4RQFA

Human seryl-trna synthetase dimer complexed with one molecule of trnasec
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
475
structure length
451
Chain Sequence
b'VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTMMDKVEFVHMLNATMCATTRTICAILENYQTKKGITVPEKLKEFMPPGLQELIPFVKPAPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords selenocysteine tRNA
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 130
structure length 451
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqfA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqfA02
2E64A 4P75C 4YRCA 3HY1A 1Z7MA 1GGMA 2CGHA 1X01A 4H2TA 1NJ1A 1EVLA 1IL2A 4HWPA 4XEOA 1E24A 2E41A 2ZXFA 2QHUA 2ZNIA 3P8YA 4TVAA 4XTYA 2IY5A 2DQ3A 1WQWA 3CMQA 2DTIA 3RF1A 3A32A 5ELOA 2C7IA 4P3NA 1J5WA 2G4CA 5HGQA 1B7YA 1EOVA 4DPGA 3E9HA 1NJ5A 3V8JA 3IKLA 4AH6A 3VQWA 4ZTZB 4XU3A 2ARTA 4K88A 1C0AA 4L87A 3REXA 3V8LA 1EIYB 4TVWA 4RQFA 2AMCB 2DTOA 4YRFA 4YRSA 4HWOA 4XTUA 3V7CA 1QF6A 2AKWB 1JJCA 3QO7A 1PYSA 3TEHA 3MF1A 4X5OA 3HXXA 5K1XA 3HFZA 2RHQB 3A5YA 2E3CA 2ZGWA 2ZIMA 2EWNA 4HWSA 2QHTA 4YYEA 4CH5A 4YDQA 2EJFA 4H2YA 4HA8A 3PCOB 4P75A 1HXDA 4DQ2A 5ELNA 3EFSA 2ZZGA 4KQEA 1KMMA 2FYKA 4TVYA 4RQEA 1B70A 4ZTUB 3BFMA 3UH0A 4UP7A 2DVEA 5C53B 3QNEA 1NJ6A 4YPFA 2J3MA 4EX5A 3LC0A 2RHSB 2ZTGA 1YFSA 4PG3A 1X54A 3NENA 2XGTA 3WQZA 1E22A 4ZIBA 4XU1A 1L0WA 4XTXA 1BBUA 2ODRD 3BJUA 3RUXA 3OD1A 4H2XB 1YB3A 3RIRA 3UGTA 2ZT5A 4P74A 4UP8A 1BIAA 3V7SA 4EO4A 1WLEA 4Q6GA 2ZT8A 3HXWA 4XEMA 4YRGA 4WJ4A 5K1PA 4OP0A 3QO8A 3KFUA 2DU5A 2EL9A 4YRLA 2E65A 2DDZA 4TVAB 1VQZA 1QE0A 4XU0A 3HTZA 1NYRA 3TUPA 1YFRA 4CH4A 4XTWA 3RACA 2CIMA 2ZR2A 3A7RA 4P74C 3RGLA 2ZIOA 1BBWA 4YROA 1ATIA 4UPAA 1ASYA 2CJAA 1YGBA 3P8TA 1NNHA 4TQDA 4RDXA 1B7YB 4YRRA 1EQRA 4BWAA 1NJ8A 1EIYA 4O2DA 1N9WA 2AMCA 1X2GA 2CJBA 2ZNJA 2HNIA 4XTVA 3UGQA 3HRKA 3QTCA 2I4OA 2DZ9A 3A7UA 3VQVA 4PHCA 2E10A 4RMFA 4Q15A 2DQ0A 2Q5IA 4YRNA 2I4LA 1JJCB 3MEYA 1WPYA 1PYSB 4HWTA 2ZT7A 3M4PA 2DXTA 4TQFA 5KNNA 3HY0A 3HXYA 3L4GB 3HFVA 3NELA 4H2WA 3FJPA 4YCVA 4YCWA 4YRPA 4WF2A 1BIBA 1SRYA 2ALYA 3A74A 3PCOA 2QHSA 1X56A 3VBBA 4G84A 1HTTA 3IALA 4YRJA 3UFGA 1SERA 2DU7A 4G85A 5C51B 2DEQA 4P3PA 4XU2A 3ERRA 4LNSA 3R07A 2P5IA 3V7RA 4H2VA 2RHSA 1B70B 4YRMA 2EJ9A 4UP9A 2DXUA 4P73C 3REUA 4H2SA 4KR2A 1G5HA 1B8AA 3A31A 1E1TA 3DSQA 3ICAA 2ZINA 1NYQA 3NEMA 1W66A 4H2XA 4P3OA 1FYFA 1USYC 1X2HA 3HXZA 3TEGA 2Q7EA 2ODRC 4K87A 1ADYA 4YRTA 1HC7A 1KOGA 11ASA 3A5ZA 4TWAA 2DKGA 4H2UA 4P71C 1G51A 2IY5B 3IKMB 1Z7NA 2EJGA 4NCXA 3NETA 4YRIA 3QO5A 2ZT6A 4WJ3M 2ZR3A 1SESA 3RKXA 3VQXA 1H4TA 3W3SA 1YFTA 1EFWA 1WNLA 2Q7GA 4TTVA 1ASZA 2J3LA 3EFRA 4CH3A 1WYDA 1E1OA 4P72A 1RIQA 3HRIA 5F5WA 3L2ZA 4YRQA 2DZCA 4XTZA 3M4QA 2I4MA 2I4NA 2EAYA 4CS4A 2AKWA 2P0LA 12ASA 1H4QA 2RHQA 4KR3A 3V8KA 1LYLA 3TEHB 3RL6A 1B76A 2DTHA 4H02A 2ARSA 3MF2A 1G5IA 2QHVA 2ZZEA 1WU7A 4YREA 4P72C 5E3IA 3HFZB 2ARUA 3G1ZA 3L4GA 4P73A 1EVKA 3RKWA 3HXVA 1ADJA 1H4VB 3P8VA 2Q5HA 3RKYA 2DJZA 3A7AA 4HVCA 2CJ9A 1SETA 4BW9A 2ZCEA 2ZZFA 1USYA 2ALYB 2XTIA 3L1AA 3HXUA 4YP0A 3I7FA 4K86A 3LSSA 4OLFA 4YCUA 3IG2A 1X55A 4WI1A 2E1HA 4E51A 4P71A 1KMNA 2PMEA 2C8MA 1H4SA 3VQYA 4CS3A 1WQ7A 4YRKA 5C52B 3E9IA 1NJ2A 2E5AA 4CH6A 4J15A 2PMFA 3LSQA 2Q7HA 3PZCA 4HWRA 4CS2A
chains in the Genus database with same CATH superfamily
4D7TA 2QWNB 1F7YA 2E64A 4P75C 4ASUG 3B8MA 3M99B 2VQEO 2Z5UA 1NJ1A 3W7WA 2YDEA 2WLMA 2P4KA 4DRXA 5DECA 1NTMH 1URFA 1Q43A 2ZXFA 1OZ0A 2ZNIA 4JASA 1Y6XA 5IE9A 4TVAA 1JPXA 2DQ3A 1DF5A 2Q0AA 4O2BA 4DV1O 2QM4A 4FPPA 1QHTA 3A32A 5ELOA 1ZSPA 3RYIB 4WFFA 5J2UB 2C7IA 2QWRB 1EN6A 2G4CA 2MK3A 1RFYA 3LNMB 2QDOA 1ROPA 4DPGA 5FLXN 3E9HA 5IYZA 3HKCA 3IKLA 1KKCA 4AH6A 1NH2B 3CRMA 1A32A 3JARB 3VQWA 4TUYA 1NU1H 2ARTA 2KSDA 1V55B 2VRZA 2Q5ZA 1C0AA 2EULA 2DYRC 1EIYB 4UV8A 5GTIZ 4RQFA 4YRFA 4YRSA 4HWOA 1OCCB 3V7CA 1OCOB 4DR5B 4ZHQB 1JJCA 3QO7A 1PYSA 3TEHA 3MF1A 2AGAA 1KB9F 2X6BA 5BZBA 3ZRWA 1YIJV 2FMLA 5IYBO 1NT2B 3HFZA 3OGCC 2RHQB 4FLYA 4B08A 3JALA 1XQ8A 2ZIMA 3K06A 4MVQA 2NNUA 4PDRA 4YYEA 4LWSA 2UU9B 2CDYA 3JCUZ 4HA8A 4YJ3B 1YCIA 4DQ2A 5JQGA 3MDSA 2QM7A 1H38A 5ELNA 2LP7A 2ZZGA 4PDMA 1KMMA 2UXXA 2EIMC 4TVYA 1AJQA 4B3SB 5LA6B 2VWJA 4ZTUB 2ETNA 1TAEA 2IM9A 5BXZA 3G80A 1BCCH 1NJ6A 4EX5A 4JI1B 2RHSB 2YEVB 3JATB 1YSCA 1YFSA 1GK9A 3NENA 2XGTA 2OT5A 5KUMA 4DV0B 3N2GB 1HR0O 3BVOA 4NYKA 1XL4A 3CJHB 4WF9V 4XTXA 1BBUA 4LNUA 4KUMA 1XNRB 2ODRD 1H2GA 5H6QA 4YIPA 3BJUA 3RUXA 5J2TB 4H2XB 2DYSC 1KU9A 2ZT5A 2GHYA 4YY3O 1JFFA 1EN4A 3DC6A 4QJFB 1WLEA 2IW5A 2ZT8A 4JTDB 4XEMA 5LGNA 1S0VA 1J5EB 4TSFG 5K1PA 3F5WC 4DRXB 3C90A 1VQ8V 4OX9O 2JK5C 3KFUA 2YS8A 2UXBO 3JAWB 4TVAB 1QE0A 1GN3A 2DJVA 4XU0A 2NR5A 2HJFC 5KAIZ 4FK5C 4WBNA 1WA8B 1YI2V 1OCZC 2LW1A 2R9RB 3MAQA 4IIJA 1SQGA 4JF3A 2ZR2A 4P74C 4LFCO 1M93A 4HNAA 3KKYA 2VQEB 3L74H 4YROA 4UPAA 3L72H 4YJ2A 1QVGU 2CJAA 1VF7A 1I94O 3TCUA 3ZHRA 4DR2O 3ZN1A 1TUBB 4TQDA 2LFRA 4RDXA 5B3SB 3IAYA 3ZRVA 1EQRA 3K3WA 5IYZB 3ZMZA 3HKCB 3MHHC 3T1YB 3LDDA 1NJ8A 3N2KB 1VF5B 4O2DA 4EEQA 4EB6B 1O9GA 2HNIA 4XTVA 3HRKA 2EIKB 1QLEB 3QTCA 1YJ9V 1VQ6V 2I4OA 3E83A 3OEHG 5AG2A 3A7UA 1OV9A 4RMFA 5GONA 3E35A 2DQ0A 1XMOO 5B1OA 2P6JA 2I4LA 2WA3A 1JJ2U 1JJCB 3IC9A 4PDLA 1PYSB 5L3GA 4FLWA 5IJ0A 4HWTA 3M4PA 3FB6C 5KNNA 3AG1C 3HXYA 3ZRWB 4BR6A 3HFVA 3FJPA 1MMMA 1NJIW 4WF2A 1BIBA 3RGBA 2ALYA 1MNGA 3JALB 2QHSA 2CH7A 4G28B 2KG7A 3SPGA 1BGYH 5JH7B 1AI7A 3VBBA 1IXMA 1HTTA 1Q3EA 1N8RW 3FB8C 3CWBH 2DU7A 4EFBA 1NTZH 3CYOA 2RDCA 1I7FA 2Q8VA 1NTKH 5D5QA 4LNSA 3E22A 2QTSA 1FXKA 1H2MA 2P5IA 3V7RA 3J81N 3RYHB 1FKAO 1CEZA 4H2VA 1TUEB 1S5JA 4DR6B 2EJ9A 4YRMA 1UPGA 4IYIA 1D5AA 1S76D 2ITCC 4J7JA 1K73W 1SQXH 1K7DA 3F7VC 1K97A 2Q67A 1JMKC 2DWDC 3A31A 5KAFZ 1FAFA 1FS0G 5EBWC 2D2CB 4I55A 4OGQB 4P3OA 4IL6Z 1R3IC 3CCVV 4FVMA 2LFSA 1R1BA 2LJ2A 4QNHB 4LNUB 4JYAO 2ODRC 4K87A 3Q4HA 4D7SA 1ADYA 4YRTA 1VEWA 4J41A 2JEXA 1FFXB 4ZKIA 4RWUA 4R7CA 4NB5A 1JFFB 2IY5B 1Y66A 1Z7NA 4F6EA 2YXHA 4HAMA 2Y48A 2X7RB 1GMGA 3A0RA 3RKXA 4PELA 3KCYA 1HR0B 1KBHA 3JYCA 4LVLA 3UO2A 4J7ZA 1EFWA 3DXRB 4UCTA 2A0LA 1KP2A 4MSWC 2Q7GA 3E8FA 2VS0A 2ITDC 4TTVA 1ASZA 2AHYA 2J3LA 1ZLZA 1WYDA 4P72A 3JD4A 3S3XA 2WAMA 3CHXA 4IIJB 5F5WA 5IY5C 4YY3B 2UUAB 5C8YA 3HRIA 3L2ZA 2DMXA 2H3OA 4ZI7A 1VARA 4DR3O 2DZCA 5E79Z 4YJ2B 3T4ZA 2M6YA 2WLHA 4CS4A 2H8PC 4OX9B 1YXBA 5KMGA 2UXBB 3THOA 3HKDA 4GCZA 1Z5WA 1AP5A 3AK3A 2OYQA 2ZD9A 2DE0X 2VWKA 2JVDA 2QE7G 3X2QC 5E3IA 2UXDB 4P73A 1BMFG 1SZTA 3HXVA 1XI1A 1ADJA 1I94B 3I55V 2WPDG 4DR2B 1SQQH 2WSSG 4UUJC 3K0DA 5B5EZ 5IJ0B 4H0LB 2F93B 3AEIA 1SETA 1S72V 3PJSK 1W0JG 4UVBA 4BW9A 1BE3H 1V54B 4I9WA 5H9CA 4JI4O 3QF7A 3RVYA 1QVFU 2ALYB 4O4JA 4X1YB 3HXUA 2KG7B 4J7KA 3I7FA 3CX5F 1MOFA 2Z3YA 3OR6C 4YCUA 4E51A 1SA0B 4P71A 1XMOB 3B2EE 5JJJB 4O4IB 4MW3A 2PMEA 1H8HG 3ABUA 1H4SA 3MHSC 3K58A 1NVPB 1WQ7A 3A0BZ 1THZA 3K0GA 2P7TC 4CH6A 2ZKOA 3E9IA 3UO3A 3WG7C 3OMIB 3ABLC 4YRCA 4WFHA 4O4HB 4DV6O 4GT1A 4I9QA 4WFEA 2CGHA 2QJ1A 2OIEA 4JZ2A 4F6RA 2ZQMA 1EVLA 5IT9N 2EILB 1IL2A 4U7OA 3TETA 4B3MO 4FZ0A 2Q68A 2QHUA 4JI0O 3P8YA 1YJWV 4MTGA 4YIOA 3W7TA 4TOIA 1KQSU 4G2KA 1COWG 2Q0OC 5BMVA 4K8ZA 1JJOA 2EBOA 1VQOV 2DTIA 3S3WA 5LXTA 2UXCO 3RF1A 1Y76B 1W0KG 3OTFA 2JJ2G 3CRCA 3JD3A 3J80N 2YI9A 5F2VO 3RVZA 5LMUO 1VMGA 4X1IB 1MSDA 1EM1A 3O9OA 3C3SA 4KP4A 5LHIA 4JYAB 2CTQA 4UVAA 2P90A 3OD4A 3UCSC 2B1IA 5DEDA 3W7XA 4ZTZB 4X20A 4MVMA 4XU3A 5FPOA 1Y4MA 5C8YB 4ZI7B 4K88A 4L87A 3REXA 4U3JB 1SZXA 3ABKC 4MVSA 2OTLV 4TVWA 4PI2A 2XAQA 2DOSA 4XTUA 2IJIA 1QF6A 3OFNG 4RAIA 1I5XA 1AVMA 2BSKA 1NH2D 1Z2GA 1VQ5V 4JPRA 1NZ6A 4JI5O 4X5OA 1EN5A 2EIJB 4GZRB 3HXXA 3EHBB 1CXZB 4BIZA 5HFLA 3SDLA 5LMNO 3G4SV 1YTFB 2IH1C 