4RQFA

Human seryl-trna synthetase dimer complexed with one molecule of trnasec
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
475
structure length
451
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTMMDKVEFVHMLNATMCATTRTICAILENYQTKKGITVPEKLKEFMPPGLQELIPFVKPAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords selenocysteine tRNA
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
total genus 130
structure length 451
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqfA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqfA02
1J5WA 3RF1A 3RL6A 1G5IA 1YGBA 2ARUA 4WI1A 4XEMA 3OD1A 2DU7A 2ZR3A 3HFZA 4HWPA 1H4SA 2ARSA 4RDXA 3QO5A 4H2WA 4H2XB 1PYSB 3IKLA 3DSQA 3RACA 3A7AA 3L1AA 3NETA 1EIYB 3I7FA 2I4MA 4K87A 4RMFA 2ALYB 4O2DA 3WQZA 3UH0A 4XU0A 2E65A 4YRFA 1VQZA 5ELNA 3HXUA 2IY5A 1RIQA 1EFWA 1NYRA 4CH3A 4CH5A 4TQDA 2RHSB 3LSSA 1E22A 4K88A 2AKWA 3G1ZA 3M4QA 1ADYA 1B76A 4P71C 4YRKA 1QE0A 1ADJA 3UGTA 4P74A 1NJ2A 3A7UA 4YRMA 1EVKA 3R07A 2Q5HA 1BBWA 2DDZA 1GGMA 3TEHB 2XTIA 4HWRA 2ZTGA 4YRSA 3BFMA 2ZZGA 2DU5A 4YRPA 2DQ0A 2ARTA 2P5IA 4EO4A 1B8AA 1NYQA 4H2SA 1Z7NA 4RQFA 1WQWA 3VQWA 4L87A 1WNLA 2DTIA 2EL9A 4P72A 3HRIA 1WLEA 4YRJA 1X56A 3V8JA 12ASA 2Q7HA 4P72C 2EWNA 4H2TA 1BIBA 11ASA 2CIMA 4UP7A 1YFRA 2XGTA 1B70A 3VQVA 3RKXA 3QTCA 4XTWA 1USYA 5ELOA 4PG3A 3FJPA 2ZT8A 4UP8A 3RKWA 4WJ3M 2ZNJA 1USYC 4XTZA 2ZNIA 3E9IA 2ZZEA 3P8YA 3L4GB 3CMQA 2I4LA 2ZT6A 4AH6A 3W3SA 1NJ6A 2ZZFA 3A7RA 4HWTA 4X5OA 4YDQA 1LYLA 2I4OA 3P8TA 2AMCB 2FYKA 4P3OA 3TUPA 1E1TA 2ZIMA 3A32A 1X54A 4TVAB 2P0LA 2DXUA 2DZ9A 2QHVA 4H2UA 3LSQA 1EQRA 2RHQA 3HXZA 1ASZA 4CS3A 4YRNA 5KNNA 4TVYA 1HTTA 1KMNA 4KQEA 2QHUA 4WF2A 3MF2A 2CJ9A 4YRLA 4YRRA 4YRGA 4WJ4A 3HTZA 3IALA 3REUA 1JJCB 2C8MA 3EFRA 3IG2A 2DQ3A 2ZIOA 3TEGA 4XU3A 3UGQA 3A74A 1BIAA 2DTHA 3RIRA 4OP0A 2ZINA 4P74C 1X01A 4YRQA 4YCWA 3BJUA 1WPYA 2ZR2A 1HXDA 3E9HA 4PHCA 4DQ2A 2DTOA 1SRYA 3PCOA 1E24A 4TQFA 4CH6A 3ERRA 4P75A 4YCUA 1W66A 1ASYA 3HFZB 3HXYA 3L2ZA 2I4NA 4H02A 4YREA 2E3CA 3REXA 4H2YA 1EVLA 2DKGA 4CH4A 3V7CA 3NEMA 3RKYA 2QHSA 4CS2A 1YFSA 3P8VA 1L0WA 2ZT7A 4BW9A 3A5ZA 5HGQA 3HY0A 3V7SA 4XEOA 4RQEA 2E64A 1Z7MA 1PYSA 3HXWA 4H2XA 4HWOA 4UPAA 2E41A 2IY5B 4G84A 4H2VA 5C51B 3PZCA 4Q6GA 4NCXA 2AKWB 4XTXA 1IL2A 2ALYA 2E1HA 5E3IA 4E51A 1WYDA 4EX5A 4BWAA 1H4VB 1SESA 4ZTZB 2RHSA 2QHTA 4TWAA 2ODRC 4P3PA 4XTYA 1HC7A 1WU7A 1H4QA 2ZT5A 2DXTA 4G85A 3PCOB 4XU2A 2J3MA 3HXVA 3V7RA 2ODRD 3TEHA 1B7YA 1C0AA 1BBUA 1NJ1A 3QO8A 1SETA 1SERA 4TTVA 4HA8A 4XTUA 1YB3A 1N9WA 4TVWA 3QNEA 1NNHA 3NENA 3HFVA 3V8LA 4YCVA 1YFTA 1WQ7A 2E5AA 2G4CA 1B70B 3QO7A 1EOVA 3VQYA 2PMEA 3IKMB 4XU1A 2CJBA 4YRIA 3VQXA 2PMFA 1ATIA 4YYEA 4YRCA 4P71A 1QF6A 3HXXA 4YRTA 4J15A 4P3NA 4XTVA 4ZIBA 2EAYA 5K1XA 2E10A 3V8KA 4YROA 1H4TA 1E1OA 2Q7EA 4UP9A 4P73A 2CGHA 4HVCA 1KOGA 2C7IA 5K1PA 3L4GA 2DEQA 1G51A 4Q15A 4P73C 1B7YB 4P75C 2Q5IA 3RUXA 3KFUA 3VBBA 1X2GA 3HY1A 2ZXFA 4DPGA 2AMCA 2RHQB 2EJGA 1NJ8A 2CJAA 3NELA 2DZCA 3MF1A 1KMMA 4TVAA 3A5YA 4LNSA 2EJ9A 1EIYA 2HNIA 1NJ5A 3MEYA 2Q7GA 2DVEA 2DJZA 4K86A 4KR3A 5C52B 3HRKA 1FYFA 5F5WA 2J3LA 3ICAA 1G5HA 3EFSA 4YP0A 1X2HA 4ZTUB 4KR2A 3UFGA 1JJCA 4HWSA 4YPFA 1X55A 2EJFA 5C53B 3A31A 4OLFA 4CS4A 2ZCEA 2ZGWA 3LC0A 3RGLA 3M4PA
chains in the Genus database with same CATH superfamily
3MD0A 5CBGA 4DYLA 3T1HB 4JYAB 1WAZA 1YJNV 1G5IA 4IGGA 1S5HC 4O2AA 2HVKC 1H4SA 2UUCB 1DTOA 4H2WA 4DR7B 3IKLA 3DSQA 1CPYA 4IIJB 3A7AA 3L1AA 1EIYB 4DR2B 4GUNA 3OD4A 3DTUB 1AILA 5LYJA 3I7FA 4K87A 4RMFA 2ALYB 5FLXN 4K0KB 4DV2O 3ABLB 3TGUH 4OX9B 4H13B 3UH0A 2EJ7A 2ITCC 2WLIA 4H44B 4QPKA 3AK2A 1DF4A 3OTOO 5ELNA 1KYOF 4DR6O 2OCCC 1JFFA 4DUZO 3K5MA 4CH3A 4TQDA 1OCCB 2RHSB 4WBNA 1FD9A 3LSSA 3I56V 1E22A 5FNVA 3G1ZA 1YIJV 1IBMO 1GM7A 3N2KB 3WB2A 5GONA 4MVOA 4JI4B 1URFA 1PNLA 1PL4A 3R07A 2WAMA 2JS5A 5KX5B 3OUFA 1V54C 3OM3B 3RN4A 1Z5WA 3P32A 5IJ0A 2XTIA 2QGNA 2JS3A 4YRSA 2ITDC 2RN9A 2LFRA 4TV9A 1K4CC 2DYSC 3L74H 2EBOA 5EC2C 2E74B 4GX0A 4DV5B 2JDIG 3BPZA 1B8AA 1NYQA 4MS2A 4F6EA 2BOCC 4ZHQB 1WNLA 2DTIA 4A5UB 2E5LB 5LBQA 12ASA 1Q86W 1KP3A 3ZMSA 4JI2B 2OCCB 11ASA 4JYCA 1YJ9V 4H0LB 1SQQH 2CUGA 4FLTA 1Q7YW 4UP7A 4PI0A 2CTRA 1H2NA 2V7QG 3QTCA 1N34B 3JASB 2RDCA 2NS6A 1QVGU 4GYCB 3FFQA 3FJPA 1XBLA 2ZT8A 2M7WA 1V54B 3RKWA 4WJ3M 1AI7A 1M57C 1VQ4V 3ETQA 4ICGA 1T5EA 2IJHA 1XMQO 2Z0AA 2ZZEA 4I4TA 3CPWU 5IJ0B 2UXBO 1MZFA 1K5SA 4NXNO 2A79B 2P4KA 2HKOA 3K3WA 4FFBB 1Q6HA 4YDQA 3FAVA 5CN0A 3CCRV 2FYKA 4P3OA 2YI8A 4B7EA 1GM9A 1K3EA 5KHKA 3THOA 5DM6V 1AJPA 1GK9A 1VQ8V 1BHBA 1X54A 2P90A 4DR1B 2P0LA 4BIZA 5CA0B 5JVDA 5EK0A 1G8MA 4EFEA 2YICA 3LSQA 3ZN1A 4KHPB 4X9QA 1EQRA 3SYCA 4Z1VA 1WB8A 1UJWB 2RHQA 2NNUA 5JWPA 4DO2A 3ZX6A 1L8DA 4FLUA 1HNWO 2ZDIC 1KMNA 2CTPA 3CD6V 2Z5UA 5EYPB 2XOKG 4YRRA 3LDDA 5AG2A 1M57B 2YIAA 3ETDA 1I7FA 1AJQA 3O65A 2HG5C 1YI2V 2HEPA 4NXMB 4XU3A 3FB7C 1WPXA 1ORQC 3ABMC 1GRJA 1AJNA 1VF5B 2KB1A 4IHJB 1WPYA 1HXDA 4I4TB 4DR4O 3CX5F 1SQFA 4WF9V 1SRYA 1HNZB 1M90W 3SPHA 4YY3B 1VQMV 3JD4A 4CH6A 2PY5A 3ERRA 3OTFA 5H5NA 4TT3G 1F4NA 2Q0OC 3D8CA 4H02A 5ITZB 4JI6O 3RWRD 1Z5VA 3FYEB 4H2YA 3LDCA 4PDRA 4K3AA 2PF4E 3NEMA 2K1EA 3DXRB 4NYKA 2LW7A 2ZT7A 1YSCA 4B3TO 3SYQA 2F43G 1P4RA 3AG3B 5HGQA 1R3KC 1E1QG 5H9CA 4XEOA 1K97A 3V7SA 1L0NH 1WPBA 2FKXA 5E79Z 4H2XA 4O4IB 2E41A 3ZRSA 5CA3A 2JEUA 3KCXA 2A9HA 1Q5OA 4JI7O 1IL2A 4I0XB 3JAWB 4FZ1A 4UCTA 2E1HA 3OUSA 4G2KA 5E3IA 1J5EO 4UXNA 1M56B 4UCOA 4BWAA 1QBZA 3E86A 4PI2A 2CH7B 3WFVA 3DC5A 1NJIW 4GT1A 1IXBA 4YHHO 4B7KA 3WG7C 5CB4A 1NQTA 1P49A 4R6ZA 4ZOLA 2UUAO 1OHHG 2YDEA 2ODRD 3TEHA 4X1IB 4YJ3A 3JAKA 3CC2V 3AG7A 1FXVA 4DXWA 3LDEA 1Y67A 4CC6A 4XTUA 1YB3A 4O4HA 2KG7A 3LSUA 4B3MB 4DR6B 4WFBV 4TSFG 4LF7B 1IBMB 4LWSA 1VQ9V 3L72H 1EOVA 1QHTA 2Q0AA 4JI0O 4PDMA 1L0LH 1QLEC 2WLNA 4DV7O 1EBOA 3B4SA 1B3QA 4YRIA 2QWPB 2PMFA 2JGDB 1ATIA 4W4LA 3JALA 2IU0A 1K33A 5KLVH 4X1KA 1M9NA 4P71A 5B3SC 3HXXA 3GWOA 2PZSA 2RQ6A 4FM0A 3WG7B 1AROP 4XTVA 1GTOA 3FD9A 2EAYA 1KU9A 4E4EA 2W0XA 3BA9A 3ZN0A 3OEHG 4P73A 1XEQA 3EFFK 4HVCA 2IBZH 4ZOLB 1Y74A 1N32O 2N05A 4Q15A 4P73C 4DUYB 3RUXA 3VBBA 3QF7A 2UUBB 4JTDB 1FFXA 2ZXFA 3MHSC 2QKSA 5KHJA 2PGGA 2E76B 2PUSA 5CBFA 1SZXA 1FAFA 2Q9LA 4DPGA 2AMCA 5H6QA 2FMLA 1SF9A 4LFBB 1OCZC 2CJAA 3NELA 5KUMA 1WN7A 1VARA 4JI3O 3A5YA 3OFNG 1N4CA 1QLEB 5JQGA 2V4DA 1XNRB 4LF9O 4IL6Z 4F6RA 2W6IG 3CCUV 1Q82W 1F23A 2VWJA 2Q7GA 3MAQA 4K86A 1TGOA 4KR3A 1XUQA 1D5AA 4PA3A 3HRKA 2GHYA 4LF8B 3SGIA 5LMNO 2QKCA 3UM7A 2Q5ZA 1BQ0A 2N74A 3Q4HB 4JTAB 4NXNB 5JJNB 2QSAA 4PD4F 3F7YC 4JI1O 3O9OA 3FB5C 4JYYA 1JJCA 4HNAA 2BCCH 4BR6A 3JCUZ 1EZJA 2MK3A 2IU3A 4O4LB 3A31A 4U3JB 1XNQB 2X6AA 2EULA 4BAYA 3ZHVA 5KA5A 1TA8A 1F7YA 4NKGB 5LGNA 3QVNA 2GUZA 2XAHA 1J5WA 3HKCB 1OCZB 3B8MA 3RF1A 3RL6A 2ARUA 1R6TA 4WI1A 4XEMA 5IJ9B 5L3EA 4LNUB 2IH1C 4X65B 1KMIZ 5EC1C 3HFZA 3E8BA 2W0FC 3U0ZA 1BHAA 4RDXA 5IYCO 4FLVA 1PYSB 3ASNC 3RACA 2IJKA 1HP8A 2X6CA 4MSWC 4I55B 1KC8W 2VQEO 1AR5A 3F5WC 5CA1B 4ZI7A 4AQYB 2QTOA 1AI5A 2BTQB 1GKFA 2YSUB 3NXSA 1H2SB 4YRFA 4DR4B 3HXUA 3I5DA 1EFWA 2QA4V 1ZL8A 4CH5A 2X0LA 1EFRG 2AKWA 1VQ6V 4MTXA 4YRKA 1ADJA 1BL8A 1GN3A 2DE0X 3UGTA 2ADQB 1NJ2A 4DV4B 2QJ1A 4O2BB 5IDJA 4J7ZA 3X2QC 1Q43A 4XBFA 3P3PA 2FTKA 1BBWA 2DDZA 1XMOO 4MVQA 1KECA 3ZRXA 1GGMA 1FJGB 3MDSA 5KA6A 2DMXA 2CTQA 3BFMA 1ZTEA 2GUZB 1JA8A 4P30A 3HKBB 5A9GA 2X7RB 4LVJA 4U7NA 3CP1A 1R3JC 4JAAA 1H2KA 4DV0O 3JD0A 4I5SA 2P5IA 3CCEV 1VQ7V 4X20B 4LF6B 3N2GB 4H2SA 5IWAO 1FS0G 1WQWA 4EKWA 3ZHTA 2WSSG 4LFCO 2PYLA 1SS3A 3TXQA 2EL9A 3DGEA 3TCUA 2JK5C 4JZGA 3HKDA 1N33O 1F4MA 2H8PC 3V8JA 3F5TA 1ZX3A 2Q7HA 4XDLA 2A8EA 4N21A 3IGAC 2HHHO 1MNGA 1US6A 2Q8VA 1SQXH 2OIEA 1YFRA 1HDJA 