2ZNIA

Crystal structure of pyrrolysyl-trna synthetase-trna(pyl) complex from desulfitobacterium hafniense
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
279
Chain Sequence
LSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 75
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2zniA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zniA02
1X2HA 4YRGA 2J3MA 4P75C 3RL6A 2XGTA 2DTOA 1X56A 3TUPA 2Q5HA 1SESA 3BFMA 3TEHA 3PZCA 2EL9A 4BWAA 2RHQB 1YGBA 1PYSA 2DU5A 1USYC 1NNHA 2QJ1A 2CJBA 3HXYA 2ZIOA 2ZINA 3HFVA 1L0WA 3ERRA 3IKMB 2PUSA 4CH4A 4H2YA 2ZXFA 3IKLA 5C52B 1ASYA 1GGMA 2ZZFA 1EFWA 4UP9A 4K86A 1YFSA 3RKWA 2AMCA 1H4TA 3ICAA 4P3OA 1N9WA 3A7UA 3RKXA 2ZT6A 3LSSA 3UH0A 2QHVA 4YRMA 4L87A 3HFZB 1HTTA 3L4GA 2ALYA 4WI1A 4H02A 1B70B 1WNLA 4OP0A 1NJ6A 2AKWB 4P3NA 1HXDA 1WQWA 2QHTA 4H2XB 4YRKA 2DEQA 2EJGA 3PCOB 5KNNA 3M4QA 4HWTA 2EJ9A 3HXZA 3BJUA 3HY0A 3TEGA 3HXXA 3V7CA 4YRTA 4UP7A 4TQDA 4KR3A 2P0LA 4YRSA 4YRFA 3TEHB 4CS2A 3L2ZA 1J5WA 2Q7EA 4UP8A 4XU0A 4YRNA 1NJ2A 2ZT5A 3A5YA 1PYSB 2IY5A 2CIMA 2ZZGA 4XU1A 11ASA 4XU3A 1SERA 5HGQA 4EO4A 2ODRD 4HWRA 4YYEA 1QE0A 5F5WA 3HFZA 1NJ1A 1NJ5A 3NELA 1B70A 3UGTA 2ZGWA 3OD1A 1VQZA 3P8YA 3A5ZA 1KMMA 4O2DA 1HC7A 1WPYA 2AKWA 1Z7MA 2RHSB 4Q15A 4TTVA 2QHSA 2DTHA 4HWOA 4WF2A 4H2XA 3VQWA 3NEMA 3LSQA 3MEYA 1NYQA 4NCXA 2DZCA 3VQYA 4P72A 1BBWA 4J15A 2ZCEA 2PGGA 3M4PA 1X01A 4YRIA 4RQEA 2DJZA 5E3IA 3EFSA 4YDQA 3P8VA 3P8TA 2DTIA 2DZ9A 4RDXA 3RIRA 12ASA 3VQXA 1E24A 2EAYA 2ZTGA 3RGLA 2ZNJA 3MF1A 3QO8A 3MF2A 3RF1A 4H2UA 4ZIBA 1RIQA 2QHUA 2ZR2A 2ARTA 3W3SA 2PMFA 3HTZA 1ADYA 2J3LA 3NETA 2YI9A 5ELNA 3VQVA 2CJ9A 2IY5B 4HVCA 3A7AA 3EFRA 2RHSA 5K1PA 2Q7GA 2ZT7A 4LNSA 4YRQA 1E22A 3REXA 2EWNA 4YROA 1YFRA 3LC0A 2HNIA 1IL2A 1SRYA 4YREA 2DKGA 1H4SA 2DVEA 4KQEA 4P74A 2PMEA 1ADJA 2P5IA 1E1TA 4RQFA 1LYLA 4YPFA 2E10A 3IALA 1EIYB 3HXWA 3E9IA 1NJ8A 4K87A 1H4QA 3IG2A 4P3PA 3CMQA 2E64A 3V8KA 2Q5IA 4XU2A 1O9HA 4TVYA 1Z7NA 4WJ3M 4Q6GA 1WQ7A 3V7SA 2CJAA 1EQRA 4K88A 4X5OA 4YRJA 2RQ6A 4HA8A 4TVAB 4YP0A 3NENA 2E3CA 2I4MA 1E1OA 3WQZA 1B76A 3A32A 4HWSA 4XTWA 4P71C 4H2WA 3E9HA 4DPGA 3V8JA 3HRIA 3QNEA 2RJZA 4ZTUB 2YIAA 1EIYA 2E1HA 4XEOA 1WLEA 1ASZA 4H2VA 2ARSA 2I4LA 1KOGA 5C51B 4YCVA 4P73A 1B7YB 4XTZA 2ZR3A 4P75A 4CH3A 1G5IA 1BIBA 3RKYA 3UGQA 3RUXA 4G85A 2DU7A 1QF6A 3QO5A 4XTYA 1JJCA 1EOVA 3HXUA 2I4NA 4XTUA 4OLFA 4KR2A 1G6UA 1BBUA 2CGHA 2YIBD 1X55A 2ZNIA 1USYA 4DQ2A 3HY1A 3QTCA 4TVAA 2R70A 3DSQA 1ATIA 4CH5A 2DXUA 4YCWA 2ZZEA 4YRLA 2DDZA 3VBBA 1KMNA 1YB3A 1X2GA 1H4VB 4ZTZB 2EJFA 4BW9A 4HWPA 3REUA 4YRCA 2ZIMA 1EVLA 4UPAA 3G1ZA 2ODRC 1G51A 2DQ0A 2DXTA 4XTVA 3V8LA 1B7YA 1YFTA 1EVKA 2XTIA 1O9GA 3BHPA 4H2SA 2JVDA 1G5HA 3HXVA 3KFUA 2FYKA 3R07A 4P74C 3L1AA 4G84A 5K1XA 3UFGA 2ZT8A 2DQ3A 2YI8A 2C7IA 1NYRA 3A7RA 2C8MA 2RHQA 2R72A 2HEPA 1FYFA 2E65A 1JJCB 2Q7HA 4E51A 4CS4A 3RACA 4H2TA 2YIBA 3I7FA 4TVWA 2I4OA 3FJPA 1WU7A 4CH6A 3A74A 3A31A 1B8AA 4YRPA 4YRRA 4PG3A 4TQFA 4PHCA 4RMFA 2ARUA 5ELOA 4P71A 4AH6A 1W66A 1BIAA 1WYDA 4WJ4A 4P72C 4XEMA 1X54A 2AMCB 4CS3A 5C53B 3ZEDA 4TWAA 2E5AA 1C0AA 3V7RA 3L4GB 2ALYB 3HRKA 3PCOA 4XTXA 2G4CA 2E41A 4P73C 1SETA 4YCUA 4EX5A 3QO7A
chains in the Genus database with same CATH superfamily
1X2HA 1AR1B 3RL6A 2DTOA 2Q5HA 3TEHA 4P2ZA 4LF7B 4LCUC 2RHQB 4LF9B 4QE9A 2UUAO 3PJSK 4I4TB 2PY5A 2JEXA 2JDIG 1NNHA 1YXBA 2B1GA 3HXYA 3HKEA 4X1IB 1L0WA 3W7WA 3D3IA 3K5NA 5L3GA 2CAZC 4DV3O 4CH4A 2ZXFA 5C52B 1MNGA 4O4LB 1GGMA 1XBLA 3FD9A 5KA5A 4UP9A 5B3SB 4K86A 2IW5A 3CCUV 3C3TA 1N0NA 3KCYA 3O65A 2AMCA 3AEIA 3L72H 3ICAA 4R50A 3LSSA 4JI0B 1F4NA 4LF8B 2QHVA 3E8GA 3J80N 5DN6G 2KSDA 1GM9A 2F43G 2IJIA 4I5SA 4DR3O 1B70B 5JJNB 5KAFZ 2XAJA 1KQSU 2UUBO 1N34O 3C3SA 2YC0A 2AKWB 2ADPA 4P3NA 5IYZB 1HXDA 3Q4HA 1WQWA 4I50B 1PNLA 5FNVB 4A5UB 4C7UA 3THOA 5IJ9A 1SQFA 2DEQA 2N74A 3M7MX 3AG3C 4HWTA 2EJ9A 4JAAA 3BJUA 1M5IA 3LSUA 3TEGA 2ATKC 1RPOA 3K5MA 4KR3A 5F2VO 3TEHB 2GSMB 2LFSA 5LA6A 3BCCH 2BOBC 4NTWA 4UP8A 1S0VA 2B5UA 1NJ2A 3T4DA 1D5AA 4MT8A 2P4VA 2ZZGA 4XU1A 5CN0A 3SJCC 4XU3A 3IJ4A 1VF6C 4QPJA 4QE7A 2O57A 3CCVV 1N33B 4EO4A 4FFBA 2XAFA 2HJFC 4ZI7B 3CCMV 3BAAA 2QKAA 3ZRSA 4X1KA 4DV6B 2QWOB 3OD1A 1QVFU 2UU9O 2JS3A 3A5ZA 3JARA 1H2MA 1WPYA 1Z7MA 4ASUG 2QHSA 4GUNA 4H2XA 1I7FA 3NEMA 3ZRWA 4GCZA 4PA6A 3VQYA 4J15A 2RCVA 4LF7O 1QCEA 4J10A 2CK3G 2DJZA 5E3IA 1LR1A 3LDDA 3ZRVA 1VQ4V 1XHXA 2QTSA 3P8VA 1RSOA 2F1MA 2DTIA 5B1OA 3CPWU 3JD1A 5BR8O 3Q4HB 2Y69B 12ASA 1VP7A 3OEEG 2EAYA 3RGLA 4DW0A 3MF1A 2ADQB 2F95B 3CRMA 1V9PA 3RF1A 4H2UA 4JI5B 3F5WC 4UXNA 4HBNA 4FLYA 1SQQH 4DV5O 2J3LA 1R6NA 3D36A 2BTQB 3TGUH 4X62B 1B6QA 4DV1O 3MQZA 2OWOA 1OCZB 4K35A 5LXTA 4HVCA 2QWRB 1I08A 4ZOLA 1XMQO 1Y66A 4UCVA 3REXA 3ABMC 2EWNA 2ZDIA 4FVMA 2WLMA 3LC0A 3IAYA 5EBWC 1KP2A 4JI4B 1ROPA 1RP3B 4DUYO 1BQ0A 4YHHO 2IJJA 1ADJA 4RQFA 4YPFA 3H01A 5CA0B 2E10A 4E2LA 3U0ZA 1SQBH 2XAQA 5CA1A 1IBMO 3UQ8A 3T1HB 4NXNO 2CGOA 3MD0A 3BY6A 1IX9A 4B3SB 5BY1A 4FLTA 2ZXWC 2DYSC 5LMNB 3RFRA 3ASOC 4AILC 5J9PC 4BW5A 4CC5A 2BOCC 4TVYA 3LDEA 4OXSA 4MTXA 1PPJH 1TVKA 5CMUA 3EXAA 1ENVA 2CJAA 5J2TB 4DV6O 1EQRA 4X5OA 4B7KA 5CB4A 4O4IA 3H1IH 3I55V 3HR0A 3NENA 3OTOB 1N32B 1VQ6V 3AG2C 5TISZ 1BS3A 4BR6A 1AI4A 1VQ7V 4DR4O 1P7GA 2RJZA 1WA8B 2ILMA 4PA9A 1YF2A 3R65A 4R8CA 4OPAA 1K34A 4ZTUB 1XL4A 2RN9A 1FS0G 3CCSV 3K59A 3HKBB 4FZ1A 4DV4B 2IJHA 1R6TA 1WP8A 1L0LH 4JI3O 3ZHQA 4XEOA 2CTQA 2F66C 2CTRA 1NTKH 4JYYA 1WLEA 5KLVH 4H2VA 3DXRB 5B66Z 4TV9B 4U3JA 2I4LA 3E86A 3FB6C 5C51B 1WB7A 4UCSA 1VQ9V 1JMKC 1BL8A 2AHZA 2UXDB 1BSMA 1K5SA 2ZR3A 1G5IA 3RKYA 2Z3YA 3RUXA 2DU7A 1QF6A 5LHGA 2RMKB 3OW2U 1XHZA 4X62O 3HKDA 2YEVB 1X55A 1Q86W 1PL4A 1Q43A 3SYAA 1IXMA 1USYA 3HY1A 3AG3B 2Y4UA 1AVMA 2LW7A 4BAYA 2JGUA 1LUWA 3TXQA 3KCXA 1VF7A 3OGCC 1TVKB 3RYHA 1S77D 1AI5A 2XUMA 5EZYA 4EFEA 1YB3A 3CC7V 2QM8A 1H4VB 2Q8VA 4ZTZB 2W6IG 4W4LA 4JZ2A 3OMIB 3K0GA 5IY5C 3OGIB 3ZS8C 3P32A 4I9WA 3G1ZA 1HP8A 4X65B 3LNNA 1KC8W 2WA4A 1N4CA 3T1YO 2DXTA 3ETGA 4F6EA 3V8LA 1K4CC 2P90A 5A2QN 1X4TA 4UFZA 1O9GA 4FFKA 2H3OA 2ETNA 3HXVA 4H2SA 3KFUA 4JI7O 3R07A 3JCZA 3K08A 4PA3A 4DR5B 1YJ9V 3ZRXA 3BFRA 4DV0B 2Q4PA 1VQPV 4DR2B 1Q8IA 3OE7G 4EEQA 1NYRA 3A7RA 1R73A 4XDLA 4PDMA 3OMNB 2QR4A 3QG5A 4OGQB 3HKDB 5BXZA 3ZMUA 3CRAA 2XAHA 4E51A 4TSFG 1VARA 2GTAA 4O4JA 4X64B 1YZBA 4KHPO 5IWAB 1WU7A 3RGBA 3ZN0A 3KKYA 1P7BA 4CH6A 5IYCO 2WWWA 4MVOA 1GN6A 4JV5O 1YTFD 1TGOA 5EZYB 5IJ0A 1NKDA 1Y4MA 1MA1A 2ARUA 1J5EB 3SPGA 1XI1A 3STLC 2JJ1G 3SYPA 1AR4A 1RFYA 5D5PA 3DC6A 4DV7O 3ABMB 1S5HC 2K9PA 1KMIZ 3DC5A 4MTGA 4FZ0A 3CXCU 1YTFB 1VQMV 4LFBO 5JQGA 4X1YA 1VMGA 4WFHA 4CS3A 3P3PA 3ZBHA 1HNZB 1R3LC 1FFXB 4LF6O 2ALYB 5LYJA 3AK2A 1AJPA 2UUCB 1V55C 3HKCB 1IBLO 1BQZA 4P73C 4EX5A 5L3CA 1EBOA 1NS1A 5DEDA 3SPHA 4P75C 2G38A 1VEWA 5H2FZ 1SESA 3P3NA 2YS8A 2ITCC 1MSDA 1AI6A 1H2SB 2ZXWB 2DYSB 5BMVB 1PYSA 2QJ1A 3ASOB 4YXWG 4G27B 2ZIOA 1EN5A 4YY3O 4O4JB 3ERRA 3IKMB 2UUAB 1OJHA 1K8AW 4WCEV 1COWG 5GTHZ 4DW1A 3I5DA 4F4LA 1TUBA 3M99B 3IKLA 1ASYA 1LNQA 4I9QA 2L6LA 3RKWA 1NT2B 4DV3B 5JH7B 3OR7C 3AG2B 1K7DA 1SQVH 3A7UA 3CE2A 2YICA 1Z5VA 4B08A 2HKOA 1R1BA 4L8JA 1NH2D 2DJVA 5E79Z 5FLXN 3D3QA 3JASA 4PHZA 4Z2WA 