1IBMO 2EJRA 2YIDA 5EZYA 2EJ7A 4YDQA 4DR3B 4H2YA 5FL7G 3FYIB 2OCCC 3CCLV 4R8CA 3EFSA 4WFBV 5LYJA 1N0JA 4X65B 3OGIB 1PKXA 2Q6AA 4LF5O 5LHHA 4B7KA 3SJQC 4JYCA 4LF8O 4PD4F 1RM1C 1XMQB 4RQEA 1NR1A 4JI3O 1B70A 1GM9A 5B1AC 4O4JB 3BFMA 3ZS8C 3UH0A 2DVEA 1V9PA 3ZN0A 2OWOA 1YZBA 4GLXA 4HZ3A 3SJAC 1QR9A 2J3MA 5KLVH 3LC0A 5EBMC 1E1RG 2JGDA 4I4TA 2V4DA 4PG3A 3BAAA 1XNQO 2HR3A 4UCSA 1X54A 2HHHO 2NLJC 5GTHZ 4LVIA 4QE9A 3IJ4A 1RSOA 3LNNA 2BCCH 3JAKB 4K0KO 2R9IA 4JI4B 1I0HA 4FFBA 2K1EA 2Z0AA 5JCOA 4P74A 1WB8A 5B1BC 1L8DA 4C7UA 1FPOA 1GTOA 4EO4A 2LQTA 4Q6GA 4F6RB 3HXWA 3BEHA 4GX0A 5KHIA 4K3AA 3ZHTA 2C2AA 1Y74A 2CGNA 2W6IG 1MZFA 3QO8A 2XOKG 4DUYO 3CCRV 4YXWG 4JI8O 2EL9A 4YRLA 1EFRG 5CMUA 2DDZA 5BR8B 1VQZA 2QWPB 2XNDG 4G27B 5CA1A 3L70H 2EX3A 5BMVB 1VQ7V 5LXTB 4DV6B 3A7RA 3RGLA 3RN4A 1BBWA 3JASA 1ATIA 3UT5A 1B04A 3P8TA 4A5UB 2KKWA 3CCMV 4B3MB 5A9GA 3NXSA 2JRIA 1KYOF 5IYCO 4JI0B 4PA9A 1EZJA 2YICA 4IHJB 1M90W 5EK0A 2AMCA 2HVJC 4JYBA 3I5DA 1TGOA 1N33O 4NXNB 3UGQA 4B3RO 5H5NA 1GN2A 4H33A 4MTXA 3RW0A 1AILA 2Q5IA 4YRNA 2RCVA 1XOUA 2F66C 4J9YB 1WPYA 2DW4A 2ZDIC 5LMUB 4DV4O 4KHPO 1S5LZ 4TQFA 2DXTA 4LF9O 2QKSA 1M56B 3BA8A 3TJTA 1ENVA 5IDJA 1QBZA 4H2WA 3LUTB 4GKJO 5CBHA 1V55C 4YRPA 2MW2B 3PCOA 4X64O 1YF2A 1US6A 4X1KA 1X56A 2Y4TA 5ITZA 4RUEA 1OCCC 1R6NA 4JZGA 3OTOO 1OCOC 4X66O 2LGQA 2QM8A 4X9QA 1SERA 2ARHA 2DEQA 1Q81W 1W2BU 3OEEG 2OTJV 5LYJB 4DO2A 1I5YA 3SYQA 4GX1A 4JI5B 3R07A 3K59A 5J9PC 4PHZA 5LMNB 3OMNB 1B70B 4AI8A 3N27A 2YXLA 1IBMB 5L3BA 2DXUA 2AW9A 1R3LC 4H2SA 5JJNB 2DWEC 4LF6O 4O2AA 5LOVB 1T5EA 1H2KA 1GH6A 4FLTA 3DSQA 1VQKV 3U11A 1W66A 2DN9A 2N04A 1AP6A 1FYFA 3P32A 3GB7C 4TV9A 4YHHO 1X2HA 4LF5B 3H1KH 5EIBC 3ETDA 2GV9A 4LF8B 5FPRA 3H1IH 4JI3B 2PY5A 3A5ZA 4FFBB 3A0HZ 4MW8A 2P22C 3H1JH 2GSMB 1AR5A 2XAJA 2R72A 2YI8A 3IKMB 3CRQA 2EJGA 4NCXA 1P4RA 3CD6V 3BABA 3QO5A 2QTOA 2YIBA 4WJ3M 2PYLA 1RP3B 3AG4B 3VQXA 2YC0A 4I50A 2HHHB 3ZBHA 4O2BB 5KHGA 4OPAA 4NXMO 2GTAA 2W0FC 1YFTA 4K0KB 4KFMA 5CA1B 3G6EV 1WJZA 2UUCO 1CP9A 1L0NH 3K9SA 1WPBA 2YIBD 1JA8A 3EFRA 1RIQA 3WB2A 3WB1A 4I5SA 2ZXWB 3JASB 5TISZ 1GO3F 3UT5B 4B3TO 2EINB 1X59A 4TUYB 4L8JA 3T4DA 3SJCC 2FTKA 2I4MA 5KA5A 5CBFA 4JI6O 1AROP 4JI8B 2P0LA 4DV1B 1J95A 2RQ6A 5E1AC 1XHZA 4FM0A 12ASA 1H4QA 3K5NA 3V8KA 1LYLA 3AG2B 3TEHB 3AK1A 3FB7C 1B76A 2OCHA 2A8EA 4H02A 2ARSA 5EBLC 3BCCH 1P49A 1K4DC 1WU7A 4YREA 3EVKA 5FNVA 5KX5A 3HFZB 3B40A 4GKKO 5B3SC 3L4GA 1M57B 5LP6C 1VQ9V 4X88A 1S3JA 4FLZA 3GWKC 3RKYA 1KUQA 2DJZA 2HFEC 3A7AA 4LWSB 4W4KA 4DYLA 2EIKC 1QLEC 5JQGB 1USYA 2LO1A 2CGOA 3L1AA 2K9PA 1GM7A 1DF4A 1N33B 4B3RB 1IVSA 2FYUH 4H37A 3CMAV 3IG2A 1X55A 3SYPA 2E1HA 1AI6A 3CC4V 2A7WA 4LH7A 3T1CA 1HW7A 5EYPA 2PF4E 2PYJA 1LUVA 4DV4B 2C8MA 1TVKA 2GDSA 3VQYA 1MG1A 1CPYA 1FXVA 4CS2A 4E4EA 5C52B 4GKJB 2ODMA 2Y69C 4LBEC 3LSQA 4X64B 3CCJV 4DR1O 4OPHA 3HKBA 4O2AB 3OTOB 4X66B 1Z7MA 1ZUQA 3D8CA 1X01A 2F43G 4QPJA 4JTCB 1NVPD 3HB3B 3DTUB 4XEOA 1E24A 2V7QG 2QWOB 1H2NA 2IJJA 1WP8A 4XTYA 3ETEA 2YUAA 2Q69A 1HWYA 5LHGA 4DV7O 3CMQA 2X6AA 3FYEB 3FD9A 4GX2A 4LF6B 5LL6Y 1BT8A 2Q4PA 4WBNB 3ZX6A 1P7GA 2HG5C 4P3NA 3L73H 1KP3A 2EZPA 3F5TA 3UM7A 4DR7O 1B7YA 1EOVA 1NBMG 3R65A 4YHHB 4HNAB 4X8AA 1Q82W 2WLKA 2YSUB 3FX7A 3K79A 4FM1A 1ZAUA 5KHKA 1Q6HA 3C3TA 5JVDA 3ZMSA 4RO2A 2WWWA 2N05A 1JR9A 4DUZO 3EFFK 4QE7A 1QLNA 3APOA 4LFCB 4NXMB 2IJHA 3ZEDA 5GONB 4CC6A 5K1XA 1HNXO 3A5YA 1OJHA 1R73A 1N36O 2ZGWA 1K92A 5IWAO 3M7MX 1FD9A 2EWNA 4EFEA 4JAUA 4HWSA 2QHTA 3AG7A 2P4VA 1MA1A 3OM3B 2N74A 5KX5B 3BPZA 4P75A 3FAVA 1QQCA 2CH7B 1BZKA 4N21A 3RWRD 1Q5OA 3ABTA 4KQEA 1VQ4V 3QVNA 2FYKA 1IX9A 3CB2A 2VQFO 2XAHA 1VIBA 3OR7C 3G6BA 2QKCA 1N32O 2WLLA 3SR2C 4UP7A 3L71H 5C53B 4P2ZA 5GW7A 3E22B 1FXKB 3QNEA 4MTFA 3SPJA 1HDJA 4YPFA 1Q90D 4J80A 5B66Z 4GKKB 2ZTGA 2BTQA 2GUZA 4TT3G 2H94A 3WFVA 4JAVA 1AR4A 3D3IA 3ZMVA 3WQZA 1GRJA 1YEWA 1IDSA 1V54C 3RYCA 2YXYA 3G67A 3AG3B 4PA6A 2P5OA 1L0WA 1M4UA 2HP8A 1S77D 1K8AW 4DK0A 2ZE6A 4ICGA 4I55B 5LBQA 3OD1A 3RIRA 2IU3A 1P84F 3UGTA 4UP8A 3K08A 3CPWU 2XASA 3Q4HB 3STLC 3V7SA 1BL8A 3JSLA 4LR3A 4WJ4A 2QGNA 1O9HA 1QCEA 3RFRA 4UXNA 1R3JC 3CCEV 2DU5A 1U96A 3ASOB 2E65A 4DV3O 4DR4O 4FMTA 1G4YB 4H13B 1VQPV 4FJCC 4LF7O 3TUPA 1XL6A 1S5HC 4ZOLA 4XTWA 5J2UA 4DR1B 4HYOA 2BTOA 4DV5O 2CIMA 2EILC 4AQYO 3ML0A 4H44B 4UB6Z 3H1LH 5BY1A 1VQLV 3CCSV 3A2FA 3E8GA 3LDEA 4KL1A 3ZMTA 2CTWA 3E89A 1NQTA 4UV9A 3JARA 3CE2A 4X89A 1B7YB 3ETQA 4YRRA 3KG2A 1N4CA 2CK3G 2ZE7A 4PJ0Z 1EIYA 4PI0A 1HP8A 4FLVA 1X2GA 4DV7B 2CJBA 2ZNJA 3TXSA 5KMGB 3ABMB 4MVOA 2A79B 3HKDB 3CXCU 2E74B 3IFXA 5JVDB 2DZ9A 4QGPA 2ZT9B 2JIZG 3ZHUA 3JD0A 2E10A 1Q6UA 1Q86W 4Q15A 3STZC 3P3NA 4B3SO 2HLDG 2E5LO 2WA4A 4Q20A 5L3FA 3JD1A 3ASNB 1FJGO 1OCRC 2QR4A 4DR7B 1KKDA 2WLIA 1WAZA 3CRAA 5B1AB 3NELA 3H1HH 1DK1A 4JI1O 1MZEA 4YCVA 4YCWA 2L35A 4YJ3A 1DTOA 2O57A 1ORQC 1FXHA 4DV0O 3EXAA 4G84A 2ATKC 2XAGA 3IALA 2A9HA 2PI4A 4G85A 5C51B 3FAVB 4DUZB 3T1HO 3APQA 4Z1VA 2EIJC 2F4VO 4OXSA 3LSUA 1PM9A 3SYOA 1WP7A 2IJKA 1HNXB 2RHSA 1Z5VA 3JATA 3K9AA 4IGGA 4UP9A 4P73C 5IWAB 1E1QG 4X62O 1WB7A 3H9VA 4HBNA 4KR2A 1VF6C 5EIBD 3N2GA 3TXQA 1N0NA 1G5HA 3CJHA 5KUKA 3SPCA 1ZWIC 4H2XA 3RYCB 2IBZH 1JCHA 3HXZA 3DC5A 4CBCA 1MABG 1QR8A 2VQFB 4DV2O 4O4LA 1GAXA 1W59A 1IBLO 1N32B 2OIGA 1VP7A 1BQ0A 4HT4A 1B3QA 1YDXA 3W7UA 4P71C 5D5PA 1LR1A 5LGTA 4J42A 3JAWA 2UUBO 1ZX3A 4YRIA 4FM2A 2ZT6A 1KECA 3T1YO 1SESA 3E8BA 1H4TA 2DYRB 3DGEA 2B9ZA 1WA8A 1NR7A 3HKEA 1FFTB 1IURA 4K8XA 4DK1A 5CB4A 1PL0A 1WNLA 1HNWO 1XBLA 2GBOA 4ZOLB 1ZL8A 4BIOA 5IJ9A 2BE3A 1Y67A 1E1OA 1AJPA 2BOBC 1BHAA 1TUBA 2Q73A 4P9PA 5EC2C 4YRQA 1D5NA 5LP6A 3K5MA 3L75H 4W4LA 3K5LA 1GN4A 3M4QA 3CCUV 4X20B 4D6TH 3N2KA 2PUSA 2QKAA 4EB6A 2V1DA 2AKWA 2UXCB 2NS6A 4DW1A 4QIWF 4DV3B 4DR4B 3K04A 1K34A 5KA6A 2JJ1G 2JDIG 4WFGA 2KB1A 3ZRXA 4LF7B 3MD0A 4UCVA 2X6CA 4KR3A 4LF4O 2BSKB 2EIMB 1PL4A 4TV8A 3MF2A 1G5IA 2QHVA 2ZZEA 4DV5B 3P30A 3B77A 3OAAG 4AQYB 4IYHA 5CN0A 1DGSA 1L0LH 3SPHA 1RPRA 2PI5A 2ZE5A 3RBZA 4R6ZA 3P8VA 5EZYB 4DR6O 1M9NA 2Q5HA 4MTOA 1MSWD 2QWQB 2B1GA 3SYCA 2WLIB 4P30A 5JH7A 4PDVA 1N34O 1ZTEA 2WLNA 3T2MA 4MT8A 3CEIA 2XUMA 1LUWA 4K86A 3CXHF 1K5QA 3LSSA 3U10A 2DYSB 4JAAA 1UJWB 1UFIA 3RYHA 2E5LB 1M56C 1BSMA 4PV1B 2R9AA 1FJGB 4LVJA 1PPJH 4UCRA 3GWOA 4CS3A 2JGDB 3WB0A 4I4TB 3H01A 5CBGA 1BHBA 2F23A 2FL4A 3BFRA 2E5AA 3RYFA 2PMFA 2Q7HA 3PZCA 1F4MA 1RSOB 3D3QA 3F7YC 5L3CA 1QU7A 4R50A 3JCZA 1NI8A 3HY1A 1OCZB 3MQZA 1GGMA 4K35A 1F23A 2ZE8A 3A8TA 2XT9A 4H2TA 4LFAO 1AB3A 3D36C 3T1HB 4ZBMA 2QEXV 4LFBO 4HWPA 1H2LA 3AK2A 1FFXA 2E41A 2F4VB 1PNLA 1EBOA 2UUAO 2AXTZ 4O4LB 2IY5A 1HNZO 1XNQB 1Y74B 1WQWA 2L6LA 2Q9LA 4X62B 1IZ3A 4EKWA 4Z1MG 3E86A 1RPOA 3JAMN 3JD2A 1G1XB 1XREA 2HVKC 3DXRA 1L1FA 1VQMV 1J5WA 2WLJA 5HGQA 3HKEB 1U97A 1PD3A 4DV2B 1NJ5A 5JCOC 5CB4B 2CAZC 3G71V 3V8JA 2UXDO 2Y0IA 1IBLB 1XDCA 2HEPA 1ZL8B 5IJ9B 3AG1B 2UXNA 4DUYB 3P3PA 5LP6B 3AG4C 5L3EA 3V8LA 2UUBB 1R6TA 1X4TA 2AMCB 2DTOA 3K57A 1I08A 2F95B 2AKWB 4BAYA 3L9DA 1JQ0A 3CSXA 3J7AU 3FKSG 4JV5O 3CC2V 1HNWB 2E3CA 3U0ZA 2NN4A 3ZHQA 2ZXWC 4TV8B 2JS5A 2ZM6O 2EINC 3PN1A 4QPKA 4CH5A 1K4CC 1SKVA 3HR0A 1WN7A 4MVRA 1EZVH 1SS3A 2EJFA 5KHHA 1XHXA 3PCOB 2GTSA 1HXDA 1R6KA 4LP8A 1K9MW 4X1KB 3O65A 5ITZB 3KCXA 4XBFA 3ZHSA 4KXRA 4X1YA 4TWKA 3AG2C 1IBKO 4XDLA 2Y69B 3B8NA 1D2DA 4LVKA 4FLUA 2PZSA 4JGSA 1SA0A 4LF4B 3RT3C 5CA3A 1BQZA 1M57C 4WFAV 4O4IA 4KHPB 4LF9B 1SC5B 2XTAA 3NR7A 2AZ2A 1DLBA 4GYCB 3OUSA 1SF9A 2FB5A 1K33A 3CS5A 4FLXA 3ICXA 1E22A 3TGUH 1E79G 4LVMA 1XUQA 4FFKA 1PP9H 2EZOA 4ZIBA 4XU1A 4O4HA 1WNSA 2A3QA 1SQVH 3RYFB 2CTPA 1N34B 5H6RA 4ABMA 4AHCA 1YB3A 4TV9B 4BW5A 3E8HA 5KHJA 3IGAC 2CTRA 1BIAA 4JTAB 4YRGA 1JX9A 1TA8A 5IY5B 3B4SA 1LNQA 