4JZ2A 3UT5B 4P9OA 1B70A 5J2TA 2JJ1G 3RKXA 2R72A 3OAAG 1USYA 3X2QB 4PG3A 3ZBHA 2OIGA 3R65A 4LBEC 4K35A 3E22B 3JATB 2YC0A 2ZNJA 1X59A 1USYC 3RYHB 3JD1A 1MA1A 4DW1A 1I94O 2ZNIA 4F4LA 1VQNV 3K5OA 3P8YA 2BSKA 3L4GB 2EX3A 4TV8A 1WA8A 2ATKC 2ZT6A 3ZHUA 5H6RA 2CK3G 4AH6A 4MVMA 2F4VB 4DK1A 2UXCO 2WA3A 3A8TA 1NTMH 2ZZFA 5LGTA 2EIKC 1N36O 3RBZA 1LYLA 2I4OA 4PELA 3M7MX 3TUPA 3AG2C 2HLDG 2Q67A 4Q20A 1EM1A 3A32A 4I9WA 1LUVA 1JOYA 4ZBMA 3K03A 1MSWD 3RT3C 2H94A 1BGYH 4HZ3A 4NTXA 2YIBD 3A2FA 1THZA 3C90A 4X66O 1QR9A 3QG5A 4X62O 3HXZA 2WPDG 3T1YB 2OYQA 3OR7C 4N23A 1S5LZ 3CB2A 1U96A 2HJDA 1IZ3A 5F2VO 4OGQB 2ADPA 3TETA 5J2TB 4YRLA 2R9RB 4LFAO 3K57A 3CCMV 3REUA 2XAQA 1IDSA 2XAFA 4YJ2B 5EZYA 2CE4A 2DQ3A 2W6JG 3L75H 2YXYA 2QM8A 4LP8A 3T4ZA 3BHPA 4DV6O 1M5IA 1BIAA 2DTHA 2F93B 3E83A 2Q4PA 1XREA 4YRQA 1R6NA 3BJUA 3C3TA 2BSKB 1X4TA 3CCJV 4HAMA 4PHCA 1WA8B 4DQ2A 2DTOA 1BQZA 1WB7A 4KFMA 4R7CA 5JCOA 3PCOA 1YHQV 1N0JA 2JVDA 5B1AC 3AG1C 3BCCH 1JX9A 2X6BA 3G80A 4YCUA 2B5UA 4O2AB 5JCOC 4MW8A 3L2ZA 5LMUB 1QQCA 4OPHA 4UVAA 3B40A 3ABUA 3H01A 1JQ0A 4HYOA 5LMNB 1NH2B 2DKGA 4CH4A 2ZE6A 1W59A 5LYJB 4CS2A 1YFSA 2UXDB 3IC7A 3AK1A 4BW9A 2BOBC 3ZRVA 2AHYA 3FB8C 1WJZA 1RPOA 3CC4V 2WLIB 5GW7A 5A2QN 4RQEA 3HXWA 1NS1A 5D5PA 1Q6UA 2A06H 1K8AW 1JFFB 4JI5B 1JPXA 4PA9A 3K0DA 4LVIA 3BVOA 4JV5B 3CWBH 4H2VA 5C51B 4WBNB 2GDSA 2Y69C 1RM1C 5FNVB 4XTXA 1BT8A 2RJZA 3ICXA 5GONB 1RSOA 4E51A 4U3FH 2XHBA 4DV1B 1H4VB 3CSXA 3M8AA 3JARA 1SESA 5BMVA 4BW5A 4TWAA 2DYSB 1HR0B 3AG1B 5B1AB 2B9ZA 4LF4B 1HC7A 2RMKB 5LHGA 1AVMA 3IAYA 4LF5O 1H4QA 3P3NA 4TV9B 3PCOB 1KD1W 1ENVA 3HKEA 2J3MA 1IBKB 3OGCC 2M6YA 3I55V 3V7RA 5EIBD 2VQFB 4DR5O 4WCEV 1NVPD 1G1XB 4PA6A 1PV0A 2HVJC 2CDYA 1PPJH 3K5NA 3CCQV 2AW9A 2KSDA 1SETA 1S77D 5LHHA 4HA8A 1GN6A 1N9WA 4TVWA 3QNEA 1VQKV 4L8JA 3NENA 3L9DA 4PJ0Z 3HFVA 3ASOC 3W7XA 2PI5A 3R66A 4GZRB 1Y76A 3G71V 4PHZA 4K8ZA 2Y69B 1AR1B 1RM1B 5B1BC 3ZMZA 5C8YA 3VQYA 2QE7G 4DV3O 2Y0IA 2EINC 1GAXA 2P6JA 2PMEA 4Z2WA 3LUTB 3IKMB 4XU1A 2CJBA 3ZIAG 1EN6A 1RSOB 2Q68A 3ZHQA 4IYHA 3UO2A 3WU2Z 4MVSA 2OWOA 4RAIA 1YVWA 3B09A 2XT9A 3CMEV 1LR1A 4ZIBA 2ZM6O 3ZMUA 1VQ5V 1H4TA 4AILC 2K9PA 5FL7G 2GV9A 1Y4MA 3ZEDA 3RYCA 4UP9A 3FAVB 1FPOA 5EBLC 4WFFA 2EIMC 1G51A 1RPRA 4KUMA 1Q90D 1V55C 2QWRB 4FZ0A 5IT9N 3J7AU 2Q5IA 2R9AA 3KFUA 1KKCA 5JVDB 5IYZA 3ETGA 4X88A 5KMGA 3SYOA 2IJJA 3ZCCA 2RHQB 3UCSC 1IBLO 1GO3F 1VEWA 3K9SA 5KHIA 5B1BB 4JI8B 1HNXB 2DZCA 3OMIB 1Y76B 3NR7A 2EINB 4TVAA 1MG1A 2UXXA 2QKAA 2DJZA 5C52B 3ABMB 3EVKA 2DWDC 4XDKA 2UXNA 5F5WA 4FPPA 3ZRWA 2UXCB 4GKJO 4KP4A 5BR8O 4ZTUB 3UFGA 3BABA 3E35A 2YXHA 4B3RO 1X55A 4OXSA 2EIMB 4WFAV 1YTFB 4QJFB 1V55B 2NR5A 2AZ2A 1G6UA 4CS4A 3FYIB 4J11A 5KUKA 2LJ2A 2YIBA 3AG4C 2LP7A 4DV2B 4B3SO 2AXTZ 4KL1A 2VS0A 3JD2A 3OMNB 5LP6A 3OTOB 1SQGA 3OD1A 4DRXA 2DU7A 2JJ2G 5CBHA 4DUZB 2ZR3A 5LP6C 5L3CA 4HWPA 3QO5A 4FJCC 3N27A 3AK3A 4H2XB 1TUBA 3D3IA 2P7TC 4NVPA 3GVMA 3NETA 1SQVH 3E2EA 1JMKC 1NKDA 1GM8A 2GSMB 2KQXA 4O2DA 1I08A 4G28B 3APOA 3H1IH 4FK5C 3ZHRA 3T1HO 4XU0A 4MT8A 4JYAO 2E65A 1VQZA 1I0HA 4X1YA 2ODMA 1RP3B 1RIQA 2IY5A 3FX7A 1TVKA 4GX1A 5IYBO 3JSNA 1NYRA 4FFKA 3RYIA 5IY5C 3IFXA 2UUCO 1ADYA 1FFTB 5LXTA 4P71C 1QE0A 4P74A 1SQBH 3SJQC 4YRMA 5CB4B 4DR2O 3G67A 1S72V 1XHXA 3S3WA 2LGQA 1B06A 4PDLA 2QDOA 2WLKA 4K0KO 1K5QA 3H1KH 3K06A 4C7UA 4OX9O 1VQPV 3TEHB 4UFZA 1SKVA 1S76D 4YJ3B 3JAKB 3JSLA 4HWRA 2ZTGA 4JAUA 2LO1A 2ZZGA 4UCSA 1HWYA 2GBOA 4O4HB 2DU5A 1G4YB 3S3XA 2A0LA 2KG7B 2DQ0A 3STZC 1JR9A 3VOUA 2ARTA 4EO4A 4MVZA 1XL4A 4JI4O 1Z7NA 4RQFA 1JJ2U 4KXRA 4LWSB 5KHGA 2R70A 3VQWA 1TUBB 1K92A 4P72A 3HRIA 1WLEA 3CJHA 1X56A 2WLMA 5LGUA 1XMQB 2Y4UA 5HFMA 5HFLA 2XAGA 4P72C 5B3SB 2EWNA 4H2TA 1BIBA 3T4DA 2UXBB 2ILMA 3JALB 2DOSA 1V9PA 2CIMA 3ZHSA 3BEHA 2YEVA 4X1KB 1R3IC 1KBHA 2EIJC 1Q8IA 4DV5O 1GMGA 5DEDA 2F66C 4MVUA 4PDVA 3K5LA 4UP8A 4BIUA 1L1FA 5BZBA 3TK1A 4ASUG 4J10A 1YJWV 3E9IA 1Y74B 4NB5A 5LOVA 4JI2O 1VF6A 4Z1MG 4UB6Z 2I4LA 2ZT9B 4PV1B 2HR3A 2DW4A 3RFRA 1HNWB 1FFXB 3A7RA 4HWTA 2JEXA 3P8TA 1N34O 1I5XA 2AMCB 4D7SA 4TWKA 1E1TA 4QIWF 1DLBA 1SA0A 2A7WA 5B1NA 1DGSA 5JQGB 3OMAB 4F6RB 1VP7A 2QHVA 4H2UA 1H2LA 4O4JA 1BE3H 2NN4A 3CRCA 1B6QA 1ZUQA 4YRNA 5KNNA 4TVYA 2ETNA 1AI4A 3KCYA 3W7SA 1HTTA 4KQEA 1NZ6A 1H8EG 3MF2A 2YEVB 3M99B 3ZS8C 2CJ9A 2CGNA 4FM1A 4YRGA 4WJ4A 3HTZA 1JJCB 2LGWA 1FXHA 1PD3A 2ZE7A 4DR1O 4HNAB 2ZIOA 3W7TA 2L6LA 1NT2B 1P84F 3F7VC 1R1BA 3SDLA 4JI6B 1AR4A 3P30A 1YCIA 4KHPO 4UV8A 4CBCA 2G38A 1ROPA 2QM7A 4P2ZA 4YCWA 1PL0A 3KKYA 2ZR2A 2QWQB 3E9HA 4ABMA 4B3TB 4J7JA 4YIPA 1D5NA 3W7UA 4DW0A 1E24A 2GTSA 4J42A 3JYCA 4X89A 2Q73A 1FYJA 3IJ4A 4I9QA 4P75A 1SQPH 3ASNB 1W66A 2XAJA 1SZTA 3HFZB 3HXYA 4R8CA 1SA0B 4JI7B 5L3FA 4YREA 2WLLA 5J2UA 2E3CA 2Q6AA 1J5EB 4LVKA 2EZOA 1NBMG 3A0RA 3RKYA 2QHSA 2F23A 1L0WA 2QTSA 3CCSV 3A5ZA 4LH6A 3CMAV 2PYJA 4ZI7B 1CEZA 1HNZO 4UVCA 3JD3A 3HY0A 3H9VA 4YY3O 5H2FZ 2E64A 4YHHB 4UPAA 1R73A 1PNMA 2A3QA 1ZL8B 3ABTA 4Q6GA 3UKMA 2AKWB 1NU1H 2ALYA 5FPRA 2UUAB 3T1CA 3WB0A 4MTFA 3RVZA 3HPLC 4EX5A 2EJRA 3BA8A 1SC5B 1NR1A 3ABLC 3IC9A 1W0KG 3G4SV 3C3SA 4ZTZB 2RHSA 2ODRC 1YDXA 5LHIA 4XTYA 4LC1A 3K08A 1WU7A 3N2KA 2ZT5A 4G85A 5B66Z 1MMMA 1Z2GA 3JCZA 4NTYA 3EXAA 1H2MA 3HXVA 5KX5A 1K9MW 4I50A 1NI8A 4JI0B 4J9YB 3CS5A 1YXBA 2QWNB 4DV7B 3H1HH 4RUFA 3J81N 1SERA 4TTVA 5IE9A 1YF2A 2PI4A 2IJIA 1FXKA 3B2EE 5GTHZ 1YEWA 3HKDB 1NNHA 2Y48A 1U97A 2YIDA 3V8LA 1FXKC 1YITV 2YXLA 1YFTA 5KAIZ 1XHZA 1LNQA 1WQ7A 4ZHQA 2ZQMA 2HJFC 2G4CA 1B70B 1LUWA 3QO7A 1B04A 4AI8A 3ML0A 3FB6C 1N32B 4JF3A 2OTJV 1OV9A 2N04A 4YRCA 4LVMA 2HFEC 1H38A 4TOIA 4B3MO 2ZKOA 4TV8B 3K9AA 2EIKB 1QU7A 1XILA 4FLXA 3JASA 1KUQA 4J15A 3K59A 4LF7O 5K1XA 2F95B 3AG2B 4X64O 1E1OA 3K04A 4JI3B 2YS8A 3H1LH 4WFEA 1PNKA 1JVMA 4LF9B 2L35A 2XTAA 4JTCB 3ZMTA 5JJEB 4I50B 1HW7A 4JYBA 3CE2A 2Y4TA 1BCCH 4FFBA 2YI9A 2H3OA 1FXKB 1MSDA 2ARHA 2EJGA 5DECA 4JI1B 2R9IA 4DK0A 4TUYA 5CA0A 1NTZH 4LNSA 1COWG 2HNIA 1NJ5A 3MHHC 2JIZG 3DC6A 1O9GA 1VMGA 1S0VA 5EZYB 4DUYO 5GTIZ 4G27B 2UUBO 4HT4A 3OEEG 1FYFA 2J3LA 1G5HA 3EFSA 1X2HA 4LFBO 1IX9A 5EYPA 5BY1A 1YZBA 1O9HA 5L3GA 2NLJC 4YPFA 2QWOB 1XNRO 3D36A 2FL4A 2UU9O 3CXCU 2XUMA 1QR8A 3RYFA 1ZAUA 2ZD9A 3ZJZA 3D36C 4IHJA 1A32A 4LF8O 4OLFA 2ZCEA 1H2GA 2O57A 2ZGWA 1NR7A 2VQEB 2LFSA 1VQOV 3LC0A 3RGLA 3SR2C 4QNHB 3M4PA 4UCVA 1VIBA 4JGSA 1JCHA 3STLC 1PM9A 1YGBA 2ZE5A 5DN6G 4FMTA 3EHBB 3A0BZ 4DR3O 4H33A 3SPIA 3SYAA 3CRAA 3T2MA 1DF5A 2ARSA 5ITZA 3CCVV 4TUYB 3HB3B 5B5EZ 1WP8A 1FKAO 4XDJA 4FLZA 1XNQO 4FVMA 2OT5A 4JASA 3DXRA 2I4MA 2ZDIA 1BSMA 2DWEC 2E75B 1XMOB 3WQZA 3K79A 4UCUA 3HR0A 2CAZC 1TUEB 4O4IA 1I5YA 3JARB 3AG3C 4X65O 5BMVB 4DV0B 2GTAA 3LNNA 4K88A 3SPJA 3M4QA 5JJJB 1B76A 3ETEA 1VQLV 4I0XA 3JAWA 3AEIA 1PKXA 3A7UA 1J95A 1EVKA 5IWAB 4JPRA 1Q81W 3RYFB 4EB6A 3E8HA 3HKEB 2P67A 2Q5HA 4LFCB 3CRQA 2CTWA 4AQYO 2CH7A 3CRRA 1N33B 1WNSA 1M56C 5EBMC 3SYPA 4GCZA 2VWKA 3SJCC 3SJAC 4PA7A 2QEXV 3ASOB 2HHHB 4OPAA 1CP9A 1NTKH 4YRPA 5LA6A 4B08A 5E1AC 1N8RW 4X1IA 4DV4O 3OW2U 1WP7A 2RCVA 4L87A 2Y0PA 5C8YB 3FKSG 2YUAA 4CC5A 4YRJA 3D3QA 1FJGO 1I94B 3J80N 4UB8Z 1AB3A 2PTMA 4EEQA 1MOFA 1ZSPA 1XQ8A 1IURA 2V1DA 3E89A 2XGTA 2P5OA 1UPGA 2B1GA 3VQVA 1N36B 2FYUH 4LF6O 4XTWA 5ELOA 1QVFU 5L3DA 2D2CB 3PJSK 4QE7A 1UFIA 2JGDA 3ZMVA 2DJVA 3RYCB 1OJHA 4EB6B 4XTZA 2Q69A 2EILC 4NR1A 4RUEA 4GKKO 2XASA 4IT5A 4X66B 2KKWA 4X62B 3CMQA 2ZXWC 4MVRA 2F1MA 4EFBA 3W3SA 3L70H 1NJ6A 5IYZB 5KMGB 4X5OA 4NTWA 5LA6B 1AP5A 2ZIMA 4LFAB 4FIPC 1Y6XA 4TVAB 1MZEA 4LR3A 2DXUA 3CYOA 5KAFZ 2DZ9A 2XNDG 4DV6B 2RNBA 3CC7V 1N0NA 2OCHA 3GWKC 2AZ0A 1R3LC 1W2BU 1ASZA 4CS3A 4K8XA 2F4VO 3L71H 3RGBA 4HBNA 3LNMB 4FLYA 2QHUA 4WF2A 3ZRWB 3RW0A 4X64B 4FLWA 1QNMA 