ5B 4ZUXA 2Y2NA 1DGBA 1KX5D 2NQBD 2DNAA 2GNOA 3UK6A 2Y2KA 2HIOB 2WZJA 4WU9C 2R18A 1QDRA 1P3AA 1EFUB 2DHYA 1P3BB 1VDLA 1OIZA 4NXMM 3KXBD 3KUYB 3JR4A 5JRGC 4J8XB 3TE6A 4R8PD 1XNRM 1S32C 2Z8YM 3NQJA 1P34C 3SARA 2UXBM 1P3QQ 3WAAC 1NNUC 4DV2M 4I5SA 3AZNC 1F66D 1KX4A 1EQZB 2UWXA 5AV5C 3AZHA 1L8QA 3C1CD 3VK8A 3U6PA 5EXPA 1P3GB 4JJNC 3KSJA 2EKFA 1MX0A 5B0YC 4LGYA 1NSFA 3GRUA 3REJB 3KVWA 4JYAM 1SXJE 3B0CT 2ZY3A 3TWMA 4YM6D 2FJ7A 2OOAA 3L2AA 1QAOA 3SHGB 3QWLA 2HHHM 5GSUA 4WU8C 2HKJA 3AOGA 2QBYB 2R45A 1PJIA 1TZYD 2RVQC 1TF0B 1H3OB 3P5JB 2F8NK 3W0LB 3A6NB 4KLNA 5E5AA 3WA9A 3TWLA 4J8UA 2ZAMA 5H37D 5B1MC 2X49A 4ZUXD 2CV5C 5DYIA 3AZFB 1D0LA 5B2JD 2O25A 1Q3BA 4IBGA 5CPID 3AFAB 3ZH9B 1AOIA 3GRRA 4X23A 4AWLB 3HWSA 3W99D 5BS7C 5B24D 3REIC 5F99A 3X1TA 5B2IA 3I51A 4FCVA 4X62M 4AKGA 3ILKA 1C7YA 3J2PB 5KQ8A 1IN7A 5EP1A 4RNAA 4PDGA 3U6SA 4WZSB 1SXJA 5EQTA 3W68A 1P3MD 4YHHM 1F1EA 5FUGB 3U6MA 3AYWA 3JR5A 3AZJD 5CPKA 4DRAA 1NV9A 1I94M 2BJWA 5ITYA 2HIOD 3B0DB 3GLHE 4WU9A 3B0BA 3AOEA 2APLA 4M0DA 5B31C 3KWQC 4CHTB 2BJVA 1P3KC 1OIPA 2DQNC 2PYOB 1P3BD 2LVNC 3E9SA 5GSUD 1W5TA 3TPZA 2V6ZM 4IJEA 3KUYD 1HR0M 4NFTA 4J8XD 3FTCA 1AIPC 3LW5F 4J8WA 2DXIA 1S32A 5CHLB 1P34A 1GJSA 3RGPA 3WAAA 1BVSA 1IY2A 3ZC7B 3UTAC 2C9OA 4JI6M 2Y2QA 3AZNA 4CISA 1EQZD 1IBMM 4H9NB 1KSFX 2XSZA 1CUKA 4LRSA 4REZA 5AV5A 3MNNB 3LELB 3VH5W 2M5ZA 1P3GD 4Z5TC 2L09A 4JJNA 1JR3A 2EUCA 3AJIB 5F3WA 4YS3A 1Z5CA 4HGAB 2LTUA 3REJD 1IN4A 1Z5BA 1WWIA 1OTRA 1VQ1A 2JUJA 4LF5M 4LJ5A 3KOXE 3W97D 4OVZB 1G41A 5GT3B 1ZMUA 3MGSB 4WU8A 2AROB 2V1CA 4AG6A 1HJPA 5IZ7D 1N1JB 2K0BX 2BYKB 3MHVC 3HGIA 4XZQB 3LMMA 4JN6A 4XUJB 2R6FA 5B1MA 1VEKA 5AVCB 5B33C 1H6UA 2Y0TA 4OX9M 3AZFD 3RELC 4MH0E 3FE3A 1QYRA 3TU4D 1WGLA 1BH8B 3IG8A 2QPAA 1V92A 3L29A 3FTDA 2MROB 3NBXX 1QUTA 3B74A 3I4YA 3D8LA 1XMOM 4J8WD 4NE3A 2L5AA 3L25A 2ZY5A 2DAEA 3BBZA 3REIA 5BNVA 2KEBA 1EIJA 4GH9A 1P3IC 5B0ZC 3UGJA 2NZDB 3AN2B 1VEGA 4ZPXA 3AZMC 3B89A 1GLNA 3MGQC 3F92A 5EP3A 3B6FC 2NQBC 1IY0A 1HNXM 2R62A 5L8RF 4R3DA 5B31A 2R0IA 5EXSA 2PYOD 1P3KA 3FYDA 2J5YA 5B40A 3B0CW 4KGCB 2G5IC 2KDLA 1KX3D 1QANA 3GPYA 1YSYA 1TH4A 1NY5A 2Y2MA 1LV7A 3X1SA 5JI2E 4PT5A 4XK8F 3HKPA 3AV1A 3MVDC 4LG2A 1HTAA 1SG9A 3UT9B 3BXWA 2L7HA 1F66C 1PZRA 1E94E 3MNND 1D0MA 3LELD 3C1CC 2QCUA 1M19C 1IN6A 5B1LB 3T1YM 3U5ZB 5EXTA 3VK7A 3VDPA 3RE8A 1R2ZA 3EPJA 2ZANA 1ZLAB 4LJ6A 3U60B 2Y2JA 3UTBB 4L8RC 3HY5A 4H9RB 1XC8A 3REHB 1P3FB 2RKOA 1S3SA 2L4FA 5GT3D 4MB7A 3MGSD 2AROD 3FTFA 2CHGA 4QHTA 2JSSA 1E9SA 1EE8A 4XZQD 3SATA 1TZYC 1WJ7A 3HU1A 3AZGA 1IXSB 4PDIA 4XUJD 4WP2A 3GO8A 3VKHA 1B6WA 2I7NA 1G4AE 3R9XB 5AVCD 4ZUXC 5B33A 3GLFB 5BR8M 2F5QA 4CGYB 2F8NA 2KRUA 3MGRB 3C3DA 1VG5A 3I04M 1P3AC 5B40D 1R6BX 5CPIC 4G4RA 3W96B 3FYCA 3GP1A 3A42A 3C3EA 5E6JA 3T38A 5DFLA 3A45A 4NSRA 3W99C 5B24C 1P3IA 3R45B 4FCTA 5B0ZA 4JI4M 2R4EA 3REKB 2MR9A 2NZDD 3AN2D 5JA4B 3V76A 3K2LA 4DR2M 3VH6A 3DZDA 3AZMA 1P3MC 1Q39A 3MGQA 3LZ1B 2J8PA 2CUZA 3AZJC 5KPRA 5KQDA 2DAMA 1KX5A 2NQBA 1P3OB 2QZ4A 2KXEA 1HNWM 4DV1M 1IBKM 3IECA 1QAQA 4HL4A 4KGCD 2FJ7C 3KS8A 1AUAA 5GSUC 4CIZA 1NHGC 3KXBA 3KUYC 4LJ4A 5G49B 4IBIA 4J8XC 2DZOB 5DNMD 3I4VA 4R8PA 4Q7JA 2K47A 1OJLA 4IBCA 2IO5C 3UT9D 3D8BA 2ZM6M 2E5LM 1F66A 1EQZC 2CHVA 2YFWA 3C1CA 1ID3B 5B1LD 1UM8A 1P3PB 1XXHA 1P3GC 4B7HA 4JV5M 5EJCA 3WKJB 3HJSA 1ZLAD 1AOIC 3X1VB 2JNHA 5GT0A 3REJC 3W98B 3UTBD 4GMQA 3U61A 3GPUA 3REHD 1P3FD 3W97C 4JI8M 1XWIA 4YM6A 2L2DA 3AV0A 4WW0A 4XBOA 2CP8A 4EIWA 3GLIB 3E21A 1QDTA 4LRTA 1TZYA 1MJGM 5E26A 2CWEA 2EJSA 3AYWC 2C96A 1J09A 1Z6TA 3KOZE 2ZY2A 5AV8B 1Q3CA 5B32B 1NY6A 4QNRA 2DF4C 3AZFC 2DI0A 3W67A 1M18B 3MGRD 3AOEC 3U6CA 1A5TA 2WSEF 3AZHB 5B2JA 4IBBA 5CP6A 2A5YB 2RGHA 3TU4C 2MGWA 1IFYA 1WXQA 5CPIA 2BWBA 4I4LA 3C1BB 2Y0QA 3SC3A 3W96D 5BNXA 3EIEA 4NL4H 4AG5A 1M1AB 5GXQB 4J8WC 1PJSA 1OAOC 3W99A 5B24A 2Y2GA 5AV6B 2XZFA 4KHAB 4ZBJC 2FE8A 4KUDD 1PJJA 1PJQA 5DYGA 4I81A 5GKNA 1P3MA 3LZ1D 4G91B 1WHCA 5B31G 5E5AB 3K9OA 3PVSA 3AZLD 3AZJA 3EPHA 2MH8A 2KA6B 1P3OD 4YS3C 1HT1E 4UUZB 5GT0D 1L1TA 2HIOA 1P3LB 4NRWA 2DVWB 3X1UD 3AV2B 5C3IC 2ZM5A 1JQJC 3HHWA 3LZ0B 1P3BA 2F5NA 3GLGB 3KUYA 4BB9A 1KX3C 7CATA 2YFQA 1GVNA 4J8XA 4S12A 3LJAB 4QNMA 3AZIB 5ITUA 4DR5M 1TAFB 3LCVB 4QHSA 2OOBA 4GHLA 2BNKA 4UPKA 1EQZA 2FNAA 2BYMB 2XH9A 3MNNC 4F1IA 4Z6YA 1SXJB 3LELC 1ID3D 5AY8B 5CP6D 3U6EA 1IN5A 2QNJA 3FKEA 1P3GA 2R44A 4Z66B 2Y2IA 1BFMA 2CFOA 3X1VD 3FUTA 3W98D 3REJA 3Q8XA 4CAYA 4WU9B 3K9PA 5A2QS 2VIIA 2VDBB 4PD2A 3W97A 3BOSA 4GKKM 5LMNM 5GT3C 1K82A 3UMMA 3MGSC 3WTPB 1JR3E 1XHBA 4GRIA 2FS1A 2LHGA 5FTJA 2VF7A 5JRGB 2F8NG 3SAWA 1H3OA 1DGFA 3A6NA 2KNVA 2EA0A 3O62B 5FTLA 4XUJC 3HJ8A 4DR4M 1P34B 5AV8D 3CF0A 2DENA 3WAAB 5B32D 5BPVA 5AVCC 4H9OB 1KU5A 3AZFA 1M18D 3GPPA 2C99A 1ZMWA 3VFDA 1QUSA 3A98B 5B40C 2FOIC 1L1ZA 3LQQA 3TU4A 4JJNB 4H9PB 1N32M 3C1BD 5CPJB 4M9XA 3CF6E 4CJ6A 4X66M 2Y2HA 5B0YB 1M1AD 2V1UA 3JAMS 2CV0A 4H9QB 3X1SC 3AV1C 5AV6D 2C5RA 1IY1A 4DV3M 2NZDC 3AN2C 4L6V6 3GLHB 5KDMA 1YLAA 5FUGA 5DNNB 2YFVB 4Z8XA 3AZKB 5B1MB 2CV5B 2O01F 1A7WA 2VQFM 2W8SA 5EP2A 1F4IA 3AV2D 1J7KA 3LZ0D 2PYOA 2Y2PA 1IXZA 3VDUA 2JA2A 1KX3A 1QZEA 4J8VB 4IBJA 2P5TA 1B67A 3AZGC 3LJAD 3A6ND 5DNMC 3AZID 2FH0A 3KSXA 2KRKA 3HHZA 3E46A 1Y8GA 2R65A 1TDHA 3NQUB 3UT9C 5KPTA 2W82A 4H9NA 3MNNA 4GHAA 5AY8D 3LELA 1V34A 2UU9M 2F8NH 5B1LC 8CATA 1OQYA 4Z66D 4IIWA 3SAVA 1W5SA 3AFAD 4LF4M 1IXRC 2UXDM 3UTBC 3KWQB 1GABA 2OPFA 1P3KB 5GT3A 3B9PA 3THGA 3WTPD 3MGSA 3E4RA 1KYIA 2AROA 5JRGD 3AZEB 1N1JA 2BYKA 3GQ5A 1U35B 4DR1M 4XZQA 2HWJA 2Y20A 2Z4RA 4I8OA 3O62D 3H4MA 3VH6W 4XUJA 2DZNB 2Z3XA 2AHMA 1G3IA 3KDSE 5AVCA 4QLCB 1KX5C 3UTAB 3MK6A 1PM5A 1ZAEA 2FFJA 5KPZA 4FVMA 1Z59A 1VDDA 5EXXA 4Z5TB 1GO5A 4WNNB 5CPJD 2F5PA 1E9RA 3KXBC 4RF0A 3B7ZA 3I01M 5B0YD 1IQPA 3MGPB 1QZMA 1R7RA 5IT9S 4R8PC 1QVRA 1Z5AA 3IHPA 1NJGA 2NZDA 3AN2A 2LVPC 4KUDC 5B32G 2JZ1A 2KNAA 1BH9B 3FDDA 3J7BA 3V9RB 3RFWA 3J7AS 2F5OA 5DNND 4NSOB 4B7GA 1HT2E 3LZ1C 3AZKD 3KOYE 4JI1M 3AZLC 2CV5D 2F4VM 5AVBB 1P3OC 3K8ZA 3RELB 5GT0C 1RU3A 2Z4SA 3DFZA 2QHOB 1NNJA 4LFAM 3X1UC 4LD9B 4EO5C 3A1IA 1HQ3B 