4OP0A 1B6QA 3LDCA 1G6UA 1KMIZ 1KC8W 1PNMA 2JEUA 1Y76A 3HTZA 1R3KC 4MVZA 4PA4A 1NYRA 4I50B 4NR1A 4CH4A 1YFRA 2CE4A 4UVCA 3QG5A 3RACA 3ZJZA 1M5IA 2HKOA 2ZIOA 4X1IA 1SQFA 1ASYA 3FB5C 4LFAB 3X2QB 1YGBA 4LFBB 1NNHA 2IH3C 1GM8A 3I56V 4JI2O 5LGUA 2R70A 2QSAA 4BWAA 4CC5A 2B5UA 5EC1C 1HNZB 4U3JA 4RUFA 2Y0PA 1N9WA 3ZIAG 4Z2WA 4FZ1A 2ILMA 3CP1A 4JYYA 4X65O 2PGGA 5CA0A 3VQVA 4PHCA 1AJNA 4LC1A 5DM6V 1H8EG 2UUCB 4I7ZB 1NKDA 1XMQO 2XHBA 4J10A 4NTXA 2ADPA 3MEYA 2ZT7A 5FNVB 4NTYA 3HY0A 2JS3A 3L4GB 4B3TB 4JI7O 3ETGA 5L3DA 3ZRSA 4F4LA 1GKFA 1SRYA 4MVUA 4JI6B 3A74A 1PNKA 1VF6A 3OE7G 1YTFD 3KZIZ 2A06H 5JWPA 2CUGA 3WG7B 4YRJA 3UFGA 4B7EA 3ABLB 2AHZA 1M1KW 4P3PA 3CCQV 3OW2U 4I0XA 4XDJA 4XU2A 3ERRA 5HFMA 3W7SA 4MS2A 3OMAB 1XEQA 3B09A 4JV5B 3SPIA 5B1NA 1BS3A 2D3OW 3SGIA 4U7NA 5EYPB 3REUA 1TVKB 3M8AA 3R66A 2ZM6B 4UFZA 4PA3A 1F51A 2RNBA 4P9OA 3JAKA 5BR8O 1B8AA 2LW7A 1K3EA 5A2QN 1E1TA 3SJBC 3ICAA 2ZINA 2P67A 1NYQA 3NEMA 1YVWA 2PTMA 3JSNA 1B06A 3HKBB 1USYC 3TEGA 5JJEB 4WCEV 2Q7EA 1IBKB 4J11A 1GN6A 4UCUA 1FXKC 1HC7A 4LH6A 1KOGA 11ASA 4FIPC 4TWAA 2DKGA 4H2UA 1WPXA 4UB8Z 4NTWA 1G51A 2IU0A 1K5SA 3NETA 1YHQV 1AI4A 3BY6A 3CRRA 4DW0A 3CMEV 1Q8IA 3RYIA 3AG3C 2ZR3A 2BOCC 2ADQB 4DR5O 3ABKB 1P7BA 1IXBA 3W3SA 4NXNO 3GVMA 4GX5A 1OHHG 2E75B 4N23A 3FFQA 2X0LA 2ZDIA 1Q7YW 2XAFA 1XILA 4CH3A 2UU9O 3UQ8A 1OCRB 4IT5A 3ASOC 4XTZA 2I4NA 4IHJA 2EAYA 2P06A 4ZHQA 1JOYA 2AZ0A 1VQNV 4UCOA 3BA9A 2OCCB 3K5OA 4XDKA 2Y4UA 4U3FH 2RHQA 4GUNA 1YITV 3RL6A 2DTHA 1QNMA 2F1MA 2E76B 5C93A 1RM1B 1YJNV 3CC7V 4P72C 4NVPA 5CA0B 1F4NA 4AILC 3K03A 2ARUA 3ZCCA 4J9ZB 5IYDO 3HPLC 3G1ZA 1EVKA 2RN9A 3RKWA 1H4VB 4NKGB 1SQBH 1NS1A 3WU2Z 2RJZA 4JI2B 4HVCA 5H2FZ 3OT7A 3BHPA 2CJ9A 1JVMA 3ABMC 1G8MA 1XNRO 2ZCEA 2RMKB 3IC7A 5LA6A 2ZZFA 2XTIA 4BIUA 5DN6G 4CZZA 2QA4V 4YP0A 1PV0A 3ZMUA 4OLFA 3ASNC 2M7WA 2YIAA 3D36A 4WI1A 4E2LA 3BRCA 2JGUA 1AR1B 2YEVA 3E2EA 5B1BB 2WLLB 1N36B 1J5EO 1KMNA 4DXWA 4LCUC 2HJDA 3TK1A 4I0XB 1H2SB 2W6JG 3ZHVA 1FYJA 1AI5A 2KQXA 3OUFA 2BTQB 2GUZB 3UKMA 4JI7B 1KD1W 3SYAA 4YRKA 5LOVA 1NJ2A 1SQPH 4J15A 4PA7A 3VOUA 5J2TA 2LGWA 2W0XA 4HWRA 2FKXA 1Q6IA 2G38A
chains in the Genus database with same CATH topology
3CCJV 3OMIB 2E64A 3ABLC 4P75C 4YRCA 3F7YC 4WFHA 5L3CA 4ASUG 4GT1A 3JCZA 4R50A 3B8MA 3M99B 4WFEA 3HY1A 1OCZB 1Z7MA 3MQZA 2Z5UA 1GGMA 2CGHA 1F23A 1X01A 4H2TA 2ZQMA 1NJ1A 2F43G 3W7WA 1EVLA 4QPJA 2EILB 2WLMA 4ZBMA 4JTCB 2QEXV 1NVPD 4HWPA 4U7OA 3HB3B 3DTUB 3TETA 1IL2A 2Q68A 4XEOA 1E24A 2V7QG 2E41A 2ZXFA 1OZ0A 2IJJA 2QHUA 1PNLA 2ZNIA 4JASA 1EBOA 3P8YA 1YJWV 4MTGA 4TVAA 4XTYA 2IY5A 3W7TA 3ETEA 2Q69A 1JPXA 2DQ3A 1KQSU 4G2KA 1COWG 1WQWA 1HWYA 5LHGA 3CMQA 2X6AA 2EBOA 1VQOV 4EKWA 3FYEB 1DF5A 2DTIA 3RF1A 4GX2A 4Z1MG 3E86A 1W0KG 1RPOA 2JJ2G 3JD2A 4FPPA 3JD3A 3A32A 2HVKC 5ELOA 4WFFA 1L1FA 2C7IA 2HG5C 1VQMV 4P3NA 1KP3A 2EZPA 1J5WA 2G4CA 2WLJA 5HGQA 2MK3A 3UM7A 3LNMB 3RVZA 1B7YA 1EOVA 1ROPA 1NBMG 3R65A 4DPGA 4X8AA 1Q82W 3E9HA 2WLKA 1PD3A 2YSUB 1NJ5A 4KP4A 5LHIA 3K79A 3G71V 3IKLA 3V8JA 4UVAA 4AH6A 1NH2B 2P90A 3VQWA 3AG1B 2UXNA 2B1IA 3W7XA 4ZTZB 4MVMA 4XU3A 2ARTA 1V55B 1Y4MA 3AG4C 4K88A 1C0AA 4L87A 5L3EA 3REXA 2DYRC 3V8LA 3ZMSA 1EIYB 4UV8A 3ABKC 4MVSA 4RO2A 2WWWA 2OTLV 4TVWA 4RQFA 2AMCB 2DTOA 4YRFA 4YRSA 4HWOA 2XAQA 1OCCB 4XTUA 3EFFK 2IJIA 3V7CA 3OFNG 4RAIA 1QF6A 1OCOB 4QE7A 2AKWB 4BAYA 1QLNA 1I5XA 3QO7A 1JJCA 1PYSA 3TEHA 1JQ0A 1NH2D 1VQ5V 3MF1A 4JPRA 2IJHA 2X6BA 5BZBA 3ZRWA 1YIJV 3FKSG 4X5OA 3HXXA 2EIJB 5IYBO 5K1XA 3CC2V 3EHBB 3HFZA 3OGCC 4BIZA 2RHQB 5HFLA 3A5YA 3G4SV 2E3CA 1YTFB 1R73A 2IH1C 2ZXWC 2ZGWA 2EJRA 1K92A 2ZIMA 2EINC 3K06A 4MVQA 2EWNA 2NNUA 4QPKA 4PDRA 4JAUA 4HWSA 2QHTA 4YYEA 3OM3B 4CH5A 1K4CC 4YDQA 4MVRA 2EJFA 4H2YA 4HA8A 5FL7G 3FYIB 3PCOB 4P75A 1HXDA 4DQ2A 1R6KA 2OCCC 2QM7A 4LP8A 3CCLV 1K9MW 4R8CA 1H38A 5ELNA 2LP7A 3EFSA 4XBFA 4WFBV 4N21A 3ABTA 2ZZGA 4KQEA 4PDMA 1VQ4V 4TWKA 1PKXA 1KMMA 2FYKA 2Q6AA 3AG2C 5LHHA 2UXXA 2EIMC 2XAHA 2Y69B 4XDLA 3B8NA 3SJQC 4TVYA 4LVKA 1AJQA 3OR7C 4JYCA 1RM1C 4RQEA 1NR1A 4JGSA 1B70A 1GM9A 5B1AC 4ZTUB 3BFMA 2WLLA 3UH0A 5CA3A 4UP7A 2DVEA 1M57C 4WFAV 4P2ZA 5GW7A 5C53B 3ZN0A 1FXKB 3QNEA 4MTFA 3SPJA 1NJ6A 4HZ3A 4YPFA 1QR9A 2J3MA 4EX5A 3LC0A 1DLBA 5EBMC 2RHSB 2ZTGA 1E1RG 2YEVB 4TT3G 1YSCA 1YFSA 2H94A 3WFVA 4PG3A 1GK9A 3OUSA 4JAVA 2HR3A 3D3IA 1X54A 3NENA 3ZMVA 2XGTA 3WQZA 2NLJC 1K33A 2OT5A 5KUMA 4LVIA 4QE9A 1E22A 1V54C 1E79G 4LVMA 1XL4A 3AG3B 4PA6A 2EZOA 4WF9V 4XU1A 1L0WA 4ZIBA 4XTXA 1BBUA 4WJ4A 4KUMA 1S77D 2ODRD 1H2GA 5H6QA 1K8AW 3BJUA 2R9IA 5LBQA 3RUXA 3OD1A 4H2XB 2DYSC 5H6RA 2K1EA 1YB3A 3RIRA 2IU3A 3UGTA 4BW5A 3E8HA 2GHYA 2ZT5A 4P74A 5B1BC 4UP8A 3IGAC 3K08A 3CPWU 1BIAA 2XASA 3STLC 3V7SA 1GTOA 1BL8A 4EO4A 4JTAB 4QJFB 1WLEA 4Q6GA 2IW5A 2ZT8A 4JTDB 1JX9A 3BEHA 4GX0A 5LGNA 3HXWA 4XEMA 4YRGA 1QCEA 1S0VA 5IY5B 4TSFG 5K1PA 2C2AA 3F5WC 4UXNA 1LNQA 4OP0A 1R3JC 2W6IG 3QO8A 1VQ8V 2XOKG 1B6QA 2JK5C 4YXWG 3CCRV 3CCEV 2DU5A 3KFUA 3LDCA 2EL9A 4YRLA 3ASOB 2E65A 1EFRG 5CMUA 4FMTA 2DDZA 1G4YB 1KC8W 1PNMA 4TVAB 1VQZA 2JEUA 1QE0A 4XU0A 3HTZA 1R3KC 2HJFC 2XNDG 4G27B 4MVZA 1VQPV 4FJCC 4PA4A 1NYRA 3TUPA 1YFRA 1XL6A 4FK5C 1S5HC 1YI2V 4XTWA 4CH4A 1OCZC 4UVCA 2R9RB 1VQ7V 3RACA 3ZJZA 4HYOA 4JF3A 2CIMA 2ZR2A 3A7RA 2EILC 4P74C 3RGLA 2HKOA 3ML0A 2ZIOA 1VQLV 1BBWA 4YROA 1ATIA 4UPAA 3CCSV 1ASYA 1QVGU 3FB5C 2CJAA 3E8GA 3LDEA 3ZMTA 3TCUA 3X2QB 3E89A 1YGBA 3P8TA 1NQTA 3ZN1A 4UV9A 1NNHA 4TQDA 3CCMV 2IH3C 1GM8A 2LFRA 4X89A 3I56V 5B3SB 1B7YB 3NXSA 4RDXA 3ZRVA 5LGUA 4YRRA 3KG2A 5IYCO 1EQRA 3K3WA 3ZMZA 2CK3G 4BWAA 4PA9A 2B5UA 3MHHC 5EC1C 1NJ8A 3LDDA 1EZJA 1EIYA 4RUFA 1M90W 5EK0A 1N9WA 4O2DA 3ZIAG 2AMCA 1X2GA 2HVJC 2CJBA 4JYBA 2HNIA 2ZNJA 4XTVA 3CP1A 3UGQA 3ABMB 3HRKA 2EIKB 1QLEB 4MVOA 2A79B 3QTCA 1YJ9V 3CXCU 1VQ6V 3IFXA 2I4OA 3E83A 3OEHG 4H33A 2DZ9A 3A7UA 3VQVA 2JIZG 1AJNA 3JD0A 4LC1A 1H8EG 4MTXA 5DM6V 2E10A 4PHCA 4RMFA 3E35A 1Q86W 3RW0A 2DQ0A 3STZC 4Q15A 5B1OA 2HLDG 2Q5IA 4YRNA 1NKDA 4Q20A 5L3FA 3JD1A 3ASNB 2P6JA 1OCRC 2I4LA 4J9YB 1JJ2U 1JJCB 4PDLA 3MEYA 1WPYA 1PYSB 5L3GA 2DW4A 2ZT7A 4HWTA 3M4PA 2ZDIC 1KKDA 3FB6C 2DXTA 4TQFA 5KNNA 3AG1C 2QKSA 1M56B 3HY0A 3HXYA 3ZRWB 3L4GB 1ENVA 2WLIA 5IDJA 3HFVA 5B1AB 1QBZA 3NELA 4H2WA 3FJPA 3ETGA 3LUTB 5CBHA 5L3DA 4YCVA 1V55C 3ZRSA 1NJIW 4YCWA 4YRPA 4F4LA 4WF2A 1GKFA 1SRYA 4MVUA 1BIBA 2ALYA 3A74A 3PCOA 1DTOA 2QHSA 1PNKA 1X56A 4G28B 3OE7G 4RUEA 1YTFD 1ORQC 3SPGA 1OCCC 1R6NA 1FXHA 1AI7A 3VBBA 4G84A 1IXMA 2ATKC 3WG7B 2XAGA 1OCOC 1HTTA 3IALA 1N8RW 3FB8C 4YRJA 2A9HA 3UFGA 2PI4A 2QM8A 1SERA 3ABLB 2DU7A 4G85A 5C51B 2DEQA 2AHZA 3CYOA 1W2BU 1Q81W 1M1KW 3OEEG 2OTJV 4P3PA 2EIJC 3CCQV 3OW2U 4XDJA 4XU2A 4DO2A 3ERRA 5HFMA 3W7SA 1I5YA 4MS2A 4OXSA 3OMAB 3SYQA 4LNSA 1FXKA 4GX1A 2P5IA 3R07A 3V7RA 5J9PC 1CEZA 4H2VA 3SYOA 3SPIA 5B1NA 2IJKA 1TUEB 2RHSA 1B70B 3OMNB 2D3OW 4YRMA 2EJ9A 3K9AA 4U7NA 5L3BA 4UP9A 2DXUA 4P73C 1S76D 3REUA 1E1QG 1R3LC 4H2SA 4PA3A 2ITCC 1K73W 1F51A 4KR2A 1K7DA 3F7VC 1K97A 2DWEC 2Q67A 1G5HA 4P9OA 2DWDC 1B8AA 3A31A 1K3EA 5KUKA 1E1TA 3DSQA 3ICAA 1FS0G 3SPCA 1VQKV 2ZINA 2P67A 1NYQA 3NEMA 1ZWIC 5EBWC 1W66A 4H2XA 4P3OA 1R3IC 1FYFA 3P32A 3CCVV 1USYC 3GB7C 1X2HA 1JCHA 2LFSA 3HXZA 3TEGA 4CBCA 4WCEV 1MABG 1QR8A 2Q7EA 4QNHB 2ODRC 3ETDA 4K87A 1ADYA 4YRTA 1FXKC 1HC7A 1KOGA 11ASA 3A5ZA 4FIPC 4HT4A 2JEXA 4TWAA 4ZKIA 4MW8A 4R7CA 3W7UA 2DKGA 4H2UA 1WPXA 4P71C 2GSMB 2XAJA 1G51A 2IU0A 2IY5B 1Y66A 3IKMB 1Z7NA 2EJGA 1K5SA 5LGTA 1P4RA 4NCXA 3CD6V 4HAMA 3NETA 4YRIA 1YHQV 1AI4A 2Y48A 3BY6A 3QO5A 3CMEV 2ZT6A 1KECA 3AG3C 2QTOA 4WJ3M 2X7RB 1GMGA 2ZR3A 1SESA 3A0RA 3AG4B 3E8BA 3RKXA 2BOCC 3VQXA 1H4TA 2DYRB 3DGEA 4PELA 1NR7A 3ABKB 1P7BA 1FFTB 3JYCA 3W3SA 4LVLA 