3VQIA

Crystal structure of kluyveromyces marxianus atg5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
252
Chain Sequence
MEELRERVWNGTINVEVVVSDAIVVPNTTLADKSCHIVMLRDAYLGFYLPTVVRKLADTIKVPYESDYRNWWFEYNGEGVPWEYPCGVLFDLLNKQMWELQLCHGDKYPRGILPLVDGHSQIKDYWRHQWKQACFILNGSAKRIMSLSIPDFENFWVSILSRNRSDFMAVRSKLFSMNKAKSLPVRVWTSNYAVLQPTVPVTLSVAELLDSIKLSSVKSVIIQGIDVSIEDNIFELYDIFASIDGFLYLVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Atg5
publication title Structural insights into atg10-mediated formation of the autophagy-essential atg12-atg5 conjugate
pubmed doi rcsb
source organism Kluyveromyces marxianus
total genus 76
structure length 252
sequence length 271
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3vqiA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vqiA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vqiA01
3A9KB 3HM3A 2K8CA 4GDLB 1L7YA 3APFA 3RZWC 3H1UA 5AEKB 2LJ5A 2REXA 4AJWA 4W9DA 2M8SA 4GSWA 3RZFA 3UQAA 3EC8A 4IWPA 5J17A 2IO0B 2LD9A 2KLGA 4DK5A 2ZCBA 3PLUA 1A5RA 4IWOA 5FR6A 3VUWA 4KIKB 2C5LC 2OJRA 1VD2A 3KH0A 4HVBA 4EZKA 1VCBA 3EFUA 3PRZA 2WX1A 4PS3A 1IP9A 4NPNA 2BGFA 4NJ7A 3ZLZA 2ZCCA 4I6LB 5CHWA 3EHVA 3NS8A 3WAOA 3P2BA 3RD2A 4GGQA 2LASA 4HWIB 3OAWA 4RM9A 4G11A 2JWZA 3X23A 4B6WA 4W9FA 2DZJA 3JVZX 4WWNA 2QHOA 3PV1A 3W1SC 1P0RA 2BYFA 3CSFA 2MWSB 2V1YA 3SHQA 2ZVNA 3A4SC 4KZ0A 3ZNGC 5J2RA 3W1YA 5AZGA 4B95A 4IG7B 2J0JA 4YL8A 4URKA 3IG3A 1WX8A 3HIZA 1Z5SB 3PGEA 3VUXA 2Y5BB 1V86A 3I3TB 1V5TA 5GMVA 3OLMD 1H4RA 2I1KA 5G55A 2AWTA 3RYTA 3L17A 3NHEB 2DYBA 4E3CA 3U30A 1LXDA 2NPTB 1SIFA 2RPQA 1I35A 2KANA 2PPHA 3QWZB 1WJ6A 3A9JB 1OEYJ 2ZPYA 3R66C 1GC7A 1V9JA 1K8RB 1UZXB 1YD8U 4G50A 4I6PA 4KZCA 3ZIMA 1E8YA 4W9JA 2WYQA 3A9KA 2M17A 5L83A 1L2NA 2XEWA 3VTWA 4GDLA 4CO7A 1NDDA 1V49A 1YX5B 