3IALA 2C2AA 2C8MA 1KKDA 3EFRA 1NH2D 3IG2A 4DR7O 2WLJA 3TEGA 2EILB 3UGQA 3A74A 5CMUA 4UV9A 1RFYA 3RIRA 3BAAA 3K58A 3Q4HA 4OP0A 2B1IA 2ZXWB 2ZINA 4P74C 1PP9H 3AG4B 1X01A 3T1YO 5C93A 1DK1A 4WFHA 4R50A 3CEIA 1AP6A 4MTOA 3CXHF 1D2DA 2QR4A 3KG2A 3RVYA 5LP6B 4TQFA 4O4LA 1S3JA 1OCRC 4U3JA 1M93A 3KZIZ 4DRXB 1XDCA 1ASYA 2QM4A 4J7KA 2I4NA 4JAVA 2DYRC 4J41A 3REXA 1EVLA 3HKCA 3ABKC 4WFGA 3V7CA 1XOUA 2IH3C 1QCEA 3P8VA 4X8AA 2P06A 5IJ9A 2HP8A 5BXZA 4YIOA 2D3OW 4LNUA 5LL6Y 1K7DA 2IW5A 5IY5B 4FM2A 3BFRA 4X1YB 1PYSA 1Z7MA 1BS3A 1KB9F 4HWOA 2IY5B 1TVKB 1OZ0A 4LF5B 4G84A 2UU9B 3RYIB 1EN4A 4I55A 4YXWG 5LMUO 3PZCA 1KQSU 4NCXA 2ZE8A 3BRCA 2OTLV 1CXZB 5LXTB 3JAMN 1K34A 5CA1A 4DR5B 1M4UA 1ZLZA 3L73H 2BTQA 2FB5A 4GLXA 1WYDA 2E5LO 1Q3EA 2P22C 2UXDO 5IYDO 4D7TA 4QE9A 5EIBC 1H8HG 2QHTA 1AI6A 1IVSA 3TJTA 3OT7A 1EZVH 5L3BA 4P3PA 1R6KA 5FPOA 1KP2A 1OCRB 3G6BA 4DR3B 1VF6C 3APQA 3CCLV 2DXTA 4O2BA 4JI5O 4JV5O 1VF7A 2WWWA 4XU2A 2DYRB 3H1JH 4DV3B 2JGUA 1B7YA 1C0AA 3ABKB 1K73W 2AGAA 2LQTA 5EBWC 1GN4A 1BBUA 1NJ1A 3QO8A 4DV1O 4U7OA 1P7BA 4LH7A 5J9PC 3HKBA 2JRIA 1IXMA 3CJHB 4LCUC 4CZZA 3PN1A 1HR0O 4LF4O 4UVBA 2EIJB 4X20A 4BIOA 4YCVA 3N2GA 1Y66A 2ZM6B 2E5AA 4GX5A 3SJBC 4D6TH 2WA4A 1IBKO 3K0GA 3A0HZ 3OGIB 2VQFO 1E1RG 4AHCA 2P4VA 3CRMA 1MABG 3VQXA 5JH7A 4YYEA 5D5QA 3OR6C 1NVPB 4RO2A 2MW2B 2BTOA 3B8NA 3UT5A 1QF6A 2CGOA 5LOVB 3E8GA 1BZKA 4LVLA 4YRTA 1JJOA 4RWUA 1QLNA 4PA4A 1IBLB 4P3NA 3U10A 4I7ZB 2E10A 3SPGA 3V8KA 4YROA 1W0JG 3E22A 3JATA 1Q6IA 2Q7EA 1EN5A 3RYHA 2Z3YA 2CGHA 4H37A 1KOGA 2C7IA 5K1PA 3L4GA 4NXMO 2DEQA 1ZWIC 3OE7G 1F51A 1B7YB 4P75C 1TAEA 2BE3A 1X2GA 3U11A 1OCOC 1E79G 3HY1A 4IYIA 4O4JB 4QPJA 2LW1A 3CHXA 1NJ8A 4GKJB 5BR8B 3BY6A 1YTFD 4UUJC 4ZKIA 3MF1A 1BMFG 4MW3A 1KMMA 4IIJA 4B3RB 3G6EV 1XI1A 1EIYA 2EJ9A 3MEYA 5B1OA 2DVEA 3UO3A 4MTGA 2WLHA 2EZPA 4J80A 5TISZ 4GKKB 3SPCA 3B77A 5KHHA 5JH7B 4E2LA 4B3SB 3ICAA 4GX2A 4YP0A 4UCRA 1S5JA 1XL6A 4P9PA 2DN9A 2IM9A 4KR2A 3WB1A 4JI8O 1HNXO 1K4DC 4YJ2A 1GH6A 4HWSA 1OCCC 1M1KW 3UQ8A 2EJFA 5C53B 3MQZA 2AHZA 3GB7C 3E8FA 3TXSA 1GN2A 4QGPA 1OCOB 3W7WA 4J9ZB 4W4KA 2VRZA 2WLLB 5J2UB 1P7GA
chains in the Genus database with same CATH topology
2XAHA 3MD0A 5CBGA 1J5WA 3JD2A 4JGSA 1OCZB 3OMNB 3B8MA 3RF1A 3RL6A 1JCHA 3STLC 1YJNV 1G5IA 1YGBA 2ARUA 5DN6G 4WI1A 4XEMA 4FMTA 3OD1A 2DU7A 5L3EA 1S5HC 2JJ2G 3EHBB 2IH1C 5CBHA 2ZR3A 5EC1C 3HFZA 2HVKC 3E8BA 4H33A 3SPIA 2W0FC 3SYAA 5L3CA 3T2MA 4HWPA 1DF5A 2ARSA 1BHAA 4RDXA 3QO5A 3CCVV 1H4SA 1DTOA 3HB3B 4FJCC 5IYCO 4H2WA 4H2XB 1PYSB 3ASNC 3DSQA 3IKLA 1CPYA 3D3IA 2P7TC 4XDJA 3RACA 2IJKA 3A7AA 3L1AA 3NETA 1EIYB 2X6CA 4MSWC 2OT5A 3DTUB 4JASA 1KC8W 3E2EA 3I7FA 2I4MA 1NKDA 4K87A 4RMFA 1GM8A 2GSMB 2ALYB 2ZDIA 3F5WC 4O2DA 2DWEC 3ABLB 3WQZA 4G28B 2QTOA 3UH0A 4FK5C 1AI5A 3K79A 2ITCC 2WLIA 4XU0A 4MT8A 1GKFA 2YSUB 3NXSA 4QPKA 2E65A 4YRFA 1VQZA 1DF4A 1TUEB 5ELNA 3HXUA 2IY5A 1RIQA 1EFWA 2OCCC 1I5YA 4GX1A 5IYBO 2QA4V 3AG3C 1NYRA 4CH3A 4CH5A 4TQDA 1OCCB 2X0LA 1EFRG 2RHSB 5IY5C 3IFXA 3LSSA 3I56V 1E22A 2AKWA 4K88A 3SPJA 3G1ZA 1ADYA 1B76A 3M4QA 3ETEA 1VQLV 4MTXA 1YIJV 1FFTB 1GM7A 1VQ6V 4P71C 1QE0A 4YRKA 1ADJA 1BL8A 3UGTA 4P74A 1NJ2A 3AEIA 1PKXA 4MVOA 3A7UA 3SJQC 4YRMA 1J95A 5IDJA 1EVKA 1S72V 4JPRA 1PNLA 1Q81W 3R07A 4PDLA 2WAMA 3X2QC 3E8HA 2P67A 2Q5HA 4XBFA 3OUFA 1V54C 2WLKA 2FTKA 1K5QA 3K06A 1BBWA 2DDZA 3OM3B 4MVQA 3P32A 1KECA 3ZRXA 1VQPV 1GGMA 3TEHB 3SYPA 1M56C 5EBMC 1S76D 5KA6A 4GCZA 2XTIA 4HWRA 2ZTGA 4YRSA 3BFMA 2ITDC 4PA7A 4JAUA 2ZZGA 2LFRA 4P30A 2QEXV 1HWYA 3ASOB 2X7RB 4LVJA 4U7NA 2DU5A 3CP1A 1G4YB 1K4CC 1R3JC 2DYSC 2EBOA 1CP9A 5EC2C 3JD0A 4YRPA 2A0LA 3VOUA 2DQ0A 3STZC 2ARTA 4I5SA 2P5IA 3CCEV 5E1AC 4GX0A 4EO4A 2JDIG 1VQ7V 1N8RW 4MVZA 1XL4A 3OW2U 1B8AA 1NYQA 4H2SA 1Z7NA 4MS2A 4RQFA 1FS0G 1JJ2U 1WQWA 4EKWA 2BOCC 3VQWA 4L87A 1WNLA 2DTIA 2WSSG 1K92A 3FKSG 2EL9A 4P72A 3DGEA 3HRIA 1WLEA 2JK5C 3TCUA 4YRJA 1X56A 2WLMA 5LGUA 1F4MA 2H8PC 5LBQA 3V8JA 12ASA 1Q86W 1KP3A 3ZMSA 5HFMA 2Q7HA 4XDLA 5HFLA 2XAGA 2A8EA 2OCCB 5B3SB 4P72C 2EWNA 4H2TA 1BIBA 4JYCA 4N21A 3T4DA 1YJ9V 1Q7YW 11ASA 3IGAC 1MOFA 2CIMA 4UP7A 1YFRA 2V1DA 3BEHA 3E89A 2XGTA 2YEVA 1R3IC 4P9OA 1B70A 2EIJC 2JJ1G 2V7QG 2B1GA 3VQVA 3RKXA 1GMGA 3QTCA 4XTWA 3OAAG 2NS6A 4MVUA 1QVGU 1USYA 5ELOA 3X2QB 1QVFU 4PG3A 3R65A 5L3DA 4LBEC 3FJPA 3PJSK 4PDVA 4QE7A 2M7WA 2ZT8A 4UP8A 1V54B 4BIUA 3RKWA 1L1FA 1AI7A 1M57C 3TK1A 3ZMVA 5BZBA 1VQ4V 3REUA 4WJ3M 2ZNJA 1USYC 4ASUG 3JD1A 2IJHA 1YJWV 4XTZA 2ZNIA 2Q69A 2EILC 4RUEA 4F4LA 1VQNV 2ZZEA 3E9IA 3P8YA 2XASA 3L4GB 4Z1MG 3CPWU 2ATKC 3CMQA 2ZXWC 4MVRA 2I4LA 1K5SA 5H6RA 2CK3G 2ZT6A 4AH6A 2A79B 4MVMA 2HR3A 3W3SA 2DW4A 2HKOA 3K3WA 1NJ6A 2ZZFA 3A7RA 5LGTA 2EIKC 4HWTA 4X5OA 4YDQA 3RBZA 5CN0A 1LYLA 3CCRV 2JEXA 4PELA 2I4OA 3P8TA 1I5XA 2AMCB 2FYKA 4P3OA 3TUPA 3AG2C 1GM9A 4TWKA 2HLDG 1K3EA 1E1TA 2Q67A 2ZIMA 5DM6V 4Q20A 4QIWF 1DLBA 3A32A 1AJPA 4FIPC 1GK9A 4I9WA 1VQ8V 1JOYA 1BHBA 1X54A 4ZBMA 2P90A 3K03A 5B1NA 4TVAB 2P0LA 1MSWD 3OMAB 4BIZA 2DXUA 3CYOA 2H94A 2DZ9A 5EK0A 2XNDG 4HZ3A 3CC7V 2QHVA 4H2UA 1G8MA 1THZA 3LSQA 3ZN1A 1QR9A 1EQRA 3SYCA 1R3LC 2WPDG 1UJWB 1W2BU 2RHQA 3HXZA 2NNUA 1ASZA 1B6QA 4DO2A 4CS3A 3OR7C 4YRNA 5KNNA 4TVYA 4N23A 1AI4A 3LNMB 2ZDIC 3W7SA 1HTTA 1KMNA 4KQEA 2QHUA 4WF2A 1H8EG 3ZRWB 3MF2A 3RW0A 2YEVB 3M99B 3CD6V 2Z5UA 3TETA 2CJ9A 2XOKG 4YRLA 4YRRA 2R9RB 3LDDA 4YRGA 4WJ4A 1M57B 3CCMV 3HTZA 2XAQA 2C2AA 3IALA 3ETDA 1KKDA 1JJCB 2XAFA 2C8MA 1FXHA 1PD3A 1NH2D 3EFRA 3IG2A 2WLJA 2DQ3A 3W7TA 2ZIOA 1AJQA 2HG5C 2W6JG 1YI2V 3F7VC 3TEGA 2QM8A 4XU3A 2EILB 4LP8A 3FB7C 3UGQA 3A74A 1WPXA 5CMUA 3T4ZA 4UV9A 1BIAA 3P30A 2DTHA 3RIRA 1ORQC 4OP0A 4UV8A 2B1IA 4CBCA 2ZXWB 3ABMC 1ROPA 2QM7A 3E83A 2ZINA 3AG4B 4P74C 4P2ZA 1AJNA 2KB1A 1X01A 1R6NA 4YCWA 4YRQA 3BJUA 1PL0A 5C93A 3CCJV 1WPYA 2ZR2A 1HXDA 4HAMA 3E9HA 4PHCA 4WFHA 4DQ2A 4R50A 2DTOA 4MTOA 4WF9V 1SRYA 4KFMA 4R7CA 1M90W 3KG2A 3PCOA 3RVYA 3SPHA 3W7UA 1YHQV 1E24A 4TQFA 3JYCA 3AG1C 4X89A 1S3JA 5B1AC 1JX9A 3JD4A 1VQMV 1OCRC 2X6BA 4CH6A 3ERRA 4P75A 4YCUA 3ASNB 2B5UA 2XAJA 1W66A 1ASYA 1SZTA 4MW8A 3HFZB 3HXYA 3L2ZA 4TT3G 1F4NA 4R8CA 2I4NA 4H02A 5L3FA 4JAVA 4YREA 2DYRC 4UVAA 2WLLA 3ABUA 2Q6AA 1JQ0A 3FYEB 3H01A 4HYOA 2E3CA 1EVLA 4H2YA 3REXA 1NH2B 2DKGA 3LDCA 4LVKA 4CH4A 2EZOA 1NBMG 3ABKC 4PDRA 4WFGA 3A0RA 3NEMA 3RKYA 3V7CA 2K1EA 2IH3C 2QHSA 4CS2A 1QCEA 1YFSA 3P8VA 1L0WA 3IC7A 4X8AA 2ZT7A 1YSCA 3CCSV 2BOBC 3ZRVA 3CMAV 3SYQA 2AHYA 3FB8C 2D3OW 3A5ZA 4BW9A 2F43G 1P4RA 1RPOA 3AG3B 3CC4V 1CEZA 1K7DA 2WLIB 3JD3A 4UVCA 1R3KC 5HGQA 3HY0A 2IW5A 5IY5B 1E1QG 5H9CA 5GW7A 1K97A 4XEOA 3V7SA 4RQEA 2E64A 1Z7MA 1PYSA 3HXWA 4H2XA 4HWOA 1R73A 2E41A 4UPAA 1PNMA 1K8AW 1OZ0A 3ZRSA 4G84A 1JPXA 4PA9A 3K0DA 4LVIA 3ABTA 4YXWG 2JEUA 5CA3A 4H2VA 5C51B 2A9HA 3PZCA 4Q6GA 2Y69C 1KQSU 3UKMA 1RM1C 2AKWB 4NCXA 4XTXA 2OTLV 1IL2A 2ALYA 3T1CA 1K34A 4MTFA 2E1HA 3OUSA 4G2KA 3RVZA 5E3IA 3HPLC 4E51A 1WYDA 4EX5A 2EJRA 4UXNA 1M56B 1NR1A 4BWAA 3ABLC 1QBZA 1H4VB 1W0KG 3G4SV 3E86A 1SESA 5IYDO 4QE9A 3WFVA 2RHSA 4BW5A 1H8HG 1NJIW 2QHTA 1AI6A 4GT1A 2ODRC 4TWAA 2DYSB 5L3BA 5LHIA 4P3PA 3AG1B 1R6KA 5B1AB 1HC7A 4XTYA 4LC1A 1KP2A 1OCRB 3K08A 5LHGA 1WU7A 1H4QA 3CCLV 2ZT5A 2DXTA 4G85A 3WG7C 3PCOB 3JCZA 1KD1W 1ENVA 1NQTA 2WWWA 4XU2A 2J3MA 2DYRB 3HXVA 4R6ZA 3OGCC 3I55V 1K9MW 3V7RA 1OHHG 4J9YB 4WCEV 1NVPD 2ODRD 3TEHA 1B7YA 1C0AA 4PA6A 3ABKB 2HVJC 1K73W 4RUFA 5EBWC 3CC2V 3CCQV 1BBUA 1NJ1A 3QO8A 1FXVA 1SETA 4DXWA 4U7OA 1P7BA 3LDEA 5J9PC 1SERA 4TTVA 1S77D 5LHHA 4HA8A 4XTUA 1YB3A 2PI4A 2IJIA 1N9WA 1IXMA 1FXKA 4LCUC 4CZZA 4TVWA 3QNEA 1NNHA 1VQKV 3NENA 4WFBV 3HFVA 4UVBA 2Y48A 3ASOC 4TSFG 2EIJB 3W7XA 2PI5A 3V8LA 4YCVA 1FXKC 1Y66A 1YITV 3G71V 