4RQEA

Human seryl-trna synthetase dimer complexed with two molecules of trnasec
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
478
structure length
460
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKELSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVTSIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 460
sequence length 478
chains with identical sequence C
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqeA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqeA02
4CS2A 2ZNIA 1SETA 4EX5A 3HFZB 3A32A 1USYA 3HXYA 4XTYA 1WLEA 3TEGA 4XTXA 2ALYB 1BIBA 2J3MA 1IL2A 4YCUA 4XTZA 4P73C 2IY5B 2ZT7A 5ELNA 3HXZA 3DSQA 4XU3A 2EAYA 4H2TA 2E41A 5C51B 3CMQA 4YROA 1C0AA 2DTHA 2ZGWA 3V7RA 2I4OA 2XTIA 1SRYA 4HWSA 1B7YA 4RQEA 3HY1A 3NETA 4H02A 2ZXFA 1ASYA 3PZCA 4YCVA 4H2SA 4TVAA 4UP7A 2ZZEA 2ZR3A 2AKWB 1GGMA 2RHSA 3L1AA 2ARSA 3EFSA 1YFRA 4XU0A 3V7CA 3E9HA 4P74A 3BFMA 2FYKA 1QE0A 2P0LA 4KQEA 1H4SA 3MF2A 3P8YA 4KR2A 4YDQA 3VQYA 4WJ4A 4XU1A 3E9IA 5ELOA 1BBUA 4H2YA 1X56A 3QTCA 1NYRA 3VQVA 2PMFA 2ODRD 4YRNA 1HC7A 4RQFA 4H2XB 1EIYB 4YRJA 4G84A 2E5AA 1Z7MA 2ZIOA 3UH0A 3P8TA 3QNEA 3EFRA 4G85A 1H4VB 1E1TA 4CS3A 2QHTA 1EOVA 4DQ2A 1FYFA 2DQ3A 4TTVA 1G51A 3LSSA 3FJPA 3REXA 4LNSA 4YP0A 4CH3A 1SERA 2CGHA 4YRRA 3I7FA 1B70A 2ZR2A 1WQ7A 2ZNJA 4YRPA 1X55A 4CS4A 4OP0A 1J5WA 2EL9A 2ZIMA 4TVYA 4ZIBA 3A7UA 3OD1A 3L4GB 3HXWA 3QO5A 3LC0A 4YRLA 1WU7A 1B8AA 4P75A 2ZZFA 4RDXA 1X01A 2DQ0A 4BW9A 5K1PA 4P71C 4X5OA 1HXDA 11ASA 3A7RA 3RL6A 1QF6A 4WI1A 2DU7A 4ZTZB 2PMEA 2DXTA 4P3NA 3HFZA 4K88A 4PG3A 4K86A 2EJ9A 5F5WA 2QHVA 2ALYA 4RMFA 1Z7NA 5K1XA 1VQZA 2ZT6A 3RGLA 4UP8A 4TVAB 4XEOA 2IY5A 1USYC 3QO7A 2ARUA 1SESA 3TEHB 2E64A 2CJBA 4K87A 3A74A 1JJCB 3A31A 3HY0A 4PHCA 3V7SA 4XTWA 1N9WA 1EVKA 2C8MA 4ZTUB 4HVCA 3HXVA 4TVWA 2Q5IA 3A5ZA 4TQDA 5C52B 2ZZGA 3V8KA 5C53B 3PCOA 1PYSB 4H2VA 1E1OA 4E51A 2C7IA 4YRIA 2P5IA 1ADYA 4HWRA 1X54A 3V8JA 1HTTA 4TQFA 2Q7HA 4KR3A 2G4CA 1NJ6A 2CJ9A 3HXXA 2AKWA 4UPAA 1G5IA 2DXUA 4EO4A 2ARTA 1YFSA 1B76A 1LYLA 1YB3A 1EFWA 4H2WA 3IKMB 3HRIA 4P74C 2AMCB 4H2UA 4Q6GA 2RHQA 3P8VA 3A7AA 3KFUA 1BIAA 3L2ZA 4UP9A 4P73A 4Q15A 1KOGA 3RIRA 3RKXA 1EIYA 2CIMA 2EJGA 1NJ8A 1H4TA 1G5HA 3TUPA 1BBWA 2DKGA 3RKYA 3RF1A 5E3IA 3M4QA 3NELA 3G1ZA 4OLFA 4HWOA 4WJ3M 2QHSA 4XU2A 4YRCA 3IALA 4YRMA 3VQWA 2DJZA 2ZT5A 1NYQA 1WYDA 2E65A 3VQXA 4YREA 4XTVA 4HWPA 4DPGA 3UGQA 3BJUA 1WQWA 1NJ5A 2DU5A 1E24A 1YGBA 1B7YB 5HGQA 2ZT8A 4BWAA 3L4GA 1ATIA 3HFVA 1YFTA 1NJ2A 2Q5HA 3VBBA 2I4MA 4YCWA 4O2DA 2RHSB 1ADJA 4P75C 2DTOA 3IKLA 4XEMA 2I4LA 4YRQA 2I4NA 3QO8A 1RIQA 3V8LA 5KNNA 4P3OA 2ZINA 3PCOB 2XGTA 4YRTA 3UFGA 3ICAA 2HNIA 3HXUA 2EJFA 2DTIA 3RACA 4AH6A 3W3SA 1WPYA 4HA8A 4YYEA 4CH5A 2DZ9A 3TEHA 3R07A 3MEYA 1KMMA 3WQZA 1JJCA 3UGTA 1EQRA 4TWAA 2ZCEA 1E22A 4J15A 3A5YA 2E1HA 2EWNA 2ZTGA 3RKWA 2DZCA 1X2HA 3NENA 4CH4A 4P72A 1NNHA 3LSQA 2RHQB 1ASZA 1PYSA 1L0WA 4CH6A 2QHUA 4L87A 4HWTA 3RUXA 1B70B 4YRKA 2DDZA 3MF1A 2CJAA 3IG2A 4NCXA 4YRFA 2Q7GA 3NEMA 4YPFA 4P71A 4H2XA 2DVEA 3HRKA 3REUA 1KMNA 2E3CA 2DEQA 3HTZA 2Q7EA 4WF2A 12ASA 4XTUA 4P3PA 1H4QA 1NJ1A 1EVLA 3ERRA 2E10A 2J3LA 3M4PA 4YRSA 2AMCA 4YRGA 1WNLA 2ODRC 1X2GA 4P72C 1W66A
chains in the Genus database with same CATH superfamily
2QR4A 1VF7A 3F7VC 1UJWB 1IBMB 2ZNIA 3OE7G 1HR0O 3HFZB 2LGQA 3K5MA 2OIEA 4XTYA 4FM2A 1WLEA 2DE0X 5BMVA 4XTXA 1L8DA 2XASA 2P4KA 1J5EB 4DRXA 1FD9A 4JASA 5KHKA 2ZE6A 5DEDA 3R65A 2ZT7A 2F4VB 5BR8O 2XHBA 2BTOA 3DGEA 2ODMA 4K0KB 4UXNA 4QE9A 4DXWA 1YJWV 1RSOB 1XHZA 1VQ8V 4F6RB 1VF6A 1WB8A 4E2LA 1WJZA 2EINB 2EZPA 2QWPB 3H1LH 1ORQC 4JI4B 3WG7C 2GTAA 2IJJA 2PI4A 4N23A 4DV5O 3G71V 1H8EG 1RFYA 1YHQV 4I5SA 4LF6B 4DV7B 3JATB 2OCHA 3AG4C 5F2VO 2R72A 3JARB 4LFAB 3CCEV 2CK3G 2ZXFA 4I4TA 1ASYA 3PZCA 5BXZA 1ZTEA 4H2SA 1BGYH 3JALA 1DF4A 2ZZEA 2CDYA 2EIKB 3N27A 1NH2B 1BS3A 3OTFA 4BAYA 1IBLO 4IIJA 1BCCH 1KKCA 1YSCA 4UCVA 2D3OW 4DV3B 4FM0A 2KG7A 3E9HA 5B1AB 1N34O 1EZVH 3KCYA 1B04A 4DV6O 3CCLV 4QPKA 1H4SA 4KQEA 3FYEB 1JA8A 3P8YA 4GT1A 2UUBO 4KR2A 4JYAO 5EC1C 2JRIA 1BHAA 4WJ4A 4I0XB 5ELOA 5FPRA 2HHHB 4H2YA 2E75B 1M9NA 2Y4UA 1R1BA 4X1KA 2ODRD 4RQFA 2E5AA 1HR0B 4X1IA 1EN6A 3UH0A 2YIDA 4Q20A 1V54B 5CB4B 3QNEA 4MVUA 4LF5O 1XI1A 1MZEA 3P3PA 5BR8B 1H38A 2RCVA 3EHBB 3OGCC 5KAIZ 5L3DA 4LR3A 5EZYA 3REXA 4U7OA 2JS5A 2L6LA 4LNSA 2UUCO 4CH3A 2CGHA 2QM4A 1B70A 3ZMZA 3BA8A 3PN1A 1B3QA 3DC6A 1X55A 1URFA 5H9CA 4OP0A 4YHHO 4LFBO 4ZIBA 5L3CA 4DV5B 3A7UA 4W4KA 2X6CA 5J9PC 3LNMB 3JASB 3HXWA 2BSKA 3LC0A 4YRLA 1WU7A 3LSUA 1YEWA 4NXMO 1SQPH 4OGQB 4BW9A 2L35A 1AVMA 4UCTA 5CA1B 5FLXN 4X5OA 1SQQH 3RYHB 2Z3YA 2JDIG 2YI8A 1IURA 11ASA 4DUZO 3A7RA 3SPCA 4JI3O 2N04A 1OCZC 4ZTZB 5A2QN 3ZHVA 1K97A 2ADQB 5IJ9B 4AI8A 2NNUA 1N34B 2QHVA 3CRCA 4HAMA 5KHHA 4DV6B 4LNUA 1EN4A 2QJ1A 1OCRC 5K1XA 3ZRWA 2ZT6A 4JZGA 2QTOA 4DV1O 4FZ0A 2UUBB 2P67A 3QO7A 1USYC 3MQZA 4JYAB 3K0GA 4XBFA 4CZZA 1SESA 4GLXA 4HT4A 3A74A 4JPRA 3O9OA 4B7KA 4LBEC 1GRJA 5IT9N 4J7KA 1EVKA 3K04A 4ZTUB 4FIPC 4HVCA 2NN4A 5TISZ 1PD3A 2LJ2A 1CPYA 1G4YB 1VQ6V 5JCOC 3HKBB 4JTAB 1Q3EA 4R50A 3A5ZA 4TQDA 2B5UA 4DUYB 3FX7A 2Q68A 3V8KA 1HWYA 5C53B 3HKDA 4LF5B 3RYCB 1NS1A 1FXKB 1QR9A 4K8XA 1WPXA 1GKFA 2JVDA 4E51A 1ADYA 4CC5A 4WBNA 4TQFA 3RVYA 1HDJA 1VIBA 2UUCB 2G4CA 1MABG 2DMXA 2WLHA 2AKWA 4J80A 4KUMA 4RAIA 4W4LA 4YHHB 4LFBB 5B5EZ 1YB3A 1EFWA 5GONB 1XL4A 4XDKA 2ZDIC 1IVSA 1XHXA 1S72V 3MHSC 4GCZA 3RWRD 2AMCB 5BZBA 4QE7A 4Q6GA 3HKEB 3E8BA 1TVKB 3KFUA 1M56C 3H01A 4P73A 4IYIA 3S3XA 4KHPB 2NR5A 5BMVB 2KQXA 3CPWU 3B2EE 1YTFB 4H0LB 3FAVA 1ZL8A 4DR2B 2HFEC 2UUAO 3E83A 5E3IA 4UCUA 2IJHA 1SQGA 5LGTA 3G1ZA 5EIBC 4TSFG 1L1FA 4DV1B 1YJ9V 4J9ZB 1X59A 2XOKG 4DYLA 2RMKB 1LNQA 3OEEG 3I56V 4X9QA 2JJ2G 5DECA 4HWPA 3W7TA 5DM6V 4JGSA 1RP3B 1K7DA 2DU5A 3L9DA 4WFFA 5B1OA 1E24A 1VQOV 1IDSA 2Q8VA 1PL0A 2DYSB 1QLNA 4I4TB 4PA4A 4PI2A 1F4NA 1MA1A 3JALB 4O4IB 1NZ6A 4IIJB 4P75C 4JYYA 4FK5C 4IL6Z 1GN2A 2KG7B 1KQSU 1E1RG 1OCCC 4F6RA 2AZ0A 2VQEO 4MVZA 3QO8A 2A0LA 1PKXA 5CA0A 1RPRA 3UFGA 3SR2C 3K58A 4FLTA 1FFTB 2HNIA 1TUBB 3JATA 3HXUA 2EJFA 4J42A 1JVMA 3SPGA 2DTIA 2LW1A 1K34A 1WPYA 2NLJC 4YYEA 1N0NA 3P32A 3UGTA 3LDCA 5J2TA 3FFQA 4J15A 1IX9A 1W59A 4X1IB 1FFXA 3RW0A 4EFBA 3UQ8A 2QTSA 3OMAB 3JSLA 1WNSA 2DW4A 3SYAA 3NENA 4IGGA 1N32B 1NNHA 4EKWA 4AHCA 1G1XB 1HNZO 2EINC 5EZYB 1PYSA 1AI7A 1S5HC 3A8TA 3T1HO 3M7MX 2ZE7A 2Q6AA 4I0XA 1B70B 4YRKA 5IWAO 3IG2A 5L3GA 4PDVA 4ZOLA 2A3QA 4PD4F 2Q7GA 4P71A 2BCCH 3F7YC 4J7JA 4JI8O 1AJQA 2E3CA 4MTOA 1XMQO 2EIKC 4NYKA 2Q7EA 2Q73A 4WF2A 3A0RA 3JCUZ 1KC8W 1I5XA 2BOBC 4P3PA 1H4QA 2EX3A 1NJ1A 2PGGA 2WA4A 3ERRA 4JI5O 3CC4V 5B1AC 3M4PA 3LDDA 3OT7A 3ZMSA 1MMMA 1NI8A 3E8FA 3FB8C 1E1QG 3STZC 4GKJO 1WNLA 2JGDA 1W66A 1ZAUA 3EVKA 4CC6A 5J2UA 4DR6O 2EIJB 5KUKA 3W7SA 4PHZA 3A32A 5LMUO 5EK0A 3JYCA 4YIPA 5EC2C 4WCEV 2OT5A 1NTKH 4LNUB 2B1IA 2H94A 3ABKB 4EB6A 3ZN1A 2J3MA 2AGAA 3ZRWB 2P6JA 1ZUQA 4FFKA 2CH7B 3CWBH 4FLYA 1XEQA 5ELNA 3HXZA 3DSQA 3JASA 4XU3A 4O4JA 1S3JA 2RNBA 1KMIZ 3GWKC 3U11A 1QLEB 2E41A 5C51B 2LW7A 1VF5B 1C0AA 1AP6A 2DTHA 1Y66A 1V54C 1X4TA 3OEHG 3RYHA 2IJIA 1EN5A 2O57A 3KZIZ 1LR1A 2VRZA 1NTZH 4JF3A 1GK9A 5EBWC 5IDJA 4HWSA 1I0HA 5HFMA 3NXSA 4FLUA 3CRAA 3HKDB 1G8MA 4RQEA 2PYJA 3OMNB 3HY1A 2F95B 3A0BZ 3D36A 3K5NA 4H02A 4MW8A 4YCVA 3L75H 1HNZB 3K5OA 2V7QG 4H13B 4WBNB 5LYJB 1BL8A 3T1HB 2OTJV 3BRCA 2Q67A 1JFFA 4OPHA 2AKWB 1GGMA 1NBMG 3E2EA 2X0LA 5IWAB 3L1AA 3W7WA 5IE9A 3SPHA 4JI4O 4O2AA 3BFMA 2Q5ZA 3ZN0A 1XOUA 4DV0B 2EJRA 1U96A 4JI8B 3MF2A 4DV7O 1HNXO 2WLKA 3OAAG 1GMGA 1H2LA 3RT3C 1ZSPA 4UUJC 1I08A 4JI2O 2JGUA 3CMEV 3E9IA 4JI5B 3SYOA 1FXKA 2YXLA 1K92A 2PYLA 1WA8A 3B40A 2PMFA 1Y76A 