2W0FC 1YFTA 1EFWA 4GX5A 1OHHG 2A0LA 1KP2A 1PL0A 4KFMA 4MSWC 3G6EV 1WNLA 2Q7GA 3E8FA 4N23A 2X0LA 2ITDC 2ZDIA 4TTVA 1CP9A 2AHYA 1Q7YW 1ASZA 2J3LA 2XAFA 3EFRA 4CH3A 1WYDA 1E1OA 4P72A 1AJPA 3JD4A 2BOBC 1BHAA 2WAMA 4P9PA 5EC2C 1RIQA 5IY5C 3HRIA 5F5WA 3L2ZA 4YRQA 4I5SA 2ZXWB 1GO3F 2DZCA 2EINB 1OCRB 3ASOC 3T4ZA 3T4DA 4XTZA 3M4QA 2FTKA 2I4MA 2I4NA 5KA5A 3CCUV 2WLHA 5CBFA 2EAYA 4CS4A 2H8PC 1AROP 3PZCA 2V1DA 2AKWA 1JOYA 2NS6A 4QIWF 1VQNV 2P0LA 1J95A 2OCCB 4XDKA 4GCZA 3K04A 1K34A 5E1AC 5KA6A 2JJ1G 2JDIG 12ASA 4WFGA 1H4QA 2KB1A 3ZRXA 2RHQA 3MD0A 2X6CA 4KR3A 3V8KA 2ZD9A 1LYLA 1YITV 3AG2B 3TEHB 3RL6A 2EIMB 3FB7C 1B76A 2A8EA 2DTHA 4H02A 2ARSA 5EBLC 5C93A 3MF2A 1G5IA 2QHVA 2ZZEA 1RM1B 1K4DC 1YJNV 3P30A 3CC7V 1WU7A 2QE7G 3B77A 3OAAG 3X2QC 4P72C 5E3IA 4YREA 5CN0A 3HFZB 1F4NA 2ARUA 3K03A 3ZCCA 5B3SC 4J9ZB 5IYDO 1M57B 3HPLC 3SPHA 1VQ9V 1BMFG 1EVKA 3G1ZA 3L4GA 4P73A 1SZTA 3RKWA 3HXVA 1RPRA 1ADJA 2PI5A 3I55V 3RBZA 1H4VB 4X88A 1S3JA 2WPDG 4R6ZA 3P8VA 2WSSG 1M9NA 2Q5HA 4UUJC 3K0DA 4MTOA 3RKYA 2DJZA 2HFEC 1MSWD 3A7AA 4HVCA 2B1GA 2CJ9A 3AEIA 1SETA 2WLIB 3SYCA 4P30A 1S72V 1JVMA 3ABMC 3PJSK 1G8MA 1W0JG 1QLEC 2EIKC 4UVBA 2ZCEA 2ZZFA 3IC7A 4BW9A 1V54B 1USYA 4I9WA 4PDVA 5H9CA 1QVFU 3RVYA 2ALYB 2XTIA 2WLNA 3T2MA 4BIUA 5DN6G 4CZZA 2QA4V 3L1AA 1GM7A 4MT8A 1DF4A 3HXUA 4YP0A 3ZMUA 3I7FA 4K86A 1MOFA 1K5QA 3LSSA 4H37A 3ASNC 2M7WA 4OLFA 2DYSB 2Z3YA 3OR6C 3CMAV 1X55A 3IG2A 4YCUA 3D36A 4WI1A 3SYPA 4E2LA 1UJWB 2E1HA 4E51A 1AR1B 2YEVA 3E2EA 4P71A 5B1BB 2WLLB 1M56C 1AI6A 4DXWA 4LCUC 1KMNA 3CC4V 4MW3A 2PMEA 4LVJA 3T1CA 1H8HG 3TK1A 2W6JG 3ABUA 1AI5A 2C8MA 1H4SA 3MHSC 3VQYA 3GWOA 3OUFA 4CS3A 1MG1A 1NVPB 3UKMA 3H01A 1CPYA 1FXVA 3SYAA 5CBGA 1KD1W 1BHBA 1WQ7A 4CS2A 4YRKA 5C52B 1THZA 3K0GA 2P7TC 1NJ2A 2E5AA 3E9IA 2Y69C 4CH6A 4LBEC 2PMFA 3LSQA 4PA7A 3VOUA 3WG7C 2Q7HA 4HWRA 4J15A 1F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  4P75 C;  4YRC A;  3HY1 A;  1Z7M A;  1GGM A;  2CGH A;  1X01 A;  4H2T A;  1NJ1 A;  1EVL A;  1IL2 A;  4HWP A;  4XEO A;  1E24 A;  2E41 A;  2ZXF A;  2QHU A;  2ZNI A;  3P8Y A;  4TVA A;  4XTY A;  2IY5 A;  2DQ3 A;  1WQW A;  3CMQ A;  2DTI A;  3RF1 A;  3A32 A;  5ELO A;  2C7I A;  4P3N A;  1J5W A;  2G4C A;  5HGQ A;  1B7Y A;  1EOV A;  4DPG A;  3E9H A;  1NJ5 A;  3V8J A;  3IKL A;  4AH6 A;  3VQW A;  4ZTZ B;  4XU3 A;  2ART A;  4K88 A;  1C0A A;  4L87 A;  3REX A;  3V8L A;  1EIY B;  4TVW A;  4RQF A;  2AMC B;  2DTO A;  4YRF A;  4YRS A;  4HWO A;  4XTU A;  3V7C A;  1QF6 A;  2AKW B;  1JJC A;  3QO7 A;  1PYS A;  3TEH A;  3MF1 A;  4X5O A;  3HXX A;  5K1X A;  3HFZ A;  2RHQ B;  3A5Y A;  2E3C A;  2ZGW A;  2ZIM A;  2EWN A;  4HWS A;  2QHT A;  4YYE A;  4CH5 A;  4YDQ A;  2EJF A;  4H2Y A;  4HA8 A;  3PCO B;  4P75 A;  1HXD A;  4DQ2 A;  5ELN A;  3EFS A;  2ZZG A;  4KQE A;  1KMM A;  2FYK A;  4TVY A;  4RQE A;  1B70 A;  4ZTU B;  3BFM A;  3UH0 A;  4UP7 A;  2DVE A;  5C53 B;  3QNE A;  1NJ6 A;  4YPF A;  2J3M A;  4EX5 A;  3LC0 A;  2RHS B;  2ZTG A;  1YFS A;  4PG3 A;  1X54 A;  3NEN A;  2XGT A;  3WQZ A;  1E22 A;  4ZIB A;  4XU1 A;  1L0W A;  4XTX A;  1BBU A;  2ODR D;  3BJU A;  3RUX A;  3OD1 A;  4H2X B;  1YB3 A;  3RIR A;  3UGT A;  2ZT5 A;  4P74 A;  4UP8 A;  1BIA A;  3V7S A;  4EO4 A;  1WLE A;  4Q6G A;  2ZT8 A;  3HXW A;  4XEM A;  4YRG A;  4WJ4 A;  5K1P A;  4OP0 A;  3QO8 A;  3KFU A;  2DU5 A;  2EL9 A;  4YRL A;  2E65 A;  2DDZ A;  4TVA B;  1VQZ A;  1QE0 A;  4XU0 A;  3HTZ A;  1NYR A;  3TUP A;  1YFR A;  4CH4 A;  4XTW A;  3RAC A;  2CIM A;  2ZR2 A;  3A7R A;  4P74 C;  3RGL A;  2ZIO A;  1BBW A;  4YRO A;  1ATI A;  4UPA A;  1ASY A;  2CJA A;  1YGB A;  3P8T A;  1NNH A;  4TQD A;  4RDX A;  1B7Y B;  4YRR A;  1EQR A;  4BWA A;  1NJ8 A;  1EIY A;  4O2D A;  1N9W A;  2AMC A;  1X2G A;  2CJB A;  2ZNJ A;  2HNI A;  4XTV A;  3UGQ A;  3HRK A;  3QTC A;  2I4O A;  2DZ9 A;  3A7U A;  3VQV A;  4PHC A;  2E10 A;  4RMF A;  4Q15 A;  2DQ0 A;  2Q5I A;  4YRN A;  2I4L A;  1JJC B;  3MEY A;  1WPY A;  1PYS B;  4HWT A;  2ZT7 A;  3M4P A;  2DXT A;  4TQF A;  5KNN A;  3HY0 A;  3HXY A;  3L4G B;  3HFV A;  3NEL A;  4H2W A;  3FJP A;  4YCV A;  4YCW A;  4YRP A;  4WF2 A;  1BIB A;  1SRY A;  2ALY A;  3A74 A;  3PCO A;  2QHS A;  1X56 A;  3VBB A;  4G84 A;  1HTT A;  3IAL A;  4YRJ A;  3UFG A;  1SER A;  2DU7 A;  4G85 A;  5C51 B;  2DEQ A;  4P3P A;  4XU2 A;  3ERR A;  4LNS A;  3R07 A;  2P5I A;  3V7R A;  4H2V A;  2RHS A;  1B70 B;  4YRM A;  2EJ9 A;  4UP9 A;  2DXU A;  4P73 C;  3REU A;  4H2S A;  4KR2 A;  1G5H A;  1B8A A;  3A31 A;  1E1T A;  3DSQ A;  3ICA A;  2ZIN A;  1NYQ A;  3NEM A;  1W66 A;  4H2X A;  4P3O A;  1FYF A;  1USY C;  1X2H A;  3HXZ A;  3TEG A;  2Q7E A;  2ODR C;  4K87 A;  1ADY A;  4YRT A;  1HC7 A;  1KOG A;  11AS A;  3A5Z A;  4TWA A;  2DKG A;  4H2U A;  4P71 C;  1G51 A;  2IY5 B;  3IKM B;  1Z7N A;  2EJG A;  4NCX A;  3NET A;  4YRI A;  3QO5 A;  2ZT6 A;  4WJ3 M;  2ZR3 A;  1SES A;  3RKX A;  3VQX A;  1H4T A;  3W3S A;  1YFT A;  1EFW A;  1WNL A;  2Q7G A;  4TTV A;  1ASZ A;  2J3L A;  3EFR A;  4CH3 A;  1WYD A;  1E1O A;  4P72 A;  1RIQ A;  3HRI A;  5F5W A;  3L2Z A;  4YRQ A;  2DZC A;  4XTZ A;  3M4Q A;  2I4M A;  2I4N A;  2EAY A;  4CS4 A;  2AKW A;  2P0L A;  12AS A;  1H4Q A;  2RHQ A;  4KR3 A;  3V8K A;  1LYL A;  3TEH B;  3RL6 A;  1B76 A;  2DTH A;  4H02 A;  2ARS A;  3MF2 A;  1G5I A;  2QHV A;  2ZZE A;  1WU7 A;  4YRE A;  4P72 C;  5E3I A;  3HFZ B;  2ARU A;  3G1Z A;  3L4G A;  4P73 A;  1EVK A;  3RKW A;  3HXV A;  1ADJ A;  1H4V B;  3P8V A;  2Q5H A;  3RKY A;  2DJZ A;  3A7A A;  4HVC A;  2CJ9 A;  1SET A;  4BW9 A;  2ZCE A;  2ZZF A;  1USY A;  2ALY B;  2XTI A;  3L1A A;  3HXU A;  4YP0 A;  3I7F A;  4K86 A;  3LSS A;  4OLF A;  4YCU A;  3IG2 A;  1X55 A;  4WI1 A;  2E1H A;  4E51 A;  4P71 A;  1KMN A;  2PME A;  2C8M A;  1H4S A;  3VQY A;  4CS3 A;  1WQ7 A;  4YRK A;  5C52 B;  3E9I A;  1NJ2 A;  2E5A A;  4CH6 A;  4J15 A;  2PMF A;  3LSQ A;  2Q7H A;  3PZC A;  4HWR A;  4CS2 A; 
#chains in the Genus database with same CATH topology
 4D7T A;  2QWN B;  1F7Y A;  2E64 A;  4P75 C;  4ASU G;  3B8M A;  3M99 B;  2VQE O;  2Z5U A;  1NJ1 A;  3W7W A;  2YDE A;  2WLM A;  2P4K A;  4DRX A;  5DEC A;  1NTM H;  1URF A;  1Q43 A;  2ZXF A;  1OZ0 A;  2ZNI A;  4JAS A;  1Y6X A;  5IE9 A;  4TVA A;  1JPX A;  2DQ3 A;  1DF5 A;  2Q0A A;  4O2B A;  4DV1 O;  2QM4 A;  4FPP A;  1QHT A;  3A32 A;  5ELO A;  1ZSP A;  3RYI B;  4WFF A;  5J2U B;  2C7I A;  2QWR B;  1EN6 A;  2G4C A;  2MK3 A;  1RFY A;  3LNM B;  2QDO A;  1ROP A;  4DPG A;  5FLX N;  3E9H A;  5IYZ A;  3HKC A;  3IKL A;  1KKC A;  4AH6 A;  1NH2 B;  3CRM A;  1A32 A;  3JAR B;  3VQW A;  4TUY A;  1NU1 H;  2ART A;  2KSD A;  1V55 B;  2VRZ A;  2Q5Z A;  1C0A A;  2EUL A;  2DYR C;  1EIY B;  4UV8 A;  5GTI Z;  4RQF A;  4YRF A;  4YRS A;  4HWO A;  1OCC B;  3V7C A;  1OCO B;  4DR5 B;  4ZHQ B;  1JJC A;  3QO7 A;  1PYS A;  3TEH A;  3MF1 A;  2AGA A;  1KB9 F;  2X6B A;  5BZB A;  3ZRW A;  1YIJ V;  2FML A;  5IYB O;  1NT2 B;  3HFZ A;  3OGC C;  2RHQ B;  4FLY A;  4B08 A;  3JAL A;  1XQ8 A;  2ZIM A;  3K06 A;  4MVQ A;  2NNU A;  4PDR A;  4YYE A;  4LWS A;  2UU9 B;  2CDY A;  3JCU Z;  4HA8 A;  4YJ3 B;  1YCI A;  4DQ2 A;  5JQG A;  3MDS A;  2QM7 A;  1H38 A;  5ELN A;  2LP7 A;  2ZZG A;  4PDM A;  1KMM A;  2UXX A;  2EIM C;  4TVY A;  1AJQ A;  4B3S B;  5LA6 B;  2VWJ A;  4ZTU B;  2ETN A;  1TAE A;  2IM9 A;  5BXZ A;  3G80 A;  1BCC H;  1NJ6 A;  4EX5 A;  4JI1 B;  2RHS B;  2YEV B;  3JAT B;  1YSC A;  1YFS A;  1GK9 A;  3NEN A;  2XGT A;  2OT5 A;  5KUM A;  4DV0 B;  3N2G B;  1HR0 O;  3BVO A;  4NYK A;  1XL4 A;  3CJH B;  4WF9 V;  4XTX A;  1BBU A;  4LNU A;  4KUM A;  1XNR B;  2ODR D;  1H2G A;  5H6Q A;  4YIP