1YFTA 1LNQA 2Y69B 1AR1B 1RM1B 1WQ7A 5B1BC 2ZQMA 2HJFC 4GX5A 2E5AA 1VQ9V 1B70B 3ZMZA 2G4CA 3QO7A 1EOVA 3K0GA 3VQYA 2QE7G 2EINC 1E1RG 4PDMA 2P6JA 1QLEC 2PMEA 2WLNA 3ML0A 1EBOA 3LUTB 3IKMB 4XU1A 3FB6C 1MABG 4JF3A 2OTJV 2CJBA 3VQXA 4YRIA 2PMFA 3ZIAG 1ATIA 2Q68A 4YYEA 3OR6C 1NVPB 4YRCA 4RO2A 2IU0A 1K33A 4MVSA 4LVMA 4RAIA 3B8NA 2HFEC 1H38A 1M9NA 4P71A 1QF6A 5B3SC 3HXXA 3GWOA 3E8GA 3K9AA 4LVLA 3CMEV 2EIKB 4YRTA 3WG7B 1AROP 4J15A 1QLNA 4PA4A 4P3NA 4XTVA 4ZIBA 1GTOA 2EAYA 5K1XA 2E10A 3ZMUA 3SPGA 3V8KA 3AG2B 4YROA 1W0JG 1VQ5V 1H4TA 1E1OA 5FL7G 3K04A 2Q7EA 1Y4MA 3ZN0A 3OEHG 4WFEA 4UP9A 1PNKA 4P73A 4ZTZB 1JVMA 2Z3YA 3EFFK 2CGHA 5EBLC 4HVCA 4H37A 4JTCB 2C7IA 4WFFA 3ZMTA 1KOGA 5K1PA 3L4GA 2DEQA 1ZWIC 2EIMC 1G51A 1RPRA 4KUMA 4Q15A 1V55C 4P73C 3OE7G 1F51A 1B7YB 4JYBA 4P75C 2Q5IA 3RUXA 3KFUA 3VBBA 1X2GA 1OCOC 1E79G 4JTDB 3ETGA 4X88A 3HY1A 3SYOA 2ZXFA 2IJJA 2QKSA 3MHSC 5CBFA 1FXKB 4DPGA 4QPJA 3ZCCA 2AMCA 5H6QA 2RHQB 2EJGA 1GO3F 1NJ8A 1OCZC 2CJAA 3NELA 3BY6A 5KUMA 5B1BB 1YTFD 2R9IA 4UUJC 4ZKIA 3OMIB 2DZCA 1BMFG 4MW3A 2EINB 1KMMA 3MF1A 3A5YA 4TVAA 3OFNG 1QLEB 1MG1A 2UXXA 3G6EV 2W6IG 3CCUV 2EJ9A 1COWG 1Q82W 1F23A 3MHHC 1NJ5A 2HNIA 4LNSA 1EIYA 2JIZG 3MEYA 2Q7GA 5B1OA 2DVEA 2DJZA 4K86A 4KR3A 5C52B 4PA3A 4MTGA 1S0VA 2WLHA 3HRKA 3ABMB 2GHYA 2EZPA 3SPCA 4G27B 4HT4A 2DWDC 3OEEG 4XDKA 3B77A 3UM7A 2UXNA 1FYFA 5F5WA 4E2LA 4JTAB 2J3LA 4GX2A 3ICAA 4FPPA 3F7YC 3ZRWA 1G5HA 1X2HA 3EFSA 1XL6A 4YP0A 4KP4A 2IY5B 4P9PA 4ZTUB 4KR2A 5L3GA 3FB5C 3UFGA 1JJCA 3E35A 1K4DC 2NLJC 4HWSA 4YPFA 3D36A 1EZJA 1OCCC 1X55A 4OXSA 1M1KW 2MK3A 2EJFA 5C53B 3CXCU 2EIMB 1QR8A 2IU3A 4WFAV 4QJFB 1YTFB 1V55B 3A31A 3MQZA 2AHZA 2ZD9A 3GB7C 3E8FA 3ZJZA 2X6AA 4BAYA 4OLFA 5KA5A 4CS4A 1OCOB 2ZCEA 1H2GA 3FYIB 3W7WA 1NR7A 4J9ZB 2LFSA 5KUKA 1VQOV 2ZGWA 3LC0A 3RGLA 5LGNA 2WLLB 3AG4C 2LP7A 4QNHB 3M4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5W A;  3RF1 A;  3RL6 A;  1G5I A;  1YGB A;  2ARU A;  4WI1 A;  4XEM A;  3OD1 A;  2DU7 A;  2ZR3 A;  3HFZ A;  4HWP A;  1H4S A;  2ARS A;  4RDX A;  3QO5 A;  4H2W A;  4H2X B;  1PYS B;  3IKL A;  3DSQ A;  3RAC A;  3A7A A;  3L1A A;  3NET A;  1EIY B;  3I7F A;  2I4M A;  4K87 A;  4RMF A;  2ALY B;  4O2D A;  3WQZ A;  3UH0 A;  4XU0 A;  2E65 A;  4YRF A;  1VQZ A;  5ELN A;  3HXU A;  2IY5 A;  1RIQ A;  1EFW A;  1NYR A;  4CH3 A;  4CH5 A;  4TQD A;  2RHS B;  3LSS A;  1E22 A;  4K88 A;  2AKW A;  3G1Z A;  3M4Q A;  1ADY A;  1B76 A;  4P71 C;  4YRK A;  1QE0 A;  1ADJ A;  3UGT A;  4P74 A;  1NJ2 A;  3A7U A;  4YRM A;  1EVK A;  3R07 A;  2Q5H A;  1BBW A;  2DDZ A;  1GGM A;  3TEH B;  2XTI A;  4HWR A;  2ZTG A;  4YRS A;  3BFM A;  2ZZG A;  2DU5 A;  4YRP A;  2DQ0 A;  2ART A;  2P5I A;  4EO4 A;  1B8A A;  1NYQ A;  4H2S A;  1Z7N A;  4RQF A;  1WQW A;  3VQW A;  4L87 A;  1WNL A;  2DTI A;  2EL9 A;  4P72 A;  3HRI A;  1WLE A;  4YRJ A;  1X56 A;  3V8J A;  12AS A;  2Q7H A;  4P72 C;  2EWN A;  4H2T A;  1BIB A;  11AS A;  2CIM A;  4UP7 A;  1YFR A;  2XGT A;  1B70 A;  3VQV A;  3RKX A;  3QTC A;  4XTW A;  1USY A;  5ELO A;  4PG3 A;  3FJP A;  2ZT8 A;  4UP8 A;  3RKW A;  4WJ3 M;  2ZNJ A;  1USY C;  4XTZ A;  2ZNI A;  3E9I A;  2ZZE A;  3P8Y A;  3L4G B;  3CMQ A;  2I4L A;  2ZT6 A;  4AH6 A;  3W3S A;  1NJ6 A;  2ZZF A;  3A7R A;  4HWT A;  4X5O A;  4YDQ A;  1LYL A;  2I4O A;  3P8T A;  2AMC B;  2FYK A;  4P3O A;  3TUP A;  1E1T A;  2ZIM A;  3A32 A;  1X54 A;  4TVA B;  2P0L A;  2DXU A;  2DZ9 A;  2QHV A;  4H2U A;  3LSQ A;  1EQR A;  2RHQ A;  3HXZ A;  1ASZ A;  4CS3 A;  4YRN A;  5KNN A;  4TVY A;  1HTT A;  1KMN A;  4KQE A;  2QHU A;  4WF2 A;  3MF2 A;  2CJ9 A;  4YRL A;  4YRR A;  4YRG A;  4WJ4 A;  3HTZ A;  3IAL A;  3REU A;  1JJC B;  2C8M A;  3EFR A;  3IG2 A;  2DQ3 A;  2ZIO A;  3TEG A;  4XU3 A;  3UGQ A;  3A74 A;  1BIA A;  2DTH A;  3RIR A;  4OP0 A;  2ZIN A;  4P74 C;  1X01 A;  4YRQ A;  4YCW A;  3BJU A;  1WPY A;  2ZR2 A;  1HXD A;  3E9H A;  4PHC A;  4DQ2 A;  2DTO A;  1SRY A;  3PCO A;  1E24 A;  4TQF A;  4CH6 A;  3ERR A;  4P75 A;  4YCU A;  1W66 A;  1ASY A;  3HFZ B;  3HXY A;  3L2Z A;  2I4N A;  4H02 A;  4YRE A;  2E3C A;  3REX A;  4H2Y A;  1EVL A;  2DKG A;  4CH4 A;  3V7C A;  3NEM A;  3RKY A;  2QHS A;  4CS2 A;  1YFS A;  3P8V A;  1L0W A;  2ZT7 A;  4BW9 A;  3A5Z A;  5HGQ A;  3HY0 A;  3V7S A;  4XEO A;  4RQE A;  2E64 A;  1Z7M A;  1PYS A;  3HXW A;  4H2X A;  4HWO A;  4UPA A;  2E41 A;  2IY5 B;  4G84 A;  4H2V A;  5C51 B;  3PZC A;  4Q6G A;  4NCX A;  2AKW B;  4XTX A;  1IL2 A;  2ALY A;  2E1H A;  5E3I A;  4E51 A;  1WYD A;  4EX5 A;  4BWA A;  1H4V B;  1SES A;  4ZTZ B;  2RHS A;  2QHT A;  4TWA A;  2ODR C;  4P3P A;  4XTY A;  1HC7 A;  1WU7 A;  1H4Q A;  2ZT5 A;  2DXT A;  4G85 A;  3PCO B;  4XU2 A;  2J3M A;  3HXV A;  3V7R A;  2ODR D;  3TEH A;  1B7Y A;  1C0A A;  1BBU A;  1NJ1 A;  3QO8 A;  1SET A;  1SER A;  4TTV A;  4HA8 A;  4XTU A;  1YB3 A;  1N9W A;  4TVW A;  3QNE A;  1NNH A;  3NEN A;  3HFV A;  3V8L A;  4YCV A;  1YFT A;  1WQ7 A;  2E5A A;  2G4C A;  1B70 B;  3QO7 A;  1EOV A;  3VQY A;  2PME A;  3IKM B;  4XU1 A;  2CJB A;  4YRI A;  3VQX A;  2PMF A;  1ATI A;  4YYE A;  4YRC A;  4P71 A;  1QF6 A;  3HXX A;  4YRT A;  4J15 A;  4P3N A;  4XTV A;  4ZIB A;  2EAY A;  5K1X A;  2E10 A;  3V8K A;  4YRO A;  1H4T A;  1E1O A;  2Q7E A;  4UP9 A;  4P73 A;  2CGH A;  4HVC A;  1KOG A;  2C7I A;  5K1P A;  3L4G A;  2DEQ A;  1G51 A;  4Q15 A;  4P73 C;  1B7Y B;  4P75 C;  2Q5I A;  3RUX A;  3KFU A;  3VBB A;  1X2G A;  3HY1 A;  2ZXF A;  4DPG A;  2AMC A;  2RHQ B;  2EJG A;  1NJ8 A;  2CJA A;  3NEL A;  2DZC A;  3MF1 A;  1KMM A;  4TVA A;  3A5Y A;  4LNS A;  2EJ9 A;  1EIY A;  2HNI A;  1NJ5 A;  3MEY A;  2Q7G A;  2DVE A;  2DJZ A;  4K86 A;  4KR3 A;  5C52 B;  3HRK A;  1FYF A;  5F5W A;  2J3L A;  3ICA A;  1G5H A;  3EFS A;  4YP0 A;  1X2H A;  4ZTU B;  4KR2 A;  3UFG A;  1JJC A;  4HWS A;  4YPF A;  1X55 A;  2EJF A;  5C53 B;  3A31 A;  4OLF A;  4CS4 A;  2ZCE A;  2ZGW A;  3LC0 A;  3RGL A;  3M4P A; 
#chains in the Genus database with same CATH topology
 3MD0 A;  5CBG A;  4DYL A;  3T1H B;  4JYA B;  1WAZ A;  1YJN V;  1G5I A;  4IGG A;  1S5H C;  4O2A A;  2HVK C;  1H4S A;  2UUC B;  1DTO A;  4H2W A;  4DR7 B;  3IKL A;  3DSQ A;  1CPY A;  4IIJ B;  3A7A A;  3L1A A;  1EIY B;  4DR2 B;  4GUN A;  3OD4 A;  3DTU B;  1AIL A;  5LYJ A;  3I7F A;  4K87 A;  4RMF A;  2ALY B;  5FLX N;  4K0K B;  4DV2 O;  3ABL B;  3TGU H;  4OX9 B;  4H13 B;  3UH0 A;  2EJ7 A;  2ITC C;  2WLI A;  4H44 B;  4QPK A;  3AK2 A;  1DF4 A;  3OTO O;  5ELN A;  1KYO F;  4DR6 O;  2OCC C;  1JFF A;  4DUZ O;  3K5M A;  4CH3 A;  4TQD A;  1OCC B;  2RHS B;  4WBN A;  1FD9 A;  3LSS A;  3I56 V;  1E22 A;  5FNV A;  3G1Z A;  1YIJ V;  1IBM O;  1GM7 A;  3N2K B;  3WB2 A;  5GON A;  4MVO A;  4JI4 B;  1URF A;  1PNL A;  1PL4 A;  3R07 A;  2WAM A;  2JS5 A;  5KX5 B;  3OUF A;  1V54 C;  3OM3 B;  3RN4 A;  1Z5W A;  3P32 A;  5IJ0 A;  2XTI A;  2QGN A;  2JS3 A;  4YRS A;  2ITD C;  2RN9 A;  2LFR A;  4TV9 A;  1K4C C;  2DYS C;  3L74 H;  2EBO A;  5EC2 C;  2E74 B;  4GX0 A;  4DV5 B;  2JDI G;  3BPZ A;  1B8A A;  1NYQ A;  4MS2 A;  4F6E A;  2BOC C;  4ZHQ B;  1WNL A;  2DTI A;  4A5U B;  2E5L B;  5LBQ A;  12AS A;  1Q86 W;  1KP3 A;  3ZMS A;  4JI2 B;  2OCC B;  11AS A;  4JYC A;  1YJ9 V;  4H0L B;  1SQQ H;  2CUG A;  4FLT A;  1Q7Y W;  4UP7 A;  4PI0 A;  2CTR A;  1H2N A;  2V7Q G;  3QTC A;  1N34 B;  3JAS B;  2RDC A;  2NS6 A;  1QVG U;  4GYC B;  3FFQ A;  3FJP A;  1XBL A;  2ZT8 A;  2M7W A;  1V54 B;  3RKW A;  4WJ3 M;  1AI7 A;  1M57 C;  1VQ4 V;  3ETQ A;  4ICG A;  1T5E A;  2IJH A;  1XMQ O;  2Z0A A;  2ZZE A;  4I4T A;  3CPW U;  5IJ0 B;  2UXB O;  1MZF A;  1K5S A;  4NXN O;  2A79 B;  2P4K A;  2HKO A;  3K3W A;  