1YVWA 2LFRA 2R9RB 2BTQA 4MS2A 4H2XB 4DR6B 4YRJA 4G84A 2R9IA 2GV9A 3FAVB 1ZL8B 5LMUB 2ITCC 2LO1A 1N4CA 2ZIOA 1TGOA 3APOA 4UVAA 1AR5A 2Q0AA 2QKCA 2ZXWC 2FL4A 1E1TA 4PA7A 1KU9A 2UXBB 3MD0A 5GONA 4R7CA 1R3KC 4TTVA 1G51A 3P30A 1Q5OA 1QHTA 2HHHO 1NVPD 4Z1MG 1UFIA 4KL1A 1NKDA 2P22C 3HR0A 4GX0A 2HJDA 5C93A 3ETGA 1M90W 2QWQB 3TJTA 1DTOA 5LHHA 2BE3A 1AP5A 2EBOA 1FXVA 4FLVA 3J80N 2M7WA 2FTKA 5LXTA 4B08A 1QCEA 3AG2B 4LF7O 2ZZFA 2HP8A 4RDXA 3ZRSA 3JCZA 2DQ0A 2P06A 3CXCU 3T2MA 3WU2Z 2PF4E 3B09A 1HXDA 1GH6A 4U3JB 5E1AC 1TAEA 2OWOA 3ZX6A 4WI1A 1R6NA 2PMEA 2PI5A 2AXTZ 4PDRA 5L3FA 3ZIAG 1XDCA 2EJ9A 3G80A 5CA0B 2Z0AA 2HVKC 5KHGA 2LQTA 4UB8Z 1VQZA 1HNXB 1JQ0A 4UP8A 4TVAB 2VWJA 1GAXA 2IY5A 3E89A 4FFBA 2DN9A 4MTGA 3A2FA 3TXSA 4JI2B 1OHHG 2FYUH 4K87A 3SDLA 3AG1B 3A31A 5J2TB 1QR8A 4O4IA 1HP8A 3V7SA 2ATKC 5IJ0A 1N9WA 1FFXB 3X2QB 4X64B 3CYOA 1S77D 4JI1O 3CSXA 1TUEB 2Q5IA 3ASNB 3BHPA 3FB6C 4P30A 2XNDG 1VF6C 1H8HG 4Z1VA 3H1IH 1P84F 1EZJA 1KBHA 2K9PA 4ABMA 1OCOB 2EIMB 1O9HA 1PYSB 3TK1A 4DW1A 4TV9A 4JI6O 1IXMA 3ETEA 5ITZB 2P5IA 1TUBA 2AHZA 2P4VA 2B1GA 2Q9LA 2Q7HA 1BE3H 2CJ9A 1PM9A 2H8PC 2CAZC 3HXXA 4ZOLB 1E79G 1PPJH 2DYSC 1G5IA 3N2GA 2EZOA 4WFGA 3ZEDA 2DXUA 2IW5A 1AI6A 5IY5B 4TV8A 4EO4A 2ARTA 1S5LZ 1YFSA 1YXBA 3F5TA 2WLLA 5B3SB 3IGAC 1K33A 4LF4O 5KAFZ 2CTWA 4DUYO 1MSDA 4A5UB 1G6UA 2FB5A 4B3MO 4LF7B 4GX1A 4LH7A 2V4DA 2QM7A 4WFBV 3P8VA 3A7AA 2JGDB 4I7ZB 2LP7A 5J2UB 3ZRXA 1K73W 1QVFU 5L3BA 2EULA 2YEVA 2NS6A 3D3IA 2RN9A 2CIMA 3UO3A 3HPLC 3EFFK 3FB7C 4EB6B 2WAMA 2C2AA 5JH7A 4DW0A 1H4TA 2DOSA 1AB3A 1GN3A 1SQVH 4ASUG 4O4JB 1SF9A 2W6IG 3SJBC 4WJ3M 3E8HA 4YRCA 3CC7V 4O4LB 2MW2B 2DJZA 2OCCB 1WYDA 4CBCA 5KLVH 1XREA 4WF9V 2QDOA 3OR7C 4DPGA 1AI5A 3KCXA 1SZTA 3BJUA 4KHPO 1NJ5A 2F66C 1H2MA 2KB1A 4RUFA 4DR3O 2FKXA 4JI1B 3OMIB 3WB0A 2UXXA 3NR7A 4DR2O 3ZMUA 2ZT8A 1L0NH 3L4GA 4PA3A 1YFTA 2CTPA 1DGSA 2CH7A 4JI6B 1RPOA 1JCHA 1XNRO 5B1BB 1SQBH 1JFFB 3SYCA 4NXNO 3ML0A 1KP3A 3H1KH 3SYQA 4O4HA 2DTOA 2YICA 3IKLA 4XEMA 5LHGA 1K4CC 4O2AB 2Z5UA 2I4LA 4UV9A 4B3RO 4ZBMA 4LVIA 5KNNA 3JD4A 5LOVA 4U7NA 2OTLV 4G2KA 4LF4B 4PV1B 3ZBHA 1I94O 2ZKOA 1TA8A 1NR7A 4DV4O 4KXRA 5LA6B 1JR9A 2EIJC 2QWOB 3IFXA 5JQGA 4B3MB 3VOUA 2HEPA 5LP6B 2R9AA 3RACA 4AH6A 2Y48A 3FB5C 4HA8A 4CH5A 3SPIA 1D5AA 1WA8B 3MEYA 2A7WA 3ABKC 3THOA 4E4EA 4J7ZA 1Y76B 4X88A 5LYJA 2BTQB 1JJCA 4NTXA 2R70A 2E1HA 1PL4A 2ZTGA 1KD1W 5JJEB 2LFSA 1D2DA 1Q7YW 1K4DC 4LCUC 3CCRV 1VARA 5D5QA 4DR7O 1N36O 4CH4A 4P72A 2XAFA 1ZX3A 4IYHA 4FPPA 1ZWIC 2QHUA 3R66A 4O2BA 1VQ5V 1FYJA 4HWTA 1JX9A 2DDZA 4YY3B 2K1EA 2CJAA 1US6A 1VMGA 1NVPB 1H2NA 3ZS8C 4X66B 4NCXA 4YRFA 2EILB 2CTQA 5KMGA 2GHYA 4YPFA 4H2XA 5LXTB 4H44B 4ZHQB 4DR3B 1Q81W 2CUGA 2XUMA 3B4SA 3K3WA 3HTZA 1CEZA 4UCRA 4U3FH 4X62O 12ASA 1KB9F 2ARHA 4XTUA 1BT8A 1N32O 3ZJZA 1B06A 4OPAA 3CEIA 2A8EA 3I5DA 3H9VA 3HB3B 3T1YO 3U0ZA 1XNRB 2F23A 3AG3B 1MZFA 4NXNB 1S0VA 1X2GA 2QHSA 4P72C 3UM7A 3ABTA 1MSWD 2AW9A 5KA6A 2Q0OC 4EX5A 1AILA 3HXYA 3TEGA 5AG2A 4IT5A 4X1YA 1BIBA 4B3RB 1OZ0A 1IL2A 5CBHA 4XTZA 4P73C 2IY5B 1I94B 4AQYO 4DV4B 4FFBB 2WWWA 2H3OA 5A9GA 2JEXA 2EAYA 4H2TA 5CA3A 1WP8A 5H6RA 4K3AA 1Q43A 3CMQA 2N05A 4YROA 2PY5A 3BCCH 3ZMVA 2JS3A 3FYIB 5IJ0B 4NKGB 1Y74B 2IH3C 3V7RA 4F6EA 4GKKO 2WLIA 4U3JA 5BY1A 2XTIA 3H1HH 4KP4A 3BA9A 3CE2A 1B7YA 2Y69B 2YUAA 4PJ0Z 4ZKIA 4DR7B 1N36B 4TV9B 2F93B 2RQ6A 1YI2V 4TVAA 3EXAA 4FM1A 3K9AA 2JK5C 3RGBA 2ZR3A 1YIJV 3CCMV 2HKOA 3N2GB 2RHSA 4FLXA 3AG2C 4TV8B 3UCSC 3EFSA 1YFRA 4P74A 3H1JH 2WLLB 1K8AW 1AR1B 3GWOA 1QE0A 4QPJA 1GO3F 3G67A 2ZE8A 3HKCB 2X7RB 1BQZA 4X62B 2QWRB 4LFCO 4UCSA 3DXRB 3VQYA 4YDQA 2LGWA 4XU1A 4EEQA 3U10A 4GX5A 1BBUA 2QE7G 4MTFA 3T1YB 3CJHA 3VQVA 5ITZA 3TETA 1PNMA 2YEVB 4DR4O 4YJ2A 2YS8A 1KUQA 3L74H 2UXNA 3W7UA 4HNAA 2ZT9B 2UXCO 5JH7B 3WB2A 5GTHZ 4JAAA 4DV0O 2VQFO 4G85A 1DLBA 2IU3A 4CS3A 4FLWA 2QHTA 4WFEA 4UFZA 4AQYB 1EOVA 1GN4A 2YXHA 3LUTB 1FYFA 4DQ2A 3SYPA 3X2QC 1NJIW 3SJAC 4PA6A 3FJPA 5C8YA 4DV2O 1BZKA 3TGUH 4AILC 4UCOA 3ASNC 1Q90D 1R3IC 1SERA 4YRRA 2ZR2A 1WQ7A 2QKAA 2MK3A 2ZNJA 3JAWB 4GKKB 1OCOC 2EIMC 4JYCA 4YRPA 3IC7A 3RYFA 2QWNB 3BEHA 1VQ7V 1I5YA 1BMFG 4CS4A 2EL9A 2CGNA 1R73A 4TUYA 3JD3A 3L4GB 2X6AA 2N74A 3DC5A 4FZ1A 2P5OA 1Z5WA 2UXBO 1SS3A 5IY5C 5K1PA 3ETDA 4P71C 5EBMC 1NU1H 3DTUB 1XMOO 5B3SC 4I50A 4KFMA 4O4HB 4JZ2A 4MVOA 3RL6A 4O4LA 3D8CA 2DU7A 2Y0IA 4X65O 2QEXV 1A32A 3BY6A 5LMNB 1Y67A 4P3NA 1CXZB 4QIWF 4D7SA 4K86A 3CS5A 1MG1A 2DWDC 5F5WA 5LOVB 1SZXA 3TXQA 2ALYA 4LVLA 5KX5B 1KECA 5JQGB 4QGPA 4XEOA 1ROPA 3LNNA 3CRMA 2ETNA 4LFCB 2VWKA 1P7GA 2X6BA 3C3TA 2E64A 3K08A 2CJBA 1QQCA 2OYQA 3P3NA 1JJCB 5LGNA 1CP9A 4OXSA 4DR4B 4XTWA 3B8MA 1VQ4V 1YJNV 3HXVA 4TVWA 5EYPA 1M4UA 1M56B 4YXWG 2UXCB 1FXHA 1W2BU 2UU9B 1EFRG 2KKWA 2VQFB 2OCCC 2ZZGA 5H2FZ 3AK2A 1AR4A 4H2VA 3ZHTA 1DK1A 3G4SV 4O2BB 1IXBA 2C7IA 5LA6A 3ZMTA 1X54A 5LP6A 4DV2B 1Z5VA 4KR3A 2QM8A 3D36C 2QA4V 1K9MW 4UPAA 4L8JA 1EBOA 5KMGB 1VQ9V 1LUWA 4X64O 4B3TO 1WP7A 1GN6A 1M5IA 1LYLA 3ABMB 1ENVA 1B6QA 4PELA 2ADPA 5D5PA 4JI0O 3RN4A 4LP8A 2XAHA 3HRIA 3ZHQA 4H2UA 2HG5C 4LC1A 2AZ2A 3SGIA 4GUNA 1XMOB 1AROP 2F1MA 1J95A 4H37A 4Q15A 4J11A 4YIOA 3RFRA 4X65B 1D5NA 4TWKA 1EIYA 1LUVA 1GM9A 4X1YB 1XNQO 5LP6C 2ZQMA 2GUZB 1F4MA 4BIUA 1FXKC 2A79B 2PUSA 1NJ8A 3UKMA 3B77A 4MSWC 1G5HA 2YIAA 2E74B 1WPBA 1BBWA 3ETQA 3ABUA 3IC9A 4ZHQA 3NELA 1NT2B 1S76D 4OLFA 4HWOA 4XU2A 1VQKV 3LDEA 3FKSG 1MNGA 1K3EA 2XAGA 4LF8O 1M1KW 4YRMA 3QVNA 2WSSG 5JVDB 3VQWA 1YTFD 2ZT5A 2E65A 2WLIB 3VQXA 2ILMA 3F5WC 4TOIA 1WB7A 4H33A 1PV0A 1YDXA 1HW7A 1XL6A 1YGBA 1JJOA 1B7YB 4DK1A 5HGQA 3CP1A 4BWAA 1Q8IA 3T1CA 1ATIA 1FS0G 2JEUA 4IHJA 4BIZA 2GTSA 2Q5HA 1COWG 4DO2A 4LF9O 2EILC 4Z2WA 4OX9O 2RHSB 2W0XA 3JAMN 1ADJA 1U97A 1H2KA 4DR1O 1EM1A 1L0LH 2DYRB 1AI4A 5JJNB 1Y74A 2I4NA 1RIQA 4BW5A 4B3TB 1V55B 2ZINA 3PCOB 3ABLB 4YRTA 1YZBA 3AG3C 1F7YA 3OTOO 1BHBA 3OUFA 5KHJA 4JI0B 4I55A 1H2GA 3OFNG 3K5LA 4WFHA 2QGNA 2RDCA 1RM1B 2HJFC 3CJHB 4MW3A 4D6TH 3TEHA 1S5JA 4EFEA 3IJ4A 2XAQA 4YJ2B 2OIGA 1EQRA 4TWAA 2HR3A 3A5YA 2EWNA 4HNAB 4RO2A 4YJ3B 3RKWA 1M57B 3JAKA 3CX5F 3WFVA 1XNQB 4UVBA 4JTCB 1AJPA 4G28B 4R8CA 2B9ZA 1X2HA 4X20B 3UO2A 3LSQA 4NB5A 2RHQB 1VQPV 4MVRA 3HKCA 4C7UA 4PDLA 3E86A 5C8YB 4LWSA 3DXRA 4JV5O 4L87A 4LF8B 3RUXA 2BOCC 2Y69C 3RYFB 1FJGO 1Q86W 1KP2A 4NR1A 5HFLA 1SA0A 3NEMA 3BVOA 1JPXA 4TUYB 1V9PA 2DEQA 1P7BA 1BQ0A 3CMAV 1IZ3A 2VS0A 3JD2A 1EVLA 2E10A 3CHXA 2WPDG 1YF2A 2J3LA 4YRSA 4LF9B 1YCIA 4YRGA 4I50B 2ODRC 3RYIB 1F51A 4OX9B 2Q69A 4CS2A 1SQFA 1SETA 4YY3O 4DR1B 1USYA 1GM7A 4X66O 4G27B 2ALYB 3JAWA 2WLJA 3I55V 3CCVV 4PI0A 4K35A 2P7TC 2Y0PA 1N33O 3AEIA 1XBLA 2WLMA 2YIBD 4YCUA 1QBZA 2ITDC 2YDEA 1Q82W 2QKSA 4B3SO 3OTOB 3B8NA 3BAAA 3MHHC 3QG5A 1Y4MA 4UV8A 2YIBA 5JCOA 1K5QA 2ZM6O 1W0JG 1NQTA 2ZGWA 1IBLB 1NR1A 3JSNA 4UVCA 4JAVA 3UT5A 4GX2A 1PP9H 3E8GA 3CB2A 5EYPB 3QF7A 2I4OA 3BPZA 1SRYA 1KKDA 3ASOB 3S3WA 4P2ZA 3NETA 5KA5A 1QU7A 5KX5A 3TCUA 4BIOA 2ZXWB 4UP7A 1R6KA 4JV5B 1F23A 2V1DA 2A06H 1JJ2U 2ARSA 2ZDIA 3CD6V 3A0HZ 4XU0A 3L73H 3V7CA 1FJGB 3OUSA 3SJCC 2FYKA 2JIZG 3AK1A 2P0LA 1QLEC 4LVKA 4P9PA 4D7TA 4ZI7A 5IYDO 2FMLA 5EIBD 1X56A 3QTCA 1NYRA 2HLDG 1NTMH 3M8AA 2YXYA 4YRNA 4WFAV 1VP7A 1HC7A 2CGOA 3Q4HA 1EIYB 1Z7MA 1WAZA 2DJVA 4DR5O 5KHIA 3K9SA 3P8TA 3EFRA 1N33B 3OD4A 1H4VB 4NXMB 4JYBA 4X89A 1FKAO 2G38A 3WG7B 4B3SB 4I9QA 2WA3A 2DQ3A 4F4LA 3J7AU 3LSSA 3SJQC 1BSMA 4FLZA 5GTIZ 3AG4B 2ZM6B 2E5LO 4DUZB 4UB6Z 4YP0A 2GSMB 3GB7C 3OM3B 3C3SA 4MT8A 4JI3B 3ZHUA 3I7FA 4HBNA 1K5SA 3CC2V 4DRXB 2GBOA 3T4ZA 3STLC 1J5WA 2ZIMA 4TVYA 3E22A 3MAQA 1IBKO 3OD1A 3CCQV 2GUZA 5KUMA 3QO5A 4J10A 1B8AA 3E35A 4P75A 1AJNA 2PTMA 4IHJB 4K8ZA 1X01A 4P9OA 1OV9A 5LBQA 