2B3TA 4KGCA 4YM6C 2NQ8C 4KO8A 3B6GB 4D82A 4B3TM 4IJFA 4J8VD 3DOAA 3SAUA 4H9SC 4AQYM 4DR3M 5DNMA 2JWSA 3HU3A 3KS4A 1PJTA 4M6BA 1V33A 4CSRB 3TQSA 3UT9A 3IG5A 1OFHA 4B3SM 4DRBA 2L6OA 4AZFA 2G5HC 1FNNA 5ITQA 3J80S 5B2JC 1ID3C 2LWXA 2XFTA 5CP6C 5B1LA 3U5ZA 3MGQB 4L4UA 2KW0A 4HEOA 3PNYA 4MGYE 1ZLAA 3B6FB 2Y2LA 2NQBB 2UXCM 3W98C 3U60A 5AV9B 3UTBA 4JXJA 4LGMA 3KWQD 3KFUG 4H9RA 3REHA 1P3FA 1XMQM 3LVVA 4ANRA 1XXHE 3SFZA 3WHLA 3AZED 2ZTDA 4G92B 1U35D 5IREB 3L27A 4A3VB 4MGZE 1HQCA 2CEAA 5FTMA 3MVDB 4QLCD 2G8LA 3GLFA 5B32C 3B7QA 2HUEB 1DGHB 2HIOC 1M18C 3EG5B 1IM2A 3MGRA 2DZLA 1GL6A 5FTKA 1M19B 4FWDA 4X64M 4Z5TD 1P3BC 5FTNA 4GIPA 3CF2A 1UFZA 4JI7M 3C1BC 3W96A 3QAUA 2BG1A 4NOOB 3MGPD 1M1AC 3QYEA 1NJFA 2CHQA 2JY7A 3R45A 5AV6C 3CGWA 4KUDA 4WV4B 2L4EA 4RF1A 5JA4A 2C98A 4MGKE 1TH3A 4OU7A 3LZ1A 5BO0B 3K92A 1E32A 3KOWE 5AVBD 3AZLA 3HHYA 2KZUA 4ZUXB 4LF7M 2OQ4A 3F6TA 1P3OA 3RELD 4LFCM 2VF8A 3X1UA 1R2YA 4LD9D 1HQ3D 1P3AB 3LZ0C 1QAMA 1N36M 3B6GD 1ZMVA 1T3TA 4B08A 1D2NA 3VLFB 3FRIA 3RGSA 5G49A 3J81S 4NC6A 4H9SA 3M7GA 4X65M 2N35A 4LY6A 3A6NC 3AZIC 3NQJB 4LF6M 1Q02A 4JI3M 1GKIA 4UN2B 5ITXE 1Z2CB 1KX4B 3UZUA 2I7PA 2DHRA 4NE5A 3KP1E 5AY8C 1ID3A 4MM3B 3H0LC 4BLCA 1N78A 2VQEM 4Z66C 3FUUA 4Z2MG 3AFAC 3B6FD 3AFHA 1JFIA 4DV4M 5BT1D 4MGHA 2DWZB 3U6QA 3Q8GA 4KODA 5ITTA 3X1VA 4KT0F 5AV9D 3W98A 4AWLC 3SHFA 1WGNA 4HLQA 2LH0A 1XNQM 2HCBA 3REKD 2FJ7B 3WTPC 2EKKA 5GSUB 1IN8A 2C9CA 3T15A 3GLIA 1X37A 1DO2A 2K9DA 3VH6T 3HX3A 2DAKA 3O62C 2YNMD 4E44A 3WA9B 3MVDD 4J8UB 5AV8A 5B32A 2IO5B 3IP4C 3GLGE
chains in the Genus database with same CATH topology
2JCHA 2Q2EB 4LJ9A 3B0DC 1M18A 3HHXA 3T1HM 3K1JA 1M19D 4D80A 2CV2A 2PYOC 5ITXA 5CPJC 3C1BA 2RIQA 1AOIB 1L2CA 1M1AA 1OFIA 2CV1A 5GXQA 4CAYB 4X23B 1YE9A 5AV6A 3W97B 4P16A 3R8FA 4KHAA 5F99B 1NVMA 5KO3A 3X1TB 2ZY4A 5B2IB 4GITA 1P3PD 5DNNC 3WKJD 3AYWB 3SMPA 3SASA 3AZKC 1N75A 5CPKB 4BBAA 4WJ3C 4UUZA 4HGAC 4JI5M 1TGUA 3WTPE 1P3LA 3AV2A 1WWSA 1P3AD 3LZ0A 4MGIE 1I4WA 4ITQA 3TU4B 4AW4A 3GLGA 4FW9A 2QBYA 2AROC 1W2EA 4Z2MH 4J8VC 4K0KM 4M9ZA 4XZQC 4D81A 4J8WB 4GC5A 3LJAA 2R4JA 1S32B 3AZIA 1TAFA 4ZBJB 2QP9X 3AZNB 1FJGM 1KX4D 2VQRA 2BYMA 5KDMB 3AZHD 5AV5B 5AY8A 1Q9CA 4IBDA 3AL0C 5ITRA 4Z66A 3AFAA 4LJAA 3GQ4A 2XZUA 4G6ZA 4YS3B 2D7EA 1HQYE 5GXQD 5C3IB 3OTOM 3W0FA 3FUWA 2J7OA 1J5EM 2F2AC 4DV7M 2FJ7D 2XEPA 3WTPA 4WU8B 2DWLA 3AZEC 5JRGA 2R46A 1KX3B 4AKHA 1U35C 4LJ8A 5LMUM 5E5AD 3WA9D 3O62A 4J8UD 3A46A 3LQRA 4H9OA 4QLCC 2Y21A 3FD9A 1P3LD 4M0WA 2YQZA 1HNZM 1R4VA 2CE7A 4AKIA 2L7IA 3GRVA 3L28A 4KGCC 3KSYA 4H9PA 3VKGA 5CPJA 4L78A 4L16A 2ZAOA 5B0YA 1AOID 3AKZA 3MGPC 3HJQA 4H9QA 4X23D 4DV0M 2QENA 3REIB 4G4NA 5BNVB 5F99D 4L15A 1ZQ9A 2UUAM 2RGOA 3X1TD 5B2ID 2X8AA 2Y2OA 3GLHA 4FD2A 3FUVA 4LCBA 2XF3A 1SXJD 2D7GA 5DNNA 3AYWD 2YFVA 3KW6A 3HU2A 5CPKD 3AZKA 1QQWA 5AVBC 2CV5A 1K3XA 1ZLAC 3L26A 1NHWC 2DWNA 1N34M 4WU9D 3NBIA 5B31B 4LD9C 4NE6A 3REHC 4OVZA 1P3FC 1L2DA 1HQ3C 5B40B 4YY3M 4OW0A 4GC9A 5FSWA 3B6GC 4J8VA 1TH2A 4G4QA 3SYKA 1YUBA 5JI3E 3MJ5A 1K3WA 4R7GA 1DGGA 1S32D 3X1SB 1T3UA 2EO2A 1P34D 5BS7A 3AV1B 3WAAD 2X4AA 3A1KA 4KHPM 3NQUA 3AZND 2XSZD 3M0EA 5AV5D 1G59A 3MGRC 3PFIA 4W5WA 4B3RM 4FWGA 2YR0A 4JJND 1JR3D 1BH8A 3CTWB 3W96C 4YS3D 5BT1C 2XLJA 4LF9M 5AV9C 4IBEA 4DQYB 5IWAM 3KWQA 3SYLA 2D7HA 3REKC 3FUXA 2XFSA 4WU8D 1C1KA 4NXNM 3U6LA 3AZEA 4DV5M 3LVWA 4NRVA 2RVQD 4G92C 1U35A 2XGNA 3AZGB 4LJ7A 4DV6M 5DNMB 4B7FA 1GL7A 5B1MD 4E45A 4QOZC 2LY8A 3KXEC 4QLCA 5B33B 2HUEC 3UTAA 4GKJM 3KP0E 3VH5A 2F8NB 1N77A 4LFBM 4Z5TA 4WNNA 3MGPA 4LZZA 4JI0M 3U6OA 2ERCA 3REID 1P3IB 5B0ZB 3EIHA 3TL4X 1MU5A 3GPXA 1BH9A 2XD5A 3WHKA 3V9RA 3AZMB 1P3PC 2UUCM 1TDZA 4LZJA 3WKJC 3H0MC 3PXGA 5AVBA 3GRYA 1KX5B 3X1VC 3RELA 2LXEA 3EPLA 5B31D 4LD9A 1IBLM 1P3KD 1HQ3A 4TUWA 4DR7M 3B6GA 3NWLA 2ZBKB 3KXBB 4AI6A 4IBFA 4G4OA 2H1RA 3X1SD 4DR6M 4R8PB 4QOSA 3AV1D 3H0RC 1N33M 5C18A 4CSRA 5AV8C 4FCWA 2G5GX 2F5SA 3UTAD 3C58A 1ORYB 5EP4A 4LF8M 4KUDB 1ULYA 1F66B 1KX4C 3SMSA 3FTEA 4M9SA 3AZHC 2YFWB 3C1CB 2J7NA 1XXHB 4IBKA 3AZLB 3B6FA 2O5RA 2LNHC 5AV9A 5GT0B 5GXQC 1KFVA 3SBJA 2XD1A 3X1UB 1DO0A 3U61B 3TWKA 3UJNA 4EO5B 5DNYA 1G8PA 3GQ3A 3REKA 2M60A 4YM6B 3AZGD 1TZYB 4G91C 5E5AC 3WA9C 3M6AA 4J8UC 3MVDA 5B33D 3ZCBB 1DGHA 2F8ND 3J27B 1P3LC 4WURA 4DUYM 3AV2C 3VH5T 2KZSA 2HL7A 5B2JB 1M19A 5CP6B 2Z7JA 3EPKA 5CPIB 5FLXS 1JFIB 4FWHA 5BNXB 4B3MM 2FFFB 4X23C 3LJAC 4PCZA 1P3ID 3W99B 5B24B 5B0ZD 5F99C 4XGIA 3X1TC 5B2IC 3PNVA 4DUZM 2JE5A 5C1BA 4JI2M 3DA1A 1SXJC 1L2BA 3AZMD 2UUBM 3MGQD 1P3MB 1P3PA 3U6DA 5BO0A 3WKJA 4II7A 2DWMA 5CPKC 3AZJB 4ZUXA 2Y2NA 1DGBA 1KX5D 2NQBD 3UK6A 2Y2KA 2HIOB 4WU9C 2R18A 1P3AA 1P3BB 4NXMM 3KXBD 3KUYB 3JR4A 5JRGC 4J8XB 3TE6A 4R8PD 1XNRM 1S32C 3NQJA 1P34C 3SARA 2UXBM 3WAAC 1NNUC 4DV2M 4I5SA 3AZNC 1F66D 1KX4A 1EQZB 2UWXA 5AV5C 3AZHA 1L8QA 3C1CD 3VK8A 3U6PA 5EXPA 1P3GB 4JJNC 3KSJA 1MX0A 5B0YC 4LGYA 1NSFA 3GRUA 3REJB 3KVWA 4JYAM 1SXJE 3B0CT 2ZY3A 3TWMA 4YM6D 2FJ7A 3L2AA 1QAOA 3SHGB 3QWLA 2HHHM 5GSUA 4WU8C 2HKJA 3AOGA 2QBYB 2R45A 1PJIA 1TZYD 2RVQC 1H3OB 3P5JB 2F8NK 3W0LB 3A6NB 4KLNA 5E5AA 3WA9A 3TWLA 4J8UA 2ZAMA 5H37D 5B1MC 2X49A 4ZUXD 2CV5C 5DYIA 3AZFB 5B2JD 1Q3BA 4IBGA 5CPID 3AFAB 3ZH9B 1AOIA 3GRRA 4X23A 4AWLB 3HWSA 3W99D 5BS7C 5B24D 3REIC 5F99A 3X1TA 5B2IA 3I51A 4FCVA 4X62M 4AKGA 3ILKA 3J2PB 5KQ8A 1IN7A 5EP1A 4RNAA 4PDGA 3U6SA 4WZSB 1SXJA 5EQTA 1P3MD 4YHHM 1F1EA 5FUGB 3U6MA 3AYWA 3JR5A 3AZJD 5CPKA 4DRAA 1I94M 2BJWA 5ITYA 2HIOD 3B0DB 4WU9A 3B0BA 3AOEA 4M0DA 5B31C 3KWQC 4CHTB 2BJVA 1P3KC 2DQNC 2PYOB 1P3BD 3E9SA 5GSUD 1W5TA 3TPZA 2V6ZM 4IJEA 3KUYD 1HR0M 4NFTA 4J8XD 3FTCA 4J8WA 2DXIA 1S32A 5CHLB 1P34A 3RGPA 3WAAA 1IY2A 3ZC7B 3UTAC 2C9OA 4JI6M 2Y2QA 3AZNA 4CISA 1EQZD 1IBMM 4H9NB 1KSFX 2XSZA 4LRSA 4REZA 5AV5A 3MNNB 3LELB 3VH5W 2M5ZA 1P3GD 4Z5TC 2L09A 4JJNA 1JR3A 2EUCA 3AJIB 5F3WA 4YS3A 1Z5CA 4HGAB 3REJD 1IN4A 1Z5BA 1WWIA 4LF5M 4LJ5A 3KOXE 3W97D 4OVZB 1G41A 5GT3B 3MGSB 4WU8A 2AROB 2V1CA 4AG6A 5IZ7D 1N1JB 2BYKB 3MHVC 3HGIA 4XZQB 3LMMA 4JN6A 4XUJB 5B1MA 5AVCB 5B33C 1H6UA 2Y0TA 4OX9M 3AZFD 3RELC 4MH0E 1QYRA 3TU4D 