2J7QB 2K6DB 2KC2A 2LRWA 5E6NA 3QIJA 4HK2A 2BPSA 1GUAB 4HCNB 2L76A 4EZJA 3IHPC 3M62B 3VAWA 4TQ0A 1PQSA 4GB9A 4W9LA 4NAWB 3AU4A 4DDGD 2NCNA 3ECIA 4GU2A 3APDA 5D94A 3VH3B 1M94A 4KIKA 3NZUA 3L10B 2KTFA 2PEAA 2V3SA 3IBEA 1GJZA 2FCQA 3AU5A 3ZDMC 1LQBA 1OTRB 2YVCA 2KQSA 3NZSA 3WA0A 3TIXA 4BBNF 2JUOA 2IY1B 1GG3A 2N7DA 4GXBA 1EUVB 4KDIC 4IM2A 3O65B 2MSED 2LXCA 3TMPB 3DVNV 2MLBA 3GZNI 3QAQA 2CS4A 2MQJA 3RCZA 3PVLA 2NBVB 5E6OA 3PRPB 3DVNU 5TR5A 4ANUA 3A4RA 4KSLC 3S2AA 2KQ7A 2KHWB 2AL6A 3AI5A 2A5UA 2NVUI 1WGRA 3UINB 1UGMA 1WF9A 5DPTA 1F9JA 5KHOA 3IVFA 5D7GA 4F1SA 2LGDA 4BKGA 2C7NB 2D11A 1R4NI 2IYDB 1WR1A 3QARA 4JGHB 1WXAA 2KDBA 2NPTA 4AOFA 2L00B 4AUQC 2RSUA 3PREA 2NBUA 2KX0A 3A9JA 4LDTB 1J19A 2JY6A 3ZNZB 1YX6B 4RMAA 2KOXA 2NS5A 1OQYA 2GMIC 2LZ6A 4AJYB 1UH6A 1WE7A 4NY0A 3KYDD 4OVUA 2BYVE 3H7SA 3LDZE 3QCAA 4IM0A 4NQKE 4W9CA 4ZRKA 3DVGX 3SU8X 2DYOA 4JIOU 4IC7B 2RD0A 1NI2A 1V6EA 3UGBB 4FADA 3T9LA 3UIPB 4PYUA 1C1YB 2KJRA 3EECA 4XZ4A 3R7RA 4MSQB 4DWFA 4LCDE 4G3XB 4NAWA 3DCGA 1WGYA 1UD7A 1Q0WB 5IA7A 2WWZA 3APCA 4TKNA 2J0MA 2MBEA 3ONSA 5JHAA 4K7SA 1JRUA 4LJOB 4KV2A 1WY8A 3AULA 1ISNA 3QK0A 3Q3FA 4M0WB 3KYCD 3VVWB 4A3PA 1WM2A 3DPDA 2LVQA 1NBFC 4OVVA 3ZDTA 2BWFA 2FIFA 2ZNVC 3PLVA 3QQ8B 4II3B 4W9EA 1TGZB 2IO1B 4RM8A 3N32A 4FJVB 4ANVA 5CHVC 2ASQA 2Z0DB 3PZDA 2UYZB 5LLIA 2G45B 4FN2A 4MEMA 3R7QA 2IO3B 3MJWA 3V6CB 2KDEB 2NR2A 2ZJDA 3RUIB 2O6VB 2FNJB 3U7DA 3K9PB 4AP4C 4MGZE 1WJ4A 1S3SG 2N4FA 4NQLB 3PS6A 2D10A 2N1VA 5D2MB 1WI0A 1TZ1A 5KHQA 2L0TA 4GDKB 1R4MI 4HJKA 2DENB 3NOBA 4BVUC 2VRRB 3U8ZA 3CF6E 2ZZPB 3WALA 4CHKA 4MJSB 1P9DU 2JPHA 2LUEA 3WAPA 2MBBB 4WJPA 4W9IA 4JQWC 1MG8A 2CHWA 4LDTD 3QA8A 4BKSA 4KDLB 2KFKB 2ZPNA 5EDSA 4TQ1A 3QC8B 2FCNA 1D3ZA 2FIDA 3L08A 2N1WA 5D6JB 3DQVA 2JF5A 3UIOB 3ZW3A 1GNUA 2KFJA 2C9WB 3TL5A 3ZRFA 