3ABLC 4X9QA 4X1YB 3F7VC 4MTOA 2QHTA 4FIPC 4DR3B 4I4TA 4AQYO 3BA8A 2UUBB 2QM4A 2EJGA 4JI1O 3OFNG 3M4QA 1N34B 2JK5C 1SZTA 2ZE5A 4MW8A 3HXZA 1G8MA 1FFTB 3ZCCA 4JYBA 1HWYA 4X1IA 3VOUA 1NH2B 1PP9H 3HXXA 4YRTA 2P0LA 1JVMA 5JCOA 1SQXH 1E1RG 3EHBB 3E89A 4YRNA 5J2UB 2ZT5A 2OTLV 4DYLA 1PYSB 1CP9A 11ASA 1ZSPA 4QPKA 1SERA 2OYQA 2DW4A 1PV0A 5IT9N 4YYEA 1QE0A 3TETA 3FYIB 2P6JA 4ZHQB 4EFBA 4XBFA 1NJ5A 1QVGU 1HNZO 3N2GA 4TT3G 1B70A 3UGTA 2ZGWA 2XHBA 1HW7A 1VQZA 1GKFA 4Z1MG 1KMMA 3RVYA 2QGNA 4O2DA 1WPBA 1AILA 4GX2A 2AKWA 2RHSB 4TTVA 4I50A 5IY5B 5FNVA 2R9RB 4NCXA 2X6AA 1BCCH 1Z5WA 3E2EA 2UU9B 2EX3A 2ZE7A 2QKCA 2PGGA 3M4PA 1X01A 4RQEA 5IDJA 1SC5B 3JASB 2P7TC 1H2KA 4JGSA 1Q5OA 2WLIB 3BRCA 4X88A 4BIOA 3P8TA 3JD3A 4RDXA 2EILC 1JPXA 3TXSA 3VQXA 1HR0O 1E24A 3KZIZ 2ZTGA 5EIBC 2B9ZA 1ORQC 3UM7A 1VQ5V 5CBHA 4MVSA 3ZIAG 4IIJA 5BR8B 2Q67A 4O2BA 3HTZA 1QU7A 5B1AC 3CCQV 3FB7C 2R9AA 3CWBH 4CBCA 2QA4V 4ZI7A 2CJ9A 2GV9A 3WB1A 3S3XA 1XILA 4PI0A 1X59A 2FTKA 1R3IC 4PDLA 3A7AA 5LL6Y 4DV5B 1JOYA 2HP8A 2Q7GA 5A9GA 5LGTA 4YRQA 4DV1B 3C90A 1E22A 2BCCH 4U7OA 2W0FC 3N2GB 2HNIA 5BZBA 2ZM6O 1XMQB 5GONB 1THZA 2QEXV 3LDCA 3CRQA 2KG7B 3AK3A 2DVEA 4P74A 4WFAV 1K9MW 1E1TA 5KHJA 2ZE8A 2LGWA 1EIYB 4UVAA 4X8AA 1GH6A 4J42A 4DUYB 1H2GA 2WSSG 4YHHB 1JFFA 4GLXA 3JD2A 1M93A 2F93B 1V55B 5B5EZ 4WBNB 4FPPA 3JALA 3ETQA 2BTQA 1IBMB 4NXNB 3N27A 3CXHF 3TCUA 4JYAO 4WJ3M 3JCUZ 4Q6GA 4X66O 1WQ7A 4IIJB 4WFGA 4O2BB 4OPHA 1I94B 2FKXA 3BVOA 1YVWA 1EFRG 3RW0A 1LUVA 3STZC 3CB2A 3MAQA 4PD4F 4B3TO 1B3QA 2I4MA 2Y0PA 1E1OA 4P9OA 4MW3A 3A8TA 4K0KO 3HRIA 2Q6AA 4DR1O 2CUGA 1YEWA 2A79B 4UCOA 3G71V 1Y76B 3W7UA 4JPRA 5EYPB 4TUYB 2N05A 5CA0A 2NS6A 2XOKG 4DR4B 2PF4E 2JEUA 5KHHA 4UVBA 2JIZG 3ZMSA 3UKMA 2EJRA 2Q0OC 1MG1A 4GX1A 4W4KA 2Q5ZA 1B7YB 3CCEV 1B06A 4JI3B 4XTZA 1VQ8V 4CH3A 1Y6XA 1GN4A 3ABLB 4DR6O 4NR1A 3QO5A 3CRRA 2CGNA 1JJCA 2A3QA 3ZHTA 2KQXA 5J2TA 2I4NA 4GX0A 1QLNA 1JFFB 2W0XA 2CTWA 1XNRO 2X6BA 2YIBD 3K57A 2ZNIA 1BBUA 1DLBA 3JALB 4I7ZB 3OUSA 1M1KW 4CH5A 4B7EA 3AG1C 2DXUA 4YCWA 2ZD9A 3K04A 2BSKB 4YRLA 4HNAB 2VQFB 4JASA 3VBBA 2Q0AA 3U10A 1WP7A 1WA8A 1VQKV 1XOUA 4U7NA 1FYJA 3B8MA 4PELA 2EJFA 2FB5A 4HWPA 3CC2V 1KBHA 3HKBA 3NXSA 4UB8Z 4J41A 4IL6Z 3TK1A 5FL7G 1EVLA 3F5TA 1KP3A 5EC2C 2A7WA 2QWQB 3DXRA 4TV9A 4DUZO 1GO3F 4DXWA 1G51A 3P30A 5LHIA 4WFBV 4LVMA 4LVKA 1A32A 1I0HA 3R66A 2JVDA 1G5HA 2ITDC 4J7JA 2FYKA 3T1YB 4AHCA 3L1AA 5EIBD 1I5YA 2ZT9B 4TV8A 3GWOA 4NTYA 5K1XA 2YEVA 1K97A 3OMAB 2DQ3A 2VWJA 1EZJA 3OUFA 1XMOO 4JI7B 3K06A 1I94O 1MABG 2GUZA 3ETDA 1FYFA 3LNMB 2EILB 1JJCB 3WB2A 2WLLB 2RNBA 1NZ6A 4CS4A 1AI7A 2WLNA 2VQEO 4HT4A 2MK3A 2HVKC 3FJPA 2DMXA 1VF6A 3A31A 2QE7G 1QNMA 3JAMN 2YDEA 2A0LA 5B1AB 1W59A 5LP6C 3ZMTA 4KHPB 2WA3A 1XQ8A 3OM3B 1WN7A 1ZL8A 4DO2A 1H38A 1F51A 4LFAO 2WLJA 4JV5B 3E8FA 1W66A 1Y74B 3JAWB 1JX9A 2GBOA 4N21A 1BIAA 3L70H 2EBOA 4WJ4A 4P72C 2ZKOA 4DK0A 1X54A 1GMGA 1XEQA 5C53B 4FLXA 2V4DA 3RT3C 3H1LH 3SDLA 1KYOF 4MVMA 2YXYA 4DV7B 1VQNV 2D2CB 3L4GB 3PCOA 2G4CA 1SETA 4LFBB 4TV8B 5AG2A 3SJQC 4RO2A 3IC9A 3ABTA 1BHAA 1Q81W 3QVNA 4YRGA 2XGTA 4O4HB 3TUPA 2VQFO 4LF6B 3BFMA 4I55B 3PZCA 3K03A 1IBLB 2GUZB 4UCTA 4H13B 3RWRD 4X20B 1K3EA 5JJJB 2CJBA 4HAMA 1IZ3A 3RYIA 3NR7A 1MMMA 3T4ZA 2HLDG 2ZINA 5LMUB 5B1NA 3HFVA 4KP4A 1DF4A 2UXCO 4G28B 4MTFA 4QJFB 1FD9A 2PUSA 2X7RB 4IHJB 4MVZA 3B40A 4H2YA 2ARHA 1FXHA 3JD0A 4YY3B 5IYDO 1YFSA 3OT7A 3WG7C 2P67A 5ITZB 2LJ2A 4P3OA 1N9WA 3RKXA 2ZT6A 1ZL8B 3FYEB 4YRMA 1FFXA 4L87A 3HFZB 4B3RO 4J9YB 2ALYA 4WI1A 4H02A 3HKCA 5KAIZ 1VIBA 1JR9A 4CC6A 1ZUQA 3K9SA 3ZMZA 1NJ6A 4OP0A 1KKDA 1Z2GA 4F6RB 4ZKIA 3G4SV 1PM9A 2W6JG 5BMVA 3PCOB 5KNNA 1FXKC 4J80A 1V54C 3B09A 5KUMA 3EFFK 1UPGA 3GB7C 3HY0A 2PYLA 3V7CA 2C2AA 4TQDA 4FK5C 4YRSA 3MHSC 4AQYB 4YRFA 2Z5UA 1OV9A 1JA8A 1CXZB 4JI1B 3L2ZA 5KMGB 1UFIA 1J5WA 2Q7EA 4XU0A 3CMEV 1KU9A 1XL6A 2YXLA 1S72V 4BIUA 3A5YA 4CZZA 2IY5A 5HFLA 2CIMA 1OCRC 4LC1A 2Y48A 2DOSA 3RYIB 3E83A 5JH7A 4RWUA 4JTCB 3L71H 5C8YA 3AG1B 4HWRA 2HVJC 3SYQA 4MVRA 2UXBO 3CCRV 1URFA 3CMAV 2D3OW 1F4MA 1YJWV 3P8YA 3E22B 4GKJO 2EZOA 3GWKC 4NXMO 1K33A 1HC7A 4Q15A 4UCRA 2NNUA 2DTHA 4HWOA 4WF2A 3K79A 1Q3EA 3VQWA 3LSQA 1NYQA 4GT1A 3IGAC 4P72A 4LWSB 2UXNA 2OTJV 3ABUA 3SR2C 3JATA 4AI8A 3EFSA 2HR3A 2XT9A 4YDQA 4JI8O 1OCCC 2QTOA 5EBLC 4PA4A 4ZBMA 3RYFB 3O9OA 4RUFA 5LMUO 5LGNA 2ZQMA 3SJAC 5J2UA 4XDJA 4IYHA 1NTZH 4NB5A 1D2DA 1F7YA 1BGYH 2XNDG 3D8CA 3W3SA 5L3EA 1HR0B 3B4SA 1ADYA 4ZHQA 2KB1A 2YI9A 5ELNA 4BIZA 4NKGB 2IY5B 3OAAG 1SA0B 4MSWC 3EFRA 2RHSA 5K1PA 2ZT7A 1TAEA 5JWPA 5C8YB 4LNSA 2EIMC 5LP6B 2JJ2G 4YROA 1YFRA 3L74H 1FXVA 4WFFA 1NTMH 1NQTA 2WPDG 1G1XB 3W7XA 5H5NA 3F7YC 2Y0IA 4YREA 3JSLA 2WLIA 2DKGA 1N36O 4DR7O 1Q6UA 4OX9O 2JRIA 4LF4O 2JGDA 3AG4C 1PNKA 2ZM6B 3HXWA 3ABKC 3JATB 3CX5F 4LVIA 3SPJA 2V7QG 1XNQO 1NJ8A 1Q7YW 4PA7A 4TWKA 3WFVA 2NR5A 1H4QA 4WF9V 2E64A 3RVZA 3V8KA 3ML0A 3L73H 2P4KA 2EIJC 1O9HA 4JF3A 2LGQA 4LFCO 3FAVA 1Z7NA 4LH7A 5KX5B 1F23A 3IFXA 3V7SA 3SJBC 4K88A 4YRJA 3BA9A 2QWPB 2V1DA 2E76B 2E5LO 4HA8A 2BTOA 4JYAB 4TVAB 2CE4A 4X66B 5L3BA 2HFEC 2FYUH 1HNXO 3WQZA 1AJQA 2CTPA 3WB0A 1B76A 3A32A 1EZVH 5GONA 2FMLA 4LH6A 4H2WA 2F4VO 4PV1B 3E9HA 1H2LA 3UT5A 2PI5A 3V8JA 3A0HZ 3QNEA 2KG7A 2M6YA 4B3TB 3H1HH 1CEZA 1Q90D 3FX7A 3A2FA 2YIAA 4KUMA 3WG7B 1EIYA 1QHTA 1L8DA 4K0KB 1IXBA 1MOFA 4DR1B 1AROP 2ZE6A 1YIJV 1H8EG 4RUEA 2DE0X 2EZPA 4UB6Z 2X6CA 1KOGA 4IYIA 2IU3A 3ZHSA 4P73A 4WBNA 2EINC 3ETEA 2LW1A 2LFRA 2QDOA 4H33A 2JGDB 3DGEA 4KXRA 4P75A 4FM1A 3K5LA 4GKKO 1BIBA 1IDSA 1EN6A 2RDCA 4KL1A 4HZ3A 1M90W 2M7WA 1S76D 1SKVA 1EOVA 3HXUA 2A8EA 2KKWA 5IE9A 4KR2A 1WPXA 4UCUA 1ZLZA 1FXKB 2LO1A 1OCOC 4YIPA 1V54B 2Q73A 2XAGA 4DR6B 2HHHB 3QTCA 2N04A 2R9IA 4IGGA 5GTIZ 4YJ2B 2AZ0A 4ABMA 1ATIA 1RPRA 2JS5A 3FAVB 2YSUB 4FMTA 1XNRB 2E74B 1VF5B 3UO2A 3D36C 1DGSA 3CJHB 3U11A 1X2GA 1R3JC 1YDXA 1Y76A 3TJTA 1BMFG 5EYPA 4TUYA 5CA3A 1KECA 1OCRB 3RBZA 2OIGA 3K5OA 3JD4A 3M8AA 4BW9A 2IBZH 5JJEB 5EK0A 4YRCA 5FPOA 2ZIMA 4FLZA 3OEHG 3RYCA 2CDYA 4UPAA 4DRXB 2ODRC 1IBKO 3UT5B 2CH7B 4FM2A 4XTVA 2ZDIC 1B7YA 5C93A 2YIDA 4DV2O 4K8XA 2XASA 2XTIA 3BHPA 4DUZB 4TOIA 1TA8A 3T2MA 2HG5C 2GDSA 4FJCC 1Y67A 1N0JA 2ZT8A 1Q6IA 2WLHA 3L75H 4JI2O 4H37A 1MSWD 2IM9A 2DN9A 2R72A 1OCCB 2DYRC 4O2AB 2BSKA 4HNAA 1KD1W 1XMOB 1K92A 4EKWA 3W7SA 4QNHB 1FJGO 3RACA 4JTDB 5LOVA 2EIKC 2YIBA 4MVUA 4TVWA 1YSCA 2I4OA 1BT8A 1E1QG 2H8PC 3A74A 4MVQA 3CRCA 4B3MO 4YRPA 1KKCA 3CEIA 1GM8A 3H1KH 1K4DC 2GHYA 3IC7A 4PG3A 2VQEB 1XDCA 3CD6V 4TQFA 3HKEB 4PHCA 5JVDA 4JAVA 5ELOA 1HNWO 4XDKA 1ZAUA 2EIMB 4NVPA 3A0RA 3RYCB 1SQPH 3G67A 2XTAA 3CCJV 4XEMA 3SGIA 2VS0A 4LFAB 2AMCB 4E4EA 3ZEDA 2E5AA 5LGUA 1GN3A 3V7RA 1WB8A 3APQA 2HHHO 4D7SA 2AXTZ 5KHKA 2E41A 1VQLV 4LF9O 2WLLA 3KG2A 1W0JG 3QO7A 3AG4B 4XTWA 4UV9A 4PDVA 2J3MA 1X56A 3ABKB 1HDJA 2PZSA 4J7KA 2EL9A 3APOA 4BWAA 1Q82W 1YGBA 5IJ9B 3FB8C 4KFMA 3X2QC 2DU5A 1USYC 2EIJB 3K9AA 3H9VA 4DK1A 3JSNA 1XUQA 1NI8A 5LOVB 1US6A 5LA6B 2EJ7A 4D7TA 1W2BU 1N8RW 1M9NA 2PI4A 3N2KA 4JI0O 1Y74A 3JAWA 1NVPD 4LF8O 3ASNC 2VWKA 2ZZFA 3ZHVA 1EFWA 2UXCB 1I5XA 1KB9F 3HB3B 2AGAA 1H4TA 5JVDB 2GTSA 5DECA 3UH0A 1GAXA 1YCIA 4FFBB 3PN1A 3FKSG 4YIOA 1HTTA 