4FFB B;  1Q6H A;  4YDQ A;  3FAV A;  5CN0 A;  3CCR V;  2FYK A;  4P3O A;  2YI8 A;  4B7E A;  1GM9 A;  1K3E A;  5KHK A;  3THO A;  5DM6 V;  1AJP A;  1GK9 A;  1VQ8 V;  1BHB A;  1X54 A;  2P90 A;  4DR1 B;  2P0L A;  4BIZ A;  5CA0 B;  5JVD A;  5EK0 A;  1G8M A;  4EFE A;  2YIC A;  3LSQ A;  3ZN1 A;  4KHP B;  4X9Q A;  1EQR A;  3SYC A;  4Z1V A;  1WB8 A;  1UJW B;  2RHQ A;  2NNU A;  5JWP A;  4DO2 A;  3ZX6 A;  1L8D A;  4FLU A;  1HNW O;  2ZDI C;  1KMN A;  2CTP A;  3CD6 V;  2Z5U A;  5EYP B;  2XOK G;  4YRR A;  3LDD A;  5AG2 A;  1M57 B;  2YIA A;  3ETD A;  1I7F A;  1AJQ A;  3O65 A;  2HG5 C;  1YI2 V;  2HEP A;  4NXM B;  4XU3 A;  3FB7 C;  1WPX A;  1ORQ C;  3ABM C;  1GRJ A;  1AJN A;  1VF5 B;  2KB1 A;  4IHJ B;  1WPY A;  1HXD A;  4I4T B;  4DR4 O;  3CX5 F;  1SQF A;  4WF9 V;  1SRY A;  1HNZ B;  1M90 W;  3SPH A;  4YY3 B;  1VQM V;  3JD4 A;  4CH6 A;  2PY5 A;  3ERR A;  3OTF A;  5H5N A;  4TT3 G;  1F4N A;  2Q0O C;  3D8C A;  4H02 A;  5ITZ B;  4JI6 O;  3RWR D;  1Z5V A;  3FYE B;  4H2Y A;  3LDC A;  4PDR A;  4K3A A;  2PF4 E;  3NEM A;  2K1E A;  3DXR B;  4NYK A;  2LW7 A;  2ZT7 A;  1YSC A;  4B3T O;  3SYQ A;  2F43 G;  1P4R A;  3AG3 B;  5HGQ A;  1R3K C;  1E1Q G;  5H9C A;  4XEO A;  1K97 A;  3V7S A;  1L0N H;  1WPB A;  2FKX A;  5E79 Z;  4H2X A;  4O4I B;  2E41 A;  3ZRS A;  5CA3 A;  2JEU A;  3KCX A;  2A9H A;  1Q5O A;  4JI7 O;  1IL2 A;  4I0X B;  3JAW B;  4FZ1 A;  4UCT A;  2E1H A;  3OUS A;  4G2K A;  5E3I A;  1J5E O;  4UXN A;  1M56 B;  4UCO A;  4BWA A;  1QBZ A;  3E86 A;  4PI2 A;  2CH7 B;  3WFV A;  3DC5 A;  1NJI W;  4GT1 A;  1IXB A;  4YHH O;  4B7K A;  3WG7 C;  5CB4 A;  1NQT A;  1P49 A;  4R6Z A;  4ZOL A;  2UUA O;  1OHH G;  2YDE A;  2ODR D;  3TEH A;  4X1I B;  4YJ3 A;  3JAK A;  3CC2 V;  3AG7 A;  1FXV A;  4DXW A;  3LDE A;  1Y67 A;  4CC6 A;  4XTU A;  1YB3 A;  4O4H A;  2KG7 A;  3LSU A;  4B3M B;  4DR6 B;  4WFB V;  4TSF G;  4LF7 B;  1IBM B;  4LWS A;  1VQ9 V;  3L72 H;  1EOV A;  1QHT A;  2Q0A A;  4JI0 O;  4PDM A;  1L0L H;  1QLE C;  2WLN A;  4DV7 O;  1EBO A;  3B4S A;  1B3Q A;  4YRI A;  2QWP B;  2PMF A;  2JGD B;  1ATI A;  4W4L A;  3JAL A;  2IU0 A;  1K33 A;  5KLV H;  4X1K A;  1M9N A;  4P71 A;  5B3S C;  3HXX A;  3GWO A;  2PZS A;  2RQ6 A;  4FM0 A;  3WG7 B;  1ARO P;  4XTV A;  1GTO A;  3FD9 A;  2EAY A;  1KU9 A;  4E4E A;  2W0X A;  3BA9 A;  3ZN0 A;  3OEH G;  4P73 A;  1XEQ A;  3EFF K;  4HVC A;  2IBZ H;  4ZOL B;  1Y74 A;  1N32 O;  2N05 A;  4Q15 A;  4P73 C;  4DUY B;  3RUX A;  3VBB A;  3QF7 A;  2UUB B;  4JTD B;  1FFX A;  2ZXF A;  3MHS C;  2QKS A;  5KHJ A;  2PGG A;  2E76 B;  2PUS A;  5CBF A;  1SZX A;  1FAF A;  2Q9L A;  4DPG A;  2AMC A;  5H6Q A;  2FML A;  1SF9 A;  4LFB B;  1OCZ C;  2CJA A;  3NEL A;  5KUM A;  1WN7 A;  1VAR A;  4JI3 O;  3A5Y A;  3OFN G;  1N4C A;  1QLE B;  5JQG A;  2V4D A;  1XNR B;  4LF9 O;  4IL6 Z;  4F6R A;  2W6I G;  3CCU V;  1Q82 W;  1F23 A;  2VWJ A;  2Q7G A;  3MAQ A;  4K86 A;  1TGO A;  4KR3 A;  1XUQ A;  1D5A A;  4PA3 A;  3HRK A;  2GHY A;  4LF8 B;  3SGI A;  5LMN O;  2QKC A;  3UM7 A;  2Q5Z A;  1BQ0 A;  2N74 A;  3Q4H B;  4JTA B;  4NXN B;  5JJN B;  2QSA A;  4PD4 F;  3F7Y C;  4JI1 O;  3O9O A;  3FB5 C;  4JYY A;  1JJC A;  4HNA A;  2BCC H;  4BR6 A;  3JCU Z;  1EZJ A;  2MK3 A;  2IU3 A;  4O4L B;  3A31 A;  4U3J B;  1XNQ B;  2X6A A;  2EUL A;  4BAY A;  3ZHV A;  5KA5 A;  1TA8 A;  1F7Y A;  4NKG B;  5LGN A;  3QVN A;  2GUZ A;  2XAH A;  1J5W A;  3HKC B;  1OCZ B;  3B8M A;  3RF1 A;  3RL6 A;  2ARU A;  1R6T A;  4WI1 A;  4XEM A;  5IJ9 B;  5L3E A;  4LNU B;  2IH1 C;  4X65 B;  1KMI Z;  5EC1 C;  3HFZ A;  3E8B A;  2W0F C;  3U0Z A;  1BHA A;  4RDX A;  5IYC O;  4FLV A;  1PYS B;  3ASN C;  3RAC A;  2IJK A;  1HP8 A;  2X6C A;  4MSW C;  4I55 B;  1KC8 W;  2VQE O;  1AR5 A;  3F5W C;  5CA1 B;  4ZI7 A;  4AQY B;  2QTO A;  1AI5 A;  2BTQ B;  1GKF A;  2YSU B;  3NXS A;  1H2S B;  4YRF A;  4DR4 B;  3HXU A;  3I5D A;  1EFW A;  2QA4 V;  1ZL8 A;  4CH5 A;  2X0L A;  1EFR G;  2AKW A;  1VQ6 V;  4MTX A;  4YRK A;  1ADJ A;  1BL8 A;  1GN3 A;  2DE0 X;  3UGT A;  2ADQ B;  1NJ2 A;  4DV4 B;  2QJ1 A;  4O2B B;  5IDJ A;  4J7Z A;  3X2Q C;  1Q43 A;  4XBF A;  3P3P A;  2FTK A;  1BBW A;  2DDZ A;  1XMO O;  4MVQ A;  1KEC A;  3ZRX A;  1GGM A;  1FJG B;  3MDS A;  5KA6 A;  2DMX A;  2CTQ A;  3BFM A;  1ZTE A;  2GUZ B;  1JA8 A;  4P30 A;  3HKB B;  5A9G A;  2X7R B;  4LVJ A;  4U7N A;  3CP1 A;  1R3J C;  4JAA A;  1H2K A;  4DV0 O;  3JD0 A;  4I5S A;  2P5I A;  3CCE V;  1VQ7 V;  4X20 B;  4LF6 B;  3N2G B;  4H2S A;  5IWA O;  1FS0 G;  1WQW A;  4EKW A;  3ZHT A;  2WSS G;  4LFC O;  2PYL A;  1SS3 A;  3TXQ A;  2EL9 A;  3DGE A;  3TCU A;  2JK5 C;  4JZG A;  3HKD A;  1N33 O;  1F4M A;  2H8P C;  3V8J A;  3F5T A;  1ZX3 A;  2Q7H A;  4XDL A;  2A8E A;  4N21 A;  3IGA C;  2HHH O;  1MNG A;  1US6 A;  2Q8V A;  1SQX H;  2OIE A;  1YFR A;  1HDJ A;  4JZ2 A;  3UT5 B;  4P9O A;  1B70 A;  5J2T A;  2JJ1 G;  3RKX A;  2R72 A;  3OAA G;  1USY A;  3X2Q B;  4PG3 A;  3ZBH A;  2OIG A;  3R65 A;  4LBE C;  4K35 A;  3E22 B;  3JAT B;  2YC0 A;  2ZNJ A;  1X59 A;  1USY C;  3RYH B;  3JD1 A;  1MA1 A;  4DW1 A;  1I94 O;  2ZNI A;  4F4L A;  1VQN V;  3K5O A;  3P8Y A;  2BSK A;  3L4G B;  2EX3 A;  4TV8 A;  1WA8 A;  2ATK C;  2ZT6 A;  3ZHU A;  5H6R A;  2CK3 G;  4AH6 A;  4MVM A;  2F4V B;  4DK1 A;  2UXC O;  2WA3 A;  3A8T A;  1NTM H;  2ZZF A;  5LGT A;  2EIK C;  1N36 O;  3RBZ A;  1LYL A;  2I4O A;  4PEL A;  3M7M X;  3TUP A;  3AG2 C;  2HLD G;  2Q67 A;  4Q20 A;  1EM1 A;  3A32 A;  4I9W A;  1LUV A;  1JOY A;  4ZBM A;  3K03 A;  1MSW D;  3RT3 C;  2H94 A;  1BGY H;  4HZ3 A;  4NTX A;  2YIB D;  3A2F A;  1THZ A;  3C90 A;  4X66 O;  1QR9 A;  3QG5 A;  4X62 O;  3HXZ A;  2WPD G;  3T1Y B;  2OYQ A;  3OR7 C;  4N23 A;  1S5L Z;  3CB2 A;  1U96 A;  2HJD A;  1IZ3 A;  5F2V O;  4OGQ B;  2ADP A;  3TET A;  5J2T B;  4YRL A;  2R9R B;  4LFA O;  3K57 A;  3CCM V;  3REU A;  2XAQ A;  1IDS A;  2XAF A;  4YJ2 B;  5EZY A;  2CE4 A;  2DQ3 A;  2W6J G;  3L75 H;  2YXY A;  2QM8 A;  4LP8 A;  3T4Z A;  3BHP A;  4DV6 O;  1M5I A;  1BIA A;  2DTH A;  2F93 B;  3E83 A;  2Q4P A;  1XRE A;  4YRQ A;  1R6N A;  3BJU A;  3C3T A;  2BSK B;  1X4T A;  3CCJ V;  4HAM A;  4PHC A;  1WA8 B;  4DQ2 A;  2DTO A;  1BQZ A;  1WB7 A;  4KFM A;  4R7C A;  5JCO A;  3PCO A;  1YHQ V;  1N0J A;  2JVD A;  5B1A C;  3AG1 C;  3BCC H;  1JX9 A;  2X6B A;  3G80 A;  4YCU A;  2B5U A;  4O2A B;  5JCO C;  4MW8 A;  3L2Z A;  5LMU B;  1QQC A;  4OPH A;  4UVA A;  3B40 A;  3ABU A;  3H01 A;  1JQ0 A;  4HYO A;  5LMN B;  1NH2 B;  2DKG A;  4CH4 A;  2ZE6 A;  1W59 A;  5LYJ B;  4CS2 A;  1YFS A;  2UXD B;  3IC7 A;  3AK1 A;  4BW9 A;  2BOB C;  3ZRV A;  2AHY A;  3FB8 C;  1WJZ A;  1RPO A;  3CC4 V;  2WLI B;  5GW7 A;  5A2Q N;  4RQE A;  3HXW A;  1NS1 A;  5D5P A;  1Q6U A;  2A06 H;  1K8A W;  1JFF B;  4JI5 B;  1JPX A;  4PA9 A;  3K0D A;  4LVI A;  3BVO A;  4JV5 B;  3CWB H;  4H2V A;  5C51 B;  4WBN B;  2GDS A;  2Y69 C;  1RM1 C;  5FNV B;  4XTX A;  1BT8 A;  2RJZ A;  3ICX A;  5GON B;  1RSO A;  4E51 A;  4U3F H;  2XHB A;  4DV1 B;  1H4V B;  3CSX A;  3M8A A;  3JAR A;  1SES A;  5BMV A;  4BW5 A;  4TWA A;  2DYS B;  1HR0 B;  3AG1 B;  5B1A B;  2B9Z A;  4LF4 B;  1HC7 A;  2RMK B;  5LHG A;  1AVM A;  3IAY A;  4LF5 O;  1H4Q A;  3P3N A;  4TV9 B;  3PCO B;  1KD1 W;  1ENV A;  3HKE A;  2J3M A;  1IBK B;  3OGC C;  2M6Y A;  3I55 V;  3V7R A;  5EIB D;  2VQF B;  4DR5 O;  4WCE V;  1NVP D;  1G1X B;  4PA6 A;  1PV0 A;  2HVJ C;  2CDY A;  1PPJ H;  3K5N A;  3CCQ V;  2AW9 A;  2KSD A;  1SET A;  1S77 D;  5LHH A;  4HA8 A;  1GN6 A;  1N9W A;  4TVW A;  3QNE A;  1VQK V;  4L8J A;  3NEN A;  3L9D A;  4PJ0 Z;  3HFV A;  3ASO C;  3W7X A;  2PI5 A;  3R66 A;  4GZR B;  1Y76 