4WJOA 4BKSD 2KC1A 2IY0B 3L0WB 1V80A 1WGHA 3NY5A 4W9GA 4ZYNA 1RFAA 2KK8A 2HE7A 2R2OA 4PYZA 1OEYA 3PHWB 1BT0A 2DAFA 4HDOA 4MDKE 2CR5A 2L8JA 4LJPB 2KLCA 2IZVB 4PS8A 3CSTA 4BOZB 2AEHA 2MA9B 4JL9A 1EO6A 4K7WA 2K6QA 1LFDA 2K1FA 4IW0A 1YQBA 2KO3A 3N3KB 5LXIB 2J0KA 4ANXA 4MGIE 3IFWB 4J6IA 4W9KA 3MHSD 4DDID 1P3QU 4WWOA 4IM3A 2M4NA 2ZEQA 1Z2MA 1WXSA 3ZNHB 2O6VA 4B9KA 3L54A 2GOWA 3CMMB 3JSVB 1XT9B 1ZW7A 5JH5C 2K8BA 4MELA 1KLVA 1G6JA 3H7PB 2MW5A 1J0GA 2O6VD 4ZRJA 2HD5B 4GDKA 4EOYA 2FAZA 5DCNA 2KN5A 2KXJA 5JHBA 4MJSA 2KMAA 2MP2B 1KOTA 2Z0EB 3HK0A 2KD0A 3ENEA 5E6PA 3VFKA 3TBLD 1QZEA 3OJ3A 1LM8B 1SGHA 2KFKA 4M8MA 3UQBA 1UBIA 3N30A 4CYEA 3PPAA 2B3AA 2C60A 2M0XA 3KUZA 4MGYE 5DPSA 3ZTDA 3ZVVA 4DHZB 3VXWA 1V2YA 4F7ZA 2FCMA 4ANWA 5L95C 1WX7A 2IBIB 3QJZA 4DHZE 2LWPA 2YLMA 3WANA 2NBWB 4WJQA 2D07B 2KDFB 4GIVA 3UF8A 2PE6B 2KZRA 3SD5A 1WXMA 4MM3A 1WZ3A 3QHTA 3T8MA 4W9HA 3VH4B 2L05A 3ZNID 3PT2B 1V5OA 4DHJB 2KWUB 4HCPB 2M1MA 2N9XA 3DOWA 4TV3A 4II2B 3VDZA 4BBNC 2LRUA 3MTNB 4MSMB 1WZ0A 1X1MA 2GBKA 4HPLB 3V6EB 4FLHA 2DYMA 1HE8A 5C1ZA 4K7UA 3VQIA 4HLEA 2N7EA 2BYEA 2UWQA 2HTHA 3JSVA 1EF5A 3ZTCA 3KUDB 3RT3B 1S1QB 1TBEA 1WRDB 2DX5B 4EKUA 1E7UA 2LVPA 5AZHA 3H7PA 4PS7A 1Y8RC 3X0WA 4ASWC 1WGGA 1EF1A 5AZFA 2MBOA 1IPGA 5JZEB 4EEWA 4E71A 2KVRA 2MP2A 1E7VA 2KTRB 1TTNA 4EFOA 2MCNB 1OGWA 2CKHB 2BKFA 3QX1A 4IWQA 4ZRIA 3TJPA 4DXAB 4FBJB 4NNJB 3KVFB 2LI5A 4FHJA 1WR6E 2DZMA 1C3TA 1SE9A 2O2VB 3PSEB 4MGKE 4A20A 1AARA 4X57B 2I1JA 2JRIB 2XK5B 2AL3A 4F8CB 4N9F4 1WGDA 2KNBA 4EZLA 2LVOA 1FXTB 3JYUA 1UELA 2FUHB 4WWPA 1WMHB 1RAXA 2EMSA 4EUTA 2L3ZA 1T0YA 2ZVOA 4K81A 5DPRA 3RULA 2LGXA 3DBLI 5CTRC 3R3MA 4DBGA 2JZZA 2DZKA 2KJHB 2KWCA 4FJZA 2ZNVB 4ZDVA 2MBQA 3HM6X 2AYOB 4WQOB 4GOCA 4TUUA 1Q5WB 2KKCA 3A33B 4M8NA 4ICUA 3L16A 3VUYA 2BKRB 3DBSA 3SDLC 2Z59B 