3L4GA 2Z0AA 4GZRB 2QWNB 2Q9LA 4UVCA 4X1KB 2IJKA 1NVPB 5HFMA 1WJZA 1WNLA 3CCLV 5GW7A 3JARB 4O4HA 5KHGA 3S3WA 1MZEA 4B3RB 4I55A 1JCHA 1E79G 4H2XB 1J95A 3FB5C 3ZRWB 1T5EA 3OTFA 4YRKA 4X20A 2DWEC 1XREA 2A06H 2EINB 3B2EE 4UP7A 1RSOB 5H6QA 3UO3A 4J7ZA 2LP7A 4LNUA 4CS2A 4IHJA 1PNMA 3H1JH 1L1FA 1N33O 1YI2V 4P30A 1QR9A 1OCOB 3K3WA 5ITZA 1ZX3A 1SS3A 1IURA 1QR8A 5HGQA 2A9HA 3CHXA 2ODRD 1R6KA 3W7TA 3HFZA 3CP1A 2OCCC 5F5WA 1NJ1A 2B1IA 3NELA 3N2KB 4HYOA 2WLKA 1JQ0A 1DF5A 5LXTB 5EC1C 1WNSA 4F6RA 2UXBB 4ZOLB 2P06A 4UV8A 3SYOA 2AZ2A 3CC4V 4EB6A 3MEYA 5L3FA 2DZCA 3E8BA 3AG7A 3SYCA 1BBWA 4GKJB 2ZCEA 4YRIA 3FFQA 2VRZA 1RM1C 4NXMB 4UUJC 4WFEA 4QIWF 2Q69A 4PDRA 2DZ9A 4JI5O 2ODMA 5KMGA 3RIRA 2Q68A 3K58A 4H0LB 4K8ZA 2F23A 2WAMA 1CPYA 2ZNJA 1DTOA 3B8NA 2P5OA 3QO8A 4JI8B 1YHQV 1NR7A 5CBFA 3MF2A 4ZIBA 5CA1B 1RIQA 2ZR2A 2QHUA 3GVMA 2ARTA 2OT5A 1L0NH 1NR1A 1SZXA 2DYRB 1TUEB 2PMFA 4LNUB 1M56C 5B1BC 1FAFA 4PI2A 3NETA 3G80A 3MDSA 4LVJA 2DWDC 3VQVA 4JAUA 4R7CA 1U97A 4JI6B 1MZFA 1M57C 2EIKB 1GK9A 3K0DA 3E22A 2UXXA 3A0BZ 5D5QA 3QF7A 1AB3A 5L3DA 5CB4B 4O4IB 1S5JA 4JI4O 4LBEC 4LWSA 1QLEC 2LQTA 1BE3H 1IL2A 3DTUB 1SRYA 1P49A 3RYFA 1SQGA 1H4SA 3T1HO 4KQEA 3I56V 2PMEA 4EB6B 1M4UA 4JTAB 3SPIA 4B3SO 2P5IA 1LYLA 4U3FH 5LMNO 3IALA 2QM7A 1N36B 1UJWB 3ZJZA 1FPOA 2L35A 4DR7B 4Z1VA 3E9IA 4OX9B 5KA6A 4YJ3A 4K87A 4GYCB 3IG2A 4P3PA 3CMQA 4LF4B 4PJ0Z 1BZKA 4U3JB 1AJNA 3WU2Z 2Q5IA 4XU2A 1OHHG 3AK1A 1H2NA 1XNQB 1AP6A 2Y4TA 3JAKA 5IYBO 5JCOC 3OTOO 1SA0A 1N32O 2H94A 2AW9A 4FLWA 4I0XA 1QQCA 2RQ6A 1EM1A 4MS2A 3X2QB 3OR6C 5LP6A 4LFCB 5B3SC 2IU0A 2NN4A 4YP0A 1GM7A 2E3CA 3G6EV 1EN4A 4HWSA 1U96A 3RYHB 4P71C 4G2KA 2E5LB 4DPGA 3OD4A 4DV4O 1S5LZ 1GRJA 3ASNB 1HNXB 1QBZA 1B04A 3T1CA 2F4VB 5EBMC 3CS5A 2X0LA 2E1HA 4X89A 2UXDO 3SPCA 5FPRA 1ASZA 2ARSA 2YXHA 1R3KC 4ICGA 4YCVA 1SF9A 2OCHA 3E8HA 2HJDA 4IT5A 3EVKA 2QKSA 1P84F 1PKXA 2E75B 1JJ2U 1PL0A 3J7AU 3UGQA 3UCSC 2PTMA 4G85A 3BABA 1WAZA 2MW2B 4FM0A 1G4YB 4XTYA 5KX5A 1NBMG 1ZWIC 4J9ZB 4JI6O 4YJ3B 4FLUA 4XTUA 4OLFA 3CYOA 1G6UA 2IH1C 2K1EA 1VQOV 2CGHA 4GKKB 4R6ZA 4DQ2A 2FL4A 1IVSA 5E1AC 1NU1H 4TVAA 1NJIW 3HPLC 2R70A 3DSQA 1K5QA 1W0KG 4LF5B 2NLJC 3E35A 3ZX6A 2ZZEA 3JAKB 2DDZA 1KMNA 4D6TH 4I0XB 3ZMVA 4X65O 3REUA 3ICXA 2EULA 1YJNV 2P22C 2OCCB 4K3AA 2DQ0A 4FLVA 4DR5O 1YITV 5IJ0B 5DM6V 4DV0O 1YFTA 4P9PA 1EVKA 1IBKB 5H9CA 4DR2O 4LR3A 4P74C 4G84A 1OZ0A 2Y69C 3G6BA 4NTXA 3UFGA 3MHHC 3ZN1A 2YI8A 4DV2B 1FXKA 3CSXA 5JQGB 1RM1B 4JZGA 2YUAA 2C7IA 3B77A 4YJ2A 2C8MA 2RHQA 4X64O 2HEPA 4LP8A 3RN4A 3ZHRA 5IWAO 2E65A 5LYJB 1GTOA 2BE3A 1ZTEA 4JI2B 2Q7HA 3CJHA 4JYCA 4LVLA 5KHIA 5KUKA 4H2TA 4N23A 1K73W 1OCZC 4Q20A 3I7FA 5LHHA 3JYCA 4O4LA 1J5EO 1B8AA 1FKAO 5H6RA 2OIEA 4J11A 3L9DA 1FJGB 4YRRA 1M56B 4DRXA 1H8HG 3BPZA 5B1BB 2CH7A 2QSAA 3LUTB 4RMFA 1M57B 1Q6HA 4B3MB 4P71A 5CBGA 4H44B 4RAIA 1GN2A 1BHBA 4AH6A 1TUBB 2IH3C 3J81N 3ZHUA 1WYDA 1D5NA 1QLEB 4NYKA 2UUCO 1HNWB 1JJOA 2AHYA 5IYZA 1AP5A 4TWAA 2PYJA 4QGPA 1C0AA 1PD3A 1DK1A 1P4RA 3BEHA 3HRKA 4O2AA 4XTXA 1S3JA 1AR5A 4LF5O 4YCUA 4GX5A 5LBQA 1KUQA
chains in the Genus database with same CATH topology
1X2HA 4YRGA 2J3MA 4P75C 3RL6A 2XGTA 2DTOA 4O4HB 1X56A 3TUPA 2Q5HA 1SESA 4LF6B 3BFMA 3TEHA 4I55B 2PZSA 3PZCA 4LF7B 2EL9A 4BWAA 1IBLB 2RHQB 4LF9B 1YGBA 4UCTA 4I4TB 3RWRD 5IJ9B 2PY5A 1H2SB 4X20B 5BMVB 1PYSA 2DU5A 5JJJB 1USYC 1NNHA 2QJ1A 2CJBA 3RYIA 3HXYA 2ZIOA 3HKEA 4X1IB 3JSNA 4DK1A 2ZINA 5LMUB 3HFVA 4O4JB 1L0WA 3ERRA 3IKMB 2UUAB 5LOVB 3K5NA 2PUSA 5LA6B 4IHJB 2CAZC 4D7TA 1TUBA 4CH4A 4H2YA 2ZXFA 3IKLA 3N2KA 5C52B 4O4LB 4YY3B 3JAWA 1ASYA 1GGMA 2VWKA 2ZZFA 1EFWA 4I9QA 4UP9A 2UXCB 1YFSA 4K86A 3RKWA 1NT2B 5ITZB 4DV3B 5JH7B 2AMCA 1H4TA 3ICAA 4P3OA 1N9WA 3A7UA 5JVDB 3RKXA 2ZT6A 3LSSA 4JI0B 3UH0A 1Z5VA 4B08A 4LF8B 2QHVA 4FFBB 4YRMA 1FFXA 3PN1A 4L87A 3HFZB 1HTTA 3L4GA 2ALYA 4WI1A 4L8JA 3HKCA 1B70B 4H02A 5JJNB 4X1KB 1WNLA 3JASA 4CC6A 3JARB 4PHZA 4OP0A 1NJ6A 4O4HA 5KHGA 4B3RB 2AKWB 4P3NA 4X1YB 5IYZB 4I55A 4F6RB 1HXDA 1WQWA 4I50B 2QHTA 4H2XB 5FNVB 4DR3B 1T5EA 4I4TA 3THOA 5IJ9A 1SQFA 3OTFA 3BA8A 4X20A 2UUBB 2QM4A 2DEQA 5BMVA 2EJGA 3PCOB 3M4QA 3M7MX 1N34B 5KNNA 4HWTA 2EJ9A 3HXZA 3BJUA 1M5IA 4X1IA 3HY0A 3TEGA 2PYLA 3B2EE 3HXXA 3V7CA 4YRTA 4UP7A 4TQDA 3K5MA 2P0LA 4YRSA 4AQYB 4KR3A 4YRFA 3TEHB 4LNUA 4CS2A 5LA6A 4IHJA 5JCOA 4JI1B 3L2ZA 5KMGB 1J5WA 2Q7EA 4UP8A 4XU0A 4YRNA 1NJ2A 5J2UB 2ZT5A 1D5AA 1KU9A 2YXLA 3A5YA 1PYSB 2IY5A 2CIMA 2ZZGA 4XU1A 11ASA 3RYIB 5ITZA 3SJCC 4XU3A 5JH7A 1SERA 4WF2A 2OYQA 5HGQA 5C8YA 3CHXA 1N33B 4EO4A 2ODRD 4HWRA 4FFBA 4YYEA 1QE0A 5F5WA 3HFZA 4ZHQB 4EFBA 1NJ1A 1NJ5A 4ZI7B 3NELA 3N2KB 3N2GA 3BAAA 1B70A 3UGTA 2ZGWA 4DV6B 2XHBA 4X1KA 3OD1A 1HW7A 1VQZA 5LXTB 3P8YA 3A5ZA 3JARA 3E22B 1KMMA 4O2DA 1WPBA 1WNSA 1HC7A 1WPYA 2AKWA 1Z7MA 2RHSB 4UCRA 4Q15A 4F6RA 2QHSA 2UXBB 2DTHA 4ZOLB 4I50A 4HWOA 4TTVA 1Q3EA 4H2XA 3VQWA 1I7FA 3LSQA 4EB6A 5FNVA 3MEYA 1NYQA 3NEMA 4NCXA 2DZCA 3VQYA 4P72A 1Z5WA 1BBWA 2UU9B 2EX3A 4J15A 4GKJB 2ZCEA 2PGGA 3SR2C 3M4PA 1X01A 3JATA 4YRIA 3FFQA 4RQEA 4NXMB 2DJZA 5E3IA 3EFSA 3JASB 1XHXA 4YDQA 1Q5OA 3P8VA 1RSOA 3BRCA 2F1MA 2DTIA 3P8TA 2DZ9A 3RYFB 4RDXA 5KMGA 3RIRA 12ASA 3VQXA 3K58A 1E24A 2EAYA 2ZTGA 3SJAC 5J2UA 4K8ZA 5EIBC 3RGLA 2ZNJA 3MF1A 2P5OA 3QO8A 4JI8B 2F95B 1V9PA 3MF2A 3RF1A 4H2UA 4ZIBA 5CA1B 1RIQA 4IIJA 4JI5B 5BR8B 2QHUA 2ZR2A 4O2BA 2ARTA 3W3SA 1HR0B 4HBNA 2PMFA 3HTZA 4FLYA 1ADYA 4LNUB 2R9AA 4ZHQA 2J3LA 3NETA 4PI2A 4ZI7A 2YI9A 5ELNA 4LVJA 2BTQB 3VQVA 4X62B 2CJ9A 4JI6B 3MQZA 2GV9A 3WB1A 4PI0A 2OWOA 5LXTA 2IY5B 3E22A 3A7AA 4HVCA 5D5QA 4DV5B 1SA0B 3QF7A 3EFRA 2RHSA 5K1PA 2Q7GA 2ZT7A 4ZOLA 1TAEA 5C8YB 4LNSA 4YRQA 4DV1B 4UCVA 5CB4B 5LP6B 4O4IB 1E22A 1S5JA 3REXA 2EWNA 4YROA 1YFRA 4FVMA 3N2GB 3LC0A 2HNIA 1IL2A 1XMQB 5GONB 1SRYA 3IAYA 3JSLA 4YREA 2DKGA 4JI4B 1P49A 3RYFA 1SQGA 2DVEA 4KQEA 4P74A 1H4SA 2PMEA 4EB6B 1M4UA 1ADJA 2P5IA 1E1TA 5KHJA 4RQFA 1LYLA 4YPFA 2E10A 5CA0B 2ZM6B 3IALA 1EIYB 3HXWA 3U0ZA 3JATB 1N36B 4DR7B 4LVIA 5CA1A 4DUYB 3UQ8A 3T1HB 4OX9B 3E9IA 1NJ8A 4YJ3A 4K87A 4YHHB 4GYCB 3IG2A 4P3PA 3CMQA 1H4QA 1JFFA 4B3SB 4LF4B 2E64A 4U3JB 4GLXA 4FLTA 3V8KA 5LMNB 1M93A 3RFRA 2F93B 4WBNB 4AILC 3JALA 2Q5IA 3ETQA 4XU2A 2BTQA 1IBMB 4CC5A 4NXNB 1O9HA 1XNQB 4TVYA 1TVKA 1Z7NA 3JAKA 4WJ3M 4LH7A 4Q6GA 5JCOC 5KX5B 1SA0A 1WQ7A 4IIJB 4O2BB 3V7SA 2CJAA 5J2TB 3SJBC 1EQRA 4K88A 1I94B 4FLWA 4X5OA 4YRJA 3BA9A 1QQCA 2RQ6A 5CB4A 5LP6A 4O4IA 4HA8A 2BTOA 4LFCB 4JYAB 3MAQA 3CB2A 4TVAB 4YP0A 3NENA 4X66B 3OTOB 2E3CA 1N32B 1E1OA 2I4MA 3WQZA 1B76A 3WB0A 3A32A 4HWSA 4XTWA 3RYHB 5GONA 4P71C 4LH6A 2E5LB 4H2WA 3E9HA 4DPGA 3V8JA 3UT5A 3HRIA 3QNEA 2RJZA 1YEWA 4UCOA 4B3TB 1HNXB 5EYPB 4TUYB 4ZTUB 3A2FA 5CA0A 2YIAA 1B04A 3K59A 1QHTA 1EIYA 2NS6A 2F4VB 1L8DA 4K0KB 4DR4B 3HKBB 4DV4B 2E1HA 4DR1B 5KHHA 4XEOA 2F66C 5FPRA 1WLEA 1ASZA 4H2VA 2ARSA 4TV9B 4U3JA 2I4LA 1KOGA 5C51B 4YCVA 4UCSA 1JMKC 4P73A 4WBNA 1B7YB 2UXDB 4JI3B 4XTZA 2ZR3A 4P75A 4CH3A 3K5LA 4FM1A 1BIBA 1G5IA 3RKYA 3UGQA 3RUXA 4YRKA 2PTMA 4G85A 2DU7A 1QF6A 3BABA 4KL1A 3QO5A 4FM0A 4XTYA 5KX5A 1XHZA 1JJCA 1SKVA 3HKDA 1EOVA 3HXUA 2A8EA 4YJ3B 5J2TA 2KKWA 4FLUA 2I4NA 4XTUA 4OLFA 4KR2A 