1BH8B 3IG8A 2QPAA 3L29A 3FTDA 3I4YA 3D8LA 1XMOM 4J8WD 4NE3A 2L5AA 3L25A 2ZY5A 3REIA 5BNVA 2KEBA 4GH9A 1P3IC 5B0ZC 3UGJA 2NZDB 3AN2B 4ZPXA 3AZMC 1GLNA 3MGQC 5EP3A 3B6FC 2NQBC 1IY0A 1HNXM 2R62A 4R3DA 5B31A 5EXSA 2PYOD 1P3KA 3FYDA 5B40A 3B0CW 4KGCB 2G5IC 1KX3D 1QANA 3GPYA 1YSYA 1TH4A 1NY5A 2Y2MA 1LV7A 3X1SA 5JI2E 4PT5A 3HKPA 3AV1A 3MVDC 4LG2A 1HTAA 3UT9B 2L7HA 1F66C 1PZRA 1E94E 3MNND 3LELD 3C1CC 2QCUA 1M19C 1IN6A 5B1LB 3T1YM 3U5ZB 5EXTA 3VK7A 3VDPA 3RE8A 1R2ZA 3EPJA 2ZANA 1ZLAB 4LJ6A 3U60B 2Y2JA 3UTBB 4L8RC 4H9RB 1XC8A 3REHB 1P3FB 2RKOA 1S3SA 5GT3D 4MB7A 3MGSD 2AROD 3FTFA 2CHGA 4QHTA 2JSSA 1E9SA 1EE8A 4XZQD 3SATA 1TZYC 3HU1A 3AZGA 1IXSB 4PDIA 4XUJD 3GO8A 3VKHA 1B6WA 2I7NA 1G4AE 3R9XB 5AVCD 4ZUXC 5B33A 3GLFB 5BR8M 2F5QA 4CGYB 2F8NA 2KRUA 3MGRB 1P3AC 5B40D 1R6BX 5CPIC 4G4RA 3W96B 3FYCA 3GP1A 3A42A 5E6JA 3T38A 3A45A 4NSRA 3W99C 5B24C 1P3IA 3R45B 4FCTA 5B0ZA 4JI4M 2R4EA 3REKB 2NZDD 3AN2D 5JA4B 3K2LA 4DR2M 3VH6A 3DZDA 3AZMA 1P3MC 1Q39A 3MGQA 3LZ1B 2J8PA 2CUZA 3AZJC 5KPRA 5KQDA 1KX5A 2NQBA 1P3OB 2QZ4A 2KXEA 1HNWM 4DV1M 1IBKM 1QAQA 4HL4A 4KGCD 2FJ7C 3KS8A 5GSUC 1NHGC 3KXBA 3KUYC 4LJ4A 5G49B 4IBIA 4J8XC 2DZOB 5DNMD 3I4VA 4R8PA 2K47A 1OJLA 4IBCA 2IO5C 3UT9D 3D8BA 2ZM6M 2E5LM 1F66A 1EQZC 2CHVA 2YFWA 3C1CA 1ID3B 5B1LD 1UM8A 1P3PB 1XXHA 1P3GC 4B7HA 4JV5M 5EJCA 3WKJB 3HJSA 1ZLAD 1AOIC 3X1VB 5GT0A 3REJC 3W98B 3UTBD 4GMQA 3U61A 3GPUA 3REHD 1P3FD 3W97C 4JI8M 1XWIA 4YM6A 3AV0A 4WW0A 4XBOA 4EIWA 3GLIB 4LRTA 1TZYA 5E26A 2CWEA 3AYWC 2C96A 1J09A 1Z6TA 3KOZE 2ZY2A 5AV8B 1Q3CA 5B32B 1NY6A 4QNRA 2DF4C 3AZFC 1M18B 3MGRD 3AOEC 3U6CA 3AZHB 5B2JA 4IBBA 5CP6A 2A5YB 2RGHA 3TU4C 1WXQA 5CPIA 4I4LA 3W96D 3C1BB 2Y0QA 3SC3A 5BNXA 3EIEA 4NL4H 4AG5A 1M1AB 5GXQB 4J8WC 3W99A 5B24A 2Y2GA 5AV6B 2XZFA 4KHAB 4ZBJC 2FE8A 4KUDD 1PJJA 5DYGA 4I81A 5GKNA 1P3MA 3LZ1D 4G91B 5B31G 5E5AB 3PVSA 3AZLD 3AZJA 3EPHA 2KA6B 1P3OD 4YS3C 1HT1E 4UUZB 5GT0D 1L1TA 2HIOA 1P3LB 4NRWA 2DVWB 3X1UD 3AV2B 5C3IC 2ZM5A 1JQJC 3HHWA 3LZ0B 1P3BA 2F5NA 3GLGB 3KUYA 4BB9A 1KX3C 7CATA 2YFQA 1GVNA 4J8XA 4S12A 3LJAB 4QNMA 3AZIB 5ITUA 4DR5M 1TAFB 4QHSA 4GHLA 2BNKA 4UPKA 1EQZA 2FNAA 2BYMB 2XH9A 3MNNC 4Z6YA 1SXJB 3LELC 1ID3D 5AY8B 5CP6D 3U6EA 1IN5A 3FKEA 1P3GA 4Z66B 2Y2IA 1BFMA 2CFOA 3X1VD 3FUTA 3W98D 3REJA 3Q8XA 4CAYA 4WU9B 5A2QS 2VIIA 4PD2A 3W97A 3BOSA 4GKKM 5LMNM 5GT3C 1K82A 3UMMA 3MGSC 3WTPB 1XHBA 4GRIA 5FTJA 5JRGB 2F8NG 3SAWA 1H3OA 1DGFA 3A6NA 2EA0A 3O62B 5FTLA 4XUJC 3HJ8A 4DR4M 1P34B 5AV8D 3CF0A 3WAAB 5B32D 5BPVA 5AVCC 4H9OB 1KU5A 3AZFA 1M18D 3GPPA 2C99A 3VFDA 3A98B 5B40C 2FOIC 1L1ZA 3LQQA 3TU4A 4JJNB 4H9PB 1N32M 3C1BD 5CPJB 4M9XA 3CF6E 4X66M 2Y2HA 5B0YB 1M1AD 2V1UA 3JAMS 2CV0A 4H9QB 3X1SC 3AV1C 5AV6D 2C5RA 1IY1A 4DV3M 2NZDC 3AN2C 3GLHB 5KDMA 5FUGA 5DNNB 2YFVB 4Z8XA 3AZKB 5B1MB 2CV5B 1A7WA 2VQFM 2W8SA 5EP2A 3AV2D 1J7KA 3LZ0D 2PYOA 2Y2PA 1IXZA 3VDUA 2JA2A 1KX3A 4J8VB 4IBJA 2P5TA 1B67A 3AZGC 3LJAD 3A6ND 5DNMC 3AZID 3KSXA 2KRKA 3HHZA 2R65A 1TDHA 3NQUB 3UT9C 5KPTA 2W82A 4H9NA 3MNNA 4GHAA 5AY8D 3LELA 2UU9M 2F8NH 5B1LC 8CATA 4Z66D 4IIWA 3SAVA 1W5SA 3AFAD 4LF4M 1IXRC 2UXDM 3UTBC 3KWQB 2OPFA 1P3KB 5GT3A 3B9PA 3THGA 3WTPD 3MGSA 3E4RA 1KYIA 2AROA 5JRGD 3AZEB 1N1JA 2BYKA 3GQ5A 1U35B 4DR1M 4XZQA 2Y20A 2Z4RA 4I8OA 3O62D 3H4MA 3VH6W 4XUJA 2DZNB 2Z3XA 2AHMA 1G3IA 3KDSE 5AVCA 4QLCB 1KX5C 3UTAB 3MK6A 1PM5A 1ZAEA 2FFJA 5KPZA 4FVMA 1Z59A 1VDDA 5EXXA 4Z5TB 4WNNB 5CPJD 2F5PA 1E9RA 3KXBC 4RF0A 5B0YD 1IQPA 3MGPB 1QZMA 1R7RA 5IT9S 4R8PC 1QVRA 1Z5AA 1NJGA 2NZDA 3AN2A 4KUDC 5B32G 1BH9B 3FDDA 3J7BA 3V9RB 3RFWA 3J7AS 2F5OA 5DNND 4NSOB 4B7GA 1HT2E 3LZ1C 3AZKD 3KOYE 4JI1M 3AZLC 2CV5D 2F4VM 5AVBB 1P3OC 3K8ZA 3RELB 5GT0C 2Z4SA 3DFZA 1NNJA 4LFAM 3X1UC 4LD9B 4EO5C 3A1IA 1HQ3B 4KGCA 4YM6C 2NQ8C 4KO8A 3B6GB 4D82A 4B3TM 4IJFA 4J8VD 3DOAA 3SAUA 4H9SC 4AQYM 4DR3M 5DNMA 3HU3A 3KS4A 4M6BA 4CSRB 3TQSA 3UT9A 3IG5A 1OFHA 4B3SM 4DRBA 2L6OA 4AZFA 2G5HC 1FNNA 5ITQA 3J80S 5B2JC 1ID3C 2LWXA 2XFTA 5CP6C 5B1LA 3U5ZA 3MGQB 4L4UA 2KW0A 3PNYA 4MGYE 1ZLAA 3B6FB 2Y2LA 2NQBB 2UXCM 3W98C 3U60A 5AV9B 3UTBA 4JXJA 4LGMA 3KWQD 3KFUG 4H9RA 3REHA 1P3FA 1XMQM 3LVVA 3SFZA 3WHLA 3AZED 4G92B 1U35D 5IREB 3L27A 4A3VB 4MGZE 1HQCA 2CEAA 5FTMA 3MVDB 4QLCD 2G8LA 3GLFA 5B32C 2HUEB 1DGHB 2HIOC 1M18C 3EG5B 1IM2A 3MGRA 1GL6A 5FTKA 1M19B 4FWDA 4X64M 4Z5TD 1P3BC 5FTNA 4GIPA 3CF2A 4JI7M 3C1BC 3W96A 3QAUA 2BG1A 4NOOB 3MGPD 1M1AC 1NJFA 2CHQA 3R45A 5AV6C 4KUDA 4WV4B 4RF1A 5JA4A 2C98A 4MGKE 1TH3A 4OU7A 3LZ1A 5BO0B 3K92A 1E32A 3KOWE 5AVBD 3AZLA 3HHYA 2KZUA 4ZUXB 4LF7M 2OQ4A 3F6TA 1P3OA 3RELD 4LFCM 3X1UA 1R2YA 4LD9D 1HQ3D 1P3AB 3LZ0C 1QAMA 1N36M 3B6GD 1T3TA 4B08A 1D2NA 3VLFB 3RGSA 5G49A 3J81S 4H9SA 3M7GA 4X65M 4LY6A 3A6NC 3AZIC 3NQJB 4LF6M 4JI3M 1GKIA 5ITXE 1Z2CB 1KX4B 3UZUA 2I7PA 2DHRA 4NE5A 3KP1E 5AY8C 1ID3A 4MM3B 3H0LC 4BLCA 1N78A 2VQEM 4Z66C 3FUUA 4Z2MG 3AFAC 3B6FD 3AFHA 1JFIA 4DV4M 5BT1D 4MGHA 2DWZB 3U6QA 4KODA 5ITTA 3X1VA 5AV9D 3W98A 4AWLC 3SHFA 4HLQA 2LH0A 1XNQM 2HCBA 3REKD 2FJ7B 3WTPC 5GSUB 1IN8A 2C9CA 3T15A 3GLIA 1X37A 1DO2A 3VH6T 3O62C 2YNMD 4E44A 3WA9B 3MVDD 4J8UB 5AV8A 5B32A 2IO5B 3IP4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL0 C;  2F2A C;  3H0M C;  2DQN C;  2G5I C;  3H0L C;  4WJ3 C;  2G5H C;  2DF4 C;  3A1I A;  3H0R C;  3IP4 C;  3A1K A;  3KFU G; 
#chains in the Genus database with same CATH topology