2V4LA 5HKHA 5DPWA 1ZKHA 2JT4B 3B0AA 4HXDA 5C23A 3ZKJC 4DHJD 5G2NA 2G4SA 1E5WA 3V62A 3JW0X 4GMVA 2KMCA 2XBBC 4G0NB 3ZO5B 3ML8A 4FULA 2L0FA 1U4AA 1WXVA 2C7HA 3B1LX 1YIWA 4I6NB 4WJNA 4E74A 3BY4B 2JRHA 3PHXB 2W9NA 2K8HA 3KUCB 3A1QB 5CHFA 1IYFA 2LXAA 1ZGUB 1WYWB 4KSKC 2KDIA 1E8WA 2KTRA 3WAMA 2JZ3B 1WX9A 4K1RB 5CX3A 2GBNA 2CU1A 1I42A 4XC2A 4WAAA 3VTVA 2OOBB 2PE9A 3L13A 1KJTA 2FCSA 2K25A 2BF8B 4IUMB 2O2VA 2D2QA 1WE6A 1XD3B 2KWVB 2XK5A 3ML9A 4BKTA 2GBRA 4FJYA 1WH3A 3K9OB 4FA6A 2EMTA 3VHTC 1P1AA 1V81A 2C7MB 1WMHA 2EKEC 3H9DA 2HJ8A 5LXHA 3KW5B 2JXXA 3LJ3A 1CMXB 2CHXA 2R2QA 3GOEA 4FHKA 2DAJA 1Q1OA 3Q3JA 1GC6A 1WIAA 3ALBA 2G4DB 3B08A 3BINA 2PJHA 3VTUA 2D3GA 1E90A 4GN1A 4NJ6A 4MH0E 3PTFC 1XQQA 3DBRI 2GBMA 5IAAC 1H8CA 1E8XA 3W1SA 4JLCA 3DDCB 3M63B 3V61A 1WM3A 4XX5A 4HPMB 1J8CA 1KM7A 2RR9A 3OJ4B 1RLFA 1UBQA 2CHZA 2GBJA 3ZRCA 4AWJA 4BFRA 3H6NA 2DHZA 1WJNA 3ZUNA 2MRPA 1E8ZA 1P98A 2IO2B 3M3JA 2RGFA 3TCAA 2L7RA 3V60A 3A1QA 4A3OA 2A4ZA 2KJ6A 3AXCA 4BOSC 3D32A 3DBHI 2BWES 2DZIA 2MX2A 1YJ1A 3HHMA 3WIMA 3PRMB 2WX0A 4KVGB 4P7IA 3C0RB 4ICVA 5BO4B 2G3QB 4HDQA 3M95A 3DVGY 2MBHA 2LGYA 2N9EB 2JVCA 1WJUA 2N9PC 2K39A 5J18A 2WDTB 2KX3A 1WFYA 1RRBA
chains in the Genus database with same CATH superfamily
2K8CA 3AEFB 3H1UA 2EELA 5AEKB 4WA6B 4W9DA 4GSWA 3RZFA 3JQZA 5J17A 4P1CC 2ZCBA 1C79A 4JWSC 1VD2A 4HVBA 3GB1A 1VCBA 1N62A 4NZLB 1YQ4B 1IP9A 1MIVA 2V4IB 3ZLZA 4J2VA 3EHVA 4ACFA 2INPE 3P2BA 3RD2A 2DNFA 3EGRA 2J4XA 2BXNA 4B6WA 4LB2A 4W9FA 3JVZX 1LGRA 4YTPB 3CSFA 3W1YA 1ZOYB 4B95A 2J0JA 3B9JA 3GP7A 3AE1B 1Z5SB 4US9A 4OHJA 4KX6B 3HRDD 2DYBA 4E3CA 2NPTB 2RPQA 4RH6A 1FFVA 1I35A 3FKYA 1ESFA 1WYGA 2KANA 3QWZB 5HHDG 5EE3A 3R66C 4A9AA 1UZXB 2PTLA 2WYQA 3A9KA 4GDLA 4F7ZA 2J7QB 2K6DB 5FKAC 3QIJA 1E78A 1V1OA 1CK1A 2L76A 4EZJA 4M0WA 3IHPC 4F5TA 