1JFFB 4UCUA 1G6UA 1BBUA 2CGHA 2YIBD 3K57A 2ZNIA 4GKKB 1Q43A 1USYA 1X55A 3HY1A 4DQ2A 4DR6B 2HHHB 3QTCA 4TVAA 3JALB 2JGUA 2R70A 3DSQA 4YJ2B 4LF5B 1ATIA 2JS5A 4CH5A 1VF7A 2DXUA 4YCWA 1TVKB 3RYHA 2ZZEA 1XNRB 4YRLA 3JAKB 4HNAB 2DDZA 2VQFB 3VBBA 2Q0AA 3U10A 1DGSA 5EZYA 1KMNA 3U11A 4EFEA 1YB3A 1X2GA 1H4VB 5EYPA 4TUYA 4ZTZB 2EJFA 3K5OA 4BW9A 4HWPA 3REUA 5JJEB 3HKBA 3ICXA 4YRCA 5FPOA 2ZIMA 4FLZA 3ZS8C 3RYCA 1EVLA 4UPAA 3G1ZA 4DRXB 2P22C 2ODRC 4TV9A 3LNNA 3UT5B 4X65B 1G51A 2DQ0A 2DXTA 4FLVA 4FM2A 4XTVA 3V8LA 5IJ0B 1B7YA 4LVMA 4LVKA 1X4TA 1YFTA 4K8XA 1EVKA 4UFZA 2XTIA 1O9GA 3BHPA 3HXVA 2JVDA 1IBKB 4DUZB 1G5HA 4TOIA 4H2SA 3KFUA 1TA8A 2FYKA 3R07A 3T1YB 4LR3A 4AHCA 4P74C 3L1AA 4DR5B 4G84A 5EIBD 4TV8A 5K1XA 3UFGA 2ZT8A 4DV0B 2DQ3A 2YI8A 4DV2B 2VWJA 3CSXA 5JQGB 4DR2B 4JI7B 1Q8IA 2C7IA 4YJ2A 2IM9A 4EEQA 1NYRA 2C8MA 2RHQA 3A7RA 2R72A 2HEPA 1FYFA 2E65A 4O2AB 5LYJB 3QG5A 4HNAA 1JJCB 3HKDB 4JI2B 3WB2A 2Q7HA 1XMOB 4E51A 4LVLA 5KHIA 4O4JA 4CS4A 4X64B 3RACA 4H2TA 5LOVA 4HT4A 2YIBA 5IWAB 3I7FA 4TVWA 2I4OA 3FJPA 1WU7A 3RGBA 4CH6A 3A74A 3A31A 4O4LA 1B8AA 4YRPA 1FJGB 5LP6C 4YRRA 4DRXA 4KHPB 4PG3A 3BPZA 2VQEB 1TGOA 5EZYB 4TQFA 3HKEB 4PHCA 5IJ0A 1XQ8A 5JVDA 1WN7A 4RMFA 2ARUA 5ELOA 1J5EB 4B3MB 4P71A 4AH6A 1TUBB 1XI1A 4JV5B 1ZAUA 1W66A 3JAWB 4NVPA 5D5PA 3RYCB 1BIAA 1WYDA 4WJ4A 4P72C 1KMIZ 4XEMA 3SGIA 4DK0A 1X54A 1HNWB 5JQGA 1JJOA 4X1YA 5IYZA 4LFAB 2AMCB 4CS3A 5C53B 4FLXA 3ZEDA 2V4DA 4TWAA 1HNZB 2E5AA 2PYJA 1C0AA 3V7RA 1FFXB 4DV7B 3L4GB 2ALYB 3HRKA 4O2AA 5LYJA 3PCOA 4D7SA 2G4CA 2UUCB 4XTXA 5KHKA 2E41A 3HKCB 4P73C 4LFBB 1SETA 4YCUA 4EX5A 4TV8B 3QO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2H A;  4YRG A;  2J3M A;  4P75 C;  3RL6 A;  2XGT A;  2DTO A;  1X56 A;  3TUP A;  2Q5H A;  1SES A;  3BFM A;  3TEH A;  3PZC A;  2EL9 A;  4BWA A;  2RHQ B;  1YGB A;  1PYS A;  2DU5 A;  1USY C;  1NNH A;  2QJ1 A;  2CJB A;  3HXY A;  2ZIO A;  2ZIN A;  3HFV A;  1L0W A;  3ERR A;  3IKM B;  2PUS A;  4CH4 A;  4H2Y A;  2ZXF A;  3IKL A;  5C52 B;  1ASY A;  1GGM A;  2ZZF A;  1EFW A;  4UP9 A;  4K86 A;  1YFS A;  3RKW A;  2AMC A;  1H4T A;  3ICA A;  4P3O A;  1N9W A;  3A7U A;  3RKX A;  2ZT6 A;  3LSS A;  3UH0 A;  2QHV A;  4YRM A;  4L87 A;  3HFZ B;  1HTT A;  3L4G A;  2ALY A;  4WI1 A;  4H02 A;  1B70 B;  1WNL A;  4OP0 A;  1NJ6 A;  2AKW B;  4P3N A;  1HXD A;  1WQW A;  2QHT A;  4H2X B;  4YRK A;  2DEQ A;  2EJG A;  3PCO B;  5KNN A;  3M4Q A;  4HWT A;  2EJ9 A;  3HXZ A;  3BJU A;  3HY0 A;  3TEG A;  3HXX A;  3V7C A;  4YRT A;  4UP7 A;  4TQD A;  4KR3 A;  2P0L A;  4YRS A;  4YRF A;  3TEH B;  4CS2 A;  3L2Z A;  1J5W A;  2Q7E A;  4UP8 A;  4XU0 A;  4YRN A;  1NJ2 A;  2ZT5 A;  3A5Y A;  1PYS B;  2IY5 A;  2CIM A;  2ZZG A;  4XU1 A;  11AS A;  4XU3 A;  1SER A;  5HGQ A;  4EO4 A;  2ODR D;  4HWR A;  4YYE A;  1QE0 A;  5F5W A;  3HFZ A;  1NJ1 A;  1NJ5 A;  3NEL A;  1B70 A;  3UGT A;  2ZGW A;  3OD1 A;  1VQZ A;  3P8Y A;  3A5Z A;  1KMM A;  4O2D A;  1HC7 A;  1WPY A;  2AKW A;  1Z7M A;  2RHS B;  4Q15 A;  4TTV A;  2QHS A;  2DTH A;  4HWO A;  4WF2 A;  4H2X A;  3VQW A;  3NEM A;  3LSQ A;  3MEY A;  1NYQ A;  4NCX A;  2DZC A;  3VQY A;  4P72 A;  1BBW A;  4J15 A;  2ZCE A;  2PGG A;  3M4P A;  1X01 A;  4YRI A;  4RQE A;  2DJZ A;  5E3I A;  3EFS A;  4YDQ A;  3P8V A;  3P8T A;  2DTI A;  2DZ9 A;  4RDX A;  3RIR A;  12AS A;  3VQX A;  1E24 A;  2EAY A;  2ZTG A;  3RGL A;  2ZNJ A;  3MF1 A;  3QO8 A;  3MF2 A;  3RF1 A;  4H2U A;  4ZIB A;  1RIQ A;  2QHU A;  2ZR2 A;  2ART A;  3W3S A;  2PMF A;  3HTZ A;  1ADY A;  2J3L A;  3NET A;  2YI9 A;  5ELN A;  3VQV A;  2CJ9 A;  2IY5 B;  4HVC A;  3A7A A;  3EFR A;  2RHS A;  5K1P A;  2Q7G A;  2ZT7 A;  4LNS A;  4YRQ A;  1E22 A;  3REX A;  2EWN A;  4YRO A;  1YFR A;  3LC0 A;  2HNI A;  1IL2 A;  1SRY A;  4YRE A;  2DKG A;  1H4S A;  2DVE A;  4KQE A;  4P74 A;  2PME A;  1ADJ A;  2P5I A;  1E1T A;  4RQF A;  1LYL A;  4YPF A;  2E10 A;  3IAL A;  1EIY B;  3HXW A;  3E9I A;  1NJ8 A;  4K87 A;  1H4Q A;  3IG2 A;  4P3P A;  3CMQ A;  2E64 A;  3V8K A;  2Q5I A;  4XU2 A;  1O9H A;  4TVY A;  1Z7N A;  4WJ3 M;  4Q6G A;  1WQ7 A;  3V7S A;  2CJA A;  1EQR A;  4K88 A;  4X5O A;  4YRJ A;  2RQ6 A;  4HA8 A;  4TVA B;  4YP0 A;  3NEN A;  2E3C A;  2I4M A;  1E1O A;  3WQZ A;  1B76 A;  3A32 A;  4HWS A;  4XTW A;  4P71 C;  4H2W A;  3E9H A;  4DPG A;  3V8J A;  3HRI A;  3QNE A;  2RJZ A;  4ZTU B;  2YIA A;  1EIY A;  2E1H A;  4XEO A;  1WLE A;  1ASZ A;  4H2V A;  2ARS A;  2I4L A;  1KOG A;  5C51 B;  4YCV A;  4P73 A;  1B7Y B;  4XTZ A;  2ZR3 A;  4P75 A;  4CH3 A;  1G5I A;  1BIB A;  3RKY A;  3UGQ A;  3RUX A;  4G85 A;  2DU7 A;  1QF6 A;  3QO5 A;  4XTY A;  1JJC A;  1EOV A;  3HXU A;  2I4N A;  4XTU A;  4OLF A;  4KR2 A;  1G6U A;  1BBU A;  2CGH A;  2YIB D;  1X55 A;  2ZNI A;  1USY A;  4DQ2 A;  3HY1 A;  3QTC A;  4TVA A;  2R70 A;  3DSQ A;  1ATI A;  4CH5 A;  2DXU A;  4YCW A;  2ZZE A;  4YRL A;  2DDZ A;  3VBB A;  1KMN A;  1YB3 A;  1X2G A;  1H4V B;  4ZTZ B;  2EJF A;  4BW9 A;  4HWP A;  3REU A;  4YRC A;  2ZIM A;  1EVL A;  4UPA A;  3G1Z A;  2ODR C;  1G51 A;  2DQ0 A;  2DXT A;  4XTV A;  3V8L A;  1B7Y A;  1YFT A;  1EVK A;  2XTI A;  1O9G A;  3BHP A;  4H2S A;  2JVD A;  1G5H A;  3HXV A;  3KFU A;  2FYK A;  3R07 A;  4P74 C;  3L1A A;  4G84 A;  5K1X A;  3UFG A;  2ZT8 A;  2DQ3 A;  2YI8 A;  2C7I A;  1NYR A;  3A7R A;  2C8M A;  2RHQ A;  2R72 A;  2HEP A;  1FYF A;  2E65 A;  1JJC B;  2Q7H A;  4E51 A;  4CS4 A;  3RAC A;  4H2T A;  2YIB A;  3I7F A;  4TVW A;  2I4O A;  3FJP A;  1WU7 A;  4CH6 A;  3A74 A;  3A31 A;  1B8A A;  4YRP A;  4YRR A;  4PG3 A;  4TQF A;  4PHC A;  4RMF A;  2ARU A;  5ELO A;  4P71 A;  4AH6 A;  1W66 A;  1BIA A;  1WYD A;  4WJ4 A;  4P72 C;  4XEM A;  1X54 A;  2AMC B;  4CS3 A;  5C53 B;  3ZED A;  4TWA A;  2E5A A;  1C0A A;  3V7R A;  3L4G B;  2ALY B;  3HRK A;  3PCO A;  4XTX A;  2G4C A;  2E41 A;  4P73 C;  1SET A;  4YCU A;  4EX5 A;  3QO7 A; 
#chains in the Genus database with same CATH topology
 1X2H A;  1AR1 B;  3RL6 A;  2DTO A;  2Q5H A;  3TEH A;  4P2Z A;  4LF7 B;  4LCU C;  2RHQ B;  4LF9 B;  4QE9 A;  2UUA O;  3PJS K;  4I4T B;  2PY5 A;  2JEX A;  2JDI G;  1NNH A;  1YXB A;  2B1G A;  3HXY A;  3HKE A;  4X1I B;  1L0W A;  3W7W A;  3D3I A;  3K5N A;  5L3G A;  2CAZ C;  4DV3 O;  4CH4 A;  2ZXF A;  5C52 B;  1MNG A;  4O4L B;  1GGM A;  1XBL A;  3FD9 A;  5KA5 A;  4UP9 A;  5B3S B;  4K86 A;  2IW5 A;  3CCU V;  3C3T A;  1N0N A;  3KCY A;  3O65 A;  2AMC A;  3AEI A;  3L72 H;  3ICA A;  4R50 A;  3LSS A;  4JI0 B;  1F4N A;  4LF8 B;  2QHV A;  3E8G A;  3J80 N;  5DN6 G;  2KSD A;  1GM9 A;  2F43 G;  2IJI A;  4I5S A;  4DR3 O;  1B70 B;  5JJN B;  5KAF Z;  2XAJ A;  1KQS U;  2UUB O;  1N34 O;  3C3S A;  2YC0 A;  2AKW B;  2ADP A;  4P3N A;  5IYZ B;  1HXD A;  3Q4H A;  1WQW A;  4I50 B;  1PNL A;  5FNV B;  4A5U B;  4C7U A;  3THO A;  5IJ9 A;  1SQF A;  2DEQ A;  2N74 A;  3M7M X;  3AG3 C;  4HWT A;  2EJ9 A;  4JAA A;  3BJU A;  1M5I A;  3LSU A;  3TEG A;  2ATK C;  1RPO A;  3K5M A;  4KR3 A;  5F2V O;  3TEH B;  2GSM B;  2LFS A;  5LA6 A;  3BCC H;  2BOB C;  4NTW A;  4UP8 A;  1S0V A;  2B5U A;  1NJ2 A;  3T4D A;  1D5A A;  4MT8 A;  2P4V A;  2ZZG A;  4XU1 A;  