1VQNV 5CBGA 4MVQA 2DWEC 4ICGA 5FNVA 3N2KA 3IAYA 1N8RW 2KSDA 3AK3A 3AG7A 3L70H 3ABMC 5IYZA 1Y6XA 1QF6A 1O9GA 3C90A 2PZSA 5JVDA 4BR6A 2DXTA 3HFZA 1HNWO 4K88A 4PG3A 1Z2GA 5CBFA 3BFRA 4RMFA 1Z7NA 4LVMA 3RGLA 3M99B 4I55B 5CMUA 2D2CB 5GW7A 2ARUA 1R3JC 2E76B 3TEHB 4N21A 3HY0A 1RSOA 4PHCA 4PA9A 3JAKB 2C8MA 2W0FC 5LMNO 4X8AA 1I7FA 4DR5B 4B7EA 5C52B 2HVJC 4R6ZA 3FD9A 3PCOA 4QJFB 3JARA 3O65A 3K06A 1NH2D 1E1OA 4LWSB 1PNLA 1XUQA 3RVZA 4YRIA 4X1KB 4HWRA 5FL7G 3V8JA 1HTTA 2XTAA 2Y4TA 1Q6HA 2E5LB 1NJ6A 1XQ8A 3K03A 1QNMA 3L71H 1SA0B 5IYBO 5EBLC 1Q6UA 3WB1A 4NVPA 4FJCC 4NTWA 1B76A 4XDJA 1UPGA 3K59A 4YJ3A 1R3LC 2UUAB 1T5EA 4J9YB 2UU9O 1N0JA 1WN7A 1IBKB 4J41A 4H2WA 1OCZB 3IKMB 3AG1C 3GVMA 1FAFA 1ZLZA 2YI9A 2DYRC 4P74C 4X20A 5B1NA 3D3QA 1PNKA 2RHQA 2IBZH 2IJKA 1H2SB 2CE4A 1OCRB 4PDMA 3BABA 3CCUV 1V55C 1BIAA 3L2ZA 4UP9A 5B66Z 3ABLC 2ZE5A 3MDSA 1FPOA 1KOGA 3OW2U 3RIRA 5LL6Y 3RKXA 1THZA 1VEWA 1HNWB 2EJGA 2BSKB 1RM1C 5JWPA 4MVMA 3TUPA 4FMTA 4RUEA 2DKGA 3RKYA 4HYOA 3ZHSA 5CN0A 5CB4A 3RF1A 4JI7O 1Q6IA 3RBZA 3CRRA 3M4QA 5LGUA 3ZHRA 4LH6A 2UXDO 1VQMV 3KKYA 1M57C 1VQLV 3IALA 1SQXH 3SPJA 4FVMA 1XILA 1SKVA 4HZ3A 3ICXA 5LHIA 1NYQA 3CCJV 3KG2A 3UT5B 5JJJB 4XTVA 4YREA 3JD0A 2IH1C 2VQEB 3RYIA 3UGQA 3J81N 1P4RA 3JD1A 1WQWA 3CCSV 5IYCO 1JMKC 1W0KG 5FPOA 2Q4PA 2M6YA 3OGIB 3HFVA 2JJ1G 1NJ2A 3VBBA 2CTRA 5CA1A 2I4MA 4DK0A 4RWUA 4YCWA 4O2DA 4TT3G 1IBMO 4JTDB 2YC0A 4JAUA 4YRQA 4GYCB 1JOYA 2IU0A 2XT9A 5IJ9A 1J5EO 1SC5B 4QNHB 3V8LA 4P3OA 2XGTA 3ICAA 1P49A 2P90A 4MTXA 2F4VO 3K57A 2A9HA 3G6BA 4ZI7B 4K0KO 3W3SA 2ZD9A 1DF5A 2DZ9A 2QSAA 5DN6G 3R07A 1YITV 3T4DA 3APQA 1KMMA 1QVGU 3WQZA 3Q4HB 2EJ7A 2ZCEA 1E22A 2YSUB 1R6TA 4LF6O 5H5NA 5E79Z 1XMQB 5L3EA 2GDSA 3L72H 3K79A 2AHYA 3HKBA 2DZCA 5B1BC 3ZRVA 2RJZA 4LFAO 1OJHA 1GTOA 4NTYA 4JI7B 3CRQA 1ASZA 3ZCCA 3RYCA 3K0DA 1L0WA 2UXDB 1MOFA 4CH6A 2IM9A 4XDLA 3PJSK 4GKJB 2F43G 3MF1A 4MVSA 2XAJA 3OR6C 3ASOC 4DV3O 4I9WA 1KYOF 3W7XA 2W6JG 3E22B 2DVEA 1M93A 3HRKA 4LVJA 5H6QA 3REUA 1KMNA 4GZRB 2WLNA 3G6EV 1OCCB 1GM8A 3CXHF 5FNVB 3N2KB 2AMCA 3HKEA 1TVKA 5IYZB
chains in the Genus database with same CATH topology
3UM7A 3ABTA 3F7VC 1UJWB 4CS2A 2ZNIA 1MSWD 2EIJB 5KUKA 5KA6A 3W7SA 1SETA 3OE7G 4EX5A 3HFZB 3A32A 1USYA 5EK0A 3HXYA 3JYCA 1GM7A 4XTYA 1WLEA 5EC2C 3TEGA 4WCEV 4XTXA 2XASA 2OT5A 4G27B 2ALYB 1BIBA 2WLJA 2B1IA 2H94A 3ABKB 3I55V 3CCVV 1OZ0A 3ZN1A 2J3MA 2P7TC 1IL2A 3ZRWB 2P6JA 5CBHA 4JASA 3AEIA 2WLMA 4YCUA 4XTZA 4P73C 1QBZA 2ITDC 2IY5B 3R65A 1Q82W 2QKSA 2ZT7A 5ELNA 2WWWA 3DSQA 3HXZA 3B8NA 3DGEA 4XU3A 3MHHC 1Y4MA 1S3JA 2JEXA 2EAYA 4H2TA 4UV8A 5CA3A 1QLEB 4UXNA 1K5QA 4QE9A 4DXWA 1YJWV 2E41A 1W0JG 5H6RA 5C51B 1NQTA 3CMQA 4YROA 1C0AA 2DTHA 3ZMVA 1Y66A 1V54C 1VQ8V 1NR1A 3OEHG 2ZGWA 3FYIB 4E2LA 2IJIA 2IH3C 4UVCA 4JAVA 3V7RA 2WLIA 2EINB 2EZPA 4GX2A 1ORQC 3E8GA 3WG7C 2I4OA 2IJJA 4JF3A 2XTIA 2PI4A 4N23A 1GK9A 4KP4A 1H8EG 1SRYA 5EBWC 5IDJA 3G71V 1YHQV 4HWSA 4I5SA 5HFMA 3NXSA 1B7YA 3AG4C 2Y69B 1G8MA 4ZKIA 4RQEA 1KKDA 3ASOB 3OMNB 3HY1A 3D36A 2CK3G 4P2ZA 3CCEV 3NETA 5KA5A 4H02A 2ZXFA 4MW8A 1ASYA 3PZCA 4YCVA 2V7QG 1YI2V 4H2SA 3TCUA 4TVAA 1BL8A 2ZXWB 1DF4A 4UP7A 3K9AA 2ZZEA 2JK5C 2EIKB 2OTJV 1R6KA 2Q67A 1NH2B 1YIJV 2ZR3A 3CCMV 2AKWB 2HKOA 1GGMA 4BAYA 1NBMG 3E2EA 1F23A 2V1DA 2X0LA 1JJ2U 2RHSA 3AG2C 3L1AA 2ARSA 1YSCA 2ZDIA 3CD6V 3EFSA 3W7WA 2D3OW 1YFRA 4XU0A 3V7CA 3SPHA 3E9HA 3OUSA 4P74A 5B1AB 3BFMA 2WLLB 1K8AW 3ZN0A 1AR1B 2FYKA 3GWOA 2JIZG 1QE0A 3CCLV 2EJRA 4QPJA 1GO3F 4QPKA 2P0LA 4KQEA 1H4SA 3MF2A 1QLEC 3FYEB 2WLKA 3P8YA 3OAAG 4GT1A 4LVKA 1GMGA 2X7RB 4UUJC 4KR2A 4YDQA 3VQYA 5EC1C 1BHAA 4WJ4A 4P9PA 4XU1A 3CMEV 3E9IA 4GX5A 5ELOA 3SYOA 1FXKA 5IYDO 1BBUA 2QE7G 4H2YA 4MTFA 1X56A 1K92A 3QTCA 1M9NA 2HLDG 1NYRA 3VQVA 3TETA 1PNMA 2YEVB 2PMFA 2ODRD 2LFRA 2R9RB 4YRNA 4WFAV 4MS2A 1HC7A 2UXNA 4RQFA 4H2XB 1EIYB 4YRJA 4G84A 3W7UA 2E5AA 1Z7MA 2R9IA 2ITCC 2ZIOA 4UVAA 4YRLA 3UH0A 4Q20A 1V54B 3P8TA 3QNEA 3EFRA 4MVUA 1DLBA 2IU3A 4G85A 2ZXWC 1H4VB 1E1TA 4CS3A 4JYBA 4X89A 4PA7A 2QHTA 4WFEA 3WG7B 1EOVA 3MD0A 1H38A 4DQ2A 3LUTB 3EHBB 3OGCC 3SYPA 4R7CA 1R3KC 2DQ3A 3X2QC 4F4LA 1NJIW 1FYFA 5L3DA 1G51A 1X2GA 3P30A 4TTVA 3LSSA 4PA6A 3SJQC 3FJPA 3REXA 4U7OA 3AG4B 4LNSA 1NVPD 4Z1MG 4YP0A 3ASNC 2GSMB 3GB7C 3OM3B 1NKDA 4MT8A 4CH3A 1R3IC 4GX0A 5C93A 3ETGA 1SERA 1M90W 2CGHA 4YRRA 3I7FA 1DTOA 2ZR2A 1B70A 3ZMZA 2MK3A 1K5SA 5LHHA 1WQ7A 2ZNJA 1OCOC 2EIMC 4JYCA 3CC2V 3IC7A 4YRPA 1X55A 1VQ7V 3BEHA 1I5YA 2EBOA 1BMFG 1FXVA 5H9CA 3STLC 3T4ZA 4OP0A 1J5WA 2M7WA 2EL9A 4CS4A 2FTKA 2ZIMA 4TVYA 4ZIBA 5L3CA 3A7UA 1R73A 3JD3A 3OD1A 2X6CA 3CCQV 3L4GB 5J9PC 3LNMB 1QCEA 2X6AA 5KUMA 3AG2B 3QO5A 3HXWA 1WU7A 1B8AA 3E35A 3LC0A 1AJNA 2ZZFA 4P75A 4RDXA 1X01A 3ZRSA 4P9OA 3JCZA 2DQ0A 3CXCU 5LBQA 1VQNV 5CBGA 4MVQA 5IY5C 4BW9A 5K1PA 3ETDA 3T2MA 4P71C 2DWEC 5EBMC 4X5OA 2Z3YA 1HXDA 2JDIG 3DTUB 5B3SC 1N8RW 5E1AC 4KFMA 11ASA 3A7RA 3SPCA 4MVOA 3RL6A 3ABMC 1QF6A 4WI1A 2DU7A 1R6NA 1OCZC 4ZTZB 2QEXV 2PMEA 3BY6A 2PI5A 4PDRA 2DXTA 4P3NA 1K97A 5L3FA 3HFZA 4K88A 4PG3A 4QIWF 3ZIAG 2EJ9A 4K86A 1MG1A 2DWDC 2NNUA 5F5WA 5CBFA 2QHVA 2HVKC 4HAMA 2ALYA 4LVLA 4RMFA 1OCRC 1Z7NA 5K1XA 1VQZA 1KECA 3ZRWA 2ZT6A 3RGLA 3M99B 4LVMA 1JQ0A 4UP8A 4TVAB 4XEOA 1ROPA 2QTOA 5CMUA 3E89A 2IY5A 1USYC 2P67A 3QO7A 5GW7A 2ARUA 3MQZA 2X6BA 1R3JC 3K0GA 4XBFA 4CZZA 1SESA 4MTGA 3TEHB 1OHHG 4N21A 3K08A 2E64A 2CJBA 4K87A 4HT4A 3A74A 3AG1B 1JJCB 4JPRA 3A31A 3HY0A 1QR8A 5LGNA 1CP9A 4OXSA 4PHCA 4LBEC 3V7SA 4PA9A 4XTWA 3B8MA 2ATKC 1N9WA 1EVKA 3K04A 2C8MA 4FIPC 4ZTUB 3X2QB 1VQ4V 4HVCA 1YJNV 2W0FC 1PD3A 3HXVA 4TVWA 3CYOA 1CPYA 1G4YB 1M56B 4X8AA 1VQ6V 1S77D 4YXWG 1FXHA 1TUEB 1W2BU 3ASNB 4JTAB 2Q5IA 3FB6C 4P30A 4R50A 1EFRG 3A5ZA 2XNDG 4TQDA 2B5UA 5C52B 1H8HG 2Q68A 2ZZGA 2HVJC 2OCCC 1HWYA 4R6ZA 1EZJA 3V8KA 5C53B 1OCOB 2EIMB 3PCOA 1PYSB 1FXKB 3TK1A 4QJFB 1QR9A 4H2VA 1WPXA 3G4SV 3K06A 1GKFA 1NH2D 1IXMA 3ETEA 1E1OA 4E51A 1PNLA 3RVZA 2C7IA 2P5IA 1ADYA 3ZMTA 4YRIA 1W66A 2AHZA 5FL7G 1X54A 4HWRA 1HTTA 3V8JA 2B1GA 4TQFA 2Q7HA 3RVYA 4KR3A 2G4CA 1NJ6A 2QM8A 2CJ9A 1MABG 2H8PC 2WLHA 3HXXA 2QA4V 2AKWA 3K03A 1K9MW 1E79G 2DYSC 1G5IA 2DXUA 4UPAA 2EZOA 4WFGA 2IW5A 1AI6A 1EBOA 5EBLC 5IYBO 5IY5B 1VQ9V 4EO4A 2ARTA 4FJCC 1B76A 1YFSA 4XDJA 4KUMA 4RAIA 2WLLA 5B3SB 1R3LC 3IGAC 1K33A 4J9YB 1LYLA 1YB3A 3ABMB 1EFWA 1ENVA 1XL4A 1B6QA 1OCZB 4XDKA 4H2WA 4PELA 3IKMB 3AG1C 2ZDIC 4LP8A 1S72V 2XAHA 3MHSC 3HRIA 4GX1A 2DYRC 4GCZA 4P74C 5B1NA 2AMCB 5BZBA 4H2UA 4QE7A 2HG5C 4LC1A 1PNKA 2QM7A 4WFBV 2RHQA 2IJKA 3E8BA 3A7AA 3P8VA 4Q6GA 1OCRB 4PDMA 3KFUA 3CCUV 1AROP 1M56C 1V55C 2LP7A 1BIAA 3L2ZA 4UP9A 3H01A 3ABLC 3ZRXA 1K73W 1J95A 4H37A 5L3BA 1QVFU 4P73A 2YEVA 4Q15A 1KOGA 3OW2U 2NS6A 3RIRA 3D3IA 3RKXA 4TWKA 1EIYA 1THZA 3CPWU 1E1QG 3FB8C 2CIMA 1GM9A 2ZQMA 3HPLC 3EFFK 3FB7C 1F4MA 1YTFB 4BIUA 1FXKC 2WAMA 2EJGA 2A79B 1NJ8A 2C2AA 1RM1C 3UKMA 1H4TA 3B77A 4MSWC 4MVMA 1G5HA 3TUPA 4FMTA 2HFEC 4RUEA 1BBWA 2DKGA 3E83A 4HYOA 3RKYA 5CN0A 3VQWA 4ASUG 3ABUA 3RF1A 5E3IA 2IJHA 3RBZA 5LGTA 3M4QA 5LGUA 3NELA 3G1ZA 4TSFG 1S76D 1L1FA 1VQMV 4OLFA 4HWOA 2W6IG 1YJ9V 4J9ZB 3E8HA 4WJ3M 2QHSA 4XU2A 4YRCA 1M57C 3CC7V 1VQLV 1VQKV 2XOKG 3LDEA 3FKSG 3IALA 3SPJA 1LNQA 1K3EA 2XAGA 1M1KW 4YRMA 2WSSG 3OEEG 3I56V 4HZ3A 2DJZA 1YTFD 2OCCB 5LHIA 2JJ2G 3CCJV 4CBCA 1NYQA 1WYDA 2E65A 2WLIB 2ZT5A 4WF9V 3KG2A 4YREA 3VQXA 4XTVA 4HWPA 3JD0A 2IH1C 3OR7C 3F5WC 5DM6V 1AI5A 3W7TA 4JGSA 4DPGA 1SZTA 3UGQA 4H33A 1P4RA 3BJUA 3JD1A 1K7DA 1WQWA 3CCSV 1NJ5A 2DU5A 4WFFA 5B1OA 5IYCO 1E24A 2KB1A 4RUFA 1XL6A 1VQOV 1YGBA 1B7YB 3OMIB 1W0KG 5HGQA 2UXXA 3CP1A 3ZMUA 2ZT8A 4BWAA 1PL0A 2DYSB 3L4GA 3T1CA 1QLNA 1FS0G 4PA3A 1ATIA 1YFTA 