1RWSA 1F0ZA 4GB9A 3E56A 4NAWB 1M94A 4KIKA 3L10B 2KTFA 2PEAA 2V3SA 2KAJA 3BPJA 3AU5A 3ZDMC 3WA0A 1OTRB 1E7EA 2KQSA 3TIXA 2IY1B 4FXCA 1EUVB 3TMPB 2JQRB 3GZNI 1XO3A 4ZYSA 3Q8EA 1EU3A 2R61A 3AE6B 2CJOA 3A4RA 2XVVA 1SB3C 2AL6A 2Z8JA 3T3OA 4Z69A 3AE7B 1UGMA 5HOZA 1JMLA 2C7NB 3P63A 3B2GA 1STEA 2IYDB 3LU6A 4JGHB 1HZ6A 2KDBA 1MHHE 3PREA 3AMZA 1HK1A 2JY6A 3Q3MC 2KOXA 1ET6A 2GMIC 2DBUA 3U2SC 4K3BA 2BYVE 3LDZE 2EFCA 2BQQA 1SE3A 3DVGX 1GB1A 4JIOU 2LXSA 3UGBB 1YQ3B 3UIPB 1HEZE 1C1YB 2KJRA 3EECA 5H8YE 4XZ4A 4MSQB 4DWFA 4LCDE 1OQQA 4PT5A 4GDXA 4TKNA 3DHHC 2CU3A 5JHAA 3OG5A 2XW1A 1I4XA 4K7SA 4M01A 1QT9A 1WY8A 1R4NB 1ISNA 4M0WB 4A3PA 2LVQA 3MHZA 1TKYA 2BWFA 3QQ8B 4LLGM 1SF0A 4W9EA 3P4PB 2NNWA 3N32A 4RGOS 1J7AA 3PZDA 1KXPD 2UYZB 2G45B 1QOGA 5IJ5A 5DBYA 5BYSA 3MHHB 4MGZE 1JWSD 1S3SG 2N4FA 1DOYA 1IBXB 2N1VA 4NJCA 1ET9A 2L0TA 1R4MI 4HJKA 2VRRB 2ZZPB 4LNFA 1N60A 3WAPA 1UF0A 1K51A 1NYRA 4W9IA 3Q8CA 1L0XB 4YXDB 1MG8A 4LDTD 4BKSA 1UORA 2KFKB 4G03A 2ZPNA 5EDSA 1QLBB 2H89B 3L08A 5IKCM 4L9QA 3ZJVA 2OZBB 2C9WB 3ZRFA 2XVUA 4HKZE 1K53A 3M99C 3L0WB 1WGHA 4ZYNA 4LUFA 1MI0A 1RFAA 5IN7A 2BS2B 4HGKA 4FIPB 4P1BC 2Y5PA 1SE4A 2KLCA 2AEHA 2MA9B 4K7WA 1EO6A 2K6QA 1FRDA 1FO4A 4C31B 1WRIA 4ANXA 3IFWB 4J6IA 3MHSD 4DDID 4WWOA 2MJ3A 4JX1C 3ZNHB 3L54A 2WXOA 3TEZA 1FFUA 4MT5A 1N5XA 4WIPA 3Q14C 1C4AA 4EOYA 1MJDA 1KOTA 2KMAA 2MP2B 3ENEA 2MH7A 3TBLD 3W9CB 1LM8B 1BM0A 3FAHA 1FNUA 5DPSA 3FNMA 4DHZB 2XW0A 1V2YA 2JZPA 5L95C 3QJZA 1L5PA 4DHZE 3N1XC 4W4UB 1QOBA 3CX9A 2BS3B 1D5MC 2KZRA 5IO9A 4KGTA 4TSSA 5BPKA 1C77A 4P6VF 2L05A 2W55A 3DOWA 4II2B 2LRUA 3MTNB 4S17A 4WAFA 2GBKA 5MPOA 4FLHA 4N58A 2UWQA 3JSVA 4DHXB 3KUDB 1NVID 3RT3B 1NENB 1TBEA 1WRDB 2L83A 1E7UA 3H7PA 1WGGA 5AZFA 2MBOA 5IP4D 4EEWA 2DLBA 4S0RA 3ABVB 3U7ZA 1DGJA 4F5UA 2BKFA 3I63C 4ZRIA 2QILA 