A;  3G71 V;  4PHZ A;  4K8Z A;  2Y69 B;  1AR1 B;  1RM1 B;  5B1B C;  3ZMZ A;  5C8Y A;  3VQY A;  2QE7 G;  4DV3 O;  2Y0I A;  2EIN C;  1GAX A;  2P6J A;  2PME A;  4Z2W A;  3LUT B;  3IKM B;  4XU1 A;  2CJB A;  3ZIA G;  1EN6 A;  1RSO B;  2Q68 A;  3ZHQ A;  4IYH A;  3UO2 A;  3WU2 Z;  4MVS A;  2OWO A;  4RAI A;  1YVW A;  3B09 A;  2XT9 A;  3CME V;  1LR1 A;  4ZIB A;  2ZM6 O;  3ZMU A;  1VQ5 V;  1H4T A;  4AIL C;  2K9P A;  5FL7 G;  2GV9 A;  1Y4M A;  3ZED A;  3RYC A;  4UP9 A;  3FAV B;  1FPO A;  5EBL C;  4WFF A;  2EIM C;  1G51 A;  1RPR A;  4KUM A;  1Q90 D;  1V55 C;  2QWR B;  4FZ0 A;  5IT9 N;  3J7A U;  2Q5I A;  2R9A A;  3KFU A;  1KKC A;  5JVD B;  5IYZ A;  3ETG A;  4X88 A;  5KMG A;  3SYO A;  2IJJ A;  3ZCC A;  2RHQ B;  3UCS C;  1IBL O;  1GO3 F;  1VEW A;  3K9S A;  5KHI A;  5B1B B;  4JI8 B;  1HNX B;  2DZC A;  3OMI B;  1Y76 B;  3NR7 A;  2EIN B;  4TVA A;  1MG1 A;  2UXX A;  2QKA A;  2DJZ A;  5C52 B;  3ABM B;  3EVK A;  2DWD C;  4XDK A;  2UXN A;  5F5W A;  4FPP A;  3ZRW A;  2UXC B;  4GKJ O;  4KP4 A;  5BR8 O;  4ZTU B;  3UFG A;  3BAB A;  3E35 A;  2YXH A;  4B3R O;  1X55 A;  4OXS A;  2EIM B;  4WFA V;  1YTF B;  4QJF B;  1V55 B;  2NR5 A;  2AZ2 A;  1G6U A;  4CS4 A;  3FYI B;  4J11 A;  5KUK A;  2LJ2 A;  2YIB A;  3AG4 C;  2LP7 A;  4DV2 B;  4B3S O;  2AXT Z;  4KL1 A;  2VS0 A;  3JD2 A;  3OMN B;  5LP6 A;  3OTO B;  1SQG A;  3OD1 A;  4DRX A;  2DU7 A;  2JJ2 G;  5CBH A;  4DUZ B;  2ZR3 A;  5LP6 C;  5L3C A;  4HWP A;  3QO5 A;  4FJC C;  3N27 A;  3AK3 A;  4H2X B;  1TUB A;  3D3I A;  2P7T C;  4NVP A;  3GVM A;  3NET A;  1SQV H;  3E2E A;  1JMK C;  1NKD A;  1GM8 A;  2GSM B;  2KQX A;  4O2D A;  1I08 A;  4G28 B;  3APO A;  3H1I H;  4FK5 C;  3ZHR A;  3T1H O;  4XU0 A;  4MT8 A;  4JYA O;  2E65 A;  1VQZ A;  1I0H A;  4X1Y A;  2ODM A;  1RP3 B;  1RIQ A;  2IY5 A;  3FX7 A;  1TVK A;  4GX1 A;  5IYB O;  3JSN A;  1NYR A;  4FFK A;  3RYI A;  5IY5 C;  3IFX A;  2UUC O;  1ADY A;  1FFT B;  5LXT A;  4P71 C;  1QE0 A;  4P74 A;  1SQB H;  3SJQ C;  4YRM A;  5CB4 B;  4DR2 O;  3G67 A;  1S72 V;  1XHX A;  3S3W A;  2LGQ A;  1B06 A;  4PDL A;  2QDO A;  2WLK A;  4K0K O;  1K5Q A;  3H1K H;  3K06 A;  4C7U A;  4OX9 O;  1VQP V;  3TEH B;  4UFZ A;  1SKV A;  1S76 D;  4YJ3 B;  3JAK B;  3JSL A;  4HWR A;  2ZTG A;  4JAU A;  2LO1 A;  2ZZG A;  4UCS A;  1HWY A;  2GBO A;  4O4H B;  2DU5 A;  1G4Y B;  3S3X A;  2A0L A;  2KG7 B;  2DQ0 A;  3STZ C;  1JR9 A;  3VOU A;  2ART A;  4EO4 A;  4MVZ A;  1XL4 A;  4JI4 O;  1Z7N A;  4RQF A;  1JJ2 U;  4KXR A;  4LWS B;  5KHG A;  2R70 A;  3VQW A;  1TUB B;  1K92 A;  4P72 A;  3HRI A;  1WLE A;  3CJH A;  1X56 A;  2WLM A;  5LGU A;  1XMQ B;  2Y4U A;  5HFM A;  5HFL A;  2XAG A;  4P72 C;  5B3S B;  2EWN A;  4H2T A;  1BIB A;  3T4D A;  2UXB B;  2ILM A;  3JAL B;  2DOS A;  1V9P A;  2CIM A;  3ZHS A;  3BEH A;  2YEV A;  4X1K B;  1R3I C;  1KBH A;  2EIJ C;  1Q8I A;  4DV5 O;  1GMG A;  5DED A;  2F66 C;  4MVU A;  4PDV A;  3K5L A;  4UP8 A;  4BIU A;  1L1F A;  5BZB A;  3TK1 A;  4ASU G;  4J10 A;  1YJW V;  3E9I A;  1Y74 B;  4NB5 A;  5LOV A;  4JI2 O;  1VF6 A;  4Z1M G;  4UB6 Z;  2I4L A;  2ZT9 B;  4PV1 B;  2HR3 A;  2DW4 A;  3RFR A;  1HNW B;  1FFX B;  3A7R A;  4HWT A;  2JEX A;  3P8T A;  1N34 O;  1I5X A;  2AMC B;  4D7S A;  4TWK A;  1E1T A;  4QIW F;  1DLB A;  1SA0 A;  2A7W A;  5B1N A;  1DGS A;  5JQG B;  3OMA B;  4F6R B;  1VP7 A;  2QHV A;  4H2U A;  1H2L A;  4O4J A;  1BE3 H;  2NN4 A;  3CRC A;  1B6Q A;  1ZUQ A;  4YRN A;  5KNN A;  4TVY A;  2ETN A;  1AI4 A;  3KCY A;  3W7S A;  1HTT A;  4KQE A;  1NZ6 A;  1H8E G;  3MF2 A;  2YEV B;  3M99 B;  3ZS8 C;  2CJ9 A;  2CGN A;  4FM1 A;  4YRG A;  4WJ4 A;  3HTZ A;  1JJC B;  2LGW A;  1FXH A;  1PD3 A;  2ZE7 A;  4DR1 O;  4HNA B;  2ZIO A;  3W7T A;  2L6L A;  1NT2 B;  1P84 F;  3F7V C;  1R1B A;  3SDL A;  4JI6 B;  1AR4 A;  3P30 A;  1YCI A;  4KHP O;  4UV8 A;  4CBC A;  2G38 A;  1ROP A;  2QM7 A;  4P2Z A;  4YCW A;  1PL0 A;  3KKY A;  2ZR2 A;  2QWQ B;  3E9H A;  4ABM A;  4B3T B;  4J7J A;  4YIP A;  1D5N A;  3W7U A;  4DW0 A;  1E24 A;  2GTS A;  4J42 A;  3JYC A;  4X89 A;  2Q73 A;  1FYJ A;  3IJ4 A;  4I9Q A;  4P75 A;  1SQP H;  3ASN B;  1W66 A;  2XAJ A;  1SZT A;  3HFZ B;  3HXY A;  4R8C A;  1SA0 B;  4JI7 B;  5L3F A;  4YRE A;  2WLL A;  5J2U A;  2E3C A;  2Q6A A;  1J5E B;  4LVK A;  2EZO A;  1NBM G;  3A0R A;  3RKY A;  2QHS A;  2F23 A;  1L0W A;  2QTS A;  3CCS V;  3A5Z A;  4LH6 A;  3CMA V;  2PYJ A;  4ZI7 B;  1CEZ A;  1HNZ O;  4UVC A;  3JD3 A;  3HY0 A;  3H9V A;  4YY3 O;  5H2F Z;  2E64 A;  4YHH B;  4UPA A;  1R73 A;  1PNM A;  2A3Q A;  1ZL8 B;  3ABT A;  4Q6G A;  3UKM A;  2AKW B;  1NU1 H;  2ALY A;  5FPR A;  2UUA B;  3T1C A;  3WB0 A;  4MTF A;  3RVZ A;  3HPL C;  4EX5 A;  2EJR A;  3BA8 A;  1SC5 B;  1NR1 A;  3ABL C;  3IC9 A;  1W0K G;  3G4S V;  3C3S A;  4ZTZ B;  2RHS A;  2ODR C;  1YDX A;  5LHI A;  4XTY A;  4LC1 A;  3K08 A;  1WU7 A;  3N2K A;  2ZT5 A;  4G85 A;  5B66 Z;  1MMM A;  1Z2G A;  3JCZ A;  4NTY A;  3EXA A;  1H2M A;  3HXV A;  5KX5 A;  1K9M W;  4I50 A;  1NI8 A;  4JI0 B;  4J9Y B;  3CS5 A;  1YXB A;  2QWN B;  4DV7 B;  3H1H H;  4RUF A;  3J81 N;  1SER A;  4TTV A;  5IE9 A;  1YF2 A;  2PI4 A;  2IJI A;  1FXK A;  3B2E E;  5GTH Z;  1YEW A;  3HKD B;  1NNH A;  2Y48 A;  1U97 A;  2YID A;  3V8L A;  1FXK C;  1YIT V;  2YXL A;  1YFT A;  5KAI Z;  1XHZ A;  1LNQ A;  1WQ7 A;  4ZHQ A;  2ZQM A;  2HJF C;  2G4C A;  1B70 B;  1LUW A;  3QO7 A;  1B04 A;  4AI8 A;  3ML0 A;  3FB6 C;  1N32 B;  4JF3 A;  2OTJ V;  1OV9 A;  2N04 A;  4YRC A;  4LVM A;  2HFE C;  1H38 A;  4TOI A;  4B3M O;  2ZKO A;  4TV8 B;  3K9A A;  2EIK B;  1QU7 A;  1XIL A;  4FLX A;  3JAS A;  1KUQ A;  4J15 A;  3K59 A;  4LF7 O;  5K1X A;  2F95 B;  3AG2 B;  4X64 O;  1E1O A;  3K04 A;  4JI3 B;  2YS8 A;  3H1L H;  4WFE A;  1PNK A;  1JVM A;  4LF9 B;  2L35 A;  2XTA A;  4JTC B;  3ZMT A;  5JJE B;  4I50 B;  1HW7 A;  4JYB A;  3CE2 A;  2Y4T A;  1BCC H;  4FFB A;  2YI9 A;  2H3O A;  1FXK B;  1MSD A;  2ARH A;  2EJG A;  5DEC A;  4JI1 B;  2R9I A;  4DK0 A;  4TUY A;  5CA0 A;  1NTZ H;  4LNS A;  1COW G;  2HNI A;  1NJ5 A;  3MHH C;  2JIZ G;  3DC6 A;  1O9G A;  1VMG A;  1S0V A;  5EZY B;  4DUY O;  5GTI Z;  4G27 B;  2UUB O;  4HT4 A;  3OEE G;  1FYF A;  2J3L A;  1G5H A;  3EFS A;  1X2H A;  4LFB O;  1IX9 A;  5EYP A;  5BY1 A;  1YZB A;  1O9H A;  5L3G A;  2NLJ C;  4YPF A;  2QWO B;  1XNR O;  3D36 A;  2FL4 A;  2UU9 O;  3CXC U;  2XUM A;  1QR8 A;  3RYF A;  1ZAU A;  2ZD9 A;  3ZJZ A;  3D36 C;  4IHJ A;  1A32 A;  4LF8 O;  4OLF A;  2ZCE A;  1H2G A;  2O57 A;  2ZGW A;  1NR7 A;  2VQE B;  2LFS A;  1VQO V;  3LC0 A;  3RGL A;  3SR2 C;  4QNH B;  3M4P A;  4UCV A;  1VIB A;  4JGS A;  1JCH A;  3STL C;  1PM9 A;  1YGB A;  2ZE5 A;  5DN6 G;  4FMT A;  3EHB B;  3A0B Z;  4DR3 O;  4H33 A;  3SPI A;  3SYA A;  3CRA A;  3T2M A;  1DF5 A;  2ARS A;  5ITZ A;  3CCV V;  4TUY B;  3HB3 B;  5B5E Z;  1WP8 A;  1FKA O;  4XDJ A;  4FLZ A;  1XNQ O;  4FVM A;  2OT5 A;  4JAS A;  3DXR A;  2I4M A;  2ZDI A;  1BSM A;  2DWE C;  2E75 B;  1XMO B;  3WQZ A;  3K79 A;  4UCU A;  3HR0 A;  2CAZ C;  1TUE B;  4O4I A;  1I5Y A;  3JAR B;  3AG3 C;  4X65 O;  5BMV B;  4DV0 B;  2GTA A;  3LNN A;  4K88 A;  3SPJ A;  3M4Q A;  5JJJ B;  1B76 A;  3ETE A;  1VQL V;  4I0X A;  3JAW A;  3AEI A;  1PKX A;  3A7U A;  1J95 A;  1EVK A;  5IWA B;  4JPR A;  1Q81 W;  3RYF B;  4EB6 A;  3E8H A;  3HKE B;  2P67 A;  2Q5H A;  4LFC B;  3CRQ A;  2CTW A;  4AQY O;  2CH7 A;  3CRR A;  1N33 B;  1WNS A;  1M56 C;  5EBM C;  3SYP A;  4GCZ A;  2VWK A;  3SJC C;  3SJA C;  4PA7 A;  2QEX V;  3ASO B;  2HHH B;  4OPA A;  1CP9 A;  1NTK H;  4YRP A;  5LA6 A;  4B08 A;  5E1A C;  1N8R W;  4X1I A;  4DV4 O;  3OW2 U;  1WP7 A;  2RCV A;  