4PA4A 2JEUA 3HFVA 1F4NA 2JJ1G 4BIZA 1NJ2A 3VBBA 2Q5HA 1COWG 1RPOA 4DO2A 1JCHA 2EILC 5B1BB 2I4MA 3SYCA 4YCWA 4O2DA 3ML0A 4TT3G 2RHSB 1KP3A 4JTDB 1ADJA 4P75C 3SYQA 4FK5C 2DTOA 3IKLA 4XEMA 2DYRB 5LHGA 1K4CC 1E1RG 1AI4A 1OCCC 2Z5UA 1KQSU 2I4LA 4JAUA 4YRQA 4MVZA 4UV9A 2I4NA 3QO8A 1JOYA 2IU0A 2A0LA 1RIQA 4ZBMA 4BW5A 4QNHB 3V8LA 4LVIA 5KNNA 1PKXA 1V55B 4P3OA 2ZINA 1RPRA 3PCOB 3JD4A 2XGTA 4P72C 3ABLB 4U7NA 2OTLV 4YRTA 3UFGA 4G2KA 3ICAA 3AG3C 1FFTB 2P90A 4MTXA 1NR7A 2HNIA 1BHBA 3OUFA 1H2GA 2A9HA 2EIJC 3IFXA 3OFNG 4WFHA 1JVMA 3SPGA 3VOUA 2DTIA 2EJFA 3RACA 4AH6A 2Y48A 3W3SA 1K34A 3FB5C 1WPYA 4HA8A 2NLJC 2ZD9A 3P32A 1DF5A 1RM1B 4YYEA 4CH5A 2DZ9A 3SPIA 2HJFC 4MW3A 3TEHA 5DN6G 3R07A 3MEYA 1YITV 3T4DA 2XAQA 3ABKC 4X88A 1KMMA 1QVGU 3WQZA 1JJCA 3UGTA 1EQRA 4TWAA 3LDCA 2ZCEA 1E22A 4J15A 2HR3A 3A5YA 2E1HA 2EWNA 4RO2A 2ZTGA 1KD1W 3RKWA 2LFSA 1M57B 1Q7YW 1K4DC 3WFVA 2YSUB 3RW0A 4LCUC 3CCRV 4UVBA 3HXUA 5L3EA 3K79A 2AHYA 4JTCB 1AJPA 3OMAB 4G28B 4R8CA 2DZCA 5B1BC 2DW4A 3SYAA 3ZRVA 1X2HA 3NENA 4CH4A 4P72A 1GTOA 1NNHA 3LSQA 4EKWA 2XAFA 2RHQB 1VQPV 1ASZA 4MVRA 3ZCCA 2EINC 3K0DA 1PYSA 1L0WA 4FPPA 4PDLA 1AI7A 3E86A 1S5HC 1MOFA 4CH6A 1ZWIC 2QHUA 4XDLA 3PJSK 4L87A 1VQ5V 2Q6AA 4HWTA 3RUXA 2F43G 1B70B 1JX9A 2BOCC 2Y69C 2DDZA 3MF1A 4YRKA 4MVSA 2XAJA 2K1EA 2CJAA 3OR6C 1NVPB 3ASOC 5L3GA 4I9WA 4PDVA 3IG2A 4NCXA 1Q86W 4YRFA 2Q7GA 2EILB 1KP2A 5HFLA 3W7XA 3NEMA 2W6JG 1JPXA 2GHYA 4P71A 4H2XA 2DVEA 4YPFA 3F7YC 3HRKA 4LVJA 5H6QA 3REUA 1KMNA 1AJQA 2E3CA 4MTOA 1Q81W 2DEQA 3K3WA 3HTZA 2EIKC 1CEZA 2Q7EA 1P7BA 2WLNA 4WF2A 3CMAV 3A0RA 12ASA 1KC8W 3G6EV 4XTUA 1OCCB 1I5XA 2BOBC 3ZJZA 4P3PA 1H4QA 3JD2A 1NJ1A 1EVLA 3ERRA 1GM8A 2E10A 2WPDG 2A8EA 2J3LA 3CC4V 3HB3B 5B1AC 3LDDA 2AMCA 3M4PA 4YRSA 4YRGA 3ZMSA 3E8FA 3STZC 1WNLA 3AG3B 2ODRC 1S0VA 1F51A 2Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS2 A;  2ZNI A;  1SET A;  4EX5 A;  3HFZ B;  3A32 A;  1USY A;  3HXY A;  4XTY A;  1WLE A;  3TEG A;  4XTX A;  2ALY B;  1BIB A;  2J3M A;  1IL2 A;  4YCU A;  4XTZ A;  4P73 C;  2IY5 B;  2ZT7 A;  5ELN A;  3HXZ A;  3DSQ A;  4XU3 A;  2EAY A;  4H2T A;  2E41 A;  5C51 B;  3CMQ A;  4YRO A;  1C0A A;  2DTH A;  2ZGW A;  3V7R A;  2I4O A;  2XTI A;  1SRY A;  4HWS A;  1B7Y A;  4RQE A;  3HY1 A;  3NET A;  4H02 A;  2ZXF A;  1ASY A;  3PZC A;  4YCV A;  4H2S A;  4TVA A;  4UP7 A;  2ZZE A;  2ZR3 A;  2AKW B;  1GGM A;  2RHS A;  3L1A A;  2ARS A;  3EFS A;  1YFR A;  4XU0 A;  3V7C A;  3E9H A;  4P74 A;  3BFM A;  2FYK A;  1QE0 A;  2P0L A;  4KQE A;  1H4S A;  3MF2 A;  3P8Y A;  4KR2 A;  4YDQ A;  3VQY A;  4WJ4 A;  4XU1 A;  3E9I A;  5ELO A;  1BBU A;  4H2Y A;  1X56 A;  3QTC A;  1NYR A;  3VQV A;  2PMF A;  2ODR D;  4YRN A;  1HC7 A;  4RQF A;  4H2X B;  1EIY B;  4YRJ A;  4G84 A;  2E5A A;  1Z7M A;  2ZIO A;  3UH0 A;  3P8T A;  3QNE A;  3EFR A;  4G85 A;  1H4V B;  1E1T A;  4CS3 A;  2QHT A;  1EOV A;  4DQ2 A;  1FYF A;  2DQ3 A;  4TTV A;  1G51 A;  3LSS A;  3FJP A;  3REX A;  4LNS A;  4YP0 A;  4CH3 A;  1SER A;  2CGH A;  4YRR A;  3I7F A;  1B70 A;  2ZR2 A;  1WQ7 A;  2ZNJ A;  4YRP A;  1X55 A;  4CS4 A;  4OP0 A;  1J5W A;  2EL9 A;  2ZIM A;  4TVY A;  4ZIB A;  3A7U A;  3OD1 A;  3L4G B;  3HXW A;  3QO5 A;  3LC0 A;  4YRL A;  1WU7 A;  1B8A A;  4P75 A;  2ZZF A;  4RDX A;  1X01 A;  2DQ0 A;  4BW9 A;  5K1P A;  4P71 C;  4X5O A;  1HXD A;  11AS A;  3A7R A;  3RL6 A;  1QF6 A;  4WI1 A;  2DU7 A;  4ZTZ B;  2PME A;  2DXT A;  4P3N A;  3HFZ A;  4K88 A;  4PG3 A;  4K86 A;  2EJ9 A;  5F5W A;  2QHV A;  2ALY A;  4RMF A;  1Z7N A;  5K1X A;  1VQZ A;  2ZT6 A;  3RGL A;  4UP8 A;  4TVA B;  4XEO A;  2IY5 A;  1USY C;  3QO7 A;  2ARU A;  1SES A;  3TEH B;  2E64 A;  2CJB A;  4K87 A;  3A74 A;  1JJC B;  3A31 A;  3HY0 A;  4PHC A;  3V7S A;  4XTW A;  1N9W A;  1EVK A;  2C8M A;  4ZTU B;  4HVC A;  3HXV A;  4TVW A;  2Q5I A;  3A5Z A;  4TQD A;  5C52 B;  2ZZG A;  3V8K A;  5C53 B;  3PCO A;  1PYS B;  4H2V A;  1E1O A;  4E51 A;  2C7I A;  4YRI A;  2P5I A;  1ADY A;  4HWR A;  1X54 A;  3V8J A;  1HTT A;  4TQF A;  2Q7H A;  4KR3 A;  2G4C A;  1NJ6 A;  2CJ9 A;  3HXX A;  2AKW A;  4UPA A;  1G5I A;  2DXU A;  4EO4 A;  2ART A;  1YFS A;  1B76 A;  1LYL A;  1YB3 A;  1EFW A;  4H2W A;  3IKM B;  3HRI A;  4P74 C;  2AMC B;  4H2U A;  4Q6G A;  2RHQ A;  3P8V A;  3A7A A;  3KFU A;  1BIA A;  3L2Z A;  4UP9 A;  4P73 A;  4Q15 A;  1KOG A;  3RIR A;  3RKX A;  1EIY A;  2CIM A;  2EJG A;  1NJ8 A;  1H4T A;  1G5H A;  3TUP A;  1BBW A;  2DKG A;  3RKY A;  3RF1 A;  5E3I A;  3M4Q A;  3NEL A;  3G1Z A;  4OLF A;  4HWO A;  4WJ3 M;  2QHS A;  4XU2 A;  4YRC A;  3IAL A;  4YRM A;  3VQW A;  2DJZ A;  2ZT5 A;  1NYQ A;  1WYD A;  2E65 A;  3VQX A;  4YRE A;  4XTV A;  4HWP A;  4DPG A;  3UGQ A;  3BJU A;  1WQW A;  1NJ5 A;  2DU5 A;  1E24 A;  1YGB A;  1B7Y B;  5HGQ A;  2ZT8 A;  4BWA A;  3L4G A;  1ATI A;  3HFV A;  1YFT A;  1NJ2 A;  2Q5H A;  3VBB A;  2I4M A;  4YCW A;  4O2D A;  2RHS B;  1ADJ A;  4P75 C;  2DTO A;  3IKL A;  4XEM A;  2I4L A;  4YRQ A;  2I4N A;  3QO8 A;  1RIQ A;  3V8L A;  5KNN A;  4P3O A;  2ZIN A;  3PCO B;  2XGT A;  4YRT A;  3UFG A;  3ICA A;  2HNI A;  3HXU A;  2EJF A;  2DTI A;  3RAC A;  4AH6 A;  3W3S A;  1WPY A;  4HA8 A;  4YYE A;  4CH5 A;  2DZ9 A;  3TEH A;  3R07 A;  3MEY A;  1KMM A;  3WQZ A;  1JJC A;  3UGT A;  1EQR A;  4TWA A;  2ZCE A;  1E22 A;  4J15 A;  3A5Y A;  2E1H A;  2EWN A;  2ZTG A;  3RKW A;  2DZC A;  1X2H A;  3NEN A;  4CH4 A;  4P72 A;  1NNH A;  3LSQ A;  2RHQ B;  1ASZ A;  1PYS A;  1L0W A;  4CH6 A;  2QHU A;  4L87 A;  4HWT A;  3RUX A;  1B70 B;  4YRK A;  2DDZ A;  3MF1 A;  2CJA A;  3IG2 A;  4NCX A;  4YRF A;  2Q7G A;  3NEM A;  4YPF A;  4P71 A;  4H2X A;  2DVE A;  3HRK A;  3REU A;  1KMN A;  2E3C A;  2DEQ A;  3HTZ A;  2Q7E A;  4WF2 A;  12AS A;  4XTU A;  4P3P A;  1H4Q A;  1NJ1 A;  1EVL A;  3ERR A;  2E10 A;  2J3L A;  3M4P A;  4YRS A;  2AMC A;  4YRG A;  1WNL A;  2ODR C;  1X2G A;  4P72 C;  1W66 A; 
#chains in the Genus database with same CATH topology
 2QR4 A;  1VF7 A;  3F7V C;  1UJW B;  1IBM B;  2ZNI A;  3OE7 G;  1HR0 O;  3HFZ B;  2LGQ A;  3K5M A;  2OIE A;  4XTY A;  4FM2 A;  1WLE A;  2DE0 X;  5BMV A;  4XTX A;  1L8D A;  2XAS A;  2P4K A;  1J5E B;  4DRX A;  1FD9 A;  4JAS A;  5KHK A;  2ZE6 A;  5DED A;  3R65 A;  2ZT7 A;  2F4V B;  5BR8 O;  2XHB A;  2BTO A;  3DGE A;  2ODM A;  4K0K B;  4UXN A;  4QE9 A;  4DXW A;  1YJW V;  1RSO B;  1XHZ A;  1VQ8 V;  4F6R B;  1VF6 A;  1WB8 A;  4E2L A;  1WJZ A;  2EIN B;  2EZP A;  2QWP B;  3H1L H;  1ORQ C;  4JI4 B;  3WG7 C;  2GTA A;  2IJJ A;  2PI4 A;  4N23 A;  4DV5 O;  3G71 V;  1H8E G;  1RFY A;  1YHQ V;  4I5S A;  4LF6 B;  4DV7 B;  3JAT B;  2OCH A;  3AG4 C;  5F2V O;  2R72 A;  3JAR B;  4LFA B;  3CCE V;  2CK3 G;  2ZXF A;  4I4T A;  1ASY A;  3PZC A;  5BXZ A;  1ZTE A;  4H2S A;  1BGY H;  3JAL A;  1DF4 A;  2ZZE A;  2CDY A;  2EIK B;  3N27 A;  1NH2 B;  1BS3 A;  3OTF A;  4BAY A;  1IBL O;  4IIJ A;  1BCC H;  1KKC A;  1YSC A;  4UCV A;  2D3O W;  4DV3 B;  4FM0 A;  2KG7 A;  3E9H A;  5B1A B;  1N34 O;  1EZV H;  3KCY A;  1B04 A;  4DV6 O;  3CCL V;  4QPK A;  1H4S A;  4KQE A;  3FYE B;  1JA8 A;  3P8Y A;  4GT1 A;  2UUB O;  4KR2 A;  4JYA O;  5EC1 C;  2JRI A;  1BHA A;  4WJ4 A;  4I0X B;  5ELO A;  5FPR A;  2HHH B;  4H2Y A;  2E75 B;  1M9N A;  2Y4U A;  1R1B A;  4X1K A;  2ODR D;  4RQF A;  2E5A A;  1HR0 B;  4X1I A;  1EN6 A;  3UH0 A;  2YID A;  4Q20 A;  1V54 B;  5CB4 B;  3QNE A;  4MVU A;  4LF5 O;  1XI1 A;  1MZE A;  3P3P A;  5BR8 B;  1H38 A;  2RCV A;  3EHB B;  3OGC C;  5KAI Z;  5L3D A;  4LR3 A;  5EZY A;  3REX A;  4U7O A;  2JS5 A;  2L6L A;  4LNS A;  2UUC O;  4CH3 A;  2CGH A;  2QM4 A;  1B70 A;  3ZMZ A;  3BA8 A;  3PN1 A;  1B3Q A;  