A;  3BJU A;  3RUX A;  5J2T B;  4H2X B;  2DYS C;  1KU9 A;  2ZT5 A;  2GHY A;  4YY3 O;  1JFF A;  1EN4 A;  3DC6 A;  4QJF B;  1WLE A;  2IW5 A;  2ZT8 A;  4JTD B;  4XEM A;  5LGN A;  1S0V A;  1J5E B;  4TSF G;  5K1P A;  3F5W C;  4DRX B;  3C90 A;  1VQ8 V;  4OX9 O;  2JK5 C;  3KFU A;  2YS8 A;  2UXB O;  3JAW B;  4TVA B;  1QE0 A;  1GN3 A;  2DJV A;  4XU0 A;  2NR5 A;  2HJF C;  5KAI Z;  4FK5 C;  4WBN A;  1WA8 B;  1YI2 V;  1OCZ C;  2LW1 A;  2R9R B;  3MAQ A;  4IIJ A;  1SQG A;  4JF3 A;  2ZR2 A;  4P74 C;  4LFC O;  1M93 A;  4HNA A;  3KKY A;  2VQE B;  3L74 H;  4YRO A;  4UPA A;  3L72 H;  4YJ2 A;  1QVG U;  2CJA A;  1VF7 A;  1I94 O;  3TCU A;  3ZHR A;  4DR2 O;  3ZN1 A;  1TUB B;  4TQD A;  2LFR A;  4RDX A;  5B3S B;  3IAY A;  3ZRV A;  1EQR A;  3K3W A;  5IYZ B;  3ZMZ A;  3HKC B;  3MHH C;  3T1Y B;  3LDD A;  1NJ8 A;  3N2K B;  1VF5 B;  4O2D A;  4EEQ A;  4EB6 B;  1O9G A;  2HNI A;  4XTV A;  3HRK A;  2EIK B;  1QLE B;  3QTC A;  1YJ9 V;  1VQ6 V;  2I4O A;  3E83 A;  3OEH G;  5AG2 A;  3A7U A;  1OV9 A;  4RMF A;  5GON A;  3E35 A;  2DQ0 A;  1XMO O;  5B1O A;  2P6J A;  2I4L A;  2WA3 A;  1JJ2 U;  1JJC B;  3IC9 A;  4PDL A;  1PYS B;  5L3G A;  4FLW A;  5IJ0 A;  4HWT A;  3M4P A;  3FB6 C;  5KNN A;  3AG1 C;  3HXY A;  3ZRW B;  4BR6 A;  3HFV A;  3FJP A;  1MMM A;  1NJI W;  4WF2 A;  1BIB A;  3RGB A;  2ALY A;  1MNG A;  3JAL B;  2QHS A;  2CH7 A;  4G28 B;  2KG7 A;  3SPG A;  1BGY H;  5JH7 B;  1AI7 A;  3VBB A;  1IXM A;  1HTT A;  1Q3E A;  1N8R W;  3FB8 C;  3CWB H;  2DU7 A;  4EFB A;  1NTZ H;  3CYO A;  2RDC A;  1I7F A;  2Q8V A;  1NTK H;  5D5Q A;  4LNS A;  3E22 A;  2QTS A;  1FXK A;  1H2M A;  2P5I A;  3V7R A;  3J81 N;  3RYH B;  1FKA O;  1CEZ A;  4H2V A;  1TUE B;  1S5J A;  4DR6 B;  2EJ9 A;  4YRM A;  1UPG A;  4IYI A;  1D5A A;  1S76 D;  2ITC C;  4J7J A;  1K73 W;  1SQX H;  1K7D A;  3F7V C;  1K97 A;  2Q67 A;  1JMK C;  2DWD C;  3A31 A;  5KAF Z;  1FAF A;  1FS0 G;  5EBW C;  2D2C B;  4I55 A;  4OGQ B;  4P3O A;  4IL6 Z;  1R3I C;  3CCV V;  4FVM A;  2LFS A;  1R1B A;  2LJ2 A;  4QNH B;  4LNU B;  4JYA O;  2ODR C;  4K87 A;  3Q4H A;  4D7S A;  1ADY A;  4YRT A;  1VEW A;  4J41 A;  2JEX A;  1FFX B;  4ZKI A;  4RWU A;  4R7C A;  4NB5 A;  1JFF B;  2IY5 B;  1Y66 A;  1Z7N A;  4F6E A;  2YXH A;  4HAM A;  2Y48 A;  2X7R B;  1GMG A;  3A0R A;  3RKX A;  4PEL A;  3KCY A;  1HR0 B;  1KBH A;  3JYC A;  4LVL A;  3UO2 A;  4J7Z A;  1EFW A;  3DXR B;  4UCT A;  2A0L A;  1KP2 A;  4MSW C;  2Q7G A;  3E8F A;  2VS0 A;  2ITD C;  4TTV A;  1ASZ A;  2AHY A;  2J3L A;  1ZLZ A;  1WYD A;  4P72 A;  3JD4 A;  3S3X A;  2WAM A;  3CHX A;  4IIJ B;  5F5W A;  5IY5 C;  4YY3 B;  2UUA B;  5C8Y A;  3HRI A;  3L2Z A;  2DMX A;  2H3O A;  4ZI7 A;  1VAR A;  4DR3 O;  2DZC A;  5E79 Z;  4YJ2 B;  3T4Z A;  2M6Y A;  2WLH A;  4CS4 A;  2H8P C;  4OX9 B;  1YXB A;  5KMG A;  2UXB B;  3THO A;  3HKD A;  4GCZ A;  1Z5W A;  1AP5 A;  3AK3 A;  2OYQ A;  2ZD9 A;  2DE0 X;  2VWK A;  2JVD A;  2QE7 G;  3X2Q C;  5E3I A;  2UXD B;  4P73 A;  1BMF G;  1SZT A;  3HXV A;  1XI1 A;  1ADJ A;  1I94 B;  3I55 V;  2WPD G;  4DR2 B;  1SQQ H;  2WSS G;  4UUJ C;  3K0D A;  5B5E Z;  5IJ0 B;  4H0L B;  2F93 B;  3AEI A;  1SET A;  1S72 V;  3PJS K;  1W0J G;  4UVB A;  4BW9 A;  1BE3 H;  1V54 B;  4I9W A;  5H9C A;  4JI4 O;  3QF7 A;  3RVY A;  1QVF U;  2ALY B;  4O4J A;  4X1Y B;  3HXU A;  2KG7 B;  4J7K A;  3I7F A;  3CX5 F;  1MOF A;  2Z3Y A;  3OR6 C;  4YCU A;  4E51 A;  1SA0 B;  4P71 A;  1XMO B;  3B2E E;  5JJJ B;  4O4I B;  4MW3 A;  2PME A;  1H8H G;  3ABU A;  1H4S A;  3MHS C;  3K58 A;  1NVP B;  1WQ7 A;  3A0B Z;  1THZ A;  3K0G A;  2P7T C;  4CH6 A;  2ZKO A;  3E9I A;  3UO3 A;  3WG7 C;  3OMI B;  3ABL C;  4YRC A;  4WFH A;  4O4H B;  4DV6 O;  4GT1 A;  4I9Q A;  4WFE A;  2CGH A;  2QJ1 A;  2OIE A;  4JZ2 A;  4F6R A;  2ZQM A;  1EVL A;  5IT9 N;  2EIL B;  1IL2 A;  4U7O A;  3TET A;  4B3M O;  4FZ0 A;  2Q68 A;  2QHU A;  4JI0 O;  3P8Y A;  1YJW V;  4MTG A;  4YIO A;  3W7T A;  4TOI A;  1KQS U;  4G2K A;  1COW G;  2Q0O C;  5BMV A;  4K8Z A;  1JJO A;  2EBO A;  1VQO V;  2DTI A;  3S3W A;  5LXT A;  2UXC O;  3RF1 A;  1Y76 B;  1W0K G;  3OTF A;  2JJ2 G;  3CRC A;  3JD3 A;  3J80 N;  2YI9 A;  5F2V O;  3RVZ A;  5LMU O;  1VMG A;  4X1I B;  1MSD A;  1EM1 A;  3O9O A;  3C3S A;  4KP4 A;  5LHI A;  4JYA B;  2CTQ A;  4UVA A;  2P90 A;  3OD4 A;  3UCS C;  2B1I A;  5DED A;  3W7X A;  4ZTZ B;  4X20 A;  4MVM A;  4XU3 A;  5FPO A;  1Y4M A;  5C8Y B;  4ZI7 B;  4K88 A;  4L87 A;  3REX A;  4U3J B;  1SZX A;  3ABK C;  4MVS A;  2OTL V;  4TVW A;  4PI2 A;  2XAQ A;  2DOS A;  4XTU A;  2IJI A;  1QF6 A;  3OFN G;  4RAI A;  1I5X A;  1AVM A;  2BSK A;  1NH2 D;  1Z2G A;  1VQ5 V;  4JPR A;  1NZ6 A;  4JI5 O;  4X5O A;  1EN5 A;  2EIJ B;  4GZR B;  3HXX A;  3EHB B;  1CXZ B;  4BIZ A;  5HFL A;  3SDL A;  5LMN O;  3G4S V;  1YTF B;  2IH1 C;  1IBM O;  2EJR A;  2YID A;  5EZY A;  2EJ7 A;  4YDQ A;  4DR3 B;  4H2Y A;  5FL7 G;  3FYI B;  2OCC C;  3CCL V;  4R8C A;  3EFS A;  4WFB V;  5LYJ A;  1N0J A;  4X65 B;  3OGI B;  1PKX A;  2Q6A A;  4LF5 O;  5LHH A;  4B7K A;  3SJQ C;  4JYC A;  4LF8 O;  4PD4 F;  1RM1 C;  1XMQ B;  4RQE A;  1NR1 A;  4JI3 O;  1B70 A;  1GM9 A;  5B1A C;  4O4J B;  3BFM A;  3ZS8 C;  3UH0 A;  2DVE A;  1V9P A;  3ZN0 A;  2OWO A;  1YZB A;  4GLX A;  4HZ3 A;  3SJA C;  1QR9 A;  2J3M A;  5KLV H;  3LC0 A;  5EBM C;  1E1R G;  2JGD A;  4I4T A;  2V4D A;  4PG3 A;  3BAA A;  1XNQ O;  2HR3 A;  4UCS A;  1X54 A;  2HHH O;  2NLJ C;  5GTH Z;  4LVI A;  4QE9 A;  3IJ4 A;  1RSO A;  3LNN A;  2BCC H;  3JAK B;  4K0K O;  2R9I A;  4JI4 B;  1I0H A;  4FFB A;  2K1E A;  2Z0A A;  5JCO A;  4P74 A;  1WB8 A;  5B1B C;  1L8D A;  4C7U A;  1FPO A;  1GTO A;  4EO4 A;  2LQT A;  4Q6G A;  4F6R B;  3HXW A;  3BEH A;  4GX0 A;  5KHI A;  4K3A A;  3ZHT A;  2C2A A;  1Y74 A;  2CGN A;  2W6I G;  1MZF A;  3QO8 A;  2XOK G;  4DUY O;  3CCR V;  4YXW G;  4JI8 O;  2EL9 A;  4YRL A;  1EFR G;  5CMU A;  2DDZ A;  5BR8 B;  1VQZ A;  2QWP B;  2XND G;  4G27 B;  5CA1 A;  3L70 H;  2EX3 A;  5BMV B;  1VQ7 V;  5LXT B;  4DV6 B;  3A7R A;  3RGL A;  3RN4 A;  1BBW A;  3JAS A;  1ATI A;  3UT5 A;  1B04 A;  3P8T A;  4A5U B;  2KKW A;  3CCM V;  4B3M B;  5A9G A;  3NXS A;  2JRI A;  1KYO F;  5IYC O;  4JI0 B;  4PA9 A;  1EZJ A;  2YIC A;  4IHJ B;  1M90 W;  5EK0 A;  2AMC A;  2HVJ C;  4JYB A;  3I5D A;  1TGO A;  1N33 O;  4NXN B;  3UGQ A;  4B3R O;  5H5N A;  1GN2 A;  4H33 A;  4MTX A;  3RW0 A;  1AIL A;  2Q5I A;  4YRN A;  2RCV A;  1XOU A;  2F66 C;  4J9Y B;  1WPY A;  2DW4 A;  2ZDI C;  5LMU B;  4DV4 O;  4KHP O;  1S5L Z;  4TQF A;  2DXT A;  4LF9 O;  2QKS A;  1M56 B;  3BA8 A;  3TJT A;  1ENV A;  5IDJ A;  1QBZ A;  4H2W A;  3LUT B;  4GKJ O;  5CBH A;  1V55 C;  4YRP A;  2MW2 B;  3PCO A;  4X64 O;  1YF2 A;  1US6 A;  4X1K A;  1X56 A;  2Y4T A;  5ITZ A;  4RUE A;  1OCC C;  1R6N A;  4JZG A;  3OTO O;  1OCO C;  4X66 O;  2LGQ A;  2QM8 A;  4X9Q A;  1SER A;  2ARH A;  2DEQ A;  1Q81 W;  1W2B U;  3OEE G;  2OTJ V;  5LYJ B;  4DO2 A;  1I5Y A;  3SYQ A;  4GX1 A;  4JI5 B;  3R07 A;  3K59 A;  5J9P C;  4PHZ A;  5LMN B;  3OMN B;  1B70 B;  4AI8 A;  3N27 A;  2YXL A;  1IBM B;  5L3B A;  2DXU A;  2AW9 A;  1R3L C;  4H2S A;  5JJN B;  2DWE C;  4LF6 O;  4O2A A;  5LOV B;  1T5E A;  1H2K A;  1GH6 A;  4FLT A;  3DSQ A;  1VQK V;  3U11 A;  1W66 A;  2DN9 A;  2N04 A;  1AP6 A;  1FYF A;  3P32 A;  3GB7 C;  4TV9 A;  4YHH O;  1X2H A;  4LF5 B;  3H1K H;  5EIB C;  3ETD A;  2GV9 A;  4LF8 B;  5FPR A;  3H1I H;  4JI3 B;  2PY5 A;  3A5Z A;  4FFB B;  3A0H Z;  4MW8 A;  2P22 C;  3H1J H;  2GSM B;  1AR5 A;  2XAJ A;  2R72 A;  2YI8 A;  3IKM B;  3CRQ A;  2EJG A;  4NCX A;  1P4R A;  3CD6 V;  3BAB A;  3QO5 A;  2QTO A;  2YIB A;  4WJ3 M;  2PYL