4L87 A;  2Y0P A;  5C8Y B;  3FKS G;  2YUA A;  4CC5 A;  4YRJ A;  3D3Q A;  1FJG O;  1I94 B;  3J80 N;  4UB8 Z;  1AB3 A;  2PTM A;  4EEQ A;  1MOF A;  1ZSP A;  1XQ8 A;  1IUR A;  2V1D A;  3E89 A;  2XGT A;  2P5O A;  1UPG A;  2B1G A;  3VQV A;  1N36 B;  2FYU H;  4LF6 O;  4XTW A;  5ELO A;  1QVF U;  5L3D A;  2D2C B;  3PJS K;  4QE7 A;  1UFI A;  2JGD A;  3ZMV A;  2DJV A;  3RYC B;  1OJH A;  4EB6 B;  4XTZ A;  2Q69 A;  2EIL C;  4NR1 A;  4RUE A;  4GKK O;  2XAS A;  4IT5 A;  4X66 B;  2KKW A;  4X62 B;  3CMQ A;  2ZXW C;  4MVR A;  2F1M A;  4EFB A;  3W3S A;  3L70 H;  1NJ6 A;  5IYZ B;  5KMG B;  4X5O A;  4NTW A;  5LA6 B;  1AP5 A;  2ZIM A;  4LFA B;  4FIP C;  1Y6X A;  4TVA B;  1MZE A;  4LR3 A;  2DXU A;  3CYO A;  5KAF Z;  2DZ9 A;  2XND G;  4DV6 B;  2RNB A;  3CC7 V;  1N0N A;  2OCH A;  3GWK C;  2AZ0 A;  1R3L C;  1W2B U;  1ASZ A;  4CS3 A;  4K8X A;  2F4V O;  3L71 H;  3RGB A;  4HBN A;  3LNM B;  4FLY A;  2QHU A;  4WF2 A;  3ZRW B;  3RW0 A;  4X64 B;  4FLW A;  1QNM A;  3IAL A;  2C2A A;  2C8M A;  1KKD A;  3EFR A;  1NH2 D;  3IG2 A;  4DR7 O;  2WLJ A;  3TEG A;  2EIL B;  3UGQ A;  3A74 A;  5CMU A;  4UV9 A;  1RFY A;  3RIR A;  3BAA A;  3K58 A;  3Q4H A;  4OP0 A;  2B1I A;  2ZXW B;  2ZIN A;  4P74 C;  1PP9 H;  3AG4 B;  1X01 A;  3T1Y O;  5C93 A;  1DK1 A;  4WFH A;  4R50 A;  3CEI A;  1AP6 A;  4MTO A;  3CXH F;  1D2D A;  2QR4 A;  3KG2 A;  3RVY A;  5LP6 B;  4TQF A;  4O4L A;  1S3J A;  1OCR C;  4U3J A;  1M93 A;  3KZI Z;  4DRX B;  1XDC A;  1ASY A;  2QM4 A;  4J7K A;  2I4N A;  4JAV A;  2DYR C;  4J41 A;  3REX A;  1EVL A;  3HKC A;  3ABK C;  4WFG A;  3V7C A;  1XOU A;  2IH3 C;  1QCE A;  3P8V A;  4X8A A;  2P06 A;  5IJ9 A;  2HP8 A;  5BXZ A;  4YIO A;  2D3O W;  4LNU A;  5LL6 Y;  1K7D A;  2IW5 A;  5IY5 B;  4FM2 A;  3BFR A;  4X1Y B;  1PYS A;  1Z7M A;  1BS3 A;  1KB9 F;  4HWO A;  2IY5 B;  1TVK B;  1OZ0 A;  4LF5 B;  4G84 A;  2UU9 B;  3RYI B;  1EN4 A;  4I55 A;  4YXW G;  5LMU O;  3PZC A;  1KQS U;  4NCX A;  2ZE8 A;  3BRC A;  2OTL V;  1CXZ B;  5LXT B;  3JAM N;  1K34 A;  5CA1 A;  4DR5 B;  1M4U A;  1ZLZ A;  3L73 H;  2BTQ A;  2FB5 A;  4GLX A;  1WYD A;  2E5L O;  1Q3E A;  2P22 C;  2UXD O;  5IYD O;  4D7T A;  4QE9 A;  5EIB C;  1H8H G;  2QHT A;  1AI6 A;  1IVS A;  3TJT A;  3OT7 A;  1EZV H;  5L3B A;  4P3P A;  1R6K A;  5FPO A;  1KP2 A;  1OCR B;  3G6B A;  4DR3 B;  1VF6 C;  3APQ A;  3CCL V;  2DXT A;  4O2B A;  4JI5 O;  4JV5 O;  1VF7 A;  2WWW A;  4XU2 A;  2DYR B;  3H1J H;  4DV3 B;  2JGU A;  1B7Y A;  1C0A A;  3ABK B;  1K73 W;  2AGA A;  2LQT A;  5EBW C;  1GN4 A;  1BBU A;  1NJ1 A;  3QO8 A;  4DV1 O;  4U7O A;  1P7B A;  4LH7 A;  5J9P C;  3HKB A;  2JRI A;  1IXM A;  3CJH B;  4LCU C;  4CZZ A;  3PN1 A;  1HR0 O;  4LF4 O;  4UVB A;  2EIJ B;  4X20 A;  4BIO A;  4YCV A;  3N2G A;  1Y66 A;  2ZM6 B;  2E5A A;  4GX5 A;  3SJB C;  4D6T H;  2WA4 A;  1IBK O;  3K0G A;  3A0H Z;  3OGI B;  2VQF O;  1E1R G;  4AHC A;  2P4V A;  3CRM A;  1MAB G;  3VQX A;  5JH7 A;  4YYE A;  5D5Q A;  3OR6 C;  1NVP B;  4RO2 A;  2MW2 B;  2BTO A;  3B8N A;  3UT5 A;  1QF6 A;  2CGO A;  5LOV B;  3E8G A;  1BZK A;  4LVL A;  4YRT A;  1JJO A;  4RWU A;  1QLN A;  4PA4 A;  1IBL B;  4P3N A;  3U10 A;  4I7Z B;  2E10 A;  3SPG A;  3V8K A;  4YRO A;  1W0J G;  3E22 A;  3JAT A;  1Q6I A;  2Q7E A;  1EN5 A;  3RYH A;  2Z3Y A;  2CGH A;  4H37 A;  1KOG A;  2C7I A;  5K1P A;  3L4G A;  4NXM O;  2DEQ A;  1ZWI C;  3OE7 G;  1F51 A;  1B7Y B;  4P75 C;  1TAE A;  2BE3 A;  1X2G A;  3U11 A;  1OCO C;  1E79 G;  3HY1 A;  4IYI A;  4O4J B;  4QPJ A;  2LW1 A;  3CHX A;  1NJ8 A;  4GKJ B;  5BR8 B;  3BY6 A;  1YTF D;  4UUJ C;  4ZKI A;  3MF1 A;  1BMF G;  4MW3 A;  1KMM A;  4IIJ A;  4B3R B;  3G6E V;  1XI1 A;  1EIY A;  2EJ9 A;  3MEY A;  5B1O A;  2DVE A;  3UO3 A;  4MTG A;  2WLH A;  2EZP A;  4J80 A;  5TIS Z;  4GKK B;  3SPC A;  3B77 A;  5KHH A;  5JH7 B;  4E2L A;  4B3S B;  3ICA A;  4GX2 A;  4YP0 A;  4UCR A;  1S5J A;  1XL6 A;  4P9P A;  2DN9 A;  2IM9 A;  4KR2 A;  3WB1 A;  4JI8 O;  1HNX O;  1K4D C;  4YJ2 A;  1GH6 A;  4HWS A;  1OCC C;  1M1K W;  3UQ8 A;  2EJF A;  5C53 B;  3MQZ A;  2AHZ A;  3GB7 C;  3E8F A;  3TXS A;  1GN2 A;  4QGP A;  1OCO B;  3W7W A;  4J9Z B;  4W4K A;  2VRZ A;  2WLL B;  5J2U B;  1P7G A; 
#chains in the Genus database with same CATH homology
 2XAH A;  3MD0 A;  5CBG A;  1J5W A;  3JD2 A;  4JGS A;  1OCZ B;  3OMN B;  3B8M A;  3RF1 A;  3RL6 A;  1JCH A;  3STL C;  1YJN V;  1G5I A;  1YGB A;  2ARU A;  5DN6 G;  4WI1 A;  4XEM A;  4FMT A;  3OD1 A;  2DU7 A;  5L3E A;  1S5H C;  2JJ2 G;  3EHB B;  2IH1 C;  5CBH A;  2ZR3 A;  5EC1 C;  3HFZ A;  2HVK C;  3E8B A;  4H33 A;  3SPI A;  2W0F C;  3SYA A;  5L3C A;  3T2M A;  4HWP A;  1DF5 A;  2ARS A;  1BHA A;  4RDX A;  3QO5 A;  3CCV V;  1H4S A;  1DTO A;  3HB3 B;  4FJC C;  5IYC O;  4H2W A;  4H2X B;  1PYS B;  3ASN C;  3DSQ A;  3IKL A;  1CPY A;  3D3I A;  2P7T C;  4XDJ A;  3RAC A;  2IJK A;  3A7A A;  3L1A A;  3NET A;  1EIY B;  2X6C A;  4MSW C;  2OT5 A;  3DTU B;  4JAS A;  1KC8 W;  3E2E A;  3I7F A;  2I4M A;  1NKD A;  4K87 A;  4RMF A;  1GM8 A;  2GSM B;  2ALY B;  2ZDI A;  3F5W C;  4O2D A;  2DWE C;  3ABL B;  3WQZ A;  4G28 B;  2QTO A;  3UH0 A;  4FK5 C;  1AI5 A;  3K79 A;  2ITC C;  2WLI A;  4XU0 A;  4MT8 A;  1GKF A;  2YSU B;  3NXS A;  4QPK A;  2E65 A;  4YRF A;  1VQZ A;  1DF4 A;  1TUE B;  5ELN A;  3HXU A;  2IY5 A;  1RIQ A;  1EFW A;  2OCC C;  1I5Y A;  4GX1 A;  5IYB O;  2QA4 V;  3AG3 C;  1NYR A;  4CH3 A;  4CH5 A;  4TQD A;  1OCC B;  2X0L A;  1EFR G;  2RHS B;  5IY5 C;  3IFX A;  3LSS A;  3I56 V;  1E22 A;  2AKW A;  4K88 A;  3SPJ A;  3G1Z A;  1ADY A;  1B76 A;  3M4Q A;  3ETE A;  1VQL V;  4MTX A;  1YIJ V;  1FFT B;  1GM7 A;  1VQ6 V;  4P71 C;  1QE0 A;  4YRK A;  1ADJ A;  1BL8 A;  3UGT A;  4P74 A;  1NJ2 A;  3AEI A;  1PKX A;  4MVO A;  3A7U A;  3SJQ C;  4YRM A;  1J95 A;  5IDJ A;  1EVK A;  1S72 V;  4JPR A;  1PNL A;  1Q81 W;  3R07 A;  4PDL A;  2WAM A;  3X2Q C;  3E8H A;  2P67 A;  2Q5H A;  4XBF A;  3OUF A;  1V54 C;  2WLK A;  2FTK A;  1K5Q A;  3K06 A;  1BBW A;  2DDZ A;  3OM3 B;  4MVQ A;  3P32 A;  1KEC A;  3ZRX A;  1VQP V;  1GGM A;  3TEH B;  3SYP A;  1M56 C;  5EBM C;  1S76 D;  5KA6 A;  4GCZ A;  2XTI A;  4HWR A;  2ZTG A;  4YRS A;  3BFM A;  2ITD C;  4PA7 A;  4JAU A;  2ZZG A;  2LFR A;  4P30 A;  2QEX V;  1HWY A;  3ASO B;  2X7R B;  4LVJ A;  4U7N A;  2DU5 A;  3CP1 A;  1G4Y B;  1K4C C;  1R3J C;  2DYS C;  2EBO A;  1CP9 A;  5EC2 C;  3JD0 A;  4YRP A;  2A0L A;  3VOU A;  2DQ0 A;  3STZ C;  2ART A;  4I5S A;  2P5I A;  3CCE V;  5E1A C;  4GX0 A;  4EO4 A;  2JDI G;  1VQ7 V;  1N8R W;  4MVZ A;  1XL4 A;  3OW2 U;  1B8A A;  1NYQ A;  4H2S A;  1Z7N A;  4MS2 A;  4RQF A;  1FS0 G;  1JJ2 U;  1WQW A;  4EKW A;  2BOC C;  3VQW A;  4L87 A;  1WNL A;  2DTI A;  2WSS G;  1K92 A;  3FKS G;  2EL9 A;  4P72 A;  3DGE A;  3HRI A;  1WLE A;  2JK5 C;  3TCU A;  4YRJ A;  1X56 A;  2WLM A;  5LGU A;  1F4M A;  2H8P C;  5LBQ A;  3V8J A;  12AS A;  1Q86 W;  1KP3 A;  3ZMS A;  5HFM A;  2Q7H A;  4XDL A;  5HFL A;  2XAG A;  2A8E A;  2OCC B;  5B3S B;  4P72 C;  2EWN A;  4H2T A;  1BIB A;  4JYC A;  4N21 A;  3T4D A;  1YJ9 V;  1Q7Y W;  11AS A;  3IGA C;  1MOF A;  2CIM A;  4UP7 A;  1YFR A;  2V1D A;  3BEH A;  3E89 A;  2XGT A;  2YEV A;  1R3I C;  4P9O A;  1B70 A;  2EIJ C;  2JJ1 G;  2V7Q G;  2B1G A;  3VQV A;  3RKX A;  1GMG A;  3QTC A;  4XTW A;  3OAA G;  2NS6 A;  4MVU A;  1QVG U;  1USY A;  5ELO A;  3X2Q B;  1QVF U;  4PG3 A;  3R65 A;  5L3D A;  4LBE C;  3FJP A;  3PJS K;  4PDV A;  4QE7 A;  2M7W A;  2ZT8 A;  4UP8 A;  1V54 B;  4BIU A;  3RKW A;  1L1F A;  1AI7 A;  1M57 C;  3TK1 A;  3ZMV A;  5BZB A;  1VQ4 V;  3REU A;  4WJ3 M;  2ZNJ A;  1USY C;  4ASU G;  3JD1 A;  2IJH A;  