 2JCH A;  2Q2E B;  4LJ9 A;  3B0D C;  1M18 A;  1DV0 A;  3HHX A;  3T1H M;  3K1J A;  1M19 D;  4D80 A;  2CV2 A;  2PYO C;  5ITX A;  5CPJ C;  3C1B A;  3B7N A;  2RIQ A;  1AOI B;  1L2C A;  1M1A A;  1OFI A;  2CV1 A;  5GXQ A;  4CAY B;  4X23 B;  1YE9 A;  5AV6 A;  3W97 B;  2JY8 A;  4P16 A;  3R8F A;  4KHA A;  5F99 B;  1NVM A;  5KO3 A;  3X1T B;  2ZY4 A;  5B2I B;  4GIT A;  4P17 A;  1P3P D;  5DNN C;  3WKJ D;  3AYW B;  3SMP A;  3SAS A;  3AZK C;  1N75 A;  5CPK B;  4BBA A;  4WJ3 C;  4UUZ A;  4HGA C;  4JI5 M;  1TGU A;  2JY6 B;  3WTP E;  1P3L A;  3AV2 A;  1WWS A;  1P3A D;  3LZ0 A;  4MGI E;  1I4W A;  4ITQ A;  3TU4 B;  4AW4 A;  3GLG A;  4FW9 A;  2QBY A;  2ARO C;  2DAI A;  2ZTC A;  1W2E A;  4Z2M H;  4J8V C;  4K0K M;  2DAG A;  4M9Z A;  4XZQ C;  4D81 A;  4J8W B;  4GC5 A;  3LJA A;  2R4J A;  1S32 B;  3AZI A;  1TAF A;  2H5X A;  2KNZ A;  4ZBJ B;  2QP9 X;  1JB0 F;  3AZN B;  1FJG M;  1KX4 D;  2VQR A;  2BYM A;  3T6P A;  5KDM B;  3AZH D;  5AV5 B;  5AY8 A;  1Q9C A;  4IBD A;  3AL0 C;  1GJT A;  5ITR A;  4Z66 A;  3AFA A;  4LJA A;  3GQ4 A;  2XZU A;  4G6Z A;  4YS3 B;  2D7E A;  1HQY E;  5GXQ D;  5C3I B;  3OTO M;  3W0F A;  3FUW A;  2J7O A;  1J5E M;  2F2A C;  4DV7 M;  2FJ7 D;  2XEP A;  3WTP A;  3ZQJ A;  4WU8 B;  2DWL A;  3AZE C;  5JRG A;  2R46 A;  1KX3 B;  4AKH A;  1U35 C;  4LJ8 A;  2GQF A;  5LMU M;  5E5A D;  3WA9 D;  3O62 A;  4J8U D;  3A46 A;  3LQR A;  4H9O A;  4QLC C;  2Y21 A;  3FD9 A;  1P3L D;  1OKS A;  4M0W A;  2YQZ A;  1HNZ M;  1R4V A;  2CE7 A;  4AKI A;  2L7I A;  3GRV A;  3L28 A;  4KGC C;  3KSY A;  4H9P A;  3VKG A;  5CPJ A;  1VEJ A;  4L78 A;  4L16 A;  2ZAO A;  5B0Y A;  1AOI D;  3AKZ A;  3MGP C;  3HJQ A;  4H9Q A;  4X23 D;  4DV0 M;  1G71 A;  2QEN A;  3REI B;  4G4N A;  5BNV B;  5F99 D;  4L15 A;  1ZQ9 A;  2UUA M;  2RGO A;  3X1T D;  5B2I D;  2X8A A;  2Y2O A;  3GLH A;  4FD2 A;  1ZV1 A;  3FUV A;  4LCB A;  2XF3 A;  1SXJ D;  2D7G A;  5DNN A;  3AYW D;  2YFV A;  3KW6 A;  3HU2 A;  5CPK D;  3AZK A;  2BWE A;  1QQW A;  5AVB C;  2CV5 A;  1K3X A;  1ZLA C;  2CWB A;  1MN3 A;  3L26 A;  2DWN A;  1NHW C;  1N34 M;  4WU9 D;  3NBI A;  4F2L A;  1D0K A;  5B31 B;  4LD9 C;  4NE6 A;  3REH C;  4OVZ A;  1P3F C;  1L2D A;  1HQ3 C;  5B40 B;  2LHC A;  4YY3 M;  4OW0 A;  4GC9 A;  5FSW A;  3HZJ A;  3B6G C;  4J8V A;  1XB2 B;  1TH2 A;  4G4Q A;  2WSC F;  3SYK A;  2K6B A;  1YUB A;  5JI3 E;  3MJ5 A;  1K3W A;  4R7G A;  1DGG A;  1S32 D;  3X1S B;  1WIV A;  1T3U A;  2EO2 A;  1P34 D;  5BS7 A;  3AV1 B;  3WAA D;  2X4A A;  3A1K A;  4KHP M;  3NQU A;  3AZN D;  2XSZ D;  2DKL A;  3M0E A;  5AV5 D;  1G59 A;  3MGR C;  3PFI A;  4W5W A;  4B3R M;  4FWG A;  2YR0 A;  4JJN D;  1JR3 D;  1BH8 A;  3CTW B;  3W96 C;  4YS3 D;  5BT1 C;  2XLJ A;  4LF9 M;  5AV9 C;  4IBE A;  4DQY B;  2QQ8 A;  5IWA M;  3KWQ A;  3SYL A;  4RKU F;  2D7H A;  3REK C;  1NV8 A;  3FUX A;  2XFS A;  4WU8 D;  1TR8 A;  1C1K A;  4NXN M;  3U6L A;  3AZE A;  1R5L A;  4DV5 M;  3LVW A;  4NRV A;  2RVQ D;  4G92 C;  1U35 A;  2XGN A;  3AZG B;  4LJ7 A;  4DV6 M;  5DNM B;  4B7F A;  1GL7 A;  5B1M D;  4E45 A;  4QOZ C;  2LY8 A;  3KXE C;  4QLC A;  5B33 B;  2HUE C;  3UTA A;  4GKJ M;  3KP0 E;  3VH5 A;  2F8N B;  1TTE A;  1N77 A;  1PGY A;  1T6O A;  3C9P A;  4Z5T A;  4LFB M;  2HAK A;  4WNN A;  2JXN A;  3GLF E;  3MGP A;  2G3Q A;  4LZZ A;  4JI0 M;  3U6O A;  2ERC A;  3REI D;  1P3I B;  4G3O A;  5B0Z B;  3EIH A;  3TL4 X;  1MU5 A;  2QSF X;  3GPX A;  3H4J A;  1BH9 A;  2XD5 A;  3WHK A;  3V9R A;  3AZM B;  1P3P C;  2UUC M;  1TDZ A;  4LZJ A;  3WKJ C;  3H0M C;  3PXG A;  5AVB A;  3GRY A;  1KX5 B;  3X1V C;  3REL A;  2LXE A;  3EPL A;  5B31 D;  4LD9 A;  4GEW A;  1IBL M;  1OAI A;  1P3K D;  1HQ3 A;  4TUW A;  2CRU A;  4DR7 M;  3B6G A;  3NWL A;  2ZBK B;  3KXB B;  4AI6 A;  4IBF A;  4G4O A;  2H1R A;  1IXS A;  3X1S D;  4DR6 M;  4R8P B;  2RRU A;  4QOS A;  3AV1 D;  3H0R C;  1N33 M;  5C18 A;  2LBC A;  4CSR A;  5AV8 C;  4FCW A;  2G5G X;  2F5S A;  3UTA D;  3C58 A;  2LVO C;  1ORY B;  5EP4 A;  4LF8 M;  4KUD B;  1ULY A;  1F66 B;  1PRB A;  1KX4 C;  3SMS A;  3FTE A;  2KHH A;  4M9S A;  3AZH C;  3LCU A;  2YFW B;  3C1C B;  2J7N A;  1XXH B;  1NO1 A;  4IBK A;  3AZL B;  3QYB A;  3B6F A;  4DBG B;  2O5R A;  2LVQ D;  2LNH C;  5AV9 A;  5GT0 B;  5GXQ C;  1KFV A;  3SBJ A;  2XD1 A;  3X1U B;  1DO0 A;  1LTM A;  3U61 B;  2WSF F;  3TWK A;  3UJN A;  4EO5 B;  5DNY A;  1G8P A;  3GQ3 A;  3REK A;  2M60 A;  4YM6 B;  3AZG D;  1TZY B;  4G91 C;  5E5A C;  3WA9 C;  3M6A A;  3MVD A;  4J8U C;  5B33 D;  3ZCB B;  1DGH A;  2F8N D;  3J27 B;  1P3L C;  4WUR A;  4DUY M;  3AV2 C;  3VH5 T;  3GLI E;  2KZS A;  2HL7 A;  5B2J B;  1M19 A;  1T43 A;  5CP6 B;  1R4G A;  2Z7J A;  2JZ0 A;  2JP7 A;  3EPK A;  5CPI B;  5FLX S;  1JFI B;  4FWH A;  5BNX B;  4B3M M;  2FFF B;  4X23 C;  3LJA C;  4Y28 F;  1WR1 B;  4PCZ A;  3FRH A;  1P3I D;  3W99 B;  3MMP A;  5B24 B;  5B0Z D;  2JY5 A;  5F99 C;  4XGI A;  3X1T C;  2LVA A;  5B2I C;  3PNV A;  4DUZ M;  2JE5 A;  5C1B A;  4JI2 M;  3DA1 A;  1SXJ C;  4R71 A;  1L2B A;  3AZM D;  2UUB M;  3MGQ D;  1P3M B;  1P3P A;  2OO9 A;  3U6D A;  5BO0 A;  3WKJ A;  4II7 A;  2DWM A;  5CPK C;  3AZJ B;  2MJ5 B;  4ZUX A;  2Y2N A;  1DGB A;  1KX5 D;  2NQB D;  2DNA A;  2GNO A;  3UK6 A;  2Y2K A;  2HIO B;  2WZJ A;  4WU9 C;  2R18 A;  1QDR A;  1P3A A;  1EFU B;  2DHY A;  1P3B B;  1VDL A;  1OIZ A;  4NXM M;  3KXB D;  3KUY B;  3JR4 A;  5JRG C;  4J8X B;  3TE6 A;  4R8P D;  1XNR M;  1S32 C;  2Z8Y M;  3NQJ A;  1P34 C;  3SAR A;  2UXB M;  1P3Q Q;  3WAA C;  1NNU C;  4DV2 M;  4I5S A;  3AZN C;  1F66 D;  1KX4 A;  1EQZ B;  2UWX A;  5AV5 C;  3AZH A;  1L8Q A;  3C1C D;  3VK8 A;  3U6P A;  5EXP A;  1P3G B;  4JJN C;  3KSJ A;  2EKF A;  1MX0 A;  5B0Y C;  4LGY A;  1NSF A;  3GRU A;  3REJ B;  3KVW A;  4JYA M;  1SXJ E;  3B0C T;  2ZY3 A;  3TWM A;  4YM6 D;  2FJ7 A;  2OOA A;  3L2A A;  1QAO A;  3SHG B;  3QWL A;  2HHH M;  5GSU A;  4WU8 C;  2HKJ A;  3AOG A;  2QBY B;  2R45 A;  1PJI A;  1TZY D;  2RVQ C;  1TF0 B;  1H3O B;  3P5J B;  2F8N K;  3W0L B;  3A6N B;  4KLN A;  5E5A A;  3WA9 A;  3TWL A;  4J8U A;  2ZAM A;  5H37 D;  5B1M C;  2X49 A;  4ZUX D;  2CV5 C;  5DYI A;  3AZF B;  1D0L A;  5B2J D;  2O25 A;  1Q3B A;  4IBG A;  5CPI D;  3AFA B;  3ZH9 B;  1AOI A;  3GRR A;  4X23 A;  4AWL B;  3HWS A;  3W99 D;  5BS7 C;  5B24 D;  3REI C;  5F99 A;  3X1T A;  5B2I A;  3I51 A;  4FCV A;  4X62 M;  4AKG A;  3ILK A;  1C7Y A;  3J2P B;  5KQ8 A;  1IN7 A;  5EP1 A;  4RNA A;  4PDG A;  3U6S A;  4WZS B;  1SXJ A;  5EQT A;  3W68 A;  1P3M D;  4YHH M;  1F1E A;  5FUG B;  3U6M A;  3AYW A;  3JR5 A;  3AZJ D;  5CPK A;  4DRA A;  1NV9 A;  1I94 M;  2BJW A;  5ITY A;  2HIO D;  3B0D B;  3GLH E;  4WU9 A;  3B0B A;  3AOE A;  2APL A;  4M0D A;  5B31 C;  3KWQ C;  4CHT B;  2BJV A;  1P3K C;  1OIP A;  2DQN C;  