2G1EA 3NVKA 1VZSA 3DHGC 1C3TA 4B0MA 4X57B 2JRIB 2AL3A 2GB1A 2LFIA 2LVOA 4WWPA 1WMHB 1RAXA 2EMSA 2ZVOA 5CTRC 2JZZA 2QC8A 2Q5WD 4ZDVA 2BTEA 2WDRB 2AYOB 4WQOB 4TUUA 4YWGG 3GS2A 1FD6A 4ICUA 3DBSA 2BXKA 1QOAA 4OVZA 2W3SA 2V4LA 4DHJD 3PZ8A 3V62A 2BXLA 1SIJA 2KMCA 3CWIA 3ZO5B 1FCCC 4FULA 2L0FA 1XLOA 3B1LX 4E74A 2JRHA 3PHXB 2K8HA 1ZDXA 2W54A 2WQYB 3WAMA 2WS3B 4K1RB 1EWYC 1WX9A 2GBNA 1I42A 2QIEB 5H92C 2OOBB 1M4VA 2FCSA 4IUMB 2KQ4X 2N9LA 2VUFA 3ML9A 4B0EA 1VDVA 3K9OB 1KTKA 2EMTA 3VHTC 3BVMA 1P1AA 2KT7A 3TEYA 2C7MB 4DM0A 1VLBA 3RPFC 1TS4A 2R2QA 2DWQA 2DAJA 4WQMA 1GC6A 3ALBA 4LNKA 1FRRA 3B08A 3AE4B 1E90A 1XXGA 3R8BA 5JXVA 4MH0E 1MUHA 1SB0A 3V03A 3PTFC 2BBCA 3A73A 5IIHA 5IAAC 1L4DB 1E8XA 3MP9A 3GE8C 1J8CA 4XX5A 3OJ4B 4AWJA 2BXMA 3H6NA 2ICIA 3SIVB 4IOIE 2JXTA 4A6QA 1L6UA 2BXCA 2A4ZA 1UUPA 3D32A 2BWES 1HTOA 1YJ1A 3WIMA 4BKEA 3N9YC 3RNEC 1VRAB 2V0GA 3TDLA 1WJUA 1MFWA 2MJDA 5IIXA 3RNBC 2KX3A 2WU2B 1I4GA 1PUTA 3APFA 1E7CA 2KBZA 2LJ5A 2REXA 2M8SA 3H3AA 2ROHA 3VUWA 2C5LC 1C76A 1HQRD 3KH0A 3EFUA 4NPNA 2ZCCA 4D7XA 3WAOA 1HK5A 4ZHOA 4GGQA 2LASA 3X23A 3FILA 3WHQA 1C78A 1SBBB 3PV1A 3W1SC 2AQ2B 2KACA 1TY2A 2LQHA 5AZGA 4YL8A 3IG3A 1WX8A 1YOVB 2ZW0A 2J53A 5GMVA 3OLMD 1H4RA 3WCQA 4OW0A 5G55A 4FK5B 3NHEB 1N6ZA 3NVYA 2BXAA 2PPHA 3FWBC 1GC7A 1K8RB 1YD8U 2M17A 2XEWA 3R2TA 1NDDA 1YX5B 4HK2A 3SIUB 1AN8A 4KKIA 4TQ0A 1XCTL 2NCNA 4GU2A 3APDA 3OWEB 4OT2A 1AW7A 2JUOA 4BBNF 1GG3A 3O65B 2H88B 4RFBA 4C4VB 4ITKA 2HJ1A 1I7HA 2JSVX 4N0UD 3PRPB 2OEDA 1PFDA 3S2AA 1HK3A 2LJIA 3AI5A 1T0SC 1RFKA 1WGRA 3SFDB 2IPKD 2KWDA 4F1SA 4YSXB 4BKGA 2EFHA 1SSNA 1Q10A 2NPTA 4JWUC 4ZBRA 4AUQC 2RSUA 1E10A 2NBUA 1QILA 1YX6B 4RMAA 1FXIA 2WXGA 2NS5A 5BMHA 1FOUA 1UH6A 2BXEA 4ZRKA 2DYOA 4EE2A 4IC7B 2RD0A 4FADA 3T9LA 3SFEB 2WXIA 1KFYB 3DWMA 2Z8IA 2NTTA 3R7RA 1SXTA 