1YJW V;  4XTZ A;  2ZNI A;  2Q69 A;  2EIL C;  4RUE A;  4F4L A;  1VQN V;  2ZZE A;  3E9I A;  3P8Y A;  2XAS A;  3L4G B;  4Z1M G;  3CPW U;  2ATK C;  3CMQ A;  2ZXW C;  4MVR A;  2I4L A;  1K5S A;  5H6R A;  2CK3 G;  2ZT6 A;  4AH6 A;  2A79 B;  4MVM A;  2HR3 A;  3W3S A;  2DW4 A;  2HKO A;  3K3W A;  1NJ6 A;  2ZZF A;  3A7R A;  5LGT A;  2EIK C;  4HWT A;  4X5O A;  4YDQ A;  3RBZ A;  5CN0 A;  1LYL A;  3CCR V;  2JEX A;  4PEL A;  2I4O A;  3P8T A;  1I5X A;  2AMC B;  2FYK A;  4P3O A;  3TUP A;  3AG2 C;  1GM9 A;  4TWK A;  2HLD G;  1K3E A;  1E1T A;  2Q67 A;  2ZIM A;  5DM6 V;  4Q20 A;  4QIW F;  1DLB A;  3A32 A;  1AJP A;  4FIP C;  1GK9 A;  4I9W A;  1VQ8 V;  1JOY A;  1BHB A;  1X54 A;  4ZBM A;  2P90 A;  3K03 A;  5B1N A;  4TVA B;  2P0L A;  1MSW D;  3OMA B;  4BIZ A;  2DXU A;  3CYO A;  2H94 A;  2DZ9 A;  5EK0 A;  2XND G;  4HZ3 A;  3CC7 V;  2QHV A;  4H2U A;  1G8M A;  1THZ A;  3LSQ A;  3ZN1 A;  1QR9 A;  1EQR A;  3SYC A;  1R3L C;  2WPD G;  1UJW B;  1W2B U;  2RHQ A;  3HXZ A;  2NNU A;  1ASZ A;  1B6Q A;  4DO2 A;  4CS3 A;  3OR7 C;  4YRN A;  5KNN A;  4TVY A;  4N23 A;  1AI4 A;  3LNM B;  2ZDI C;  3W7S A;  1HTT A;  1KMN A;  4KQE A;  2QHU A;  4WF2 A;  1H8E G;  3ZRW B;  3MF2 A;  3RW0 A;  2YEV B;  3M99 B;  3CD6 V;  2Z5U A;  3TET A;  2CJ9 A;  2XOK G;  4YRL A;  4YRR A;  2R9R B;  3LDD A;  4YRG A;  4WJ4 A;  1M57 B;  3CCM V;  3HTZ A;  2XAQ A;  2C2A A;  3IAL A;  3ETD A;  1KKD A;  1JJC B;  2XAF A;  2C8M A;  1FXH A;  1PD3 A;  1NH2 D;  3EFR A;  3IG2 A;  2WLJ A;  2DQ3 A;  3W7T A;  2ZIO A;  1AJQ A;  2HG5 C;  2W6J G;  1YI2 V;  3F7V C;  3TEG A;  2QM8 A;  4XU3 A;  2EIL B;  4LP8 A;  3FB7 C;  3UGQ A;  3A74 A;  1WPX A;  5CMU A;  3T4Z A;  4UV9 A;  1BIA A;  3P30 A;  2DTH A;  3RIR A;  1ORQ C;  4OP0 A;  4UV8 A;  2B1I A;  4CBC A;  2ZXW B;  3ABM C;  1ROP A;  2QM7 A;  3E83 A;  2ZIN A;  3AG4 B;  4P74 C;  4P2Z A;  1AJN A;  2KB1 A;  1X01 A;  1R6N A;  4YCW A;  4YRQ A;  3BJU A;  1PL0 A;  5C93 A;  3CCJ V;  1WPY A;  2ZR2 A;  1HXD A;  4HAM A;  3E9H A;  4PHC A;  4WFH A;  4DQ2 A;  4R50 A;  2DTO A;  4MTO A;  4WF9 V;  1SRY A;  4KFM A;  4R7C A;  1M90 W;  3KG2 A;  3PCO A;  3RVY A;  3SPH A;  3W7U A;  1YHQ V;  1E24 A;  4TQF A;  3JYC A;  3AG1 C;  4X89 A;  1S3J A;  5B1A C;  1JX9 A;  3JD4 A;  1VQM V;  1OCR C;  2X6B A;  4CH6 A;  3ERR A;  4P75 A;  4YCU A;  3ASN B;  2B5U A;  2XAJ A;  1W66 A;  1ASY A;  1SZT A;  4MW8 A;  3HFZ B;  3HXY A;  3L2Z A;  4TT3 G;  1F4N A;  4R8C A;  2I4N A;  4H02 A;  5L3F A;  4JAV A;  4YRE A;  2DYR C;  4UVA A;  2WLL A;  3ABU A;  2Q6A A;  1JQ0 A;  3FYE B;  3H01 A;  4HYO A;  2E3C A;  1EVL A;  4H2Y A;  3REX A;  1NH2 B;  2DKG A;  3LDC A;  4LVK A;  4CH4 A;  2EZO A;  1NBM G;  3ABK C;  4PDR A;  4WFG A;  3A0R A;  3NEM A;  3RKY A;  3V7C A;  2K1E A;  2IH3 C;  2QHS A;  4CS2 A;  1QCE A;  1YFS A;  3P8V A;  1L0W A;  3IC7 A;  4X8A A;  2ZT7 A;  1YSC A;  3CCS V;  2BOB C;  3ZRV A;  3CMA V;  3SYQ A;  2AHY A;  3FB8 C;  2D3O W;  3A5Z A;  4BW9 A;  2F43 G;  1P4R A;  1RPO A;  3AG3 B;  3CC4 V;  1CEZ A;  1K7D A;  2WLI B;  3JD3 A;  4UVC A;  1R3K C;  5HGQ A;  3HY0 A;  2IW5 A;  5IY5 B;  1E1Q G;  5H9C A;  5GW7 A;  1K97 A;  4XEO A;  3V7S A;  4RQE A;  2E64 A;  1Z7M A;  1PYS A;  3HXW A;  4H2X A;  4HWO A;  1R73 A;  2E41 A;  4UPA A;  1PNM A;  1K8A W;  1OZ0 A;  3ZRS A;  4G84 A;  1JPX A;  4PA9 A;  3K0D A;  4LVI A;  3ABT A;  4YXW G;  2JEU A;  5CA3 A;  4H2V A;  5C51 B;  2A9H A;  3PZC A;  4Q6G A;  2Y69 C;  1KQS U;  3UKM A;  1RM1 C;  2AKW B;  4NCX A;  4XTX A;  2OTL V;  1IL2 A;  2ALY A;  3T1C A;  1K34 A;  4MTF A;  2E1H A;  3OUS A;  4G2K A;  3RVZ A;  5E3I A;  3HPL C;  4E51 A;  1WYD A;  4EX5 A;  2EJR A;  4UXN A;  1M56 B;  1NR1 A;  4BWA A;  3ABL C;  1QBZ A;  1H4V B;  1W0K G;  3G4S V;  3E86 A;  1SES A;  5IYD O;  4QE9 A;  3WFV A;  2RHS A;  4BW5 A;  1H8H G;  1NJI W;  2QHT A;  1AI6 A;  4GT1 A;  2ODR C;  4TWA A;  2DYS B;  5L3B A;  5LHI A;  4P3P A;  3AG1 B;  1R6K A;  5B1A B;  1HC7 A;  4XTY A;  4LC1 A;  1KP2 A;  1OCR B;  3K08 A;  5LHG A;  1WU7 A;  1H4Q A;  3CCL V;  2ZT5 A;  2DXT A;  4G85 A;  3WG7 C;  3PCO B;  3JCZ A;  1KD1 W;  1ENV A;  1NQT A;  2WWW A;  4XU2 A;  2J3M A;  2DYR B;  3HXV A;  4R6Z A;  3OGC C;  3I55 V;  1K9M W;  3V7R A;  1OHH G;  4J9Y B;  4WCE V;  1NVP D;  2ODR D;  3TEH A;  1B7Y A;  1C0A A;  4PA6 A;  3ABK B;  2HVJ C;  1K73 W;  4RUF A;  5EBW C;  3CC2 V;  3CCQ V;  1BBU A;  1NJ1 A;  3QO8 A;  1FXV A;  1SET A;  4DXW A;  4U7O A;  1P7B A;  3LDE A;  5J9P C;  1SER A;  4TTV A;  1S77 D;  5LHH A;  4HA8 A;  4XTU A;  1YB3 A;  2PI4 A;  2IJI A;  1N9W A;  1IXM A;  1FXK A;  4LCU C;  4CZZ A;  4TVW A;  3QNE A;  1NNH A;  1VQK V;  3NEN A;  4WFB V;  3HFV A;  4UVB A;  2Y48 A;  3ASO C;  4TSF G;  2EIJ B;  3W7X A;  2PI5 A;  3V8L A;  4YCV A;  1FXK C;  1Y66 A;  1YIT V;  3G71 V;  1YFT A;  1LNQ A;  2Y69 B;  1AR1 B;  1RM1 B;  1WQ7 A;  5B1B C;  2ZQM A;  2HJF C;  4GX5 A;  2E5A A;  1VQ9 V;  1B70 B;  3ZMZ A;  2G4C A;  3QO7 A;  1EOV A;  3K0G A;  3VQY A;  2QE7 G;  2EIN C;  1E1R G;  4PDM A;  2P6J A;  1QLE C;  2PME A;  2WLN A;  3ML0 A;  1EBO A;  3LUT B;  3IKM B;  4XU1 A;  3FB6 C;  1MAB G;  4JF3 A;  2OTJ V;  2CJB A;  3VQX A;  4YRI A;  2PMF A;  3ZIA G;  1ATI A;  2Q68 A;  4YYE A;  3OR6 C;  1NVP B;  4YRC A;  4RO2 A;  2IU0 A;  1K33 A;  4MVS A;  4LVM A;  4RAI A;  3B8N A;  2HFE C;  1H38 A;  1M9N A;  4P71 A;  1QF6 A;  5B3S C;  3HXX A;  3GWO A;  3E8G A;  3K9A A;  4LVL A;  3CME V;  2EIK B;  4YRT A;  3WG7 B;  1ARO P;  4J15 A;  1QLN A;  4PA4 A;  4P3N A;  4XTV A;  4ZIB A;  1GTO A;  2EAY A;  5K1X A;  2E10 A;  3ZMU A;  3SPG A;  3V8K A;  3AG2 B;  4YRO A;  1W0J G;  1VQ5 V;  1H4T A;  1E1O A;  5FL7 G;  3K04 A;  2Q7E A;  1Y4M A;  3ZN0 A;  3OEH G;  4WFE A;  4UP9 A;  1PNK A;  4P73 A;  4ZTZ B;  1JVM A;  2Z3Y A;  3EFF K;  2CGH A;  5EBL C;  4HVC A;  4H37 A;  4JTC B;  2C7I A;  4WFF A;  3ZMT A;  1KOG A;  5K1P A;  3L4G A;  2DEQ A;  1ZWI C;  2EIM C;  1G51 A;  1RPR A;  4KUM A;  4Q15 A;  1V55 C;  4P73 C;  3OE7 G;  1F51 A;  1B7Y B;  4JYB A;  4P75 C;  2Q5I A;  3RUX A;  3KFU A;  3VBB A;  1X2G A;  1OCO C;  1E79 G;  4JTD B;  3ETG A;  4X88 A;  3HY1 A;  3SYO A;  2ZXF A;  2IJJ A;  2QKS A;  3MHS C;  5CBF A;  1FXK B;  4DPG A;  4QPJ A;  3ZCC A;  2AMC A;  5H6Q A;  2RHQ B;  2EJG A;  1GO3 F;  1NJ8 A;  1OCZ C;  2CJA A;  3NEL A;  3BY6 A;  5KUM A;  5B1B B;  1YTF D;  2R9I A;  4UUJ C;  4ZKI A;  3OMI B;  2DZC A;  1BMF G;  4MW3 A;  2EIN B;  1KMM A;  3MF1 A;  3A5Y A;  4TVA A;  3OFN G;  1QLE B;  1MG1 A;  2UXX A;  3G6E V;  2W6I G;  3CCU V;  2EJ9 A;  1COW G;  1Q82 W;  1F23 A;  3MHH C;  1NJ5 A;  2HNI A;  4LNS A;  1EIY A;  2JIZ G;  3MEY A;  2Q7G A;  5B1O A;  2DVE A;  2DJZ A;  4K86 A;  4KR3 A;  5C52 B;  4PA3 A;  4MTG A;  1S0V A;  2WLH A;  3HRK A;  3ABM B;  2GHY A;  2EZP A;  3SPC A;  4G27 B;  4HT4 A;  2DWD C;  3OEE G;  4XDK A;  3B77 A;  3UM7 A;  2UXN A;  1FYF A;  5F5W A;  4E2L A;  4JTA B;  2J3L A;  4GX2 A;  3ICA A;  4FPP A;  3F7Y C;  3ZRW A;  1G5H A;  1X2H A;  3EFS A;  1XL6 A;  4YP0 A;  4KP4 A;  2IY5 B;  4P9P A;  4ZTU B;  4KR2 A;  5L3G A;  3FB5 C;  3UFG A;  1JJC A;  3E35 A;  1K4D C;  2NLJ C;  4HWS A;  4YPF A;  3D36 A;  1EZJ A;  1OCC C;  1X55 A;  4OXS A;  1M1K W;  2MK3 A;  2EJF A;  5C53 B;  3CXC U;  2EIM B;  1QR8 A;  2IU3 A;  4WFA V;  4QJF B;  1YTF B;  1V55 B;  3A31 A;  3MQZ A;  2AHZ A;  2ZD9 A;  3GB7 C;  3E8F A;  3ZJZ A;  2X6A A;  4BAY A;  4OLF A;  5KA5 A;  4CS4 A;  1OCO B;  2ZCE A;  1H2G A;  3FYI B;  3W7W A;  1NR7 A;  4J9Z B;  2LFS A;  5KUK A;  1VQO V;  2ZGW A;  3LC0 A;  3RGL A;  5LGN A;  2WLL B;  3AG4 C;  2LP7 A;  4QNH B;  3M4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...