3DC6 A;  1X55 A;  1URF A;  5H9C A;  4OP0 A;  4YHH O;  4LFB O;  4ZIB A;  5L3C A;  4DV5 B;  3A7U A;  4W4K A;  2X6C A;  5J9P C;  3LNM B;  3JAS B;  3HXW A;  2BSK A;  3LC0 A;  4YRL A;  1WU7 A;  3LSU A;  1YEW A;  4NXM O;  1SQP H;  4OGQ B;  4BW9 A;  2L35 A;  1AVM A;  4UCT A;  5CA1 B;  5FLX N;  4X5O A;  1SQQ H;  3RYH B;  2Z3Y A;  2JDI G;  2YI8 A;  1IUR A;  11AS A;  4DUZ O;  3A7R A;  3SPC A;  4JI3 O;  2N04 A;  1OCZ C;  4ZTZ B;  5A2Q N;  3ZHV A;  1K97 A;  2ADQ B;  5IJ9 B;  4AI8 A;  2NNU A;  1N34 B;  2QHV A;  3CRC A;  4HAM A;  5KHH A;  4DV6 B;  4LNU A;  1EN4 A;  2QJ1 A;  1OCR C;  5K1X A;  3ZRW A;  2ZT6 A;  4JZG A;  2QTO A;  4DV1 O;  4FZ0 A;  2UUB B;  2P67 A;  3QO7 A;  1USY C;  3MQZ A;  4JYA B;  3K0G A;  4XBF A;  4CZZ A;  1SES A;  4GLX A;  4HT4 A;  3A74 A;  4JPR A;  3O9O A;  4B7K A;  4LBE C;  1GRJ A;  5IT9 N;  4J7K A;  1EVK A;  3K04 A;  4ZTU B;  4FIP C;  4HVC A;  2NN4 A;  5TIS Z;  1PD3 A;  2LJ2 A;  1CPY A;  1G4Y B;  1VQ6 V;  5JCO C;  3HKB B;  4JTA B;  1Q3E A;  4R50 A;  3A5Z A;  4TQD A;  2B5U A;  4DUY B;  3FX7 A;  2Q68 A;  3V8K A;  1HWY A;  5C53 B;  3HKD A;  4LF5 B;  3RYC B;  1NS1 A;  1FXK B;  1QR9 A;  4K8X A;  1WPX A;  1GKF A;  2JVD A;  4E51 A;  1ADY A;  4CC5 A;  4WBN A;  4TQF A;  3RVY A;  1HDJ A;  1VIB A;  2UUC B;  2G4C A;  1MAB G;  2DMX A;  2WLH A;  2AKW A;  4J80 A;  4KUM A;  4RAI A;  4W4L A;  4YHH B;  4LFB B;  5B5E Z;  1YB3 A;  1EFW A;  5GON B;  1XL4 A;  4XDK A;  2ZDI C;  1IVS A;  1XHX A;  1S72 V;  3MHS C;  4GCZ A;  3RWR D;  2AMC B;  5BZB A;  4QE7 A;  4Q6G A;  3HKE B;  3E8B A;  1TVK B;  3KFU A;  1M56 C;  3H01 A;  4P73 A;  4IYI A;  3S3X A;  4KHP B;  2NR5 A;  5BMV B;  2KQX A;  3CPW U;  3B2E E;  1YTF B;  4H0L B;  3FAV A;  1ZL8 A;  4DR2 B;  2HFE C;  2UUA O;  3E83 A;  5E3I A;  4UCU A;  2IJH A;  1SQG A;  5LGT A;  3G1Z A;  5EIB C;  4TSF G;  1L1F A;  4DV1 B;  1YJ9 V;  4J9Z B;  1X59 A;  2XOK G;  4DYL A;  2RMK B;  1LNQ A;  3OEE G;  3I56 V;  4X9Q A;  2JJ2 G;  5DEC A;  4HWP A;  3W7T A;  5DM6 V;  4JGS A;  1RP3 B;  1K7D A;  2DU5 A;  3L9D A;  4WFF A;  5B1O A;  1E24 A;  1VQO V;  1IDS A;  2Q8V A;  1PL0 A;  2DYS B;  1QLN A;  4I4T B;  4PA4 A;  4PI2 A;  1F4N A;  1MA1 A;  3JAL B;  4O4I B;  1NZ6 A;  4IIJ B;  4P75 C;  4JYY A;  4FK5 C;  4IL6 Z;  1GN2 A;  2KG7 B;  1KQS U;  1E1R G;  1OCC C;  4F6R A;  2AZ0 A;  2VQE O;  4MVZ A;  3QO8 A;  2A0L A;  1PKX A;  5CA0 A;  1RPR A;  3UFG A;  3SR2 C;  3K58 A;  4FLT A;  1FFT B;  2HNI A;  1TUB B;  3JAT A;  3HXU A;  2EJF A;  4J42 A;  1JVM A;  3SPG A;  2DTI A;  2LW1 A;  1K34 A;  1WPY A;  2NLJ C;  4YYE A;  1N0N A;  3P32 A;  3UGT A;  3LDC A;  5J2T A;  3FFQ A;  4J15 A;  1IX9 A;  1W59 A;  4X1I B;  1FFX A;  3RW0 A;  4EFB A;  3UQ8 A;  2QTS A;  3OMA B;  3JSL A;  1WNS A;  2DW4 A;  3SYA A;  3NEN A;  4IGG A;  1N32 B;  1NNH A;  4EKW A;  4AHC A;  1G1X B;  1HNZ O;  2EIN C;  5EZY B;  1PYS A;  1AI7 A;  1S5H C;  3A8T A;  3T1H O;  3M7M X;  2ZE7 A;  2Q6A A;  4I0X A;  1B70 B;  4YRK A;  5IWA O;  3IG2 A;  5L3G A;  4PDV A;  4ZOL A;  2A3Q A;  4PD4 F;  2Q7G A;  4P71 A;  2BCC H;  3F7Y C;  4J7J A;  4JI8 O;  1AJQ A;  2E3C A;  4MTO A;  1XMQ O;  2EIK C;  4NYK A;  2Q7E A;  2Q73 A;  4WF2 A;  3A0R A;  3JCU Z;  1KC8 W;  1I5X A;  2BOB C;  4P3P A;  1H4Q A;  2EX3 A;  1NJ1 A;  2PGG A;  2WA4 A;  3ERR A;  4JI5 O;  3CC4 V;  5B1A C;  3M4P A;  3LDD A;  3OT7 A;  3ZMS A;  1MMM A;  1NI8 A;  3E8F A;  3FB8 C;  1E1Q G;  3STZ C;  4GKJ O;  1WNL A;  2JGD A;  1W66 A;  1ZAU A;  3EVK A;  4CC6 A;  5J2U A;  4DR6 O;  2EIJ B;  5KUK A;  3W7S A;  4PHZ A;  3A32 A;  5LMU O;  5EK0 A;  3JYC A;  4YIP A;  5EC2 C;  4WCE V;  2OT5 A;  1NTK H;  4LNU B;  2B1I A;  2H94 A;  3ABK B;  4EB6 A;  3ZN1 A;  2J3M A;  2AGA A;  3ZRW B;  2P6J A;  1ZUQ A;  4FFK A;  2CH7 B;  3CWB H;  4FLY A;  1XEQ A;  5ELN A;  3HXZ A;  3DSQ A;  3JAS A;  4XU3 A;  4O4J A;  1S3J A;  2RNB A;  1KMI Z;  3GWK C;  3U11 A;  1QLE B;  2E41 A;  5C51 B;  2LW7 A;  1VF5 B;  1C0A A;  1AP6 A;  2DTH A;  1Y66 A;  1V54 C;  1X4T A;  3OEH G;  3RYH A;  2IJI A;  1EN5 A;  2O57 A;  3KZI Z;  1LR1 A;  2VRZ A;  1NTZ H;  4JF3 A;  1GK9 A;  5EBW C;  5IDJ A;  4HWS A;  1I0H A;  5HFM A;  3NXS A;  4FLU A;  3CRA A;  3HKD B;  1G8M A;  4RQE A;  2PYJ A;  3OMN B;  3HY1 A;  2F95 B;  3A0B Z;  3D36 A;  3K5N A;  4H02 A;  4MW8 A;  4YCV A;  3L75 H;  1HNZ B;  3K5O A;  2V7Q G;  4H13 B;  4WBN B;  5LYJ B;  1BL8 A;  3T1H B;  2OTJ V;  3BRC A;  2Q67 A;  1JFF A;  4OPH A;  2AKW B;  1GGM A;  1NBM G;  3E2E A;  2X0L A;  5IWA B;  3L1A A;  3W7W A;  5IE9 A;  3SPH A;  4JI4 O;  4O2A A;  3BFM A;  2Q5Z A;  3ZN0 A;  1XOU A;  4DV0 B;  2EJR A;  1U96 A;  4JI8 B;  3MF2 A;  4DV7 O;  1HNX O;  2WLK A;  3OAA G;  1GMG A;  1H2L A;  3RT3 C;  1ZSP A;  4UUJ C;  1I08 A;  4JI2 O;  2JGU A;  3CME V;  3E9I A;  4JI5 B;  3SYO A;  1FXK A;  2YXL A;  1K92 A;  2PYL A;  1WA8 A;  3B40 A;  2PMF A;  1Y76 A;  1YVW A;  2LFR A;  2R9R B;  2BTQ A;  4MS2 A;  4H2X B;  4DR6 B;  4YRJ A;  4G84 A;  2R9I A;  2GV9 A;  3FAV B;  1ZL8 B;  5LMU B;  2ITC C;  2LO1 A;  1N4C A;  2ZIO A;  1TGO A;  3APO A;  4UVA A;  1AR5 A;  2Q0A A;  2QKC A;  2ZXW C;  2FL4 A;  1E1T A;  4PA7 A;  1KU9 A;  2UXB B;  3MD0 A;  5GON A;  4R7C A;  1R3K C;  4TTV A;  1G51 A;  3P30 A;  1Q5O A;  1QHT A;  2HHH O;  1NVP D;  4Z1M G;  1UFI A;  4KL1 A;  1NKD A;  2P22 C;  3HR0 A;  4GX0 A;  2HJD A;  5C93 A;  3ETG A;  1M90 W;  2QWQ B;  3TJT A;  1DTO A;  5LHH A;  2BE3 A;  1AP5 A;  2EBO A;  1FXV A;  4FLV A;  3J80 N;  2M7W A;  2FTK A;  5LXT A;  4B08 A;  1QCE A;  3AG2 B;  4LF7 O;  2ZZF A;  2HP8 A;  4RDX A;  3ZRS A;  3JCZ A;  2DQ0 A;  2P06 A;  3CXC U;  3T2M A;  3WU2 Z;  2PF4 E;  3B09 A;  1HXD A;  1GH6 A;  4U3J B;  5E1A C;  1TAE A;  2OWO A;  3ZX6 A;  4WI1 A;  1R6N A;  2PME A;  2PI5 A;  2AXT Z;  4PDR A;  5L3F A;  3ZIA G;  1XDC A;  2EJ9 A;  3G80 A;  5CA0 B;  2Z0A A;  2HVK C;  5KHG A;  2LQT A;  4UB8 Z;  1VQZ A;  1HNX B;  1JQ0 A;  4UP8 A;  4TVA B;  2VWJ A;  1GAX A;  2IY5 A;  3E89 A;  4FFB A;  2DN9 A;  4MTG A;  3A2F A;  3TXS A;  4JI2 B;  1OHH G;  2FYU H;  4K87 A;  3SDL A;  3AG1 B;  3A31 A;  5J2T B;  1QR8 A;  4O4I A;  1HP8 A;  3V7S A;  2ATK C;  5IJ0 A;  1N9W A;  1FFX B;  3X2Q B;  4X64 B;  3CYO A;  1S77 D;  4JI1 O;  3CSX A;  1TUE B;  2Q5I A;  3ASN B;  3BHP A;  3FB6 C;  4P30 A;  2XND G;  1VF6 C;  1H8H G;  4Z1V A;  3H1I H;  1P84 F;  1EZJ A;  1KBH A;  2K9P A;  4ABM A;  1OCO B;  2EIM B;  1O9H A;  1PYS B;  3TK1 A;  4DW1 A;  4TV9 A;  4JI6 O;  1IXM A;  3ETE A;  5ITZ B;  2P5I A;  1TUB A;  2AHZ A;  2P4V A;  2B1G A;  2Q9L A;  2Q7H A;  1BE3 H;  2CJ9 A;  1PM9 A;  2H8P C;  2CAZ C;  3HXX A;  4ZOL B;  1E79 G;  1PPJ H;  2DYS C;  1G5I A;  3N2G A;  2EZO A;  4WFG A;  3ZED A;  2DXU A;  2IW5 A;  1AI6 A;  5IY5 B;  4TV8 A;  4EO4 A;  2ART A;  1S5L Z;  1YFS A;  1YXB A;  3F5T A;  2WLL A;  5B3S B;  3IGA C;  1K33 A;  4LF4 O;  5KAF Z;  2CTW A;  4DUY O;  1MSD A;  4A5U B;  1G6U A;  2FB5 A;  4B3M O;  4LF7 B;  4GX1 A;  4LH7 A;  2V4D A;  2QM7 A;  4WFB V;  3P8V A;  3A7A A;  2JGD B;  4I7Z B;  2LP7 A;  5J2U B;  3ZRX A;  1K73 W;  1QVF U;  5L3B A;  2EUL A;  2YEV A;  2NS6 A;  3D3I A;  2RN9 A;  2CIM A;  3UO3 A;  3HPL C;  3EFF K;  3FB7 C;  4EB6 B;  2WAM A;  2C2A A;  5JH7 A;  4DW0 A;  1H4T A;  2DOS A;  1AB3 A;  1GN3 A;  1SQV H;  4ASU G;  4O4J B;  1SF9 A;  2W6I G;  3SJB C;  4WJ3 M;  3E8H A;  4YRC A;  3CC7 V;  4O4L B;  2MW2 B;  2DJZ A;  2OCC B;  1WYD A;  4CBC A;  5KLV H;  1XRE A;  4WF9 V;  2QDO A;  3OR7 C;  4DPG A;  1AI5 A;  3KCX A;  1SZT A;  3BJU A;  4KHP O;  1NJ5 A;  2F66 C;  1H2M A;  2KB1 A;  4RUF A;  4DR3 O;  2FKX A;  4JI1 B;  3OMI B;  3WB0 A;  2UXX A;  3NR7 A;  4DR2 O;  3ZMU A;  