A;  1RP3 B;  3AG4 B;  3VQX A;  2YC0 A;  4I50 A;  2HHH B;  3ZBH A;  4O2B B;  5KHG A;  4OPA A;  4NXM O;  2GTA A;  2W0F C;  1YFT A;  4K0K B;  4KFM A;  5CA1 B;  3G6E V;  1WJZ A;  2UUC O;  1CP9 A;  1L0N H;  3K9S A;  1WPB A;  2YIB D;  1JA8 A;  3EFR A;  1RIQ A;  3WB2 A;  3WB1 A;  4I5S A;  2ZXW B;  3JAS B;  5TIS Z;  1GO3 F;  3UT5 B;  4B3T O;  2EIN B;  1X59 A;  4TUY B;  4L8J A;  3T4D A;  3SJC C;  2FTK A;  2I4M A;  5KA5 A;  5CBF A;  4JI6 O;  1ARO P;  4JI8 B;  2P0L A;  4DV1 B;  1J95 A;  2RQ6 A;  5E1A C;  1XHZ A;  4FM0 A;  12AS A;  1H4Q A;  3K5N A;  3V8K A;  1LYL A;  3AG2 B;  3TEH B;  3AK1 A;  3FB7 C;  1B76 A;  2OCH A;  2A8E A;  4H02 A;  2ARS A;  5EBL C;  3BCC H;  1P49 A;  1K4D C;  1WU7 A;  4YRE A;  3EVK A;  5FNV A;  5KX5 A;  3HFZ B;  3B40 A;  4GKK O;  5B3S C;  3L4G A;  1M57 B;  5LP6 C;  1VQ9 V;  4X88 A;  1S3J A;  4FLZ A;  3GWK C;  3RKY A;  1KUQ A;  2DJZ A;  2HFE C;  3A7A A;  4LWS B;  4W4K A;  4DYL A;  2EIK C;  1QLE C;  5JQG B;  1USY A;  2LO1 A;  2CGO A;  3L1A A;  2K9P A;  1GM7 A;  1DF4 A;  1N33 B;  4B3R B;  1IVS A;  2FYU H;  4H37 A;  3CMA V;  3IG2 A;  1X55 A;  3SYP A;  2E1H A;  1AI6 A;  3CC4 V;  2A7W A;  4LH7 A;  3T1C A;  1HW7 A;  5EYP A;  2PF4 E;  2PYJ A;  1LUV A;  4DV4 B;  2C8M A;  1TVK A;  2GDS A;  3VQY A;  1MG1 A;  1CPY A;  1FXV A;  4CS2 A;  4E4E A;  5C52 B;  4GKJ B;  2ODM A;  2Y69 C;  4LBE C;  3LSQ A;  4X64 B;  3CCJ V;  4DR1 O;  4OPH A;  3HKB A;  4O2A B;  3OTO B;  4X66 B;  1Z7M A;  1ZUQ A;  3D8C A;  1X01 A;  2F43 G;  4QPJ A;  4JTC B;  1NVP D;  3HB3 B;  3DTU B;  4XEO A;  1E24 A;  2V7Q G;  2QWO B;  1H2N A;  2IJJ A;  1WP8 A;  4XTY A;  3ETE A;  2YUA A;  2Q69 A;  1HWY A;  5LHG A;  4DV7 O;  3CMQ A;  2X6A A;  3FYE B;  3FD9 A;  4GX2 A;  4LF6 B;  5LL6 Y;  1BT8 A;  2Q4P A;  4WBN B;  3ZX6 A;  1P7G A;  2HG5 C;  4P3N A;  3L73 H;  1KP3 A;  2EZP A;  3F5T A;  3UM7 A;  4DR7 O;  1B7Y A;  1EOV A;  1NBM G;  3R65 A;  4YHH B;  4HNA B;  4X8A A;  1Q82 W;  2WLK A;  2YSU B;  3FX7 A;  3K79 A;  4FM1 A;  1ZAU A;  5KHK A;  1Q6H A;  3C3T A;  5JVD A;  3ZMS A;  4RO2 A;  2WWW A;  2N05 A;  1JR9 A;  4DUZ O;  3EFF K;  4QE7 A;  1QLN A;  3APO A;  4LFC B;  4NXM B;  2IJH A;  3ZED A;  5GON B;  4CC6 A;  5K1X A;  1HNX O;  3A5Y A;  1OJH A;  1R73 A;  1N36 O;  2ZGW A;  1K92 A;  5IWA O;  3M7M X;  1FD9 A;  2EWN A;  4EFE A;  4JAU A;  4HWS A;  2QHT A;  3AG7 A;  2P4V A;  1MA1 A;  3OM3 B;  2N74 A;  5KX5 B;  3BPZ A;  4P75 A;  3FAV A;  1QQC A;  2CH7 B;  1BZK A;  4N21 A;  3RWR D;  1Q5O A;  3ABT A;  4KQE A;  1VQ4 V;  3QVN A;  2FYK A;  1IX9 A;  3CB2 A;  2VQF O;  2XAH A;  1VIB A;  3OR7 C;  3G6B A;  2QKC A;  1N32 O;  2WLL A;  3SR2 C;  4UP7 A;  3L71 H;  5C53 B;  4P2Z A;  5GW7 A;  3E22 B;  1FXK B;  3QNE A;  4MTF A;  3SPJ A;  1HDJ A;  4YPF A;  1Q90 D;  4J80 A;  5B66 Z;  4GKK B;  2ZTG A;  2BTQ A;  2GUZ A;  4TT3 G;  2H94 A;  3WFV A;  4JAV A;  1AR4 A;  3D3I A;  3ZMV A;  3WQZ A;  1GRJ A;  1YEW A;  1IDS A;  1V54 C;  3RYC A;  2YXY A;  3G67 A;  3AG3 B;  4PA6 A;  2P5O A;  1L0W A;  1M4U A;  2HP8 A;  1S77 D;  1K8A W;  4DK0 A;  2ZE6 A;  4ICG A;  4I55 B;  5LBQ A;  3OD1 A;  3RIR A;  2IU3 A;  1P84 F;  3UGT A;  4UP8 A;  3K08 A;  3CPW U;  2XAS A;  3Q4H B;  3STL C;  3V7S A;  1BL8 A;  3JSL A;  4LR3 A;  4WJ4 A;  2QGN A;  1O9H A;  1QCE A;  3RFR A;  4UXN A;  1R3J C;  3CCE V;  2DU5 A;  1U96 A;  3ASO B;  2E65 A;  4DV3 O;  4DR4 O;  4FMT A;  1G4Y B;  4H13 B;  1VQP V;  4FJC C;  4LF7 O;  3TUP A;  1XL6 A;  1S5H C;  4ZOL A;  4XTW A;  5J2U A;  4DR1 B;  4HYO A;  2BTO A;  4DV5 O;  2CIM A;  2EIL C;  4AQY O;  3ML0 A;  4H44 B;  4UB6 Z;  3H1L H;  5BY1 A;  1VQL V;  3CCS V;  3A2F A;  3E8G A;  3LDE A;  4KL1 A;  3ZMT A;  2CTW A;  3E89 A;  1NQT A;  4UV9 A;  3JAR A;  3CE2 A;  4X89 A;  1B7Y B;  3ETQ A;  4YRR A;  3KG2 A;  1N4C A;  2CK3 G;  2ZE7 A;  4PJ0 Z;  1EIY A;  4PI0 A;  1HP8 A;  4FLV A;  1X2G A;  4DV7 B;  2CJB A;  2ZNJ A;  3TXS A;  5KMG B;  3ABM B;  4MVO A;  2A79 B;  3HKD B;  3CXC U;  2E74 B;  3IFX A;  5JVD B;  2DZ9 A;  4QGP A;  2ZT9 B;  2JIZ G;  3ZHU A;  3JD0 A;  2E10 A;  1Q6U A;  1Q86 W;  4Q15 A;  3STZ C;  3P3N A;  4B3S O;  2HLD G;  2E5L O;  2WA4 A;  4Q20 A;  5L3F A;  3JD1 A;  3ASN B;  1FJG O;  1OCR C;  2QR4 A;  4DR7 B;  1KKD A;  2WLI A;  1WAZ A;  3CRA A;  5B1A B;  3NEL A;  3H1H H;  1DK1 A;  4JI1 O;  1MZE A;  4YCV A;  4YCW A;  2L35 A;  4YJ3 A;  1DTO A;  2O57 A;  1ORQ C;  1FXH A;  4DV0 O;  3EXA A;  4G84 A;  2ATK C;  2XAG A;  3IAL A;  2A9H A;  2PI4 A;  4G85 A;  5C51 B;  3FAV B;  4DUZ B;  3T1H O;  3APQ A;  4Z1V A;  2EIJ C;  2F4V O;  4OXS A;  3LSU A;  1PM9 A;  3SYO A;  1WP7 A;  2IJK A;  1HNX B;  2RHS A;  1Z5V A;  3JAT A;  3K9A A;  4IGG A;  4UP9 A;  4P73 C;  5IWA B;  1E1Q G;  4X62 O;  1WB7 A;  3H9V A;  4HBN A;  4KR2 A;  1VF6 C;  5EIB D;  3N2G A;  3TXQ A;  1N0N A;  1G5H A;  3CJH A;  5KUK A;  3SPC A;  1ZWI C;  4H2X A;  3RYC B;  2IBZ H;  1JCH A;  3HXZ A;  3DC5 A;  4CBC A;  1MAB G;  1QR8 A;  2VQF B;  4DV2 O;  4O4L A;  1GAX A;  1W59 A;  1IBL O;  1N32 B;  2OIG A;  1VP7 A;  1BQ0 A;  4HT4 A;  1B3Q A;  1YDX A;  3W7U A;  4P71 C;  5D5P A;  1LR1 A;  5LGT A;  4J42 A;  3JAW A;  2UUB O;  1ZX3 A;  4YRI A;  4FM2 A;  2ZT6 A;  1KEC A;  3T1Y O;  1SES A;  3E8B A;  1H4T A;  2DYR B;  3DGE A;  2B9Z A;  1WA8 A;  1NR7 A;  3HKE A;  1FFT B;  1IUR A;  4K8X A;  4DK1 A;  5CB4 A;  1PL0 A;  1WNL A;  1HNW O;  1XBL A;  2GBO A;  4ZOL B;  1ZL8 A;  4BIO A;  5IJ9 A;  2BE3 A;  1Y67 A;  1E1O A;  1AJP A;  2BOB C;  1BHA A;  1TUB A;  2Q73 A;  4P9P A;  5EC2 C;  4YRQ A;  1D5N A;  5LP6 A;  3K5M A;  3L75 H;  4W4L A;  3K5L A;  1GN4 A;  3M4Q A;  3CCU V;  4X20 B;  4D6T H;  3N2K A;  2PUS A;  2QKA A;  4EB6 A;  2V1D A;  2AKW A;  2UXC B;  2NS6 A;  4DW1 A;  4QIW F;  4DV3 B;  4DR4 B;  3K04 A;  1K34 A;  5KA6 A;  2JJ1 G;  2JDI G;  4WFG A;  2KB1 A;  3ZRX A;  4LF7 B;  3MD0 A;  4UCV A;  2X6C A;  4KR3 A;  4LF4 O;  2BSK B;  2EIM B;  1PL4 A;  4TV8 A;  3MF2 A;  1G5I A;  2QHV A;  2ZZE A;  4DV5 B;  3P30 A;  3B77 A;  3OAA G;  4AQY B;  4IYH A;  5CN0 A;  1DGS A;  1L0L H;  3SPH A;  1RPR A;  2PI5 A;  2ZE5 A;  3RBZ A;  4R6Z A;  3P8V A;  5EZY B;  4DR6 O;  1M9N A;  2Q5H A;  4MTO A;  1MSW D;  2QWQ B;  2B1G A;  3SYC A;  2WLI B;  4P30 A;  5JH7 A;  4PDV A;  1N34 O;  1ZTE A;  2WLN A;  3T2M A;  4MT8 A;  3CEI A;  2XUM A;  1LUW A;  4K86 A;  3CXH F;  1K5Q A;  3LSS A;  3U10 A;  2DYS B;  4JAA A;  1UJW B;  1UFI A;  3RYH A;  2E5L B;  1M56 C;  1BSM A;  4PV1 B;  2R9A A;  1FJG B;  4LVJ A;  1PPJ H;  4UCR A;  3GWO A;  4CS3 A;  2JGD B;  3WB0 A;  4I4T B;  3H01 A;  5CBG A;  1BHB A;  2F23 A;  2FL4 A;  3BFR A;  2E5A A;  3RYF A;  2PMF A;  2Q7H A;  3PZC A;  1F4M A;  1RSO B;  3D3Q A;  3F7Y C;  5L3C A;  1QU7 A;  4R50 A;  3JCZ A;  1NI8 A;  3HY1 A;  1OCZ B;  3MQZ A;  1GGM A;  4K35 A;  1F23 A;  2ZE8 A;  3A8T A;  2XT9 A;  4H2T A;  4LFA O;  1AB3 A;  3D36 C;  3T1H B;  4ZBM A;  2QEX V;  4LFB O;  4HWP A;  1H2L A;  3AK2 A;  1FFX A;  2E41 A;  2F4V B;  1PNL A;  1EBO A;  2UUA O;  2AXT Z;  4O4L B;  2IY5 A;  1HNZ O;  1XNQ B;  1Y74 B;  1WQW A;  2L6L A;  2Q9L A;  4X62 B;  1IZ3 A;  4EKW A;  4Z1M G;  3E86 A;  1RPO A;  3JAM N;  3JD2 A;  1G1X B;  1XRE A;  2HVK C;  3DXR A;  1L1F A;  1VQM V;  1J5W A;  2WLJ A;  5HGQ A;  3HKE B;  1U97 A;  1PD3 A;  4DV2 B;  1NJ5 A;  5JCO C;  5CB4 B;  2CAZ C;  3G71 V;  3V8J A;  2UXD O;  2Y0I A;  1IBL B;  1XDC A;  2HEP A;  1ZL8 B;  5IJ9 B;  3AG1 B;  2UXN A;  4DUY B;  3P3P A;  5LP6 B;  3AG4 C;  5L3E A;  3V8L A;  2UUB B;  1R6T A;  1X4T A;  2AMC B;  2DTO A;  3K57 A;  1I08 A;  2F95 B;  2AKW B;  4BAY A;  3L9D A;  1JQ0 A;  3CSX A;  3J7A U;  3FKS G;  4JV5 O;  3CC2 V;  1HNW B;  2E3C A;  