4NAWA 4US8A 2PVGC 1NEKB 1EM7A 1UD7A 1PGAA 2WWZA 3BVZA 2J0MA 2MBEA 3AE9B 4HKQA 4KV2A 3AULA 3VVWB 1WM2A 1IGCA 4ZHPA 1NBFC 4OVVA 2JWUA 3PLVA 4II3B 2IO1B 4RM8A 4ANVA 2K5PA 5CHVC 2Z0DB 4CQNA 3R7QA 2V36A 4MEMA 4DQOC 4MH8A 2O6VB 2FNJB 3AH7A 1UGJA 2B76B 4GDKB 4L23A 2DENB 2VDBA 3NOBA 5ID7A 1P9DU 4WJPA 2L52A 4JQWC 1ACCA 4OZAA 2BS4B 2RDBC 3IXSA 3QA8A 5HG2A 4KDLB 2VZKD 2IJ0A 1D3ZA 2FIDA 1EWCA 2N1WA 4USAA 3DQVA 1GNUA 4WJOA 4BKSD 2KC1A 1CZPA 3NY5A 4ARCA 4LB9A 2HE7A 4PYZA 2XN9C 2V3NA 3PHWB 1BT0A 3AE8B 4MDKE 5G5HA 4K2CA 4WWMA 3BWUD 1E7PB 3BIID 1JRPA 2K1FA 2J0KA 1H9ZA 1R4MB 1MVKA 1BKEA 1N5UA 1WXSA 3DBLB 3V08A 2K3UA 2GOWA 3CMMB 1YN4A 3T3NA 2K8BA 1T0RC 4MELA 1G6JA 4HRSA 1IBXA 2MW5A 1WSPA 4ZRJA 2K22A 2I2YA 4ZOHC 3HK0A 3C8YA 5E6PA 4PO0A 3OJ3A 3W2DA 4RGTA 1ROEA 2KFKA 3A75A 2QMTA 1D5XC 1VZ6A 3N30A 4CYEA 2YEPB 2JUHA 3W5UB 2Y5CA 1BXTA 1WX7A 2BX8A 2YLMA 1LOTA 3WANA 2D07B 2XVQA 3Q69A 3MC8A 1MUSA 5EE1A 2K0PA 3VH4B 3T8MA 3ZNID 3U4EG 2EFEA 1V5OA 4BY9C 2KWUB 2M1MA 4MSMB 1TZOA 1QQRA 2BB5A 1X1MA 2DYMA 2SEBD 2JU6X 3VQIA 3AE3B 2WXLA 1N5WA 3ZTCA 2IGHA 1S1QB 3RMKC 4TMAB 2GRIA 2E3TA 5GINA 3NZ3A 1EF1A 5JZEB 4YSZB 4LTUA 2MP2A 2KTRB 1KRHA 2MCNB 2BVCA 4IWQA 3QX1A 3TJPA 3ZJUA 4FBJB 4NNJB 1HK4A 3KVFB 2LI5A 2DBYA 3PSEB 4MGKE 1PGBA 2XK5B 1HA2A 1C4PA 2KNBA 4EZLA 1FXTB 3GQXA 3O13A 3ZYYX 3RULA 3DBLI 2BXDA 2QCZA 3P4SB 4K3CA 5FK9C 3R3MA 1T6BX 1HTQA 3GQUA 4M8NA 3ZQ4A 4D2KA 2BKRB 4KKJA 2Z59B 2WXPA 5HKHA 5DPWA 4HXDA 3ETRA 3RFZB 2G4SA 2DG5A 4G0NB 4IKGA 3ML8A 5D3DA 5BYRA 3UIVA 2C7HA 1YIWA 4FJCB 3BY4B 1TIFA 5BMGA 3A1QB 5CHFA 1IYFA 1DYQA 2QDFA 4KSKC 1RYJA 2KDIA 1E8WA 1HK2A 2ONQA 2JZ3B 3GA9L 2FUG1 3J9CA 2CU1A 2PE9A 3L13A 2K25A 4N6EB 2BF8B 5E6JA 5EE0A 1XD3B 2KWVB 1WXQA 2GBRA 2WXMA 3B9LA 1WH3A 1BJ5A 1I4QA 4G01A 2EKEC 1V1PB 1WMHA 3H9DA 3KW5B 2WU5B 2W82A 