2ZT8 A;  1L0N H;  3L4G A;  4PA3 A;  1YFT A;  2CTP A;  1DGS A;  2CH7 A;  4JI6 B;  1RPO A;  1JCH A;  1XNR O;  5B1B B;  1SQB H;  1JFF B;  3SYC A;  4NXN O;  3ML0 A;  1KP3 A;  3H1K H;  3SYQ A;  4O4H A;  2DTO A;  2YIC A;  3IKL A;  4XEM A;  5LHG A;  1K4C C;  4O2A B;  2Z5U A;  2I4L A;  4UV9 A;  4B3R O;  4ZBM A;  4LVI A;  5KNN A;  3JD4 A;  5LOV A;  4U7N A;  2OTL V;  4G2K A;  4LF4 B;  4PV1 B;  3ZBH A;  1I94 O;  2ZKO A;  1TA8 A;  1NR7 A;  4DV4 O;  4KXR A;  5LA6 B;  1JR9 A;  2EIJ C;  2QWO B;  3IFX A;  5JQG A;  4B3M B;  3VOU A;  2HEP A;  5LP6 B;  2R9A A;  3RAC A;  4AH6 A;  2Y48 A;  3FB5 C;  4HA8 A;  4CH5 A;  3SPI A;  1D5A A;  1WA8 B;  3MEY A;  2A7W A;  3ABK C;  3THO A;  4E4E A;  4J7Z A;  1Y76 B;  4X88 A;  5LYJ A;  2BTQ B;  1JJC A;  4NTX A;  2R70 A;  2E1H A;  1PL4 A;  2ZTG A;  1KD1 W;  5JJE B;  2LFS A;  1D2D A;  1Q7Y W;  1K4D C;  4LCU C;  3CCR V;  1VAR A;  5D5Q A;  4DR7 O;  1N36 O;  4CH4 A;  4P72 A;  2XAF A;  1ZX3 A;  4IYH A;  4FPP A;  1ZWI C;  2QHU A;  3R66 A;  4O2B A;  1VQ5 V;  1FYJ A;  4HWT A;  1JX9 A;  2DDZ A;  4YY3 B;  2K1E A;  2CJA A;  1US6 A;  1VMG A;  1NVP B;  1H2N A;  3ZS8 C;  4X66 B;  4NCX A;  4YRF A;  2EIL B;  2CTQ A;  5KMG A;  2GHY A;  4YPF A;  4H2X A;  5LXT B;  4H44 B;  4ZHQ B;  4DR3 B;  1Q81 W;  2CUG A;  2XUM A;  3B4S A;  3K3W A;  3HTZ A;  1CEZ A;  4UCR A;  4U3F H;  4X62 O;  12AS A;  1KB9 F;  2ARH A;  4XTU A;  1BT8 A;  1N32 O;  3ZJZ A;  1B06 A;  4OPA A;  3CEI A;  2A8E A;  3I5D A;  3H9V A;  3HB3 B;  3T1Y O;  3U0Z A;  1XNR B;  2F23 A;  3AG3 B;  1MZF A;  4NXN B;  1S0V A;  1X2G A;  2QHS A;  4P72 C;  3UM7 A;  3ABT A;  1MSW D;  2AW9 A;  5KA6 A;  2Q0O C;  4EX5 A;  1AIL A;  3HXY A;  3TEG A;  5AG2 A;  4IT5 A;  4X1Y A;  1BIB A;  4B3R B;  1OZ0 A;  1IL2 A;  5CBH A;  4XTZ A;  4P73 C;  2IY5 B;  1I94 B;  4AQY O;  4DV4 B;  4FFB B;  2WWW A;  2H3O A;  5A9G A;  2JEX A;  2EAY A;  4H2T A;  5CA3 A;  1WP8 A;  5H6R A;  4K3A A;  1Q43 A;  3CMQ A;  2N05 A;  4YRO A;  2PY5 A;  3BCC H;  3ZMV A;  2JS3 A;  3FYI B;  5IJ0 B;  4NKG B;  1Y74 B;  2IH3 C;  3V7R A;  4F6E A;  4GKK O;  2WLI A;  4U3J A;  5BY1 A;  2XTI A;  3H1H H;  4KP4 A;  3BA9 A;  3CE2 A;  1B7Y A;  2Y69 B;  2YUA A;  4PJ0 Z;  4ZKI A;  4DR7 B;  1N36 B;  4TV9 B;  2F93 B;  2RQ6 A;  1YI2 V;  4TVA A;  3EXA A;  4FM1 A;  3K9A A;  2JK5 C;  3RGB A;  2ZR3 A;  1YIJ V;  3CCM V;  2HKO A;  3N2G B;  2RHS A;  4FLX A;  3AG2 C;  4TV8 B;  3UCS C;  3EFS A;  1YFR A;  4P74 A;  3H1J H;  2WLL B;  1K8A W;  1AR1 B;  3GWO A;  1QE0 A;  4QPJ A;  1GO3 F;  3G67 A;  2ZE8 A;  3HKC B;  2X7R B;  1BQZ A;  4X62 B;  2QWR B;  4LFC O;  4UCS A;  3DXR B;  3VQY A;  4YDQ A;  2LGW A;  4XU1 A;  4EEQ A;  3U10 A;  4GX5 A;  1BBU A;  2QE7 G;  4MTF A;  3T1Y B;  3CJH A;  3VQV A;  5ITZ A;  3TET A;  1PNM A;  2YEV B;  4DR4 O;  4YJ2 A;  2YS8 A;  1KUQ A;  3L74 H;  2UXN A;  3W7U A;  4HNA A;  2ZT9 B;  2UXC O;  5JH7 B;  3WB2 A;  5GTH Z;  4JAA A;  4DV0 O;  2VQF O;  4G85 A;  1DLB A;  2IU3 A;  4CS3 A;  4FLW A;  2QHT A;  4WFE A;  4UFZ A;  4AQY B;  1EOV A;  1GN4 A;  2YXH A;  3LUT B;  1FYF A;  4DQ2 A;  3SYP A;  3X2Q C;  1NJI W;  3SJA C;  4PA6 A;  3FJP A;  5C8Y A;  4DV2 O;  1BZK A;  3TGU H;  4AIL C;  4UCO A;  3ASN C;  1Q90 D;  1R3I C;  1SER A;  4YRR A;  2ZR2 A;  1WQ7 A;  2QKA A;  2MK3 A;  2ZNJ A;  3JAW B;  4GKK B;  1OCO C;  2EIM C;  4JYC A;  4YRP A;  3IC7 A;  3RYF A;  2QWN B;  3BEH A;  1VQ7 V;  1I5Y A;  1BMF G;  4CS4 A;  2EL9 A;  2CGN A;  1R73 A;  4TUY A;  3JD3 A;  3L4G B;  2X6A A;  2N74 A;  3DC5 A;  4FZ1 A;  2P5O A;  1Z5W A;  2UXB O;  1SS3 A;  5IY5 C;  5K1P A;  3ETD A;  4P71 C;  5EBM C;  1NU1 H;  3DTU B;  1XMO O;  5B3S C;  4I50 A;  4KFM A;  4O4H B;  4JZ2 A;  4MVO A;  3RL6 A;  4O4L A;  3D8C A;  2DU7 A;  2Y0I A;  4X65 O;  2QEX V;  1A32 A;  3BY6 A;  5LMN B;  1Y67 A;  4P3N A;  1CXZ B;  4QIW F;  4D7S A;  4K86 A;  3CS5 A;  1MG1 A;  2DWD C;  5F5W A;  5LOV B;  1SZX A;  3TXQ A;  2ALY A;  4LVL A;  5KX5 B;  1KEC A;  5JQG B;  4QGP A;  4XEO A;  1ROP A;  3LNN A;  3CRM A;  2ETN A;  4LFC B;  2VWK A;  1P7G A;  2X6B A;  3C3T A;  2E64 A;  3K08 A;  2CJB A;  1QQC A;  2OYQ A;  3P3N A;  1JJC B;  5LGN A;  1CP9 A;  4OXS A;  4DR4 B;  4XTW A;  3B8M A;  1VQ4 V;  1YJN V;  3HXV A;  4TVW A;  5EYP A;  1M4U A;  1M56 B;  4YXW G;  2UXC B;  1FXH A;  1W2B U;  2UU9 B;  1EFR G;  2KKW A;  2VQF B;  2OCC C;  2ZZG A;  5H2F Z;  3AK2 A;  1AR4 A;  4H2V A;  3ZHT A;  1DK1 A;  3G4S V;  4O2B B;  1IXB A;  2C7I A;  5LA6 A;  3ZMT A;  1X54 A;  5LP6 A;  4DV2 B;  1Z5V A;  4KR3 A;  2QM8 A;  3D36 C;  2QA4 V;  1K9M W;  4UPA A;  4L8J A;  1EBO A;  5KMG B;  1VQ9 V;  1LUW A;  4X64 O;  4B3T O;  1WP7 A;  1GN6 A;  1M5I A;  1LYL A;  3ABM B;  1ENV A;  1B6Q A;  4PEL A;  2ADP A;  5D5P A;  4JI0 O;  3RN4 A;  4LP8 A;  2XAH A;  3HRI A;  3ZHQ A;  4H2U A;  2HG5 C;  4LC1 A;  2AZ2 A;  3SGI A;  4GUN A;  1XMO B;  1ARO P;  2F1M A;  1J95 A;  4H37 A;  4Q15 A;  4J11 A;  4YIO A;  3RFR A;  4X65 B;  1D5N A;  4TWK A;  1EIY A;  1LUV A;  1GM9 A;  4X1Y B;  1XNQ O;  5LP6 C;  2ZQM A;  2GUZ B;  1F4M A;  4BIU A;  1FXK C;  2A79 B;  2PUS A;  1NJ8 A;  3UKM A;  3B77 A;  4MSW C;  1G5H A;  2YIA A;  2E74 B;  1WPB A;  1BBW A;  3ETQ A;  3ABU A;  3IC9 A;  4ZHQ A;  3NEL A;  1NT2 B;  1S76 D;  4OLF A;  4HWO A;  4XU2 A;  1VQK V;  3LDE A;  3FKS G;  1MNG A;  1K3E A;  2XAG A;  4LF8 O;  1M1K W;  4YRM A;  3QVN A;  2WSS G;  5JVD B;  3VQW A;  1YTF D;  2ZT5 A;  2E65 A;  2WLI B;  3VQX A;  2ILM A;  3F5W C;  4TOI A;  1WB7 A;  4H33 A;  1PV0 A;  1YDX A;  1HW7 A;  1XL6 A;  1YGB A;  1JJO A;  1B7Y B;  4DK1 A;  5HGQ A;  3CP1 A;  4BWA A;  1Q8I A;  3T1C A;  1ATI A;  1FS0 G;  2JEU A;  4IHJ A;  4BIZ A;  2GTS A;  2Q5H A;  1COW G;  4DO2 A;  4LF9 O;  2EIL C;  4Z2W A;  4OX9 O;  2RHS B;  2W0X A;  3JAM N;  1ADJ A;  1U97 A;  1H2K A;  4DR1 O;  1EM1 A;  1L0L H;  2DYR B;  1AI4 A;  5JJN B;  1Y74 A;  2I4N A;  1RIQ A;  4BW5 A;  4B3T B;  1V55 B;  2ZIN A;  3PCO B;  3ABL B;  4YRT A;  1YZB A;  3AG3 C;  1F7Y A;  3OTO O;  1BHB A;  3OUF A;  5KHJ A;  4JI0 B;  4I55 A;  1H2G A;  3OFN G;  3K5L A;  4WFH A;  2QGN A;  2RDC A;  1RM1 B;  2HJF C;  3CJH B;  4MW3 A;  4D6T H;  3TEH A;  1S5J A;  4EFE A;  3IJ4 A;  2XAQ A;  4YJ2 B;  2OIG A;  1EQR A;  4TWA A;  2HR3 A;  3A5Y A;  2EWN A;  4HNA B;  4RO2 A;  4YJ3 B;  3RKW A;  1M57 B;  3JAK A;  3CX5 F;  3WFV A;  1XNQ B;  4UVB A;  4JTC B;  1AJP A;  4G28 B;  4R8C A;  2B9Z A;  1X2H A;  4X20 B;  3UO2 A;  3LSQ A;  4NB5 A;  2RHQ B;  1VQP V;  4MVR A;  3HKC A;  4C7U A;  4PDL A;  3E86 A;  5C8Y B;  4LWS A;  3DXR A;  4JV5 O;  4L87 A;  4LF8 B;  3RUX A;  2BOC C;  2Y69 C;  3RYF B;  1FJG O;  1Q86 W;  1KP2 A;  4NR1 A;  5HFL A;  1SA0 A;  3NEM A;  3BVO A;  1JPX A;  4TUY B;  1V9P A;  2DEQ A;  1P7B A;  1BQ0 A;  3CMA V;  1IZ3 A;  2VS0 A;  3JD2 A;  1EVL A;  2E10 A;  3CHX A;  2WPD G;  1YF2 A;  2J3L A;  4YRS A;  4LF9 B;  1YCI A;  4YRG A;  4I50 B;  2ODR C;  3RYI B;  1F51 A;  4OX9 B;  2Q69 A;  4CS2 A;  1SQF A;  1SET A;  4YY3 O;  4DR1 B;  1USY A;  1GM7 A;  4X66 O;  4G27 B;  2ALY B;  3JAW A;  2WLJ A;  3I55 V;  3CCV V;  4PI0 A;  4K35 A;  2P7T C;  2Y0P A;  1N33 O;  3AEI A;  1XBL A;  2WLM A;  2YIB D;  4YCU A;  1QBZ A;  2ITD C;  2YDE A;  1Q82 W;  2QKS A;  4B3S O;  3OTO B;  3B8N A;  3BAA A;  3MHH C;  3QG5 A;  1Y4M A;  4UV8 A;  2YIB A;  5JCO A;  1K5Q A;  2ZM6 O;  1W0J G;  1NQT A;  2ZGW A;  1IBL B;  1NR1 A;  3JSN A;  4UVC A;  4JAV A;  3UT5 A;  4GX2 A;  1PP9 H;  3E8G A;  3CB2 A;  5EYP B;  3QF7 A;  2I4O A;  3BPZ A;  1SRY A;  1KKD A;  3ASO B;  3S3W A;  4P2Z A;  3NET A;  5KA5 A;  1QU7 A;  5KX5 A;  3TCU A;  4BIO A;  2ZXW B;  4UP7 A;  1R6K A;  4JV5 B;  1F23 A;  2V1D A;  2A06 H;  1JJ2 U;  2ARS A;  2ZDI A;  3CD6 V;  3A0H Z;  4XU0 A;  3L73 H;  3V7C A;  1FJG B;  3OUS A;  3SJC C;  2FYK A;  2JIZ G;  3AK1 A;  2P0L A;  1QLE C;  4LVK A;  4P9P A;  4D7T A;  4ZI7 A;  5IYD O;  2FML A;  5EIB D;  1X56 A;  3QTC A;  1NYR A;  2HLD G;  1NTM H;  3M8A A;  2YXY A;  4YRN A;  4WFA V;  1VP7 A;  1HC7 A;  2CGO A;  3Q4H A;  1EIY B;  1Z7M A;  1WAZ A;  2DJV A;  4DR5 O;  5KHI A;  3K9S A;  3P8T A;  3EFR A;  1N33 B;  3OD4 A;  1H4V B;  4NXM B;  4JYB A;  4X89 A;  1FKA O;  2G38 A;  3WG7 B;  4B3S B;  4I9Q A;  2WA3 A;  2DQ3 A;  4F4L A;  3J7A U;  3LSS A;  3SJQ C;  1BSM A;  4FLZ A;  5GTI Z;  3AG4 B;  2ZM6 B;  2E5L O;  4DUZ B;  4UB6 Z;  4YP0 A;  2GSM B;  3GB7 C;  3OM3 B;  3C3S A;  4MT8 A;  4JI3 B;  3ZHU A;  3I7F A;  4HBN A;  1K5S A;  3CC2 V;  4DRX B;  2GBO A;  3T4Z A;  3STL C;  1J5W A;  2ZIM A;  4TVY A;  3E22 A;  3MAQ A;  1IBK O;  3OD1 A;  3CCQ V;  2GUZ A;  5KUM A;  3QO5 A;  4J10 A;  1B8A A;  3E35 A;  4P75 A;  1AJN A;  2PTM A;  4IHJ B;  4K8Z A;  1X01 A;  4P9O A;  1OV9 A;  5LBQ A;  1VQN V;  5CBG A;  4MVQ A;  2DWE C;  4ICG A;  5FNV A;  3N2K A;  3IAY A;  1N8R W;  2KSD A;  3AK3 A;  3AG7 A;  3L70 H;  3ABM C;  5IYZ A;  1Y6X A;  1QF6 A;  1O9G A;  3C90 A;  2PZS A;  5JVD A;  4BR6 A;  2DXT A;  3HFZ A;  1HNW O;  4K88 A;  4PG3 A;  1Z2G A;  5CBF A;  3BFR A;  4RMF A;  1Z7N A;  4LVM A;  3RGL A;  3M99 B;  4I55 B;  5CMU A;  2D2C B;  5GW7 A;  2ARU A;  1R3J C;  2E76 B;  3TEH B;  4N21 A;  3HY0 A;  1RSO A;  4PHC A;  4PA9 A;  3JAK B;  2C8M A;  2W0F C;  5LMN O;  4X8A A;  1I7F A;  4DR5 B;  4B7E A;  5C52 B;  2HVJ C;  4R6Z A;  3FD9 A;  3PCO A;  4QJF B;  3JAR A;  3O65 A;  3K06 A;  1NH2 D;  1E1O A;  4LWS B;  1PNL A;  1XUQ A;  3RVZ A;  4YRI A;  4X1K B;  4HWR A;  5FL7 G;  3V8J A;  1HTT A;  2XTA A;  2Y4T A;  1Q6H A;  2E5L B;  1NJ6 A;  1XQ8 A;  3K03 A;  1QNM A;  3L71 H;  1SA0 B;  5IYB O;  5EBL C;  1Q6U A;  3WB1 A;  4NVP A;  4FJC C;  4NTW A;  1B76 A;  4XDJ A;  1UPG A;  3K59 A;  4YJ3 A;  1R3L C;  2UUA B;  1T5E A;  4J9Y B;  2UU9 O;  1N0J A;  1WN7 A;  1IBK B;  4J41 A;  4H2W A;  1OCZ B;  3IKM B;  3AG1 C;  3GVM A;  1FAF A;  1ZLZ A;  2YI9 A;  2DYR C;  4P74 C;  4X20 A;  5B1N A;  3D3Q A;  1PNK A;  2RHQ A;  2IBZ H;  2IJK A;  1H2S B;  2CE4 A;  1OCR B;  4PDM A;  3BAB A;  3CCU V;  1V55 C;  1BIA A;  3L2Z A;  4UP9 A;  5B66 Z;  3ABL C;  2ZE5 A;  3MDS A;  1FPO A;  1KOG A;  3OW2 U;  3RIR A;  5LL6 Y;  3RKX A;  1THZ A;  1VEW A;  1HNW B;  2EJG A;  2BSK B;  1RM1 C;  5JWP A;  4MVM A;  3TUP A;  4FMT A;  4RUE A;  2DKG A;  3RKY A;  4HYO A;  3ZHS A;  5CN0 A;  5CB4 A;  3RF1 A;  4JI7 O;  1Q6I A;  3RBZ A;  3CRR A;  3M4Q A;  5LGU A;  3ZHR A;  4LH6 A;  2UXD O;  1VQM V;  3KKY A;  1M57 C;  1VQL V;  3IAL A;  1SQX H;  3SPJ A;  4FVM A;  1XIL A;  1SKV A;  4HZ3 A;  3ICX A;  5LHI A;  1NYQ A;  3CCJ V;  3KG2 A;  3UT5 B;  5JJJ B;  4XTV A;  4YRE A;  3JD0 A;  2IH1 C;  2VQE B;  3RYI A;  3UGQ A;  3J81 N;  1P4R A;  3JD1 A;  1WQW A;  3CCS V;  5IYC O;  1JMK C;  1W0K G;  5FPO A;  2Q4P A;  2M6Y A;  3OGI B;  3HFV A;  2JJ1 G;  1NJ2 A;  3VBB A;  2CTR A;  5CA1 A;  2I4M A;  4DK0 A;  4RWU A;  4YCW A;  4O2D A;  4TT3 G;  1IBM O;  4JTD B;  2YC0 A;  4JAU A;  4YRQ A;  4GYC B;  1JOY A;  2IU0 A;  2XT9 A;  5IJ9 A;  1J5E O;  1SC5 B;  4QNH B;  3V8L A;  4P3O A;  2XGT A;  3ICA A;  1P49 A;  2P90 A;  4MTX A;  2F4V O;  3K57 A;  2A9H A;  3G6B A;  4ZI7 B;  4K0K O;  3W3S A;  2ZD9 A;  1DF5 A;  2DZ9 A;  2QSA A;  5DN6 G;  3R07 A;  1YIT V;  3T4D A;  3APQ A;  1KMM A;  1QVG U;  3WQZ A;  3Q4H B;  2EJ7 A;  2ZCE A;  1E22 A;  2YSU B;  1R6T A;  4LF6 O;  5H5N A;  5E79 Z;  1XMQ B;  5L3E A;  2GDS A;  3L72 H;  3K79 A;  2AHY A;  3HKB A;  2DZC A;  5B1B C;  3ZRV A;  2RJZ A;  4LFA O;  1OJH A;  1GTO A;  4NTY A;  4JI7 B;  3CRQ A;  1ASZ A;  3ZCC A;  3RYC A;  3K0D A;  1L0W A;  2UXD B;  1MOF A;  4CH6 A;  2IM9 A;  4XDL A;  3PJS K;  4GKJ B;  2F43 G;  3MF1 A;  4MVS A;  2XAJ A;  3OR6 C;  3ASO C;  4DV3 O;  4I9W A;  1KYO F;  3W7X A;  2W6J G;  3E22 B;  2DVE A;  1M93 A;  3HRK A;  4LVJ A;  5H6Q A;  3REU A;  1KMN A;  4GZR B;  2WLN A;  3G6E V;  1OCC B;  1GM8 A;  3CXH F;  5FNV B;  3N2K B;  2AMC A;  3HKE A;  1TVK A;  5IYZ B; 
#chains in the Genus database with same CATH homology
 3UM7 A;  3ABT A;  3F7V C;  1UJW B;  4CS2 A;  2ZNI A;  1MSW D;  2EIJ B;  5KUK A;  5KA6 A;  3W7S A;  1SET A;  3OE7 G;  4EX5 A;  3HFZ B;  3A32 A;  1USY A;  5EK0 A;  3HXY A;  3JYC A;  1GM7 A;  4XTY A;  1WLE A;  5EC2 C;  3TEG A;  4WCE V;  4XTX A;  2XAS A;  2OT5 A;  4G27 B;  2ALY B;  1BIB A;  2WLJ A;  2B1I A;  2H94 A;  3ABK B;  3I55 V;  3CCV V;  1OZ0 A;  3ZN1 A;  2J3M A;  2P7T C;  1IL2 A;  3ZRW B;  2P6J A;  5CBH A;  4JAS A;  3AEI A;  2WLM A;  4YCU A;  4XTZ A;  4P73 C;  1QBZ A;  2ITD C;  2IY5 B;  3R65 A;  1Q82 W;  2QKS A;  2ZT7 A;  5ELN A;  2WWW A;  3DSQ A;  3HXZ A;  3B8N A;  3DGE A;  4XU3 A;  3MHH C;  1Y4M A;  1S3J A;  2JEX A;  2EAY A;  4H2T A;  4UV8 A;  5CA3 A;  1QLE B;  4UXN A;  1K5Q A;  4QE9 A;  4DXW A;  1YJW V;  2E41 A;  1W0J G;  5H6R A;  5C51 B;  1NQT A;  3CMQ A;  4YRO A;  1C0A A;  2DTH A;  3ZMV A;  1Y66 A;  1V54 C;  1VQ8 V;  1NR1 A;  3OEH G;  2ZGW A;  3FYI B;  4E2L A;  2IJI A;  2IH3 C;  4UVC A;  4JAV A;  3V7R A;  2WLI A;  2EIN B;  2EZP A;  4GX2 A;  1ORQ C;  3E8G A;  3WG7 C;  2I4O A;  2IJJ A;  4JF3 A;  2XTI A;  2PI4 A;  4N23 A;  1GK9 A;  4KP4 A;  1H8E G;  1SRY A;  5EBW C;  5IDJ A;  3G71 V;  1YHQ V;  4HWS A;  4I5S A;  5HFM A;  3NXS A;  1B7Y A;  3AG4 C;  2Y69 B;  1G8M A;  4ZKI A;  4RQE A;  1KKD A;  3ASO B;  3OMN B;  3HY1 A;  3D36 A;  2CK3 G;  4P2Z A;  3CCE V;  3NET A;  5KA5 A;  4H02 A;  2ZXF A;  4MW8 A;  1ASY A;  3PZC A;  4YCV A;  2V7Q G;  1YI2 V;  4H2S A;  3TCU A;  4TVA A;  1BL8 A;  2ZXW B;  1DF4 A;  4UP7 A;  3K9A A;  2ZZE A;  2JK5 C;  2EIK B;  2OTJ V;  1R6K A;  2Q67 A;  1NH2 B;  1YIJ V;  2ZR3 A;  3CCM V;  2AKW B;  2HKO A;  1GGM A;  4BAY A;  1NBM G;  3E2E A;  1F23 A;  2V1D A;  2X0L A;  1JJ2 U;  2RHS A;  3AG2 C;  3L1A A;  2ARS A;  1YSC A;  2ZDI A;  3CD6 V;  3EFS A;  3W7W A;  2D3O W;  1YFR A;  4XU0 A;  3V7C A;  3SPH A;  3E9H A;  3OUS A;  4P74 A;  5B1A B;  3BFM A;  2WLL B;  1K8A W;  3ZN0 A;  1AR1 B;  2FYK A;  3GWO A;  2JIZ G;  1QE0 A;  3CCL V;  2EJR A;  4QPJ A;  1GO3 F;  4QPK A;  2P0L A;  4KQE A;  1H4S A;  3MF2 A;  1QLE C;  3FYE B;  2WLK A;  3P8Y A;  3OAA G;  4GT1 A;  4LVK A;  1GMG A;  2X7R B;  4UUJ C;  4KR2 A;  4YDQ A;  3VQY A;  5EC1 C;  1BHA A;  4WJ4 A;  4P9P A;  4XU1 A;  3CME V;  3E9I A;  4GX5 A;  5ELO A;  3SYO A;  1FXK A;  5IYD O;  1BBU A;  2QE7 G;  4H2Y A;  4MTF A;  1X56 A;  1K92 A;  3QTC A;  1M9N A;  2HLD G;  1NYR A;  3VQV A;  3TET A;  1PNM A;  2YEV B;  2PMF A;  2ODR D;  2LFR A;  2R9R B;  4YRN A;  4WFA V;  4MS2 A;  1HC7 A;  2UXN A;  4RQF A;  4H2X B;  1EIY B;  4YRJ A;  4G84 A;  3W7U A;  2E5A A;  1Z7M A;  2R9I A;  2ITC C;  2ZIO A;  4UVA A;  4YRL A;  3UH0 A;  4Q20 A;  1V54 B;  3P8T A;  3QNE A;  3EFR A;  4MVU A;  1DLB A;  2IU3 A;  4G85 A;  2ZXW C;  1H4V B;  1E1T A;  4CS3 A;  4JYB A;  4X89 A;  4PA7 A;  2QHT A;  4WFE A;  3WG7 B;  1EOV A;  3MD0 A;  1H38 A;  4DQ2 A;  3LUT B;  3EHB B;  3OGC C;  3SYP A;  4R7C A;  1R3K C;  2DQ3 A;  3X2Q C;  4F4L A;  1NJI W;  1FYF A;  5L3D A;  1G51 A;  1X2G A;  3P30 A;  4TTV A;  3LSS A;  4PA6 A;  3SJQ C;  3FJP A;  3REX A;  4U7O A;  3AG4 B;  4LNS A;  1NVP D;  4Z1M G;  4YP0 A;  3ASN C;  2GSM B;  3GB7 C;  3OM3 B;  1NKD A;  4MT8 A;  4CH3 A;  1R3I C;  4GX0 A;  5C93 A;  3ETG A;  1SER A;  1M90 W;  2CGH A;  4YRR A;  3I7F A;  1DTO A;  2ZR2 A;  1B70 A;  3ZMZ A;  2MK3 A;  1K5S A;  5LHH A;  1WQ7 A;  2ZNJ A;  1OCO C;  2EIM C;  4JYC