3U0Z A;  2NN4 A;  3ZHQ A;  2ZXW C;  4TV8 B;  2JS5 A;  2ZM6 O;  2EIN C;  3PN1 A;  4QPK A;  4CH5 A;  1K4C C;  1SKV A;  3HR0 A;  1WN7 A;  4MVR A;  1EZV H;  1SS3 A;  2EJF A;  5KHH A;  1XHX A;  3PCO B;  2GTS A;  1HXD A;  1R6K A;  4LP8 A;  1K9M W;  4X1K B;  3O65 A;  5ITZ B;  3KCX A;  4XBF A;  3ZHS A;  4KXR A;  4X1Y A;  4TWK A;  3AG2 C;  1IBK O;  4XDL A;  2Y69 B;  3B8N A;  1D2D A;  4LVK A;  4FLU A;  2PZS A;  4JGS A;  1SA0 A;  4LF4 B;  3RT3 C;  5CA3 A;  1BQZ A;  1M57 C;  4WFA V;  4O4I A;  4KHP B;  4LF9 B;  1SC5 B;  2XTA A;  3NR7 A;  2AZ2 A;  1DLB A;  4GYC B;  3OUS A;  1SF9 A;  2FB5 A;  1K33 A;  3CS5 A;  4FLX A;  3ICX A;  1E22 A;  3TGU H;  1E79 G;  4LVM A;  1XUQ A;  4FFK A;  1PP9 H;  2EZO A;  4ZIB A;  4XU1 A;  4O4H A;  1WNS A;  2A3Q A;  1SQV H;  3RYF B;  2CTP A;  1N34 B;  5H6R A;  4ABM A;  4AHC A;  1YB3 A;  4TV9 B;  4BW5 A;  3E8H A;  5KHJ A;  3IGA C;  2CTR A;  1BIA A;  4JTA B;  4YRG A;  1JX9 A;  1TA8 A;  5IY5 B;  3B4S A;  1LNQ A;  4OP0 A;  1B6Q A;  3LDC A;  1G6U A;  1KMI Z;  1KC8 W;  1PNM A;  2JEU A;  1Y76 A;  3HTZ A;  1R3K C;  4MVZ A;  4PA4 A;  1NYR A;  4I50 B;  4NR1 A;  4CH4 A;  1YFR A;  2CE4 A;  4UVC A;  3QG5 A;  3RAC A;  3ZJZ A;  1M5I A;  2HKO A;  2ZIO A;  4X1I A;  1SQF A;  1ASY A;  3FB5 C;  4LFA B;  3X2Q B;  1YGB A;  4LFB B;  1NNH A;  2IH3 C;  1GM8 A;  3I56 V;  4JI2 O;  5LGU A;  2R70 A;  2QSA A;  4BWA A;  4CC5 A;  2B5U A;  5EC1 C;  1HNZ B;  4U3J A;  4RUF A;  2Y0P A;  1N9W A;  3ZIA G;  4Z2W A;  4FZ1 A;  2ILM A;  3CP1 A;  4JYY A;  4X65 O;  2PGG A;  5CA0 A;  3VQV A;  4PHC A;  1AJN A;  4LC1 A;  5DM6 V;  1H8E G;  2UUC B;  4I7Z B;  1NKD A;  1XMQ O;  2XHB A;  4J10 A;  4NTX A;  2ADP A;  3MEY A;  2ZT7 A;  5FNV B;  4NTY A;  3HY0 A;  2JS3 A;  3L4G B;  4B3T B;  4JI7 O;  3ETG A;  5L3D A;  3ZRS A;  4F4L A;  1GKF A;  1SRY A;  4MVU A;  4JI6 B;  3A74 A;  1PNK A;  1VF6 A;  3OE7 G;  1YTF D;  3KZI Z;  2A06 H;  5JWP A;  2CUG A;  3WG7 B;  4YRJ A;  3UFG A;  4B7E A;  3ABL B;  2AHZ A;  1M1K W;  4P3P A;  3CCQ V;  3OW2 U;  4I0X A;  4XDJ A;  4XU2 A;  3ERR A;  5HFM A;  3W7S A;  4MS2 A;  3OMA B;  1XEQ A;  3B09 A;  4JV5 B;  3SPI A;  5B1N A;  1BS3 A;  2D3O W;  3SGI A;  4U7N A;  5EYP B;  3REU A;  1TVK B;  3M8A A;  3R66 A;  2ZM6 B;  4UFZ A;  4PA3 A;  1F51 A;  2RNB A;  4P9O A;  3JAK A;  5BR8 O;  1B8A A;  2LW7 A;  1K3E A;  5A2Q N;  1E1T A;  3SJB C;  3ICA A;  2ZIN A;  2P67 A;  1NYQ A;  3NEM A;  1YVW A;  2PTM A;  3JSN A;  1B06 A;  3HKB B;  1USY C;  3TEG A;  5JJE B;  4WCE V;  2Q7E A;  1IBK B;  4J11 A;  1GN6 A;  4UCU A;  1FXK C;  1HC7 A;  4LH6 A;  1KOG A;  11AS A;  4FIP C;  4TWA A;  2DKG A;  4H2U A;  1WPX A;  4UB8 Z;  4NTW A;  1G51 A;  2IU0 A;  1K5S A;  3NET A;  1YHQ V;  1AI4 A;  3BY6 A;  3CRR A;  4DW0 A;  3CME V;  1Q8I A;  3RYI A;  3AG3 C;  2ZR3 A;  2BOC C;  2ADQ B;  4DR5 O;  3ABK B;  1P7B A;  1IXB A;  3W3S A;  4NXN O;  3GVM A;  4GX5 A;  1OHH G;  2E75 B;  4N23 A;  3FFQ A;  2X0L A;  2ZDI A;  1Q7Y W;  2XAF A;  1XIL A;  4CH3 A;  2UU9 O;  3UQ8 A;  1OCR B;  4IT5 A;  3ASO C;  4XTZ A;  2I4N A;  4IHJ A;  2EAY A;  2P06 A;  4ZHQ A;  1JOY A;  2AZ0 A;  1VQN V;  4UCO A;  3BA9 A;  2OCC B;  3K5O A;  4XDK A;  2Y4U A;  4U3F H;  2RHQ A;  4GUN A;  1YIT V;  3RL6 A;  2DTH A;  1QNM A;  2F1M A;  2E76 B;  5C93 A;  1RM1 B;  1YJN V;  3CC7 V;  4P72 C;  4NVP A;  5CA0 B;  1F4N A;  4AIL C;  3K03 A;  2ARU A;  3ZCC A;  4J9Z B;  5IYD O;  3HPL C;  3G1Z A;  1EVK A;  2RN9 A;  3RKW A;  1H4V B;  4NKG B;  1SQB H;  1NS1 A;  3WU2 Z;  2RJZ A;  4JI2 B;  4HVC A;  5H2F Z;  3OT7 A;  3BHP A;  2CJ9 A;  1JVM A;  3ABM C;  1G8M A;  1XNR O;  2ZCE A;  2RMK B;  3IC7 A;  5LA6 A;  2ZZF A;  2XTI A;  4BIU A;  5DN6 G;  4CZZ A;  2QA4 V;  4YP0 A;  1PV0 A;  3ZMU A;  4OLF A;  3ASN C;  2M7W A;  2YIA A;  3D36 A;  4WI1 A;  4E2L A;  3BRC A;  2JGU A;  1AR1 B;  2YEV A;  3E2E A;  5B1B B;  2WLL B;  1N36 B;  1J5E O;  1KMN A;  4DXW A;  4LCU C;  2HJD A;  3TK1 A;  4I0X B;  1H2S B;  2W6J G;  3ZHV A;  1FYJ A;  1AI5 A;  2KQX A;  3OUF A;  2BTQ B;  2GUZ B;  3UKM A;  4JI7 B;  1KD1 W;  3SYA A;  4YRK A;  5LOV A;  1NJ2 A;  1SQP H;  4J15 A;  4PA7 A;  3VOU A;  5J2T A;  2LGW A;  2W0X A;  4HWR A;  2FKX A;  1Q6I A;  2G38 A; 
#chains in the Genus database with same CATH homology
 3CCJ V;  3OMI B;  2E64 A;  3ABL C;  4P75 C;  4YRC A;  3F7Y C;  4WFH A;  5L3C A;  4ASU G;  4GT1 A;  3JCZ A;  4R50 A;  3B8M A;  3M99 B;  4WFE A;  3HY1 A;  1OCZ B;  1Z7M A;  3MQZ A;  2Z5U A;  1GGM A;  2CGH A;  1F23 A;  1X01 A;  4H2T A;  2ZQM A;  1NJ1 A;  2F43 G;  3W7W A;  1EVL A;  4QPJ A;  2EIL B;  2WLM A;  4ZBM A;  4JTC B;  2QEX V;  1NVP D;  4HWP A;  4U7O A;  3HB3 B;  3DTU B;  3TET A;  1IL2 A;  2Q68 A;  4XEO A;  1E24 A;  2V7Q G;  2E41 A;  2ZXF A;  1OZ0 A;  2IJJ A;  2QHU A;  1PNL A;  2ZNI A;  4JAS A;  1EBO A;  3P8Y A;  1YJW V;  4MTG A;  4TVA A;  4XTY A;  2IY5 A;  3W7T A;  3ETE A;  2Q69 A;  1JPX A;  2DQ3 A;  1KQS U;  4G2K A;  1COW G;  1WQW A;  1HWY A;  5LHG A;  3CMQ A;  2X6A A;  2EBO A;  1VQO V;  4EKW A;  3FYE B;  1DF5 A;  2DTI A;  3RF1 A;  4GX2 A;  4Z1M G;  3E86 A;  1W0K G;  1RPO A;  2JJ2 G;  3JD2 A;  4FPP A;  3JD3 A;  3A32 A;  2HVK C;  5ELO A;  4WFF A;  1L1F A;  2C7I A;  2HG5 C;  1VQM V;  4P3N A;  1KP3 A;  2EZP A;  1J5W A;  2G4C A;  2WLJ A;  5HGQ A;  2MK3 A;  3UM7 A;  3LNM B;  3RVZ A;  1B7Y A;  1EOV A;  1ROP A;  1NBM G;  3R65 A;  4DPG A;  4X8A A;  1Q82 W;  3E9H A;  2WLK A;  1PD3 A;  2YSU B;  1NJ5 A;  4KP4 A;  5LHI A;  3K79 A;  3G71 V;  3IKL A;  3V8J A;  4UVA A;  4AH6 A;  1NH2 B;  2P90 A;  3VQW A;  3AG1 B;  2UXN A;  2B1I A;  3W7X A;  4ZTZ B;  4MVM A;  4XU3 A;  2ART A;  1V55 B;  1Y4M A;  3AG4 C;  4K88 A;  1C0A A;  4L87 A;  5L3E A;  3REX A;  2DYR C;  3V8L A;  3ZMS A;  1EIY B;  4UV8 A;  3ABK C;  4MVS A;  4RO2 A;  2WWW A;  2OTL V;  4TVW A;  4RQF A;  2AMC B;  2DTO A;  4YRF A;  4YRS A;  4HWO A;  2XAQ A;  1OCC B;  4XTU A;  3EFF K;  2IJI A;  3V7C A;  3OFN G;  4RAI A;  1QF6 A;  1OCO B;  4QE7 A;  2AKW B;  4BAY A;  1QLN A;  1I5X A;  3QO7 A;  1JJC A;  1PYS A;  3TEH A;  1JQ0 A;  1NH2 D;  1VQ5 V;  3MF1 A;  4JPR A;  2IJH A;  2X6B A;  5BZB A;  3ZRW A;  1YIJ V;  3FKS G;  4X5O A;  3HXX A;  2EIJ B;  5IYB O;  5K1X A;  3CC2 V;  3EHB B;  3HFZ A;  3OGC C;  4BIZ A;  2RHQ B;  5HFL A;  3A5Y A;  3G4S V;  2E3C A;  1YTF B;  1R73 A;  2IH1 C;  2ZXW C;  2ZGW A;  2EJR A;  1K92 A;  2ZIM A;  2EIN C;  3K06 A;  4MVQ A;  2EWN A;  2NNU A;  4QPK A;  4PDR A;  4JAU A;  4HWS A;  2QHT A;  4YYE A;  3OM3 B;  4CH5 A;  1K4C C;  4YDQ A;  4MVR A;  2EJF A;  4H2Y A;  4HA8 A;  5FL7 G;  3FYI B;  3PCO B;  4P75 A;  1HXD A;  4DQ2 A;  1R6K A;  2OCC C;  2QM7 A;  4LP8 A;  3CCL V;  1K9M W;  4R8C A;  1H38 A;  5ELN A;  2LP7 A;  3EFS A;  4XBF A;  4WFB V;  4N21 A;  3ABT A;  2ZZG A;  4KQE A;  4PDM A;  1VQ4 V;  4TWK A;  1PKX A;  1KMM A;  2FYK A;  2Q6A A;  3AG2 C;  5LHH A;  2UXX A;  2EIM C;  2XAH A;  2Y69 B;  4XDL A;  3B8N A;  3SJQ C;  4TVY A;  4LVK A;  1AJQ A;  3OR7 C;  4JYC A;  1RM1 C;  4RQE A;  1NR1 A;  4JGS A;  1B70 A;  1GM9 A;  5B1A C;  4ZTU B;  3BFM A;  2WLL A;  3UH0 A;  5CA3 A;  4UP7 A;  2DVE A;  1M57 C;  4WFA V;  4P2Z A;  5GW7 A;  5C53 B;  3ZN0 A;  1FXK B;  3QNE A;  4MTF A;  3SPJ A;  1NJ6 A;  4HZ3 A;  4YPF A;  1QR9 A;  2J3M A;  4EX5 A;  3LC0 A;  1DLB A;  5EBM C;  2RHS B;  2ZTG A;  1E1R G;  2YEV B;  4TT3 G;  1YSC A;  1YFS A;  2H94 A;  3WFV A;  4PG3 A;  1GK9 A;  3OUS A;  4JAV A;  2HR3 A;  3D3I A;  1X54 A;  3NEN A;  3ZMV A;  2XGT A;  3WQZ A;  2NLJ C;  1K33 A;  2OT5 A;  5KUM A;  4LVI A;  4QE9 A;  1E22 A;  1V54 C;  1E79 G;  4LVM A;  1XL4 A;  3AG3 B;  4PA6 A;  2EZO A;  4WF9 V;  4XU1 A;  1L0W A;  4ZIB