5CN0 A;  3SJC C;  4XU3 A;  3IJ4 A;  1VF6 C;  4QPJ A;  4QE7 A;  2O57 A;  3CCV V;  1N33 B;  4EO4 A;  4FFB A;  2XAF A;  2HJF C;  4ZI7 B;  3CCM V;  3BAA A;  2QKA A;  3ZRS A;  4X1K A;  4DV6 B;  2QWO B;  3OD1 A;  1QVF U;  2UU9 O;  2JS3 A;  3A5Z A;  3JAR A;  1H2M A;  1WPY A;  1Z7M A;  4ASU G;  2QHS A;  4GUN A;  4H2X A;  1I7F A;  3NEM A;  3ZRW A;  4GCZ A;  4PA6 A;  3VQY A;  4J15 A;  2RCV A;  4LF7 O;  1QCE A;  4J10 A;  2CK3 G;  2DJZ A;  5E3I A;  1LR1 A;  3LDD A;  3ZRV A;  1VQ4 V;  1XHX A;  2QTS A;  3P8V A;  1RSO A;  2F1M A;  2DTI A;  5B1O A;  3CPW U;  3JD1 A;  5BR8 O;  3Q4H B;  2Y69 B;  12AS A;  1VP7 A;  3OEE G;  2EAY A;  3RGL A;  4DW0 A;  3MF1 A;  2ADQ B;  2F95 B;  3CRM A;  1V9P A;  3RF1 A;  4H2U A;  4JI5 B;  3F5W C;  4UXN A;  4HBN A;  4FLY A;  1SQQ H;  4DV5 O;  2J3L A;  1R6N A;  3D36 A;  2BTQ B;  3TGU H;  4X62 B;  1B6Q A;  4DV1 O;  3MQZ A;  2OWO A;  1OCZ B;  4K35 A;  5LXT A;  4HVC A;  2QWR B;  1I08 A;  4ZOL A;  1XMQ O;  1Y66 A;  4UCV A;  3REX A;  3ABM C;  2EWN A;  2ZDI A;  4FVM A;  2WLM A;  3LC0 A;  3IAY A;  5EBW C;  1KP2 A;  4JI4 B;  1ROP A;  1RP3 B;  4DUY O;  1BQ0 A;  4YHH O;  2IJJ A;  1ADJ A;  4RQF A;  4YPF A;  3H01 A;  5CA0 B;  2E10 A;  4E2L A;  3U0Z A;  1SQB H;  2XAQ A;  5CA1 A;  1IBM O;  3UQ8 A;  3T1H B;  4NXN O;  2CGO A;  3MD0 A;  3BY6 A;  1IX9 A;  4B3S B;  5BY1 A;  4FLT A;  2ZXW C;  2DYS C;  5LMN B;  3RFR A;  3ASO C;  4AIL C;  5J9P C;  4BW5 A;  4CC5 A;  2BOC C;  4TVY A;  3LDE A;  4OXS A;  4MTX A;  1PPJ H;  1TVK A;  5CMU A;  3EXA A;  1ENV A;  2CJA A;  5J2T B;  4DV6 O;  1EQR A;  4X5O A;  4B7K A;  5CB4 A;  4O4I A;  3H1I H;  3I55 V;  3HR0 A;  3NEN A;  3OTO B;  1N32 B;  1VQ6 V;  3AG2 C;  5TIS Z;  1BS3 A;  4BR6 A;  1AI4 A;  1VQ7 V;  4DR4 O;  1P7G A;  2RJZ A;  1WA8 B;  2ILM A;  4PA9 A;  1YF2 A;  3R65 A;  4R8C A;  4OPA A;  1K34 A;  4ZTU B;  1XL4 A;  2RN9 A;  1FS0 G;  3CCS V;  3K59 A;  3HKB B;  4FZ1 A;  4DV4 B;  2IJH A;  1R6T A;  1WP8 A;  1L0L H;  4JI3 O;  3ZHQ A;  4XEO A;  2CTQ A;  2F66 C;  2CTR A;  1NTK H;  4JYY A;  1WLE A;  5KLV H;  4H2V A;  3DXR B;  5B66 Z;  4TV9 B;  4U3J A;  2I4L A;  3E86 A;  3FB6 C;  5C51 B;  1WB7 A;  4UCS A;  1VQ9 V;  1JMK C;  1BL8 A;  2AHZ A;  2UXD B;  1BSM A;  1K5S A;  2ZR3 A;  1G5I A;  3RKY A;  2Z3Y A;  3RUX A;  2DU7 A;  1QF6 A;  5LHG A;  2RMK B;  3OW2 U;  1XHZ A;  4X62 O;  3HKD A;  2YEV B;  1X55 A;  1Q86 W;  1PL4 A;  1Q43 A;  3SYA A;  1IXM A;  1USY A;  3HY1 A;  3AG3 B;  2Y4U A;  1AVM A;  2LW7 A;  4BAY A;  2JGU A;  1LUW A;  3TXQ A;  3KCX A;  1VF7 A;  3OGC C;  1TVK B;  3RYH A;  1S77 D;  1AI5 A;  2XUM A;  5EZY A;  4EFE A;  1YB3 A;  3CC7 V;  2QM8 A;  1H4V B;  2Q8V A;  4ZTZ B;  2W6I G;  4W4L A;  4JZ2 A;  3OMI B;  3K0G A;  5IY5 C;  3OGI B;  3ZS8 C;  3P32 A;  4I9W A;  3G1Z A;  1HP8 A;  4X65 B;  3LNN A;  1KC8 W;  2WA4 A;  1N4C A;  3T1Y O;  2DXT A;  3ETG A;  4F6E A;  3V8L A;  1K4C C;  2P90 A;  5A2Q N;  1X4T A;  4UFZ A;  1O9G A;  4FFK A;  2H3O A;  2ETN A;  3HXV A;  4H2S A;  3KFU A;  4JI7 O;  3R07 A;  3JCZ A;  3K08 A;  4PA3 A;  4DR5 B;  1YJ9 V;  3ZRX A;  3BFR A;  4DV0 B;  2Q4P A;  1VQP V;  4DR2 B;  1Q8I A;  3OE7 G;  4EEQ A;  1NYR A;  3A7R A;  1R73 A;  4XDL A;  4PDM A;  3OMN B;  2QR4 A;  3QG5 A;  4OGQ B;  3HKD B;  5BXZ A;  3ZMU A;  3CRA A;  2XAH A;  4E51 A;  4TSF G;  1VAR A;  2GTA A;  4O4J A;  4X64 B;  1YZB A;  4KHP O;  5IWA B;  1WU7 A;  3RGB A;  3ZN0 A;  3KKY A;  1P7B A;  4CH6 A;  5IYC O;  2WWW A;  4MVO A;  1GN6 A;  4JV5 O;  1YTF D;  1TGO A;  5EZY B;  5IJ0 A;  1NKD A;  1Y4M A;  1MA1 A;  2ARU A;  1J5E B;  3SPG A;  1XI1 A;  3STL C;  2JJ1 G;  3SYP A;  1AR4 A;  1RFY A;  5D5P A;  3DC6 A;  4DV7 O;  3ABM B;  1S5H C;  2K9P A;  1KMI Z;  3DC5 A;  4MTG A;  4FZ0 A;  3CXC U;  1YTF B;  1VQM V;  4LFB O;  5JQG A;  4X1Y A;  1VMG A;  4WFH A;  4CS3 A;  3P3P A;  3ZBH A;  1HNZ B;  1R3L C;  1FFX B;  4LF6 O;  2ALY B;  5LYJ A;  3AK2 A;  1AJP A;  2UUC B;  1V55 C;  3HKC B;  1IBL O;  1BQZ A;  4P73 C;  4EX5 A;  5L3C A;  1EBO A;  1NS1 A;  5DED A;  3SPH A;  4P75 C;  2G38 A;  1VEW A;  5H2F Z;  1SES A;  3P3N A;  2YS8 A;  2ITC C;  1MSD A;  1AI6 A;  1H2S B;  2ZXW B;  2DYS B;  5BMV B;  1PYS A;  2QJ1 A;  3ASO B;  4YXW G;  4G27 B;  2ZIO A;  1EN5 A;  4YY3 O;  4O4J B;  3ERR A;  3IKM B;  2UUA B;  1OJH A;  1K8A W;  4WCE V;  1COW G;  5GTH Z;  4DW1 A;  3I5D A;  4F4L A;  1TUB A;  3M99 B;  3IKL A;  1ASY A;  1LNQ A;  4I9Q A;  2L6L A;  3RKW A;  1NT2 B;  4DV3 B;  5JH7 B;  3OR7 C;  3AG2 B;  1K7D A;  1SQV H;  3A7U A;  3CE2 A;  2YIC A;  1Z5V A;  4B08 A;  2HKO A;  1R1B A;  4L8J A;  1NH2 D;  2DJV A;  5E79 Z;  5FLX N;  3D3Q A;  3JAS A;  4PHZ A;  4Z2W A;  3ABL C;  4X9Q A;  4X1Y B;  3F7V C;  4MTO A;  2QHT A;  4FIP C;  4DR3 B;  4I4T A;  4AQY O;  3BA8 A;  2UUB B;  2QM4 A;  2EJG A;  4JI1 O;  3OFN G;  3M4Q A;  1N34 B;  2JK5 C;  1SZT A;  2ZE5 A;  4MW8 A;  3HXZ A;  1G8M A;  1FFT B;  3ZCC A;  4JYB A;  1HWY A;  4X1I A;  3VOU A;  1NH2 B;  1PP9 H;  3HXX A;  4YRT A;  2P0L A;  1JVM A;  5JCO A;  1SQX H;  1E1R G;  3EHB B;  3E89 A;  4YRN A;  5J2U B;  2ZT5 A;  2OTL V;  4DYL A;  1PYS B;  1CP9 A;  11AS A;  1ZSP A;  4QPK A;  1SER A;  2OYQ A;  2DW4 A;  1PV0 A;  5IT9 N;  4YYE A;  1QE0 A;  3TET A;  3FYI B;  2P6J A;  4ZHQ B;  4EFB A;  4XBF A;  1NJ5 A;  1QVG U;  1HNZ O;  3N2G A;  4TT3 G;  1B70 A;  3UGT A;  2ZGW A;  2XHB A;  1HW7 A;  1VQZ A;  1GKF A;  4Z1M G;  1KMM A;  3RVY A;  2QGN A;  4O2D A;  1WPB A;  1AIL A;  4GX2 A;  2AKW A;  2RHS B;  4TTV A;  4I50 A;  5IY5 B;  5FNV A;  2R9R B;  4NCX A;  2X6A A;  1BCC H;  1Z5W A;  3E2E A;  2UU9 B;  2EX3 A;  2ZE7 A;  2QKC A;  2PGG A;  3M4P A;  1X01 A;  4RQE A;  5IDJ A;  1SC5 B;  3JAS B;  2P7T C;  1H2K A;  4JGS A;  1Q5O A;  2WLI B;  3BRC A;  4X88 A;  4BIO A;  3P8T A;  3JD3 A;  4RDX A;  2EIL C;  1JPX A;  3TXS A;  3VQX A;  1HR0 O;  1E24 A;  3KZI Z;  2ZTG A;  5EIB C;  2B9Z A;  1ORQ C;  3UM7 A;  1VQ5 V;  5CBH A;  4MVS A;  3ZIA G;  4IIJ A;  5BR8 B;  2Q67 A;  4O2B A;  3HTZ A;  1QU7 A;  5B1A C;  3CCQ V;  3FB7 C;  2R9A A;  3CWB H;  4CBC A;  2QA4 V;  4ZI7 A;  2CJ9 A;  2GV9 A;  3WB1 A;  3S3X A;  1XIL A;  4PI0 A;  1X59 A;  2FTK A;  1R3I C;  4PDL A;  3A7A A;  5LL6 Y;  4DV5 B;  1JOY A;  2HP8 A;  2Q7G A;  5A9G A;  5LGT A;  4YRQ A;  4DV1 B;  3C90 A;  1E22 A;  2BCC H;  4U7O A;  2W0F C;  3N2G B;  2HNI A;  5BZB A;  2ZM6 O;  1XMQ B;  5GON B;  1THZ A;  2QEX V;  3LDC A;  3CRQ A;  2KG7 B;  3AK3 A;  2DVE A;  4P74 A;  4WFA V;  1K9M W;  1E1T A;  5KHJ A;  2ZE8 A;  2LGW A;  1EIY B;  4UVA A;  4X8A A;  1GH6 A;  4J42 A;  4DUY B;  1H2G A;  2WSS G;  4YHH B;  1JFF A;  4GLX A;  3JD2 A;  1M93 A;  2F93 B;  1V55 B;  5B5E Z;  4WBN B;  4FPP A;  3JAL A;  3ETQ A;  2BTQ A;  1IBM B;  4NXN B;  3N27 A;  3CXH F;  3TCU A;  4JYA O;  4WJ3 M;  3JCU Z;  4Q6G A;  4X66 O;  1WQ7 A;  4IIJ B;  4WFG A;  4O2B B;  4OPH A;  1I94 B;  2FKX A;  3BVO A;  1YVW A;  1EFR G;  3RW0 A;  1LUV A;  3STZ C;  3CB2 A;  3MAQ A;  4PD4 F;  4B3T O;  1B3Q A;  2I4M A;  2Y0P A;  1E1O A;  4P9O A;  4MW3 A;  3A8T A;  4K0K O;  3HRI A;  2Q6A A;  4DR1 O;  2CUG A;  1YEW A;  2A79 B;  4UCO A;  3G71 V;  1Y76 B;  3W7U A;  4JPR A;  