2PYO B;  1P3B D;  2LVN C;  3E9S A;  5GSU D;  1W5T A;  3TPZ A;  2V6Z M;  4IJE A;  3KUY D;  1HR0 M;  4NFT A;  4J8X D;  3FTC A;  1AIP C;  3LW5 F;  4J8W A;  2DXI A;  1S32 A;  5CHL B;  1P34 A;  1GJS A;  3RGP A;  3WAA A;  1BVS A;  1IY2 A;  3ZC7 B;  3UTA C;  2C9O A;  4JI6 M;  2Y2Q A;  3AZN A;  4CIS A;  1EQZ D;  1IBM M;  4H9N B;  1KSF X;  2XSZ A;  1CUK A;  4LRS A;  4REZ A;  5AV5 A;  3MNN B;  3LEL B;  3VH5 W;  2M5Z A;  1P3G D;  4Z5T C;  2L09 A;  4JJN A;  1JR3 A;  2EUC A;  3AJI B;  5F3W A;  4YS3 A;  1Z5C A;  4HGA B;  2LTU A;  3REJ D;  1IN4 A;  1Z5B A;  1WWI A;  1OTR A;  1VQ1 A;  2JUJ A;  4LF5 M;  4LJ5 A;  3KOX E;  3W97 D;  4OVZ B;  1G41 A;  5GT3 B;  1ZMU A;  3MGS B;  4WU8 A;  2ARO B;  2V1C A;  4AG6 A;  1HJP A;  5IZ7 D;  1N1J B;  2K0B X;  2BYK B;  3MHV C;  3HGI A;  4XZQ B;  3LMM A;  4JN6 A;  4XUJ B;  2R6F A;  5B1M A;  1VEK A;  5AVC B;  5B33 C;  1H6U A;  2Y0T A;  4OX9 M;  3AZF D;  3REL C;  4MH0 E;  3FE3 A;  1QYR A;  3TU4 D;  1WGL A;  1BH8 B;  3IG8 A;  2QPA A;  1V92 A;  3L29 A;  3FTD A;  2MRO B;  3NBX X;  1QUT A;  3B74 A;  3I4Y A;  3D8L A;  1XMO M;  4J8W D;  4NE3 A;  2L5A A;  3L25 A;  2ZY5 A;  2DAE A;  3BBZ A;  3REI A;  5BNV A;  2KEB A;  1EIJ A;  4GH9 A;  1P3I C;  5B0Z C;  3UGJ A;  2NZD B;  3AN2 B;  1VEG A;  4ZPX A;  3AZM C;  3B89 A;  1GLN A;  3MGQ C;  3F92 A;  5EP3 A;  3B6F C;  2NQB C;  1IY0 A;  1HNX M;  2R62 A;  5L8R F;  4R3D A;  5B31 A;  2R0I A;  5EXS A;  2PYO D;  1P3K A;  3FYD A;  2J5Y A;  5B40 A;  3B0C W;  4KGC B;  2G5I C;  2KDL A;  1KX3 D;  1QAN A;  3GPY A;  1YSY A;  1TH4 A;  1NY5 A;  2Y2M A;  1LV7 A;  3X1S A;  5JI2 E;  4PT5 A;  4XK8 F;  3HKP A;  3AV1 A;  3MVD C;  4LG2 A;  1HTA A;  1SG9 A;  3UT9 B;  3BXW A;  2L7H A;  1F66 C;  1PZR A;  1E94 E;  3MNN D;  1D0M A;  3LEL D;  3C1C C;  2QCU A;  1M19 C;  1IN6 A;  5B1L B;  3T1Y M;  3U5Z B;  5EXT A;  3VK7 A;  3VDP A;  3RE8 A;  1R2Z A;  3EPJ A;  2ZAN A;  1ZLA B;  4LJ6 A;  3U60 B;  2Y2J A;  3UTB B;  4L8R C;  3HY5 A;  4H9R B;  1XC8 A;  3REH B;  1P3F B;  2RKO A;  1S3S A;  2L4F A;  5GT3 D;  4MB7 A;  3MGS D;  2ARO D;  3FTF A;  2CHG A;  4QHT A;  2JSS A;  1E9S A;  1EE8 A;  4XZQ D;  3SAT A;  1TZY C;  1WJ7 A;  3HU1 A;  3AZG A;  1IXS B;  4PDI A;  4XUJ D;  4WP2 A;  3GO8 A;  3VKH A;  1B6W A;  2I7N A;  1G4A E;  3R9X B;  5AVC D;  4ZUX C;  5B33 A;  3GLF B;  5BR8 M;  2F5Q A;  4CGY B;  2F8N A;  2KRU A;  3MGR B;  3C3D A;  1VG5 A;  3I04 M;  1P3A C;  5B40 D;  1R6B X;  5CPI C;  4G4R A;  3W96 B;  3FYC A;  3GP1 A;  3A42 A;  3C3E A;  5E6J A;  3T38 A;  5DFL A;  3A45 A;  4NSR A;  3W99 C;  5B24 C;  1P3I A;  3R45 B;  4FCT A;  5B0Z A;  4JI4 M;  2R4E A;  3REK B;  2MR9 A;  2NZD D;  3AN2 D;  5JA4 B;  3V76 A;  3K2L A;  4DR2 M;  3VH6 A;  3DZD A;  3AZM A;  1P3M C;  1Q39 A;  3MGQ A;  3LZ1 B;  2J8P A;  2CUZ A;  3AZJ C;  5KPR A;  5KQD A;  2DAM A;  1KX5 A;  2NQB A;  1P3O B;  2QZ4 A;  2KXE A;  1HNW M;  4DV1 M;  1IBK M;  3IEC A;  1QAQ A;  4HL4 A;  4KGC D;  2FJ7 C;  3KS8 A;  1AUA A;  5GSU C;  4CIZ A;  1NHG C;  3KXB A;  3KUY C;  4LJ4 A;  5G49 B;  4IBI A;  4J8X C;  2DZO B;  5DNM D;  3I4V A;  4R8P A;  4Q7J A;  2K47 A;  1OJL A;  4IBC A;  2IO5 C;  3UT9 D;  3D8B A;  2ZM6 M;  2E5L M;  1F66 A;  1EQZ C;  2CHV A;  2YFW A;  3C1C A;  1ID3 B;  5B1L D;  1UM8 A;  1P3P B;  1XXH A;  1P3G C;  4B7H A;  4JV5 M;  5EJC A;  3WKJ B;  3HJS A;  1ZLA D;  1AOI C;  3X1V B;  2JNH A;  5GT0 A;  3REJ C;  3W98 B;  3UTB D;  4GMQ A;  3U61 A;  3GPU A;  3REH D;  1P3F D;  3W97 C;  4JI8 M;  1XWI A;  4YM6 A;  2L2D A;  3AV0 A;  4WW0 A;  4XBO A;  2CP8 A;  4EIW A;  3GLI B;  3E21 A;  1QDT A;  4LRT A;  1TZY A;  1MJG M;  5E26 A;  2CWE A;  2EJS A;  3AYW C;  2C96 A;  1J09 A;  1Z6T A;  3KOZ E;  2ZY2 A;  5AV8 B;  1Q3C A;  5B32 B;  1NY6 A;  4QNR A;  2DF4 C;  3AZF C;  2DI0 A;  3W67 A;  1M18 B;  3MGR D;  3AOE C;  3U6C A;  1A5T A;  2WSE F;  3AZH B;  5B2J A;  4IBB A;  5CP6 A;  2A5Y B;  2RGH A;  3TU4 C;  2MGW A;  1IFY A;  1WXQ A;  5CPI A;  2BWB A;  4I4L A;  3C1B B;  2Y0Q A;  3SC3 A;  3W96 D;  5BNX A;  3EIE A;  4NL4 H;  4AG5 A;  1M1A B;  5GXQ B;  4J8W C;  1PJS A;  1OAO C;  3W99 A;  5B24 A;  2Y2G A;  5AV6 B;  2XZF A;  4KHA B;  4ZBJ C;  2FE8 A;  4KUD D;  1PJJ A;  1PJQ A;  5DYG A;  4I81 A;  5GKN A;  1P3M A;  3LZ1 D;  4G91 B;  1WHC A;  5B31 G;  5E5A B;  3K9O A;  3PVS A;  3AZL D;  3AZJ A;  3EPH A;  2MH8 A;  2KA6 B;  1P3O D;  4YS3 C;  1HT1 E;  4UUZ B;  5GT0 D;  1L1T A;  2HIO A;  1P3L B;  4NRW A;  2DVW B;  3X1U D;  3AV2 B;  5C3I C;  2ZM5 A;  1JQJ C;  3HHW A;  3LZ0 B;  1P3B A;  2F5N A;  3GLG B;  3KUY A;  4BB9 A;  1KX3 C;  7CAT A;  2YFQ A;  1GVN A;  4J8X A;  4S12 A;  3LJA B;  4QNM A;  3AZI B;  5ITU A;  4DR5 M;  1TAF B;  3LCV B;  4QHS A;  2OOB A;  4GHL A;  2BNK A;  4UPK A;  1EQZ A;  2FNA A;  2BYM B;  2XH9 A;  3MNN C;  4F1I A;  4Z6Y A;  1SXJ B;  3LEL C;  1ID3 D;  5AY8 B;  5CP6 D;  3U6E A;  1IN5 A;  2QNJ A;  3FKE A;  1P3G A;  2R44 A;  4Z66 B;  2Y2I A;  1BFM A;  2CFO A;  3X1V D;  3FUT A;  3W98 D;  3REJ A;  3Q8X A;  4CAY A;  4WU9 B;  3K9P A;  5A2Q S;  2VII A;  2VDB B;  4PD2 A;  3W97 A;  3BOS A;  4GKK M;  5LMN M;  5GT3 C;  1K82 A;  3UMM A;  3MGS C;  3WTP B;  1JR3 E;  1XHB A;  4GRI A;  2FS1 A;  2LHG A;  5FTJ A;  2VF7 A;  5JRG B;  2F8N G;  3SAW A;  1H3O A;  1DGF A;  3A6N A;  2KNV A;  2EA0 A;  3O62 B;  5FTL A;  4XUJ C;  3HJ8 A;  4DR4 M;  1P34 B;  5AV8 D;  3CF0 A;  2DEN A;  3WAA B;  5B32 D;  5BPV A;  5AVC C;  4H9O B;  1KU5 A;  3AZF A;  1M18 D;  3GPP A;  2C99 A;  1ZMW A;  3VFD A;  1QUS A;  3A98 B;  5B40 C;  2FOI C;  1L1Z A;  3LQQ A;  3TU4 A;  4JJN B;  4H9P B;  1N32 M;  3C1B D;  5CPJ B;  4M9X A;  3CF6 E;  4CJ6 A;  4X66 M;  2Y2H A;  5B0Y B;  1M1A D;  2V1U A;  3JAM S;  2CV0 A;  4H9Q B;  3X1S C;  3AV1 C;  5AV6 D;  2C5R A;  1IY1 A;  4DV3 M;  2NZD C;  3AN2 C;  4L6V 6;  3GLH B;  5KDM A;  1YLA A;  5FUG A;  5DNN B;  2YFV B;  4Z8X A;  3AZK B;  5B1M B;  2CV5 B;  2O01 F;  1A7W A;  2VQF M;  2W8S A;  5EP2 A;  1F4I A;  3AV2 D;  1J7K A;  3LZ0 D;  2PYO A;  2Y2P A;  1IXZ A;  3VDU A;  2JA2 A;  1KX3 A;  1QZE A;  4J8V B;  4IBJ A;  2P5T A;  1B67 A;  3AZG C;  3LJA D;  3A6N D;  5DNM C;  3AZI D;  2FH0 A;  3KSX A;  2KRK A;  3HHZ A;  3E46 A;  1Y8G A;  2R65 A;  1TDH A;  3NQU B;  3UT9 C;  5KPT A;  2W82 A;  4H9N A;  3MNN A;  4GHA A;  5AY8 D;  3LEL A;  1V34 A;  2UU9 M;  2F8N H;  5B1L C;  8CAT A;  1OQY A;  4Z66 D;  4IIW A;  3SAV A;  1W5S A;  3AFA D;  4LF4 M;  1IXR C;  2UXD M;  3UTB C;  3KWQ B;  1GAB A;  2OPF A;  1P3K B;  5GT3 A;  3B9P A;  3THG A;  3WTP D;  3MGS A;  3E4R A;  1KYI A;  2ARO A;  5JRG D;  3AZE B;  1N1J A;  2BYK A;  3GQ5 A;  1U35 B;  4DR1 M;  4XZQ A;  2HWJ A;  2Y20 A;  2Z4R A;  4I8O A;  3O62 D;  3H4M A;  3VH6 W;  4XUJ A;  2DZN B;  2Z3X A;  2AHM A;  1G3I A;  3KDS E;  5AVC A;  4QLC B;  1KX5 C;  3UTA B;  3MK6 A;  1PM5 A;  1ZAE A;  2FFJ A;  5KPZ A;  4FVM A;  1Z59 A;  1VDD A;  5EXX A;  4Z5T B;  1GO5 A;  4WNN B;  5CPJ D;  2F5P A;  1E9R A;  3KXB C;  4RF0 A;  3B7Z A;  3I01 M;  5B0Y D;  1IQP A;  3MGP B;  1QZM A;  1R7R A;  5IT9 S;  4R8P C;  1QVR A;  1Z5A A;  3IHP A;  1NJG A;  2NZD A;  3AN2 A;  2LVP C;  4KUD C;  5B32 G;  2JZ1 A;  2KNA A;  1BH9 B;  3FDD A;  3J7B A;  3V9R B;  3RFW A;  3J7A S;  2F5O A;  5DNN D;  4NSO B;  4B7G A;  1HT2 E;  3LZ1 C;  3AZK D;  3KOY E;  4JI1 M;  3AZL C;  2CV5 D;  2F4V M;  5AVB B;  1P3O C;  3K8Z A;  3REL B;  5GT0 C;  1RU3 A;  2Z4S A;  3DFZ A;  2QHO B;  1NNJ A;  4LFA M;  3X1U C;  4LD9 B;  4EO5 C;  3A1I A;  1HQ3 B;  2B3T A;  4KGC A;  4YM6 C;  2NQ8 C;  4KO8 A;  3B6G B;  4D82 A;  4B3T M;  4IJF A;  4J8V D;  3DOA A;  3SAU A;  4H9S C;  4AQY M;  4DR3 M;  5DNM A;  2JWS A;  3HU3 A;  3KS4 A;  1PJT A;  4M6B A;  1V33 A;  4CSR B;  3TQS A;  3UT9 A;  3IG5 A;  1OFH A;  4B3S M;  4DRB A;  2L6O A;  4AZF A;  2G5H C;  1FNN A;  5ITQ A;  3J80 S;  5B2J C;  1ID3 C;  2LWX A;  2XFT A;  5CP6 C;  5B1L A;  3U5Z A;  3MGQ B;  4L4U A;  2KW0 A;  4HEO A;  3PNY A;  4MGY E;  1ZLA A;  3B6F B;  2Y2L A;  2NQB B;  2UXC M;  3W98 C;  3U60 A;  5AV9 B;  3UTB A;  4JXJ A;  4LGM A;  3KWQ D;  3KFU G;  4H9R A;  3REH A;  1P3F A;  1XMQ M;  3LVV A;  4ANR A;  1XXH E;  3SFZ A;  3WHL A;  3AZE D;  2ZTD A;  4G92 B;  1U35 D;  5IRE B;  3L27 A;  4A3V B;  4MGZ E;  1HQC A;  2CEA A;  5FTM A;  3MVD B;  4QLC D;  2G8L A;  3GLF A;  5B32 C;  3B7Q A;  2HUE B;  1DGH B;  2HIO C;  1M18 C;  3EG5 B;  1IM2 A;  3MGR A;  2DZL A;  1GL6 A;  5FTK A;  1M19 B;  4FWD A;  4X64 M;  4Z5T D;  1P3B C;  5FTN A;  4GIP A;  3CF2 A;  1UFZ A;  4JI7 M;  3C1B C;  3W96 A;  3QAU A;  2BG1 A;  4NOO B;  3MGP D;  1M1A C;  3QYE A;  1NJF A;  2CHQ A;  2JY7 A;  3R45 A;  5AV6 C;  3CGW A;  4KUD A;  4WV4 B;  2L4E A;  4RF1 A;  5JA4 A;  2C98 A;  4MGK E;  1TH3 A;  4OU7 A;  3LZ1 A;  5BO0 B;  3K92 A;  1E32 A;  3KOW E;  5AVB D;  3AZL A;  3HHY A;  2KZU A;  4ZUX B;  4LF7 M;  2OQ4 A;  3F6T A;  1P3O A;  3REL D;  4LFC M;  2VF8 A;  3X1U A;  1R2Y A;  4LD9 D;  1HQ3 D;  1P3A B;  3LZ0 C;  1QAM A;  1N36 M;  3B6G D;  1ZMV A;  1T3T A;  4B08 A;  1D2N A;  3VLF B;  3FRI A;  3RGS A;  5G49 A;  3J81 S;  4NC6 A;  4H9S A;  3M7G A;  4X65 M;  2N35 A;  4LY6 A;  3A6N C;  3AZI C;  3NQJ B;  4LF6 M;  1Q02 A;  4JI3 M;  1GKI A;  4UN2 B;  5ITX E;  1Z2C B;  1KX4 B;  3UZU A;  2I7P A;  2DHR A;  4NE5 A;  3KP1 E;  5AY8 C;  1ID3 A;  4MM3 B;  3H0L C;  4BLC A;  1N78 A;  2VQE M;  4Z66 C;  3FUU A;  4Z2M G;  3AFA C;  3B6F D;  3AFH A;  1JFI A;  4DV4 M;  5BT1 D;  4MGH A;  2DWZ B;  3U6Q A;  3Q8G A;  4KOD A;  5ITT A;  3X1V A;  4KT0 F;  5AV9 D;  3W98 A;  4AWL C;  3SHF A;  1WGN A;  4HLQ A;  2LH0 A;  1XNQ M;  2HCB A;  3REK D;  2FJ7 B;  3WTP C;  2EKK A;  5GSU B;  1IN8 A;  2C9C A;  3T15 A;  3GLI A;  1X37 A;  1DO2 A;  2K9D A;  3VH6 T;  3HX3 A;  2DAK A;  3O62 C;  2YNM D;  4E44 A;  3WA9 B;  3MVD D;  4J8U B;  5AV8 A;  5B32 A;  2IO5 B;  3IP4 C;  3GLG E; 
#chains in the Genus database with same CATH homology
 2JCH A;  2Q2E B;  4LJ9 A;  3B0D C;  1M18 A;  3HHX A;  3T1H M;  3K1J A;  1M19 D;  4D80 A;  2CV2 A;  2PYO C;  5ITX A;  5CPJ C;  3C1B A;  2RIQ A;  1AOI B;  1L2C A;  1M1A A;  1OFI A;  2CV1 A;  5GXQ A;  4CAY B;  4X23 B;  1YE9 A;  5AV6 A;  3W97 B;  4P16 A;  3R8F A;  4KHA A;  5F99 B;  1NVM A;  5KO3 A;  3X1T B;  2ZY4 A;  5B2I B;  4GIT A;  1P3P D;  5DNN C;  3WKJ D;  3AYW B;  3SMP A;  3SAS A;  3AZK C;  1N75 A;  5CPK B;  4BBA A;  4WJ3 C;  4UUZ A;  4HGA C;  4JI5 M;  1TGU A;  3WTP E;  1P3L A;  3AV2 A;  1WWS A;  1P3A D;  3LZ0 A;  4MGI E;  1I4W A;  4ITQ A;  3TU4 B;  4AW4 A;  3GLG A;  4FW9 A;  2QBY A;  2ARO C;  1W2E A;  4Z2M H;  4J8V C;  4K0K M;  4M9Z A;  4XZQ C;  4D81 A;  4J8W B;  4GC5 A;  3LJA A;  2R4J A;  1S32 B;  3AZI A;  1TAF A;  4ZBJ B;  2QP9 X;  3AZN B;  1FJG M;  1KX4 D;  2VQR A;  2BYM A;  5KDM B;  3AZH D;  5AV5 B;  5AY8 A;  1Q9C A;  4IBD A;  3AL0 C;  5ITR A;  4Z66 A;  3AFA A;  4LJA A;  3GQ4 A;  2XZU A;  4G6Z A;  4YS3 B;  2D7E A;  1HQY E;  5GXQ D;  5C3I B;  3OTO M;  3W0F A;  3FUW A;  2J7O A;  1J5E M;  2F2A C;  4DV7 M;  2FJ7 D;  2XEP A;  3WTP A;  4WU8 B;  2DWL A;  3AZE C;  5JRG A;  2R46 A;  1KX3 B;  4AKH A;  1U35 C;  4LJ8 A;  5LMU M;  5E5A D;  3WA9 D;  3O62 A;  4J8U D;  3A46 A;  3LQR A;  4H9O A;  4QLC C;  2Y21 A;  3FD9 A;  1P3L D;  4M0W A;  2YQZ A;  1HNZ M;  1R4V A;  2CE7 A;  4AKI A;  2L7I A;  3GRV A;  3L28 A;  4KGC C;  3KSY A;  4H9P A;  3VKG A;  5CPJ A;  4L78 A;  4L16 A;  2ZAO A;  5B0Y A;  1AOI D;  3AKZ A;  3MGP C;  3HJQ A;  4H9Q A;  4X23 D;  4DV0 M;  2QEN A;  3REI B;  4G4N A;  5BNV B;  5F99 D;  4L15 A;  1ZQ9 A;  2UUA M;  2RGO A;  3X1T D;  5B2I D;  2X8A A;  2Y2O A;  3GLH A;  4FD2 A;  3FUV A;  4LCB A;  2XF3 A;  1SXJ D;  2D7G A;  5DNN A;  3AYW D;  2YFV A;  3KW6 A;  3HU2 A;  5CPK D;  3AZK A;  1QQW A;  5AVB C;  2CV5 A;  1K3X A;  1ZLA C;  3L26 A;  1NHW C;  2DWN A;  1N34 M;  4WU9 D;  3NBI A;  5B31 B;  4LD9 C;  4NE6 A;  3REH C;  4OVZ A;  1P3F C;  1L2D A;  1HQ3 C;  5B40 B;  4YY3 M;  4OW0 A;  4GC9 A;  5FSW A;  3B6G C;  4J8V A;  1TH2 A;  4G4Q A;  3SYK A;  1YUB A;  5JI3 E;  3MJ5 A;  1K3W A;  4R7G A;  1DGG A;  1S32 D;  3X1S B;  1T3U A;  2EO2 A;  1P34 D;  5BS7 A;  3AV1 B;  3WAA D;  2X4A A;  3A1K A;  4KHP M;  3NQU A;  