A;  3CC2 V;  3IC7 A;  4YRP A;  1X55 A;  1VQ7 V;  3BEH A;  1I5Y A;  2EBO A;  1BMF G;  1FXV A;  5H9C A;  3STL C;  3T4Z A;  4OP0 A;  1J5W A;  2M7W A;  2EL9 A;  4CS4 A;  2FTK A;  2ZIM A;  4TVY A;  4ZIB A;  5L3C A;  3A7U A;  1R73 A;  3JD3 A;  3OD1 A;  2X6C A;  3CCQ V;  3L4G B;  5J9P C;  3LNM B;  1QCE A;  2X6A A;  5KUM A;  3AG2 B;  3QO5 A;  3HXW A;  1WU7 A;  1B8A A;  3E35 A;  3LC0 A;  1AJN A;  2ZZF A;  4P75 A;  4RDX A;  1X01 A;  3ZRS A;  4P9O A;  3JCZ A;  2DQ0 A;  3CXC U;  5LBQ A;  1VQN V;  5CBG A;  4MVQ A;  5IY5 C;  4BW9 A;  5K1P A;  3ETD A;  3T2M A;  4P71 C;  2DWE C;  5EBM C;  4X5O A;  2Z3Y A;  1HXD A;  2JDI G;  3DTU B;  5B3S C;  1N8R W;  5E1A C;  4KFM A;  11AS A;  3A7R A;  3SPC A;  4MVO A;  3RL6 A;  3ABM C;  1QF6 A;  4WI1 A;  2DU7 A;  1R6N A;  1OCZ C;  4ZTZ B;  2QEX V;  2PME A;  3BY6 A;  2PI5 A;  4PDR A;  2DXT A;  4P3N A;  1K97 A;  5L3F A;  3HFZ A;  4K88 A;  4PG3 A;  4QIW F;  3ZIA G;  2EJ9 A;  4K86 A;  1MG1 A;  2DWD C;  2NNU A;  5F5W A;  5CBF A;  2QHV A;  2HVK C;  4HAM A;  2ALY A;  4LVL A;  4RMF A;  1OCR C;  1Z7N A;  5K1X A;  1VQZ A;  1KEC A;  3ZRW A;  2ZT6 A;  3RGL A;  3M99 B;  4LVM A;  1JQ0 A;  4UP8 A;  4TVA B;  4XEO A;  1ROP A;  2QTO A;  5CMU A;  3E89 A;  2IY5 A;  1USY C;  2P67 A;  3QO7 A;  5GW7 A;  2ARU A;  3MQZ A;  2X6B A;  1R3J C;  3K0G A;  4XBF A;  4CZZ A;  1SES A;  4MTG A;  3TEH B;  1OHH G;  4N21 A;  3K08 A;  2E64 A;  2CJB A;  4K87 A;  4HT4 A;  3A74 A;  3AG1 B;  1JJC B;  4JPR A;  3A31 A;  3HY0 A;  1QR8 A;  5LGN A;  1CP9 A;  4OXS A;  4PHC A;  4LBE C;  3V7S A;  4PA9 A;  4XTW A;  3B8M A;  2ATK C;  1N9W A;  1EVK A;  3K04 A;  2C8M A;  4FIP C;  4ZTU B;  3X2Q B;  1VQ4 V;  4HVC A;  1YJN V;  2W0F C;  1PD3 A;  3HXV A;  4TVW A;  3CYO A;  1CPY A;  1G4Y B;  1M56 B;  4X8A A;  1VQ6 V;  1S77 D;  4YXW G;  1FXH A;  1TUE B;  1W2B U;  3ASN B;  4JTA B;  2Q5I A;  3FB6 C;  4P30 A;  4R50 A;  1EFR G;  3A5Z A;  2XND G;  4TQD A;  2B5U A;  5C52 B;  1H8H G;  2Q68 A;  2ZZG A;  2HVJ C;  2OCC C;  1HWY A;  4R6Z A;  1EZJ A;  3V8K A;  5C53 B;  1OCO B;  2EIM B;  3PCO A;  1PYS B;  1FXK B;  3TK1 A;  4QJF B;  1QR9 A;  4H2V A;  1WPX A;  3G4S V;  3K06 A;  1GKF A;  1NH2 D;  1IXM A;  3ETE A;  1E1O A;  4E51 A;  1PNL A;  3RVZ A;  2C7I A;  2P5I A;  1ADY A;  3ZMT A;  4YRI A;  1W66 A;  2AHZ A;  5FL7 G;  1X54 A;  4HWR A;  1HTT A;  3V8J A;  2B1G A;  4TQF A;  2Q7H A;  3RVY A;  4KR3 A;  2G4C A;  1NJ6 A;  2QM8 A;  2CJ9 A;  1MAB G;  2H8P C;  2WLH A;  3HXX A;  2QA4 V;  2AKW A;  3K03 A;  1K9M W;  1E79 G;  2DYS C;  1G5I A;  2DXU A;  4UPA A;  2EZO A;  4WFG A;  2IW5 A;  1AI6 A;  1EBO A;  5EBL C;  5IYB O;  5IY5 B;  1VQ9 V;  4EO4 A;  2ART A;  4FJC C;  1B76 A;  1YFS A;  4XDJ A;  4KUM A;  4RAI A;  2WLL A;  5B3S B;  1R3L C;  3IGA C;  1K33 A;  4J9Y B;  1LYL A;  1YB3 A;  3ABM B;  1EFW A;  1ENV A;  1XL4 A;  1B6Q A;  1OCZ B;  4XDK A;  4H2W A;  4PEL A;  3IKM B;  3AG1 C;  2ZDI C;  4LP8 A;  1S72 V;  2XAH A;  3MHS C;  3HRI A;  4GX1 A;  2DYR C;  4GCZ A;  4P74 C;  5B1N A;  2AMC B;  5BZB A;  4H2U A;  4QE7 A;  2HG5 C;  4LC1 A;  1PNK A;  2QM7 A;  4WFB V;  2RHQ A;  2IJK A;  3E8B A;  3A7A A;  3P8V A;  4Q6G A;  1OCR B;  4PDM A;  3KFU A;  3CCU V;  1ARO P;  1M56 C;  1V55 C;  2LP7 A;  1BIA A;  3L2Z A;  4UP9 A;  3H01 A;  3ABL C;  3ZRX A;  1K73 W;  1J95 A;  4H37 A;  5L3B A;  1QVF U;  4P73 A;  2YEV A;  4Q15 A;  1KOG A;  3OW2 U;  2NS6 A;  3RIR A;  3D3I A;  3RKX A;  4TWK A;  1EIY A;  1THZ A;  3CPW U;  1E1Q G;  3FB8 C;  2CIM A;  1GM9 A;  2ZQM A;  3HPL C;  3EFF K;  3FB7 C;  1F4M A;  1YTF B;  4BIU A;  1FXK C;  2WAM A;  2EJG A;  2A79 B;  1NJ8 A;  2C2A A;  1RM1 C;  3UKM A;  1H4T A;  3B77 A;  4MSW C;  4MVM A;  1G5H A;  3TUP A;  4FMT A;  2HFE C;  4RUE A;  1BBW A;  2DKG A;  3E83 A;  4HYO A;  3RKY A;  5CN0 A;  3VQW A;  4ASU G;  3ABU A;  3RF1 A;  5E3I A;  2IJH A;  3RBZ A;  5LGT A;  3M4Q A;  5LGU A;  3NEL A;  3G1Z A;  4TSF G;  1S76 D;  1L1F A;  1VQM V;  4OLF A;  4HWO A;  2W6I G;  1YJ9 V;  4J9Z B;  3E8H A;  4WJ3 M;  2QHS A;  4XU2 A;  4YRC A;  1M57 C;  3CC7 V;  1VQL V;  1VQK V;  2XOK G;  3LDE A;  3FKS G;  3IAL A;  3SPJ A;  1LNQ A;  1K3E A;  2XAG A;  1M1K W;  4YRM A;  2WSS G;  3OEE G;  3I56 V;  4HZ3 A;  2DJZ A;  1YTF D;  2OCC B;  5LHI A;  2JJ2 G;  3CCJ V;  4CBC A;  1NYQ A;  1WYD A;  2E65 A;  2WLI B;  2ZT5 A;  4WF9 V;  3KG2 A;  4YRE A;  3VQX A;  4XTV A;  4HWP A;  3JD0 A;  2IH1 C;  3OR7 C;  3F5W C;  5DM6 V;  1AI5 A;  3W7T A;  4JGS A;  4DPG A;  1SZT A;  3UGQ A;  4H33 A;  1P4R A;  3BJU A;  3JD1 A;  1K7D A;  1WQW A;  3CCS V;  1NJ5 A;  2DU5 A;  4WFF A;  5B1O A;  5IYC O;  1E24 A;  2KB1 A;  4RUF A;  1XL6 A;  1VQO V;  1YGB A;  1B7Y B;  3OMI B;  1W0K G;  5HGQ A;  2UXX A;  3CP1 A;  3ZMU A;  2ZT8 A;  4BWA A;  1PL0 A;  2DYS B;  3L4G A;  3T1C A;  1QLN A;  1FS0 G;  4PA3 A;  1ATI A;  1YFT A;  4PA4 A;  2JEU A;  3HFV A;  1F4N A;  2JJ1 G;  4BIZ A;  1NJ2 A;  3VBB A;  2Q5H A;  1COW G;  1RPO A;  4DO2 A;  1JCH A;  2EIL C;  5B1B B;  2I4M A;  3SYC A;  4YCW A;  4O2D A;  3ML0 A;  4TT3 G;  2RHS B;  1KP3 A;  4JTD B;  1ADJ A;  4P75 C;  3SYQ A;  4FK5 C;  2DTO A;  3IKL A;  4XEM A;  2DYR B;  5LHG A;  1K4C C;  1E1R G;  1AI4 A;  1OCC C;  2Z5U A;  1KQS U;  2I4L A;  4JAU A;  4YRQ A;  4MVZ A;  4UV9 A;  2I4N A;  3QO8 A;  1JOY A;  2IU0 A;  2A0L A;  1RIQ A;  4ZBM A;  4BW5 A;  4QNH B;  3V8L A;  4LVI A;  5KNN A;  1PKX A;  1V55 B;  4P3O A;  2ZIN A;  1RPR A;  3PCO B;  3JD4 A;  2XGT A;  4P72 C;  3ABL B;  4U7N A;  2OTL V;  4YRT A;  3UFG A;  4G2K A;  3ICA A;  3AG3 C;  1FFT B;  2P90 A;  4MTX A;  1NR7 A;  2HNI A;  1BHB A;  3OUF A;  1H2G A;  2A9H A;  2EIJ C;  3IFX A;  3OFN G;  4WFH A;  1JVM A;  3SPG A;  3VOU A;  2DTI A;  2EJF A;  3RAC A;  4AH6 A;  2Y48 A;  3W3S A;  1K34 A;  3FB5 C;  1WPY A;  4HA8 A;  2NLJ C;  2ZD9 A;  3P32 A;  1DF5 A;  1RM1 B;  4YYE A;  4CH5 A;  2DZ9 A;  3SPI A;  2HJF C;  4MW3 A;  3TEH A;  5DN6 G;  3R07 A;  3MEY A;  1YIT V;  3T4D A;  2XAQ A;  3ABK C;  4X88 A;  1KMM A;  1QVG U;  3WQZ A;  1JJC A;  3UGT A;  1EQR A;  4TWA A;  3LDC A;  2ZCE A;  1E22 A;  4J15 A;  2HR3 A;  3A5Y A;  2E1H A;  2EWN A;  4RO2 A;  2ZTG A;  1KD1 W;  3RKW A;  2LFS A;  1M57 B;  1Q7Y W;  1K4D C;  3WFV A;  2YSU B;  3RW0 A;  4LCU C;  3CCR V;  4UVB A;  3HXU A;  5L3E A;  3K79 A;  2AHY A;  4JTC B;  1AJP A;  3OMA B;  4G28 B;  4R8C A;  2DZC A;  5B1B C;  2DW4 A;  3SYA A;  3ZRV A;  1X2H A;  3NEN A;  4CH4 A;  4P72 A;  1GTO A;  1NNH A;  3LSQ A;  4EKW A;  2XAF A;  2RHQ B;  1VQP V;  1ASZ A;  4MVR A;  3ZCC A;  2EIN C;  3K0D A;  1PYS A;  1L0W A;  4FPP A;  4PDL A;  1AI7 A;  3E86 A;  1S5H C;  1MOF A;  4CH6 A;  1ZWI C;  2QHU A;  4XDL A;  3PJS K;  4L87 A;  1VQ5 V;  2Q6A A;  4HWT A;  3RUX A;  2F43 G;  1B70 B;  1JX9 A;  2BOC C;  2Y69 C;  2DDZ A;  3MF1 A;  4YRK A;  4MVS A;  2XAJ A;  2K1E A;  2CJA A;  3OR6 C;  1NVP B;  3ASO C;  5L3G A;  4I9W A;  4PDV A;  3IG2 A;  4NCX A;  1Q86 W;  4YRF A;  2Q7G A;  2EIL B;  1KP2 A;  5HFL A;  3W7X A;  3NEM A;  2W6J G;  1JPX A;  2GHY A;  4P71 A;  4H2X A;  2DVE A;  4YPF A;  3F7Y C;  3HRK A;  4LVJ A;  5H6Q A;  3REU A;  1KMN A;  1AJQ A;  2E3C A;  4MTO A;  1Q81 W;  2DEQ A;  3K3W A;  3HTZ A;  2EIK C;  1CEZ A;  2Q7E A;  1P7B A;  2WLN A;  4WF2 A;  3CMA V;  3A0R A;  12AS A;  1KC8 W;  3G6E V;  4XTU A;  1OCC B;  1I5X A;  2BOB C;  3ZJZ A;  4P3P A;  1H4Q A;  3JD2 A;  1NJ1 A;  1EVL A;  3ERR A;  1GM8 A;  2E10 A;  2WPD G;  2A8E A;  2J3L A;  3CC4 V;  3HB3 B;  5B1A C;  3LDD A;  2AMC A;  3M4P A;  4YRS A;  4YRG A;  3ZMS A;  3E8F A;  3STZ C;  1WNL A;  3AG3 B;  2ODR C;  1S0V A;  1F51 A;  2Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...