5EYP B;  4TUY B;  2N05 A;  5CA0 A;  2NS6 A;  2XOK G;  4DR4 B;  2PF4 E;  2JEU A;  5KHH A;  4UVB A;  2JIZ G;  3ZMS A;  3UKM A;  2EJR A;  2Q0O C;  1MG1 A;  4GX1 A;  4W4K A;  2Q5Z A;  1B7Y B;  3CCE V;  1B06 A;  4JI3 B;  4XTZ A;  1VQ8 V;  4CH3 A;  1Y6X A;  1GN4 A;  3ABL B;  4DR6 O;  4NR1 A;  3QO5 A;  3CRR A;  2CGN A;  1JJC A;  2A3Q A;  3ZHT A;  2KQX A;  5J2T A;  2I4N A;  4GX0 A;  1QLN A;  1JFF B;  2W0X A;  2CTW A;  1XNR O;  2X6B A;  2YIB D;  3K57 A;  2ZNI A;  1BBU A;  1DLB A;  3JAL B;  4I7Z B;  3OUS A;  1M1K W;  4CH5 A;  4B7E A;  3AG1 C;  2DXU A;  4YCW A;  2ZD9 A;  3K04 A;  2BSK B;  4YRL A;  4HNA B;  2VQF B;  4JAS A;  3VBB A;  2Q0A A;  3U10 A;  1WP7 A;  1WA8 A;  1VQK V;  1XOU A;  4U7N A;  1FYJ A;  3B8M A;  4PEL A;  2EJF A;  2FB5 A;  4HWP A;  3CC2 V;  1KBH A;  3HKB A;  3NXS A;  4UB8 Z;  4J41 A;  4IL6 Z;  3TK1 A;  5FL7 G;  1EVL A;  3F5T A;  1KP3 A;  5EC2 C;  2A7W A;  2QWQ B;  3DXR A;  4TV9 A;  4DUZ O;  1GO3 F;  4DXW A;  1G51 A;  3P30 A;  5LHI A;  4WFB V;  4LVM A;  4LVK A;  1A32 A;  1I0H A;  3R66 A;  2JVD A;  1G5H A;  2ITD C;  4J7J A;  2FYK A;  3T1Y B;  4AHC A;  3L1A A;  5EIB D;  1I5Y A;  2ZT9 B;  4TV8 A;  3GWO A;  4NTY A;  5K1X A;  2YEV A;  1K97 A;  3OMA B;  2DQ3 A;  2VWJ A;  1EZJ A;  3OUF A;  1XMO O;  4JI7 B;  3K06 A;  1I94 O;  1MAB G;  2GUZ A;  3ETD A;  1FYF A;  3LNM B;  2EIL B;  1JJC B;  3WB2 A;  2WLL B;  2RNB A;  1NZ6 A;  4CS4 A;  1AI7 A;  2WLN A;  2VQE O;  4HT4 A;  2MK3 A;  2HVK C;  3FJP A;  2DMX A;  1VF6 A;  3A31 A;  2QE7 G;  1QNM A;  3JAM N;  2YDE A;  2A0L A;  5B1A B;  1W59 A;  5LP6 C;  3ZMT A;  4KHP B;  2WA3 A;  1XQ8 A;  3OM3 B;  1WN7 A;  1ZL8 A;  4DO2 A;  1H38 A;  1F51 A;  4LFA O;  2WLJ A;  4JV5 B;  3E8F A;  1W66 A;  1Y74 B;  3JAW B;  1JX9 A;  2GBO A;  4N21 A;  1BIA A;  3L70 H;  2EBO A;  4WJ4 A;  4P72 C;  2ZKO A;  4DK0 A;  1X54 A;  1GMG A;  1XEQ A;  5C53 B;  4FLX A;  2V4D A;  3RT3 C;  3H1L H;  3SDL A;  1KYO F;  4MVM A;  2YXY A;  4DV7 B;  1VQN V;  2D2C B;  3L4G B;  3PCO A;  2G4C A;  1SET A;  4LFB B;  4TV8 B;  5AG2 A;  3SJQ C;  4RO2 A;  3IC9 A;  3ABT A;  1BHA A;  1Q81 W;  3QVN A;  4YRG A;  2XGT A;  4O4H B;  3TUP A;  2VQF O;  4LF6 B;  3BFM A;  4I55 B;  3PZC A;  3K03 A;  1IBL B;  2GUZ B;  4UCT A;  4H13 B;  3RWR D;  4X20 B;  1K3E A;  5JJJ B;  2CJB A;  4HAM A;  1IZ3 A;  3RYI A;  3NR7 A;  1MMM A;  3T4Z A;  2HLD G;  2ZIN A;  5LMU B;  5B1N A;  3HFV A;  4KP4 A;  1DF4 A;  2UXC O;  4G28 B;  4MTF A;  4QJF B;  1FD9 A;  2PUS A;  2X7R B;  4IHJ B;  4MVZ A;  3B40 A;  4H2Y A;  2ARH A;  1FXH A;  3JD0 A;  4YY3 B;  5IYD O;  1YFS A;  3OT7 A;  3WG7 C;  2P67 A;  5ITZ B;  2LJ2 A;  4P3O A;  1N9W A;  3RKX A;  2ZT6 A;  1ZL8 B;  3FYE B;  4YRM A;  1FFX A;  4L87 A;  3HFZ B;  4B3R O;  4J9Y B;  2ALY A;  4WI1 A;  4H02 A;  3HKC A;  5KAI Z;  1VIB A;  1JR9 A;  4CC6 A;  1ZUQ A;  3K9S A;  3ZMZ A;  1NJ6 A;  4OP0 A;  1KKD A;  1Z2G A;  4F6R B;  4ZKI A;  3G4S V;  1PM9 A;  2W6J G;  5BMV A;  3PCO B;  5KNN A;  1FXK C;  4J80 A;  1V54 C;  3B09 A;  5KUM A;  3EFF K;  1UPG A;  3GB7 C;  3HY0 A;  2PYL A;  3V7C A;  2C2A A;  4TQD A;  4FK5 C;  4YRS A;  3MHS C;  4AQY B;  4YRF A;  2Z5U A;  1OV9 A;  1JA8 A;  1CXZ B;  4JI1 B;  3L2Z A;  5KMG B;  1UFI A;  1J5W A;  2Q7E A;  4XU0 A;  3CME V;  1KU9 A;  1XL6 A;  2YXL A;  1S72 V;  4BIU A;  3A5Y A;  4CZZ A;  2IY5 A;  5HFL A;  2CIM A;  1OCR C;  4LC1 A;  2Y48 A;  2DOS A;  3RYI B;  3E83 A;  5JH7 A;  4RWU A;  4JTC B;  3L71 H;  5C8Y A;  3AG1 B;  4HWR A;  2HVJ C;  3SYQ A;  4MVR A;  2UXB O;  3CCR V;  1URF A;  3CMA V;  2D3O W;  1F4M A;  1YJW V;  3P8Y A;  3E22 B;  4GKJ O;  2EZO A;  3GWK C;  4NXM O;  1K33 A;  1HC7 A;  4Q15 A;  4UCR A;  2NNU A;  2DTH A;  4HWO A;  4WF2 A;  3K79 A;  1Q3E A;  3VQW A;  3LSQ A;  1NYQ A;  4GT1 A;  3IGA C;  4P72 A;  4LWS B;  2UXN A;  2OTJ V;  3ABU A;  3SR2 C;  3JAT A;  4AI8 A;  3EFS A;  2HR3 A;  2XT9 A;  4YDQ A;  4JI8 O;  1OCC C;  2QTO A;  5EBL C;  4PA4 A;  4ZBM A;  3RYF B;  3O9O A;  4RUF A;  5LMU O;  5LGN A;  2ZQM A;  3SJA C;  5J2U A;  4XDJ A;  4IYH A;  1NTZ H;  4NB5 A;  1D2D A;  1F7Y A;  1BGY H;  2XND G;  3D8C A;  3W3S A;  5L3E A;  1HR0 B;  3B4S A;  1ADY A;  4ZHQ A;  2KB1 A;  2YI9 A;  5ELN A;  4BIZ A;  4NKG B;  2IY5 B;  3OAA G;  1SA0 B;  4MSW C;  3EFR A;  2RHS A;  5K1P A;  2ZT7 A;  1TAE A;  5JWP A;  5C8Y B;  4LNS A;  2EIM C;  5LP6 B;  2JJ2 G;  4YRO A;  1YFR A;  3L74 H;  1FXV A;  4WFF A;  1NTM H;  1NQT A;  2WPD G;  1G1X B;  3W7X A;  5H5N A;  3F7Y C;  2Y0I A;  4YRE A;  3JSL A;  2WLI A;  2DKG A;  1N36 O;  4DR7 O;  1Q6U A;  4OX9 O;  2JRI A;  4LF4 O;  2JGD A;  3AG4 C;  1PNK A;  2ZM6 B;  3HXW A;  3ABK C;  3JAT B;  3CX5 F;  4LVI A;  3SPJ A;  2V7Q G;  1XNQ O;  1NJ8 A;  1Q7Y W;  4PA7 A;  4TWK A;  3WFV A;  2NR5 A;  1H4Q A;  4WF9 V;  2E64 A;  3RVZ A;  3V8K A;  3ML0 A;  3L73 H;  2P4K A;  2EIJ C;  1O9H A;  4JF3 A;  2LGQ A;  4LFC O;  3FAV A;  1Z7N A;  4LH7 A;  5KX5 B;  1F23 A;  3IFX A;  3V7S A;  3SJB C;  4K88 A;  4YRJ A;  3BA9 A;  2QWP B;  2V1D A;  2E76 B;  2E5L O;  4HA8 A;  2BTO A;  4JYA B;  4TVA B;  2CE4 A;  4X66 B;  5L3B A;  2HFE C;  2FYU H;  1HNX O;  3WQZ A;  1AJQ A;  2CTP A;  3WB0 A;  1B76 A;  3A32 A;  1EZV H;  5GON A;  2FML A;  4LH6 A;  4H2W A;  2F4V O;  4PV1 B;  3E9H A;  1H2L A;  3UT5 A;  2PI5 A;  3V8J A;  3A0H Z;  3QNE A;  2KG7 A;  2M6Y A;  4B3T B;  3H1H H;  1CEZ A;  1Q90 D;  3FX7 A;  3A2F A;  2YIA A;  4KUM A;  3WG7 B;  1EIY A;  1QHT A;  1L8D A;  4K0K B;  1IXB A;  1MOF A;  4DR1 B;  1ARO P;  2ZE6 A;  1YIJ V;  1H8E G;  4RUE A;  2DE0 X;  2EZP A;  4UB6 Z;  2X6C A;  1KOG A;  4IYI A;  2IU3 A;  3ZHS A;  4P73 A;  4WBN A;  2EIN C;  3ETE A;  2LW1 A;  2LFR A;  2QDO A;  4H33 A;  2JGD B;  3DGE A;  4KXR A;  4P75 A;  4FM1 A;  3K5L A;  4GKK O;  1BIB A;  1IDS A;  1EN6 A;  2RDC A;  4KL1 A;  4HZ3 A;  1M90 W;  2M7W A;  1S76 D;  1SKV A;  1EOV A;  3HXU A;  2A8E A;  2KKW A;  5IE9 A;  4KR2 A;  1WPX A;  4UCU A;  1ZLZ A;  1FXK B;  2LO1 A;  1OCO C;  4YIP A;  1V54 B;  2Q73 A;  2XAG A;  4DR6 B;  2HHH B;  3QTC A;  2N04 A;  2R9I A;  4IGG A;  5GTI Z;  4YJ2 B;  2AZ0 A;  4ABM A;  1ATI A;  1RPR A;  2JS5 A;  3FAV B;  2YSU B;  4FMT A;  1XNR B;  2E74 B;  1VF5 B;  3UO2 A;  3D36 C;  1DGS A;  3CJH B;  3U11 A;  1X2G A;  1R3J C;  1YDX A;  1Y76 A;  3TJT A;  1BMF G;  5EYP A;  4TUY A;  5CA3 A;  1KEC A;  1OCR B;  3RBZ A;  2OIG A;  3K5O A;  3JD4 A;  3M8A A;  4BW9 A;  2IBZ H;  5JJE B;  5EK0 A;  4YRC A;  5FPO A;  2ZIM A;  4FLZ A;  3OEH G;  3RYC A;  2CDY A;  4UPA A;  4DRX B;  2ODR C;  1IBK O;  3UT5 B;  2CH7 B;  4FM2 A;  4XTV A;  2ZDI C;  1B7Y A;  5C93 A;  2YID A;  4DV2 O;  4K8X A;  2XAS A;  2XTI A;  3BHP A;  4DUZ B;  4TOI A;  1TA8 A;  3T2M A;  2HG5 C;  2GDS A;  4FJC C;  1Y67 A;  1N0J A;  2ZT8 A;  1Q6I A;  2WLH A;  3L75 H;  4JI2 O;  4H37 A;  1MSW D;  2IM9 A;  2DN9 A;  2R72 A;  1OCC B;  2DYR C;  4O2A B;  2BSK A;  4HNA A;  1KD1 W;  1XMO B;  1K92 A;  4EKW A;  3W7S A;  4QNH B;  1FJG O;  3RAC A;  4JTD B;  5LOV A;  2EIK C;  2YIB A;  4MVU A;  4TVW A;  1YSC A;  2I4O A;  1BT8 A;  1E1Q G;  2H8P C;  3A74 A;  4MVQ A;  3CRC A;  4B3M O;  4YRP A;  1KKC A;  3CEI A;  1GM8 A;  