3AZN D;  2XSZ D;  3M0E A;  5AV5 D;  1G59 A;  3MGR C;  3PFI A;  4W5W A;  4B3R M;  4FWG A;  2YR0 A;  4JJN D;  1JR3 D;  1BH8 A;  3CTW B;  3W96 C;  4YS3 D;  5BT1 C;  2XLJ A;  4LF9 M;  5AV9 C;  4IBE A;  4DQY B;  5IWA M;  3KWQ A;  3SYL A;  2D7H A;  3REK C;  3FUX A;  2XFS A;  4WU8 D;  1C1K A;  4NXN M;  3U6L A;  3AZE A;  4DV5 M;  3LVW A;  4NRV A;  2RVQ D;  4G92 C;  1U35 A;  2XGN A;  3AZG B;  4LJ7 A;  4DV6 M;  5DNM B;  4B7F A;  1GL7 A;  5B1M D;  4E45 A;  4QOZ C;  2LY8 A;  3KXE C;  4QLC A;  5B33 B;  2HUE C;  3UTA A;  4GKJ M;  3KP0 E;  3VH5 A;  2F8N B;  1N77 A;  4LFB M;  4Z5T A;  4WNN A;  3MGP A;  4LZZ A;  4JI0 M;  3U6O A;  2ERC A;  3REI D;  1P3I B;  5B0Z B;  3EIH A;  3TL4 X;  1MU5 A;  3GPX A;  1BH9 A;  2XD5 A;  3WHK A;  3V9R A;  3AZM B;  1P3P C;  2UUC M;  1TDZ A;  4LZJ A;  3WKJ C;  3H0M C;  3PXG A;  5AVB A;  3GRY A;  1KX5 B;  3X1V C;  3REL A;  2LXE A;  3EPL A;  5B31 D;  4LD9 A;  1IBL M;  1P3K D;  1HQ3 A;  4TUW A;  4DR7 M;  3B6G A;  3NWL A;  2ZBK B;  3KXB B;  4AI6 A;  4IBF A;  4G4O A;  2H1R A;  3X1S D;  4DR6 M;  4R8P B;  4QOS A;  3AV1 D;  3H0R C;  1N33 M;  5C18 A;  4CSR A;  5AV8 C;  4FCW A;  2G5G X;  2F5S A;  3UTA D;  3C58 A;  1ORY B;  5EP4 A;  4LF8 M;  4KUD B;  1ULY A;  1F66 B;  1KX4 C;  3SMS A;  3FTE A;  4M9S A;  3AZH C;  2YFW B;  3C1C B;  2J7N A;  1XXH B;  4IBK A;  3AZL B;  3B6F A;  2O5R A;  2LNH C;  5AV9 A;  5GT0 B;  5GXQ C;  1KFV A;  3SBJ A;  2XD1 A;  3X1U B;  1DO0 A;  3U61 B;  3TWK A;  3UJN A;  4EO5 B;  5DNY A;  1G8P A;  3GQ3 A;  3REK A;  2M60 A;  4YM6 B;  3AZG D;  1TZY B;  4G91 C;  5E5A C;  3WA9 C;  3M6A A;  4J8U C;  3MVD A;  5B33 D;  3ZCB B;  1DGH A;  2F8N D;  3J27 B;  1P3L C;  4WUR A;  4DUY M;  3AV2 C;  3VH5 T;  2KZS A;  2HL7 A;  5B2J B;  1M19 A;  5CP6 B;  2Z7J A;  3EPK A;  5CPI B;  5FLX S;  1JFI B;  4FWH A;  5BNX B;  4B3M M;  2FFF B;  4X23 C;  3LJA C;  4PCZ A;  1P3I D;  3W99 B;  5B24 B;  5B0Z D;  5F99 C;  4XGI A;  3X1T C;  5B2I C;  3PNV A;  4DUZ M;  2JE5 A;  5C1B A;  4JI2 M;  3DA1 A;  1SXJ C;  1L2B A;  3AZM D;  2UUB M;  3MGQ D;  1P3M B;  1P3P A;  3U6D A;  5BO0 A;  3WKJ A;  4II7 A;  2DWM A;  5CPK C;  3AZJ B;  4ZUX A;  2Y2N A;  1DGB A;  1KX5 D;  2NQB D;  3UK6 A;  2Y2K A;  2HIO B;  4WU9 C;  2R18 A;  1P3A A;  1P3B B;  4NXM M;  3KXB D;  3KUY B;  3JR4 A;  5JRG C;  4J8X B;  3TE6 A;  4R8P D;  1XNR M;  1S32 C;  3NQJ A;  1P34 C;  3SAR A;  2UXB M;  3WAA C;  1NNU C;  4DV2 M;  4I5S A;  3AZN C;  1F66 D;  1KX4 A;  1EQZ B;  2UWX A;  5AV5 C;  3AZH A;  1L8Q A;  3C1C D;  3VK8 A;  3U6P A;  5EXP A;  1P3G B;  4JJN C;  3KSJ A;  1MX0 A;  5B0Y C;  4LGY A;  1NSF A;  3GRU A;  3REJ B;  3KVW A;  4JYA M;  1SXJ E;  3B0C T;  2ZY3 A;  3TWM A;  4YM6 D;  2FJ7 A;  3L2A A;  1QAO A;  3SHG B;  3QWL A;  2HHH M;  5GSU A;  4WU8 C;  2HKJ A;  3AOG A;  2QBY B;  2R45 A;  1PJI A;  1TZY D;  2RVQ C;  1H3O B;  3P5J B;  2F8N K;  3W0L B;  3A6N B;  4KLN A;  5E5A A;  3WA9 A;  3TWL A;  4J8U A;  2ZAM A;  5H37 D;  5B1M C;  2X49 A;  4ZUX D;  2CV5 C;  5DYI A;  3AZF B;  5B2J D;  1Q3B A;  4IBG A;  5CPI D;  3AFA B;  3ZH9 B;  1AOI A;  3GRR A;  4X23 A;  4AWL B;  3HWS A;  3W99 D;  5BS7 C;  5B24 D;  3REI C;  5F99 A;  3X1T A;  5B2I A;  3I51 A;  4FCV A;  4X62 M;  4AKG A;  3ILK A;  3J2P B;  5KQ8 A;  1IN7 A;  5EP1 A;  4RNA A;  4PDG A;  3U6S A;  4WZS B;  1SXJ A;  5EQT A;  1P3M D;  4YHH M;  1F1E A;  5FUG B;  3U6M A;  3AYW A;  3JR5 A;  3AZJ D;  5CPK A;  4DRA A;  1I94 M;  2BJW A;  5ITY A;  2HIO D;  3B0D B;  4WU9 A;  3B0B A;  3AOE A;  4M0D A;  5B31 C;  3KWQ C;  4CHT B;  2BJV A;  1P3K C;  2DQN C;  2PYO B;  1P3B D;  3E9S A;  5GSU D;  1W5T A;  3TPZ A;  2V6Z M;  4IJE A;  3KUY D;  1HR0 M;  4NFT A;  4J8X D;  3FTC A;  4J8W A;  2DXI A;  1S32 A;  5CHL B;  1P34 A;  3RGP A;  3WAA A;  1IY2 A;  3ZC7 B;  3UTA C;  2C9O A;  4JI6 M;  2Y2Q A;  3AZN A;  4CIS A;  1EQZ D;  1IBM M;  4H9N B;  1KSF X;  2XSZ A;  4LRS A;  4REZ A;  5AV5 A;  3MNN B;  3LEL B;  3VH5 W;  2M5Z A;  1P3G D;  4Z5T C;  2L09 A;  4JJN A;  1JR3 A;  2EUC A;  3AJI B;  5F3W A;  4YS3 A;  1Z5C A;  4HGA B;  3REJ D;  1IN4 A;  1Z5B A;  1WWI A;  4LF5 M;  4LJ5 A;  3KOX E;  3W97 D;  4OVZ B;  1G41 A;  5GT3 B;  3MGS B;  4WU8 A;  2ARO B;  2V1C A;  4AG6 A;  5IZ7 D;  1N1J B;  2BYK B;  3MHV C;  3HGI A;  4XZQ B;  3LMM A;  4JN6 A;  4XUJ B;  5B1M A;  5AVC B;  5B33 C;  1H6U A;  2Y0T A;  4OX9 M;  3AZF D;  3REL C;  4MH0 E;  1QYR A;  3TU4 D;  1BH8 B;  3IG8 A;  2QPA A;  3L29 A;  3FTD A;  3I4Y A;  3D8L A;  1XMO M;  4J8W D;  4NE3 A;  2L5A A;  3L25 A;  2ZY5 A;  3REI A;  5BNV A;  2KEB A;  4GH9 A;  1P3I C;  5B0Z C;  3UGJ A;  2NZD B;  3AN2 B;  4ZPX A;  3AZM C;  1GLN A;  3MGQ C;  5EP3 A;  3B6F C;  2NQB C;  1IY0 A;  1HNX M;  2R62 A;  4R3D A;  5B31 A;  5EXS A;  2PYO D;  1P3K A;  3FYD A;  5B40 A;  3B0C W;  4KGC B;  2G5I C;  1KX3 D;  1QAN A;  3GPY A;  1YSY A;  1TH4 A;  1NY5 A;  2Y2M A;  1LV7 A;  3X1S A;  5JI2 E;  4PT5 A;  3HKP A;  3AV1 A;  3MVD C;  4LG2 A;  1HTA A;  3UT9 B;  2L7H A;  1F66 C;  1PZR A;  1E94 E;  3MNN D;  3LEL D;  3C1C C;  2QCU A;  1M19 C;  1IN6 A;  5B1L B;  3T1Y M;  3U5Z B;  5EXT A;  3VK7 A;  3VDP A;  3RE8 A;  1R2Z A;  3EPJ A;  2ZAN A;  1ZLA B;  4LJ6 A;  3U60 B;  2Y2J A;  3UTB B;  4L8R C;  4H9R B;  1XC8 A;  3REH B;  1P3F B;  2RKO A;  1S3S A;  5GT3 D;  4MB7 A;  3MGS D;  2ARO D;  3FTF A;  2CHG A;  4QHT A;  2JSS A;  1E9S A;  1EE8 A;  4XZQ D;  3SAT A;  1TZY C;  3HU1 A;  3AZG A;  1IXS B;  4PDI A;  4XUJ D;  3GO8 A;  3VKH A;  1B6W A;  2I7N A;  1G4A E;  3R9X B;  5AVC D;  4ZUX C;  5B33 A;  3GLF B;  5BR8 M;  2F5Q A;  4CGY B;  2F8N A;  2KRU A;  3MGR B;  1P3A C;  5B40 D;  1R6B X;  5CPI C;  4G4R A;  3W96 B;  3FYC A;  3GP1 A;  3A42 A;  5E6J A;  3T38 A;  3A45 A;  4NSR A;  3W99 C;  5B24 C;  1P3I A;  3R45 B;  4FCT A;  5B0Z A;  4JI4 M;  2R4E A;  3REK B;  2NZD D;  3AN2 D;  5JA4 B;  3K2L A;  4DR2 M;  3VH6 A;  3DZD A;  3AZM A;  1P3M C;  1Q39 A;  3MGQ A;  3LZ1 B;  2J8P A;  2CUZ A;  3AZJ C;  5KPR A;  5KQD A;  1KX5 A;  2NQB A;  1P3O B;  2QZ4 A;  2KXE A;  1HNW M;  4DV1 M;  1IBK M;  1QAQ A;  