A;  4XTX A;  1BBU A;  4WJ4 A;  4KUM A;  1S77 D;  2ODR D;  1H2G A;  5H6Q A;  1K8A W;  3BJU A;  2R9I A;  5LBQ A;  3RUX A;  3OD1 A;  4H2X B;  2DYS C;  5H6R A;  2K1E A;  1YB3 A;  3RIR A;  2IU3 A;  3UGT A;  4BW5 A;  3E8H A;  2GHY A;  2ZT5 A;  4P74 A;  5B1B C;  4UP8 A;  3IGA C;  3K08 A;  3CPW U;  1BIA A;  2XAS A;  3STL C;  3V7S A;  1GTO A;  1BL8 A;  4EO4 A;  4JTA B;  4QJF B;  1WLE A;  4Q6G A;  2IW5 A;  2ZT8 A;  4JTD B;  1JX9 A;  3BEH A;  4GX0 A;  5LGN A;  3HXW A;  4XEM A;  4YRG A;  1QCE A;  1S0V A;  5IY5 B;  4TSF G;  5K1P A;  2C2A A;  3F5W C;  4UXN A;  1LNQ A;  4OP0 A;  1R3J C;  2W6I G;  3QO8 A;  1VQ8 V;  2XOK G;  1B6Q A;  2JK5 C;  4YXW G;  3CCR V;  3CCE V;  2DU5 A;  3KFU A;  3LDC A;  2EL9 A;  4YRL A;  3ASO B;  2E65 A;  1EFR G;  5CMU A;  4FMT A;  2DDZ A;  1G4Y B;  1KC8 W;  1PNM A;  4TVA B;  1VQZ A;  2JEU A;  1QE0 A;  4XU0 A;  3HTZ A;  1R3K C;  2HJF C;  2XND G;  4G27 B;  4MVZ A;  1VQP V;  4FJC C;  4PA4 A;  1NYR A;  3TUP A;  1YFR A;  1XL6 A;  4FK5 C;  1S5H C;  1YI2 V;  4XTW A;  4CH4 A;  1OCZ C;  4UVC A;  2R9R B;  1VQ7 V;  3RAC A;  3ZJZ A;  4HYO A;  4JF3 A;  2CIM A;  2ZR2 A;  3A7R A;  2EIL C;  4P74 C;  3RGL A;  2HKO A;  3ML0 A;  2ZIO A;  1VQL V;  1BBW A;  4YRO A;  1ATI A;  4UPA A;  3CCS V;  1ASY A;  1QVG U;  3FB5 C;  2CJA A;  3E8G A;  3LDE A;  3ZMT A;  3TCU A;  3X2Q B;  3E89 A;  1YGB A;  3P8T A;  1NQT A;  3ZN1 A;  4UV9 A;  1NNH A;  4TQD A;  3CCM V;  2IH3 C;  1GM8 A;  2LFR A;  4X89 A;  3I56 V;  5B3S B;  1B7Y B;  3NXS A;  4RDX A;  3ZRV A;  5LGU A;  4YRR A;  3KG2 A;  5IYC O;  1EQR A;  3K3W A;  3ZMZ A;  2CK3 G;  4BWA A;  4PA9 A;  2B5U A;  3MHH C;  5EC1 C;  1NJ8 A;  3LDD A;  1EZJ A;  1EIY A;  4RUF A;  1M90 W;  5EK0 A;  1N9W A;  4O2D A;  3ZIA G;  2AMC A;  1X2G A;  2HVJ C;  2CJB A;  4JYB A;  2HNI A;  2ZNJ A;  4XTV A;  3CP1 A;  3UGQ A;  3ABM B;  3HRK A;  2EIK B;  1QLE B;  4MVO A;  2A79 B;  3QTC A;  1YJ9 V;  3CXC U;  1VQ6 V;  3IFX A;  2I4O A;  3E83 A;  3OEH G;  4H33 A;  2DZ9 A;  3A7U A;  3VQV A;  2JIZ G;  1AJN A;  3JD0 A;  4LC1 A;  1H8E G;  4MTX A;  5DM6 V;  2E10 A;  4PHC A;  4RMF A;  3E35 A;  1Q86 W;  3RW0 A;  2DQ0 A;  3STZ C;  4Q15 A;  5B1O A;  2HLD G;  2Q5I A;  4YRN A;  1NKD A;  4Q20 A;  5L3F A;  3JD1 A;  3ASN B;  2P6J A;  1OCR C;  2I4L A;  4J9Y B;  1JJ2 U;  1JJC B;  4PDL A;  3MEY A;  1WPY A;  1PYS B;  5L3G A;  2DW4 A;  2ZT7 A;  4HWT A;  3M4P A;  2ZDI C;  1KKD A;  3FB6 C;  2DXT A;  4TQF A;  5KNN A;  3AG1 C;  2QKS A;  1M56 B;  3HY0 A;  3HXY A;  3ZRW B;  3L4G B;  1ENV A;  2WLI A;  5IDJ A;  3HFV A;  5B1A B;  1QBZ A;  3NEL A;  4H2W A;  3FJP A;  3ETG A;  3LUT B;  5CBH A;  5L3D A;  4YCV A;  1V55 C;  3ZRS A;  1NJI W;  4YCW A;  4YRP A;  4F4L A;  4WF2 A;  1GKF A;  1SRY A;  4MVU A;  1BIB A;  2ALY A;  3A74 A;  3PCO A;  1DTO A;  2QHS A;  1PNK A;  1X56 A;  4G28 B;  3OE7 G;  4RUE A;  1YTF D;  1ORQ C;  3SPG A;  1OCC C;  1R6N A;  1FXH A;  1AI7 A;  3VBB A;  4G84 A;  1IXM A;  2ATK C;  3WG7 B;  2XAG A;  1OCO C;  1HTT A;  3IAL A;  1N8R W;  3FB8 C;  4YRJ A;  2A9H A;  3UFG A;  2PI4 A;  2QM8 A;  1SER A;  3ABL B;  2DU7 A;  4G85 A;  5C51 B;  2DEQ A;  2AHZ A;  3CYO A;  1W2B U;  1Q81 W;  1M1K W;  3OEE G;  2OTJ V;  4P3P A;  2EIJ C;  3CCQ V;  3OW2 U;  4XDJ A;  4XU2 A;  4DO2 A;  3ERR A;  5HFM A;  3W7S A;  1I5Y A;  4MS2 A;  4OXS A;  3OMA B;  3SYQ A;  4LNS A;  1FXK A;  4GX1 A;  2P5I A;  3R07 A;  3V7R A;  5J9P C;  1CEZ A;  4H2V A;  3SYO A;  3SPI A;  5B1N A;  2IJK A;  1TUE B;  2RHS A;  1B70 B;  3OMN B;  2D3O W;  4YRM A;  2EJ9 A;  3K9A A;  4U7N A;  5L3B A;  4UP9 A;  2DXU A;  4P73 C;  1S76 D;  3REU A;  1E1Q G;  1R3L C;  4H2S A;  4PA3 A;  2ITC C;  1K73 W;  1F51 A;  4KR2 A;  1K7D A;  3F7V C;  1K97 A;  2DWE C;  2Q67 A;  1G5H A;  4P9O A;  2DWD C;  1B8A A;  3A31 A;  1K3E A;  5KUK A;  1E1T A;  3DSQ A;  3ICA A;  1FS0 G;  3SPC A;  1VQK V;  2ZIN A;  2P67 A;  1NYQ A;  3NEM A;  1ZWI C;  5EBW C;  1W66 A;  4H2X A;  4P3O A;  1R3I C;  1FYF A;  3P32 A;  3CCV V;  1USY C;  3GB7 C;  1X2H A;  1JCH A;  2LFS A;  3HXZ A;  3TEG A;  4CBC A;  4WCE V;  1MAB G;  1QR8 A;  2Q7E A;  4QNH B;  2ODR C;  3ETD A;  4K87 A;  1ADY A;  4YRT A;  1FXK C;  1HC7 A;  1KOG A;  11AS A;  3A5Z A;  4FIP C;  4HT4 A;  2JEX A;  4TWA A;  4ZKI A;  4MW8 A;  4R7C A;  3W7U A;  2DKG A;  4H2U A;  1WPX A;  4P71 C;  2GSM B;  2XAJ A;  1G51 A;  2IU0 A;  2IY5 B;  1Y66 A;  3IKM B;  1Z7N A;  2EJG A;  1K5S A;  5LGT A;  1P4R A;  4NCX A;  3CD6 V;  4HAM A;  3NET A;  4YRI A;  1YHQ V;  1AI4 A;  2Y48 A;  3BY6 A;  3QO5 A;  3CME V;  2ZT6 A;  1KEC A;  3AG3 C;  2QTO A;  4WJ3 M;  2X7R B;  1GMG A;  2ZR3 A;  1SES A;  3A0R A;  3AG4 B;  3E8B A;  3RKX A;  2BOC C;  3VQX A;  1H4T A;  2DYR B;  3DGE A;  4PEL A;  1NR7 A;  3ABK B;  1P7B A;  1FFT B;  3JYC A;  3W3S A;  4LVL A;  2W0F C;  1YFT A;  1EFW A;  4GX5 A;  1OHH G;  2A0L A;  1KP2 A;  1PL0 A;  4KFM A;  4MSW C;  3G6E V;  1WNL A;  2Q7G A;  3E8F A;  4N23 A;  2X0L A;  2ITD C;  2ZDI A;  4TTV A;  1CP9 A;  2AHY A;  1Q7Y W;  1ASZ A;  2J3L A;  2XAF A;  3EFR A;  4CH3 A;  1WYD A;  1E1O A;  4P72 A;  1AJP A;  3JD4 A;  2BOB C;  1BHA A;  2WAM A;  4P9P A;  5EC2 C;  1RIQ A;  5IY5 C;  3HRI A;  5F5W A;  3L2Z A;  4YRQ A;  4I5S A;  2ZXW B;  1GO3 F;  2DZC A;  2EIN B;  1OCR B;  3ASO C;  3T4Z A;  3T4D A;  4XTZ A;  3M4Q A;  2FTK A;  2I4M A;  2I4N A;  5KA5 A;  3CCU V;  2WLH A;  5CBF A;  2EAY A;  4CS4 A;  2H8P C;  1ARO P;  3PZC A;  2V1D A;  2AKW A;  1JOY A;  2NS6 A;  4QIW F;  1VQN V;  2P0L A;  1J95 A;  2OCC B;  4XDK A;  4GCZ A;  3K04 A;  1K34 A;  5E1A C;  5KA6 A;  2JJ1 G;  2JDI G;  12AS A;  4WFG A;  1H4Q A;  2KB1 A;  3ZRX A;  2RHQ A;  3MD0 A;  2X6C A;  4KR3 A;  3V8K A;  2ZD9 A;  1LYL A;  1YIT V;  3AG2 B;  3TEH B;  3RL6 A;  2EIM B;  3FB7 C;  1B76 A;  2A8E A;  2DTH A;  4H02 A;  2ARS A;  5EBL C;  5C93 A;  3MF2 A;  1G5I A;  2QHV A;  2ZZE A;  1RM1 B;  1K4D C;  1YJN V;  3P30 A;  3CC7 V;  1WU7 A;  2QE7 G;  3B77 A;  3OAA G;  3X2Q C;  4P72 C;  5E3I A;  4YRE A;  5CN0 A;  3HFZ B;  1F4N A;  2ARU A;  3K03 A;  3ZCC A;  5B3S C;  4J9Z B;  5IYD O;  1M57 B;  3HPL C;  3SPH A;  1VQ9 V;  1BMF G;  1EVK A;  3G1Z A;  3L4G A;  4P73 A;  1SZT A;  3RKW A;  3HXV A;  1RPR A;  1ADJ A;  2PI5 A;  3I55 V;  3RBZ A;  1H4V B;  4X88 A;  1S3J A;  2WPD G;  4R6Z A;  3P8V A;  2WSS G;  1M9N A;  2Q5H A;  4UUJ C;  3K0D A;  4MTO A;  3RKY A;  2DJZ A;  2HFE C;  1MSW D;  3A7A A;  4HVC A;  2B1G A;  2CJ9 A;  3AEI A;  1SET A;  2WLI B;  3SYC A;  4P30 A;  1S72 V;  1JVM A;  3ABM C;  3PJS K;  1G8M A;  1W0J G;  1QLE C;  2EIK C;  4UVB A;  2ZCE A;  2ZZF A;  3IC7 A;  4BW9 A;  1V54 B;  1USY A;  4I9W A;  4PDV A;  5H9C A;  1QVF U;  3RVY A;  2ALY B;  2XTI A;  2WLN A;  3T2M A;  4BIU A;  5DN6 G;  4CZZ A;  2QA4 V;  3L1A A;  1GM7 A;  4MT8 A;  1DF4 A;  3HXU A;  4YP0 A;  3ZMU A;  3I7F A;  4K86 A;  1MOF A;  1K5Q A;  3LSS A;  4H37 A;  3ASN C;  2M7W A;  4OLF A;  2DYS B;  2Z3Y A;  3OR6 C;  3CMA V;  1X55 A;  3IG2 A;  4YCU A;  3D36 A;  4WI1 A;  3SYP A;  4E2L A;  1UJW B;  2E1H A;  4E51 A;  1AR1 B;  2YEV A;  3E2E A;  4P71 A;  5B1B B;  2WLL B;  1M56 C;  1AI6 A;  4DXW A;  4LCU C;  1KMN A;  3CC4 V;  4MW3 A;  2PME A;  4LVJ A;  3T1C A;  1H8H G;  3TK1 A;  2W6J G;  3ABU A;  1AI5 A;  2C8M A;  1H4S A;  3MHS C;  3VQY A;  3GWO A;  3OUF A;  4CS3 A;  1MG1 A;  1NVP B;  3UKM A;  3H01 A;  1CPY A;  1FXV A;  3SYA A;  5CBG A;  1KD1 W;  1BHB A;  1WQ7 A;  4CS2 A;  4YRK A;  5C52 B;  1THZ A;  3K0G A;  2P7T C;  1NJ2 A;  2E5A A;  3E9I A;  2Y69 C;  4CH6 A;  4LBE C;  2PMF A;  3LSQ A;  4PA7 A;  3VOU A;  3WG7 C;  2Q7H A;  4HWR A;  4J15 A;  1F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...