3H1K H;  1K4D C;  2GHY A;  3IC7 A;  4PG3 A;  2VQE B;  1XDC A;  3CD6 V;  4TQF A;  3HKE B;  4PHC A;  5JVD A;  4JAV A;  5ELO A;  1HNW O;  4XDK A;  1ZAU A;  2EIM B;  4NVP A;  3A0R A;  3RYC B;  1SQP H;  3G67 A;  2XTA A;  3CCJ V;  4XEM A;  3SGI A;  2VS0 A;  4LFA B;  2AMC B;  4E4E A;  3ZED A;  2E5A A;  5LGU A;  1GN3 A;  3V7R A;  1WB8 A;  3APQ A;  2HHH O;  4D7S A;  2AXT Z;  5KHK A;  2E41 A;  1VQL V;  4LF9 O;  2WLL A;  3KG2 A;  1W0J G;  3QO7 A;  3AG4 B;  4XTW A;  4UV9 A;  4PDV A;  2J3M A;  1X56 A;  3ABK B;  1HDJ A;  2PZS A;  4J7K A;  2EL9 A;  3APO A;  4BWA A;  1Q82 W;  1YGB A;  5IJ9 B;  3FB8 C;  4KFM A;  3X2Q C;  2DU5 A;  1USY C;  2EIJ B;  3K9A A;  3H9V A;  4DK1 A;  3JSN A;  1XUQ A;  1NI8 A;  5LOV B;  1US6 A;  5LA6 B;  2EJ7 A;  4D7T A;  1W2B U;  1N8R W;  1M9N A;  2PI4 A;  3N2K A;  4JI0 O;  1Y74 A;  3JAW A;  1NVP D;  4LF8 O;  3ASN C;  2VWK A;  2ZZF A;  3ZHV A;  1EFW A;  2UXC B;  1I5X A;  1KB9 F;  3HB3 B;  2AGA A;  1H4T A;  5JVD B;  2GTS A;  5DEC A;  3UH0 A;  1GAX A;  1YCI A;  4FFB B;  3PN1 A;  3FKS G;  4YIO A;  1HTT A;  3L4G A;  2Z0A A;  4GZR B;  2QWN B;  2Q9L A;  4UVC A;  4X1K B;  2IJK A;  1NVP B;  5HFM A;  1WJZ A;  1WNL A;  3CCL V;  5GW7 A;  3JAR B;  4O4H A;  5KHG A;  3S3W A;  1MZE A;  4B3R B;  4I55 A;  1JCH A;  1E79 G;  4H2X B;  1J95 A;  3FB5 C;  3ZRW B;  1T5E A;  3OTF A;  4YRK A;  4X20 A;  2DWE C;  1XRE A;  2A06 H;  2EIN B;  3B2E E;  4UP7 A;  1RSO B;  5H6Q A;  3UO3 A;  4J7Z A;  2LP7 A;  4LNU A;  4CS2 A;  4IHJ A;  1PNM A;  3H1J H;  1L1F A;  1N33 O;  1YI2 V;  4P30 A;  1QR9 A;  1OCO B;  3K3W A;  5ITZ A;  1ZX3 A;  1SS3 A;  1IUR A;  1QR8 A;  5HGQ A;  2A9H A;  3CHX A;  2ODR D;  1R6K A;  3W7T A;  3HFZ A;  3CP1 A;  2OCC C;  5F5W A;  1NJ1 A;  2B1I A;  3NEL A;  3N2K B;  4HYO A;  2WLK A;  1JQ0 A;  1DF5 A;  5LXT B;  5EC1 C;  1WNS A;  4F6R A;  2UXB B;  4ZOL B;  2P06 A;  4UV8 A;  3SYO A;  2AZ2 A;  3CC4 V;  4EB6 A;  3MEY A;  5L3F A;  2DZC A;  3E8B A;  3AG7 A;  3SYC A;  1BBW A;  4GKJ B;  2ZCE A;  4YRI A;  3FFQ A;  2VRZ A;  1RM1 C;  4NXM B;  4UUJ C;  4WFE A;  4QIW F;  2Q69 A;  4PDR A;  2DZ9 A;  4JI5 O;  2ODM A;  5KMG A;  3RIR A;  2Q68 A;  3K58 A;  4H0L B;  4K8Z A;  2F23 A;  2WAM A;  1CPY A;  2ZNJ A;  1DTO A;  3B8N A;  2P5O A;  3QO8 A;  4JI8 B;  1YHQ V;  1NR7 A;  5CBF A;  3MF2 A;  4ZIB A;  5CA1 B;  1RIQ A;  2ZR2 A;  2QHU A;  3GVM A;  2ART A;  2OT5 A;  1L0N H;  1NR1 A;  1SZX A;  2DYR B;  1TUE B;  2PMF A;  4LNU B;  1M56 C;  5B1B C;  1FAF A;  4PI2 A;  3NET A;  3G80 A;  3MDS A;  4LVJ A;  2DWD C;  3VQV A;  4JAU A;  4R7C A;  1U97 A;  4JI6 B;  1MZF A;  1M57 C;  2EIK B;  1GK9 A;  3K0D A;  3E22 A;  2UXX A;  3A0B Z;  5D5Q A;  3QF7 A;  1AB3 A;  5L3D A;  5CB4 B;  4O4I B;  1S5J A;  4JI4 O;  4LBE C;  4LWS A;  1QLE C;  2LQT A;  1BE3 H;  1IL2 A;  3DTU B;  1SRY A;  1P49 A;  3RYF A;  1SQG A;  1H4S A;  3T1H O;  4KQE A;  3I56 V;  2PME A;  4EB6 B;  1M4U A;  4JTA B;  3SPI A;  4B3S O;  2P5I A;  1LYL A;  4U3F H;  5LMN O;  3IAL A;  2QM7 A;  1N36 B;  1UJW B;  3ZJZ A;  1FPO A;  2L35 A;  4DR7 B;  4Z1V A;  3E9I A;  4OX9 B;  5KA6 A;  4YJ3 A;  4K87 A;  4GYC B;  3IG2 A;  4P3P A;  3CMQ A;  4LF4 B;  4PJ0 Z;  1BZK A;  4U3J B;  1AJN A;  3WU2 Z;  2Q5I A;  4XU2 A;  1OHH G;  3AK1 A;  1H2N A;  1XNQ B;  1AP6 A;  2Y4T A;  3JAK A;  5IYB O;  5JCO C;  3OTO O;  1SA0 A;  1N32 O;  2H94 A;  2AW9 A;  4FLW A;  4I0X A;  1QQC A;  2RQ6 A;  1EM1 A;  4MS2 A;  3X2Q B;  3OR6 C;  5LP6 A;  4LFC B;  5B3S C;  2IU0 A;  2NN4 A;  4YP0 A;  1GM7 A;  2E3C A;  3G6E V;  1EN4 A;  4HWS A;  1U96 A;  3RYH B;  4P71 C;  4G2K A;  2E5L B;  4DPG A;  3OD4 A;  4DV4 O;  1S5L Z;  1GRJ A;  3ASN B;  1HNX B;  1QBZ A;  1B04 A;  3T1C A;  2F4V B;  5EBM C;  3CS5 A;  2X0L A;  2E1H A;  4X89 A;  2UXD O;  3SPC A;  5FPR A;  1ASZ A;  2ARS A;  2YXH A;  1R3K C;  4ICG A;  4YCV A;  1SF9 A;  2OCH A;  3E8H A;  2HJD A;  4IT5 A;  3EVK A;  2QKS A;  1P84 F;  1PKX A;  2E75 B;  1JJ2 U;  1PL0 A;  3J7A U;  3UGQ A;  3UCS C;  2PTM A;  4G85 A;  3BAB A;  1WAZ A;  2MW2 B;  4FM0 A;  1G4Y B;  4XTY A;  5KX5 A;  1NBM G;  1ZWI C;  4J9Z B;  4JI6 O;  4YJ3 B;  4FLU A;  4XTU A;  4OLF A;  3CYO A;  1G6U A;  2IH1 C;  2K1E A;  1VQO V;  2CGH A;  4GKK B;  4R6Z A;  4DQ2 A;  2FL4 A;  1IVS A;  5E1A C;  1NU1 H;  4TVA A;  1NJI W;  3HPL C;  2R70 A;  3DSQ A;  1K5Q A;  1W0K G;  4LF5 B;  2NLJ C;  3E35 A;  3ZX6 A;  2ZZE A;  3JAK B;  2DDZ A;  1KMN A;  4D6T H;  4I0X B;  3ZMV A;  4X65 O;  3REU A;  3ICX A;  2EUL A;  1YJN V;  2P22 C;  2OCC B;  4K3A A;  2DQ0 A;  4FLV A;  4DR5 O;  1YIT V;  5IJ0 B;  5DM6 V;  4DV0 O;  1YFT A;  4P9P A;  1EVK A;  1IBK B;  5H9C A;  4DR2 O;  4LR3 A;  4P74 C;  4G84 A;  1OZ0 A;  2Y69 C;  3G6B A;  4NTX A;  3UFG A;  3MHH C;  3ZN1 A;  2YI8 A;  4DV2 B;  1FXK A;  3CSX A;  5JQG B;  1RM1 B;  4JZG A;  2YUA A;  2C7I A;  3B77 A;  4YJ2 A;  2C8M A;  2RHQ A;  4X64 O;  2HEP A;  4LP8 A;  3RN4 A;  3ZHR A;  5IWA O;  2E65 A;  5LYJ B;  1GTO A;  2BE3 A;  1ZTE A;  4JI2 B;  2Q7H A;  3CJH A;  4JYC A;  4LVL A;  5KHI A;  5KUK A;  4H2T A;  4N23 A;  1K73 W;  1OCZ C;  4Q20 A;  3I7F A;  5LHH A;  3JYC A;  4O4L A;  1J5E O;  1B8A A;  1FKA O;  5H6R A;  2OIE A;  4J11 A;  3L9D A;  1FJG B;  4YRR A;  1M56 B;  4DRX A;  1H8H G;  3BPZ A;  5B1B B;  2CH7 A;  2QSA A;  3LUT B;  4RMF A;  1M57 B;  1Q6H A;  4B3M B;  4P71 A;  5CBG A;  4H44 B;  4RAI A;  1GN2 A;  1BHB A;  4AH6 A;  1TUB B;  2IH3 C;  3J81 N;  3ZHU A;  1WYD A;  1D5N A;  1QLE B;  4NYK A;  2UUC O;  1HNW B;  1JJO A;  2AHY A;  5IYZ A;  1AP5 A;  4TWA A;  2PYJ A;  4QGP A;  1C0A A;  1PD3 A;  1DK1 A;  1P4R A;  3BEH A;  3HRK A;  4O2A A;  4XTX A;  1S3J A;  1AR5 A;  4LF5 O;  4YCU A;  4GX5 A;  5LBQ A;  1KUQ A; 
#chains in the Genus database with same CATH homology
 1X2H A;  4YRG A;  2J3M A;  4P75 C;  3RL6 A;  2XGT A;  2DTO A;  4O4H B;  1X56 A;  3TUP A;  2Q5H A;  1SES A;  4LF6 B;  3BFM A;  3TEH A;  4I55 B;  2PZS A;  3PZC A;  4LF7 B;  2EL9 A;  4BWA A;  1IBL B;  2RHQ B;  4LF9 B;  1YGB A;  4UCT A;  4I4T B;  3RWR D;  5IJ9 B;  2PY5 A;  1H2S B;  4X20 B;  5BMV B;  1PYS A;  2DU5 A;  5JJJ B;  1USY C;  1NNH A;  2QJ1 A;  2CJB A;  3RYI A;  3HXY A;  2ZIO A;  3HKE A;  4X1I B;  3JSN A;  4DK1 A;  2ZIN A;  5LMU B;  3HFV A;  4O4J B;  1L0W A;  3ERR A;  3IKM B;  2UUA B;  5LOV B;  3K5N A;  2PUS A;  5LA6 B;  4IHJ B;  2CAZ C;  4D7T A;  1TUB A;  4CH4 A;  4H2Y A;  2ZXF A;  3IKL A;  3N2K A;  5C52 B;  4O4L B;  4YY3 B;  3JAW A;  1ASY A;  1GGM A;  2VWK A;  2ZZF A;  1EFW A;  4I9Q A;  4UP9 A;  2UXC B;  1YFS A;  4K86 A;  3RKW A;  1NT2 B;  5ITZ B;  4DV3 B;  5JH7 B;  2AMC A;  1H4T A;  3ICA A;  4P3O A;  1N9W A;  3A7U A;  5JVD B;  3RKX A;  2ZT6 A;  3LSS A;  4JI0 B;  3UH0 A;  1Z5V A;  4B08 A;  4LF8 B;  2QHV A;  4FFB B;  4YRM A;  1FFX A;  3PN1 A;  4L87 A;  3HFZ B;  1HTT A;  3L4G A;  2ALY A;  4WI1 A;  4L8J A;  3HKC A;  1B70 B;  4H02 A;  5JJN B;  4X1K B;  1WNL A;  3JAS A;  4CC6 A;  3JAR B;  4PHZ A;  4OP0 A;  1NJ6 A;  4O4H A;  5KHG A;  4B3R B;  2AKW B;  4P3N A;  4X1Y B;  5IYZ B;  4I55 A;  4F6R B;  1HXD A;  1WQW A;  4I50 B;  2QHT A;  4H2X B;  5FNV B;  4DR3 B;  1T5E A;  4I4T A;  3THO