4HL4 A;  4KGC D;  2FJ7 C;  3KS8 A;  5GSU C;  1NHG C;  3KXB A;  3KUY C;  4LJ4 A;  5G49 B;  4IBI A;  4J8X C;  2DZO B;  5DNM D;  3I4V A;  4R8P A;  2K47 A;  1OJL A;  4IBC A;  2IO5 C;  3UT9 D;  3D8B A;  2ZM6 M;  2E5L M;  1F66 A;  1EQZ C;  2CHV A;  2YFW A;  3C1C A;  1ID3 B;  5B1L D;  1UM8 A;  1P3P B;  1XXH A;  1P3G C;  4B7H A;  4JV5 M;  5EJC A;  3WKJ B;  3HJS A;  1ZLA D;  1AOI C;  3X1V B;  5GT0 A;  3REJ C;  3W98 B;  3UTB D;  4GMQ A;  3U61 A;  3GPU A;  3REH D;  1P3F D;  3W97 C;  4JI8 M;  1XWI A;  4YM6 A;  3AV0 A;  4WW0 A;  4XBO A;  4EIW A;  3GLI B;  4LRT A;  1TZY A;  5E26 A;  2CWE A;  3AYW C;  2C96 A;  1J09 A;  1Z6T A;  3KOZ E;  2ZY2 A;  5AV8 B;  1Q3C A;  5B32 B;  1NY6 A;  4QNR A;  2DF4 C;  3AZF C;  1M18 B;  3MGR D;  3AOE C;  3U6C A;  3AZH B;  5B2J A;  4IBB A;  5CP6 A;  2A5Y B;  2RGH A;  3TU4 C;  1WXQ A;  5CPI A;  4I4L A;  3W96 D;  3C1B B;  2Y0Q A;  3SC3 A;  5BNX A;  3EIE A;  4NL4 H;  4AG5 A;  1M1A B;  5GXQ B;  4J8W C;  3W99 A;  5B24 A;  2Y2G A;  5AV6 B;  2XZF A;  4KHA B;  4ZBJ C;  2FE8 A;  4KUD D;  1PJJ A;  5DYG A;  4I81 A;  5GKN A;  1P3M A;  3LZ1 D;  4G91 B;  5B31 G;  5E5A B;  3PVS A;  3AZL D;  3AZJ A;  3EPH A;  2KA6 B;  1P3O D;  4YS3 C;  1HT1 E;  4UUZ B;  5GT0 D;  1L1T A;  2HIO A;  1P3L B;  4NRW A;  2DVW B;  3X1U D;  3AV2 B;  5C3I C;  2ZM5 A;  1JQJ C;  3HHW A;  3LZ0 B;  1P3B A;  2F5N A;  3GLG B;  3KUY A;  4BB9 A;  1KX3 C;  7CAT A;  2YFQ A;  1GVN A;  4J8X A;  4S12 A;  3LJA B;  4QNM A;  3AZI B;  5ITU A;  4DR5 M;  1TAF B;  4QHS A;  4GHL A;  2BNK A;  4UPK A;  1EQZ A;  2FNA A;  2BYM B;  2XH9 A;  3MNN C;  4Z6Y A;  1SXJ B;  3LEL C;  1ID3 D;  5AY8 B;  5CP6 D;  3U6E A;  1IN5 A;  3FKE A;  1P3G A;  4Z66 B;  2Y2I A;  1BFM A;  2CFO A;  3X1V D;  3FUT A;  3W98 D;  3REJ A;  3Q8X A;  4CAY A;  4WU9 B;  5A2Q S;  2VII A;  4PD2 A;  3W97 A;  3BOS A;  4GKK M;  5LMN M;  5GT3 C;  1K82 A;  3UMM A;  3MGS C;  3WTP B;  1XHB A;  4GRI A;  5FTJ A;  5JRG B;  2F8N G;  3SAW A;  1H3O A;  1DGF A;  3A6N A;  2EA0 A;  3O62 B;  5FTL A;  4XUJ C;  3HJ8 A;  4DR4 M;  1P34 B;  5AV8 D;  3CF0 A;  3WAA B;  5B32 D;  5BPV A;  5AVC C;  4H9O B;  1KU5 A;  3AZF A;  1M18 D;  3GPP A;  2C99 A;  3VFD A;  3A98 B;  5B40 C;  2FOI C;  1L1Z A;  3LQQ A;  3TU4 A;  4JJN B;  4H9P B;  1N32 M;  3C1B D;  5CPJ B;  4M9X A;  3CF6 E;  4X66 M;  2Y2H A;  5B0Y B;  1M1A D;  2V1U A;  3JAM S;  2CV0 A;  4H9Q B;  3X1S C;  3AV1 C;  5AV6 D;  2C5R A;  1IY1 A;  4DV3 M;  2NZD C;  3AN2 C;  3GLH B;  5KDM A;  5FUG A;  5DNN B;  2YFV B;  4Z8X A;  3AZK B;  5B1M B;  2CV5 B;  1A7W A;  2VQF M;  2W8S A;  5EP2 A;  3AV2 D;  1J7K A;  3LZ0 D;  2PYO A;  2Y2P A;  1IXZ A;  3VDU A;  2JA2 A;  1KX3 A;  4J8V B;  4IBJ A;  2P5T A;  1B67 A;  3AZG C;  3LJA D;  3A6N D;  5DNM C;  3AZI D;  3KSX A;  2KRK A;  3HHZ A;  2R65 A;  1TDH A;  3NQU B;  3UT9 C;  5KPT A;  2W82 A;  4H9N A;  3MNN A;  4GHA A;  5AY8 D;  3LEL A;  2UU9 M;  2F8N H;  5B1L C;  8CAT A;  4Z66 D;  4IIW A;  3SAV A;  1W5S A;  3AFA D;  4LF4 M;  1IXR C;  2UXD M;  3UTB C;  3KWQ B;  2OPF A;  1P3K B;  5GT3 A;  3B9P A;  3THG A;  3WTP D;  3MGS A;  3E4R A;  1KYI A;  2ARO A;  5JRG D;  3AZE B;  1N1J A;  2BYK A;  3GQ5 A;  1U35 B;  4DR1 M;  4XZQ A;  2Y20 A;  2Z4R A;  4I8O A;  3O62 D;  3H4M A;  3VH6 W;  4XUJ A;  2DZN B;  2Z3X A;  2AHM A;  1G3I A;  3KDS E;  5AVC A;  4QLC B;  1KX5 C;  3UTA B;  3MK6 A;  1PM5 A;  1ZAE A;  2FFJ A;  5KPZ A;  4FVM A;  1Z59 A;  1VDD A;  5EXX A;  4Z5T B;  4WNN B;  5CPJ D;  2F5P A;  1E9R A;  3KXB C;  4RF0 A;  5B0Y D;  1IQP A;  3MGP B;  1QZM A;  1R7R A;  5IT9 S;  4R8P C;  1QVR A;  1Z5A A;  1NJG A;  2NZD A;  3AN2 A;  4KUD C;  5B32 G;  1BH9 B;  3FDD A;  3J7B A;  3V9R B;  3RFW A;  3J7A S;  2F5O A;  5DNN D;  4NSO B;  4B7G A;  1HT2 E;  3LZ1 C;  3AZK D;  3KOY E;  4JI1 M;  3AZL C;  2CV5 D;  2F4V M;  5AVB B;  1P3O C;  3K8Z A;  3REL B;  5GT0 C;  2Z4S A;  3DFZ A;  1NNJ A;  4LFA M;  3X1U C;  4LD9 B;  4EO5 C;  3A1I A;  1HQ3 B;  4KGC A;  4YM6 C;  2NQ8 C;  4KO8 A;  3B6G B;  4D82 A;  4B3T M;  4IJF A;  4J8V D;  3DOA A;  3SAU A;  4H9S C;  4AQY M;  4DR3 M;  5DNM A;  3HU3 A;  3KS4 A;  4M6B A;  4CSR B;  3TQS A;  3UT9 A;  3IG5 A;  1OFH A;  4B3S M;  4DRB A;  2L6O A;  4AZF A;  2G5H C;  1FNN A;  5ITQ A;  3J80 S;  5B2J C;  1ID3 C;  2LWX A;  2XFT A;  5CP6 C;  5B1L A;  3U5Z A;  3MGQ B;  4L4U A;  2KW0 A;  3PNY A;  4MGY E;  1ZLA A;  3B6F B;  2Y2L A;  2NQB B;  2UXC M;  3W98 C;  3U60 A;  5AV9 B;  3UTB A;  4JXJ A;  4LGM A;  3KWQ D;  3KFU G;  4H9R A;  3REH A;  1P3F A;  1XMQ M;  3LVV A;  3SFZ A;  3WHL A;  3AZE D;  4G92 B;  1U35 D;  5IRE B;  3L27 A;  4A3V B;  4MGZ E;  1HQC A;  2CEA A;  5FTM A;  3MVD B;  4QLC D;  2G8L A;  3GLF A;  5B32 C;  2HUE B;  1DGH B;  2HIO C;  1M18 C;  3EG5 B;  1IM2 A;  3MGR A;  1GL6 A;  5FTK A;  1M19 B;  4FWD A;  4X64 M;  4Z5T D;  1P3B C;  5FTN A;  4GIP A;  3CF2 A;  4JI7 M;  3C1B C;  3W96 A;  3QAU A;  2BG1 A;  4NOO B;  3MGP D;  1M1A C;  1NJF A;  2CHQ A;  3R45 A;  5AV6 C;  4KUD A;  4WV4 B;  4RF1 A;  5JA4 A;  2C98 A;  4MGK E;  1TH3 A;  4OU7 A;  3LZ1 A;  5BO0 B;  3K92 A;  1E32 A;  3KOW E;  5AVB D;  3AZL A;  3HHY A;  2KZU A;  4ZUX B;  4LF7 M;  2OQ4 A;  3F6T A;  1P3O A;  3REL D;  4LFC M;  3X1U A;  1R2Y A;  4LD9 D;  1HQ3 D;  1P3A B;  3LZ0 C;  1QAM A;  1N36 M;  3B6G D;  1T3T A;  4B08 A;  1D2N A;  3VLF B;  3RGS A;  5G49 A;  3J81 S;  4H9S A;  3M7G A;  4X65 M;  4LY6 A;  3A6N C;  3AZI C;  3NQJ B;  4LF6 M;  4JI3 M;  1GKI A;  5ITX E;  1Z2C B;  1KX4 B;  3UZU A;  2I7P A;  2DHR A;  4NE5 A;  3KP1 E;  5AY8 C;  1ID3 A;  4MM3 B;  3H0L C;  4BLC A;  1N78 A;  2VQE M;  4Z66 C;  3FUU A;  4Z2M G;  3AFA C;  3B6F D;  3AFH A;  1JFI A;  4DV4 M;  5BT1 D;  4MGH A;  2DWZ B;  3U6Q A;  4KOD A;  5ITT A;  3X1V A;  5AV9 D;  3W98 A;  4AWL C;  3SHF A;  4HLQ A;  2LH0 A;  1XNQ M;  2HCB A;  3REK D;  2FJ7 B;  3WTP C;  5GSU B;  1IN8 A;  2C9C A;  3T15 A;  3GLI A;  1X37 A;  1DO2 A;  3VH6 T;  3O62 C;  2YNM D;  4E44 A;  3WA9 B;  3MVD D;  4J8U B;  5AV8 A;  5B32 A;  2IO5 B;  3IP4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...