A;  5IJ9 A;  1SQF A;  3OTF A;  3BA8 A;  4X20 A;  2UUB B;  2QM4 A;  2DEQ A;  5BMV A;  2EJG A;  3PCO B;  3M4Q A;  3M7M X;  1N34 B;  5KNN A;  4HWT A;  2EJ9 A;  3HXZ A;  3BJU A;  1M5I A;  4X1I A;  3HY0 A;  3TEG A;  2PYL A;  3B2E E;  3HXX A;  3V7C A;  4YRT A;  4UP7 A;  4TQD A;  3K5M A;  2P0L A;  4YRS A;  4AQY B;  4KR3 A;  4YRF A;  3TEH B;  4LNU A;  4CS2 A;  5LA6 A;  4IHJ A;  5JCO A;  4JI1 B;  3L2Z A;  5KMG B;  1J5W A;  2Q7E A;  4UP8 A;  4XU0 A;  4YRN A;  1NJ2 A;  5J2U B;  2ZT5 A;  1D5A A;  1KU9 A;  2YXL A;  3A5Y A;  1PYS B;  2IY5 A;  2CIM A;  2ZZG A;  4XU1 A;  11AS A;  3RYI B;  5ITZ A;  3SJC C;  4XU3 A;  5JH7 A;  1SER A;  4WF2 A;  2OYQ A;  5HGQ A;  5C8Y A;  3CHX A;  1N33 B;  4EO4 A;  2ODR D;  4HWR A;  4FFB A;  4YYE A;  1QE0 A;  5F5W A;  3HFZ A;  4ZHQ B;  4EFB A;  1NJ1 A;  1NJ5 A;  4ZI7 B;  3NEL A;  3N2K B;  3N2G A;  3BAA A;  1B70 A;  3UGT A;  2ZGW A;  4DV6 B;  2XHB A;  4X1K A;  3OD1 A;  1HW7 A;  1VQZ A;  5LXT B;  3P8Y A;  3A5Z A;  3JAR A;  3E22 B;  1KMM A;  4O2D A;  1WPB A;  1WNS A;  1HC7 A;  1WPY A;  2AKW A;  1Z7M A;  2RHS B;  4UCR A;  4Q15 A;  4F6R A;  2QHS A;  2UXB B;  2DTH A;  4ZOL B;  4I50 A;  4HWO A;  4TTV A;  1Q3E A;  4H2X A;  3VQW A;  1I7F A;  3LSQ A;  4EB6 A;  5FNV A;  3MEY A;  1NYQ A;  3NEM A;  4NCX A;  2DZC A;  3VQY A;  4P72 A;  1Z5W A;  1BBW A;  2UU9 B;  2EX3 A;  4J15 A;  4GKJ B;  2ZCE A;  2PGG A;  3SR2 C;  3M4P A;  1X01 A;  3JAT A;  4YRI A;  3FFQ A;  4RQE A;  4NXM B;  2DJZ A;  5E3I A;  3EFS A;  3JAS B;  1XHX A;  4YDQ A;  1Q5O A;  3P8V A;  1RSO A;  3BRC A;  2F1M A;  2DTI A;  3P8T A;  2DZ9 A;  3RYF B;  4RDX A;  5KMG A;  3RIR A;  12AS A;  3VQX A;  3K58 A;  1E24 A;  2EAY A;  2ZTG A;  3SJA C;  5J2U A;  4K8Z A;  5EIB C;  3RGL A;  2ZNJ A;  3MF1 A;  2P5O A;  3QO8 A;  4JI8 B;  2F95 B;  1V9P A;  3MF2 A;  3RF1 A;  4H2U A;  4ZIB A;  5CA1 B;  1RIQ A;  4IIJ A;  4JI5 B;  5BR8 B;  2QHU A;  2ZR2 A;  4O2B A;  2ART A;  3W3S A;  1HR0 B;  4HBN A;  2PMF A;  3HTZ A;  4FLY A;  1ADY A;  4LNU B;  2R9A A;  4ZHQ A;  2J3L A;  3NET A;  4PI2 A;  4ZI7 A;  2YI9 A;  5ELN A;  4LVJ A;  2BTQ B;  3VQV A;  4X62 B;  2CJ9 A;  4JI6 B;  3MQZ A;  2GV9 A;  3WB1 A;  4PI0 A;  2OWO A;  5LXT A;  2IY5 B;  3E22 A;  3A7A A;  4HVC A;  5D5Q A;  4DV5 B;  1SA0 B;  3QF7 A;  3EFR A;  2RHS A;  5K1P A;  2Q7G A;  2ZT7 A;  4ZOL A;  1TAE A;  5C8Y B;  4LNS A;  4YRQ A;  4DV1 B;  4UCV A;  5CB4 B;  5LP6 B;  4O4I B;  1E22 A;  1S5J A;  3REX A;  2EWN A;  4YRO A;  1YFR A;  4FVM A;  3N2G B;  3LC0 A;  2HNI A;  1IL2 A;  1XMQ B;  5GON B;  1SRY A;  3IAY A;  3JSL A;  4YRE A;  2DKG A;  4JI4 B;  1P49 A;  3RYF A;  1SQG A;  2DVE A;  4KQE A;  4P74 A;  1H4S A;  2PME A;  4EB6 B;  1M4U A;  1ADJ A;  2P5I A;  1E1T A;  5KHJ A;  4RQF A;  1LYL A;  4YPF A;  2E10 A;  5CA0 B;  2ZM6 B;  3IAL A;  1EIY B;  3HXW A;  3U0Z A;  3JAT B;  1N36 B;  4DR7 B;  4LVI A;  5CA1 A;  4DUY B;  3UQ8 A;  3T1H B;  4OX9 B;  3E9I A;  1NJ8 A;  4YJ3 A;  4K87 A;  4YHH B;  4GYC B;  3IG2 A;  4P3P A;  3CMQ A;  1H4Q A;  1JFF A;  4B3S B;  4LF4 B;  2E64 A;  4U3J B;  4GLX A;  4FLT A;  3V8K A;  5LMN B;  1M93 A;  3RFR A;  2F93 B;  4WBN B;  4AIL C;  3JAL A;  2Q5I A;  3ETQ A;  4XU2 A;  2BTQ A;  1IBM B;  4CC5 A;  4NXN B;  1O9H A;  1XNQ B;  4TVY A;  1TVK A;  1Z7N A;  3JAK A;  4WJ3 M;  4LH7 A;  4Q6G A;  5JCO C;  5KX5 B;  1SA0 A;  1WQ7 A;  4IIJ B;  4O2B B;  3V7S A;  2CJA A;  5J2T B;  3SJB C;  1EQR A;  4K88 A;  1I94 B;  4FLW A;  4X5O A;  4YRJ A;  3BA9 A;  1QQC A;  2RQ6 A;  5CB4 A;  5LP6 A;  4O4I A;  4HA8 A;  2BTO A;  4LFC B;  4JYA B;  3MAQ A;  3CB2 A;  4TVA B;  4YP0 A;  3NEN A;  4X66 B;  3OTO B;  2E3C A;  1N32 B;  1E1O A;  2I4M A;  3WQZ A;  1B76 A;  3WB0 A;  3A32 A;  4HWS A;  4XTW A;  3RYH B;  5GON A;  4P71 C;  4LH6 A;  2E5L B;  4H2W A;  3E9H A;  4DPG A;  3V8J A;  3UT5 A;  3HRI A;  3QNE A;  2RJZ A;  1YEW A;  4UCO A;  4B3T B;  1HNX B;  5EYP B;  4TUY B;  4ZTU B;  3A2F A;  5CA0 A;  2YIA A;  1B04 A;  3K59 A;  1QHT A;  1EIY A;  2NS6 A;  2F4V B;  1L8D A;  4K0K B;  4DR4 B;  3HKB B;  4DV4 B;  2E1H A;  4DR1 B;  5KHH A;  4XEO A;  2F66 C;  5FPR A;  1WLE A;  1ASZ A;  4H2V A;  2ARS A;  4TV9 B;  4U3J A;  2I4L A;  1KOG A;  5C51 B;  4YCV A;  4UCS A;  1JMK C;  4P73 A;  4WBN A;  1B7Y B;  2UXD B;  4JI3 B;  4XTZ A;  2ZR3 A;  4P75 A;  4CH3 A;  3K5L A;  4FM1 A;  1BIB A;  1G5I A;  3RKY A;  3UGQ A;  3RUX A;  4YRK A;  2PTM A;  4G85 A;  2DU7 A;  1QF6 A;  3BAB A;  4KL1 A;  3QO5 A;  4FM0 A;  4XTY A;  5KX5 A;  1XHZ A;  1JJC A;  1SKV A;  3HKD A;  1EOV A;  3HXU A;  2A8E A;  4YJ3 B;  5J2T A;  2KKW A;  4FLU A;  2I4N A;  4XTU A;  4OLF A;  4KR2 A;  1JFF B;  4UCU A;  1G6U A;  1BBU A;  2CGH A;  2YIB D;  3K57 A;  2ZNI A;  4GKK B;  1Q43 A;  1USY A;  1X55 A;  3HY1 A;  4DQ2 A;  4DR6 B;  2HHH B;  3QTC A;  4TVA A;  3JAL B;  2JGU A;  2R70 A;  3DSQ A;  4YJ2 B;  4LF5 B;  1ATI A;  2JS5 A;  4CH5 A;  1VF7 A;  2DXU A;  4YCW A;  1TVK B;  3RYH A;  2ZZE A;  1XNR B;  4YRL A;  3JAK B;  4HNA B;  2DDZ A;  2VQF B;  3VBB A;  2Q0A A;  3U10 A;  1DGS A;  5EZY A;  1KMN A;  3U11 A;  4EFE A;  1YB3 A;  1X2G A;  1H4V B;  5EYP A;  4TUY A;  4ZTZ B;  2EJF A;  3K5O A;  4BW9 A;  4HWP A;  3REU A;  5JJE B;  3HKB A;  3ICX A;  4YRC A;  5FPO A;  2ZIM A;  4FLZ A;  3ZS8 C;  3RYC A;  1EVL A;  4UPA A;  3G1Z A;  4DRX B;  2P22 C;  2ODR C;  4TV9 A;  3LNN A;  3UT5 B;  4X65 B;  1G51 A;  2DQ0 A;  2DXT A;  4FLV A;  4FM2 A;  4XTV A;  3V8L A;  5IJ0 B;  1B7Y A;  4LVM A;  4LVK A;  1X4T A;  1YFT A;  4K8X A;  1EVK A;  4UFZ A;  2XTI A;  1O9G A;  3BHP A;  3HXV A;  2JVD A;  1IBK B;  4DUZ B;  1G5H A;  4TOI A;  4H2S A;  3KFU A;  1TA8 A;  2FYK A;  3R07 A;  3T1Y B;  4LR3 A;  4AHC A;  4P74 C;  3L1A A;  4DR5 B;  4G84 A;  5EIB D;  4TV8 A;  5K1X A;  3UFG A;  2ZT8 A;  4DV0 B;  2DQ3 A;  2YI8 A;  4DV2 B;  2VWJ A;  3CSX A;  5JQG B;  4DR2 B;  4JI7 B;  1Q8I A;  2C7I A;  4YJ2 A;  2IM9 A;  4EEQ A;  1NYR A;  2C8M A;  2RHQ A;  3A7R A;  2R72 A;  2HEP A;  1FYF A;  2E65 A;  4O2A B;  5LYJ B;  3QG5 A;  4HNA A;  1JJC B;  3HKD B;  4JI2 B;  3WB2 A;  2Q7H A;  1XMO B;  4E51 A;  4LVL A;  5KHI A;  4O4J A;  4CS4 A;  4X64 B;  3RAC A;  4H2T A;  5LOV A;  4HT4 A;  2YIB A;  5IWA B;  3I7F A;  4TVW A;  2I4O A;  3FJP A;  1WU7 A;  3RGB A;  4CH6 A;  3A74 A;  3A31 A;  4O4L A;  1B8A A;  4YRP A;  1FJG B;  5LP6 C;  4YRR A;  4DRX A;  4KHP B;  4PG3 A;  3BPZ A;  2VQE B;  1TGO A;  5EZY B;  4TQF A;  3HKE B;  4PHC A;  5IJ0 A;  1XQ8 A;  5JVD A;  1WN7 A;  4RMF A;  2ARU A;  5ELO A;  1J5E B;  4B3M B;  4P71 A;  4AH6 A;  1TUB B;  1XI1 A;  4JV5 B;  1ZAU A;  1W66 A;  3JAW B;  4NVP A;  5D5P A;  3RYC B;  1BIA A;  1WYD A;  4WJ4 A;  4P72 C;  1KMI Z;  4XEM A;  3SGI A;  4DK0 A;  1X54 A;  1HNW B;  5JQG A;  1JJO A;  4X1Y A;  5IYZ A;  4LFA B;  2AMC B;  4CS3 A;  5C53 B;  4FLX A;  3ZED A;  2V4D A;  4TWA A;  1HNZ B;  2E5A A;  2PYJ A;  1C0A A;  3V7R A;  1FFX B;  4DV7 B;  3L4G B;  2ALY B;  3HRK A;  4O2A A;  5LYJ A;  3PCO A;  4D7S A;  2G4C A;  2UUC B;  4XTX A;  5KHK A;  2E41 A;  3HKC B;  4P73 C;  4LFB B;  1SET A;  4YCU A;  4EX5 A;  4TV8 B;  3QO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...