2CHXA 3GOEA 3SEBA 1Q1OA 3Q3JA 4ZRQA 4J3OD 1WIAA 2ACZB 1AWDA 4RF0A 2PJHA 1TS3A 4L1BA 1XQQA 2GBMA 2JX5A 1E7BA 2WHIA 3V61A 3V05A 1WM3A 4HPMB 2RR9A 4BFRA 2GBJA 3ZRCA 3ZUNA 2DHZA 2WDQB 4EMXA 1MHXA 1FIQA 1JW9D 5BYQA 3V60A 4AQ7A 5I4DA 4A3OA 3AV8A 2J42A 4BOSC 3PRMB 1JQ4A 3H37A 2WX0A 4KVGB 4ICVA 4HDQA 2VUEA 3M95A 3DVGY 2JYTA 1BUIC 2LGSA 2N9EB 2JVCA 2K39A 2WDTB 1WFYA 2AGHB 3HM3A 3MC9A 1L7YA 1C4CA 1ZDVA 2KMMA 2WDVB 2LD9A 2KLGA 4DK5A 1A5RA 3PLUA 1E7GA 4IWOA 2M56B 3PRZA 2BGFA 4NJ7A 4ZUXV 4HWIB 4RM9A 4G11A 1IUEA 1DOIA 3IT6B 2QHOA 2L32A 2BYFA 3NJTA 2MWSB 1JWUD 2PMVA 5J2RA 4KZ0A 1JWAD 3RNCC 2LOQA 3HIZA 3SR6A 3N1YC 2FBWB 3VUXA 1F77A 1V86A 1TKGA 1V5TA 2I1KA 3Q8FA 1MIYA 3RYTA 3L17A 3P1MA 3U30A 1J7BA 3FC4A 1MM8A 4GLSC 1V97A 3A9JB 3G9KD 1V9JA 3NG0A 4G50A 4I6PA 3ZIMA 5AUIA 1YN5A 4M00A 5L83A 1L2NA 1MG4A 3VTWA 2RMMA 1V49A 2KC2A 5E6NA 1VZ8A 2BPSA 1GUAB 4HCNB 4NAMA 3VAWA 1PQSA 4W9LA 3LB8C 3AU4A 1VR9A 3ECIA 5D94A 3VH3B 5HI1A 2VH1A 1GJZA 2BW2A 1LQBA 2YVCA 4BAXA 3ZJTA 2BXBA 3TUOA 4GXBA 4KDIC 4IM2A 4C7ZA 2MSED 5DQFA 3DVNV 3QAQA 2OHFA 2CS4A 3RCZA 2NBVB 3KIKA 1E7FA 2QEJC 1GAQB 3DVNU 5TR5A 1A70A 4KSLC 4YSYB 2KQ7A 2KHWB 3V09A 2A5UA 1HA5A 3AN1A 3RN9C 1WF9A 5DPTA 1F9JA 4LUHA 3IVFA 5D7GA 1TF0A 1T3QA 2V3PA 5C2TB 2JYEA 1WR1A 3EFCA 3QARA 3RI7C 2SAKA 3CIRB 3H8HA 2KX0A 4LDTB 1J19A 2DBXA 3ZNZB 3NVVA 3ICXA 1TY0A 1CQVA 1OQYA 2LZ6A 4OVUA 3KYDD 3QCAA 2LHEA 3SU8X 1SJED 3B2FA 4PYUA 2LXTA 3PLAA 4MACA 2X38A 3DCGA 2INNE 1Q0WB 5IA7A 3LU8A 1QF6A 3ONSA 3LU7A 1JRUA 1GNJA 1JALA 4C4VA 3AEDB 3Q3FA 3MHSB 2IGGA 2BB6A 3DPDA 3ZDTA 2ZNVC 2FIFA 2X8XX 1TGZB 4WURA 3LXFA 1E7HA 1ZE3D 4FJVB 2LMCA 2INCC 1YMHE 2ASQA 5LLIA 4HGMB 2IO3B 3MJWA 3V6CB 5IFOA 2NR2A 2ZJDA 5IJEA 3PS6A 1ZXIA 2PKOA 2D10A 3SQJA 2LGIA 1WI0A 1TZ1A 2HTME 4RCOA 4BVUC 3KJLA 3U8ZA 1Y56A 2WP9B 4CHKA 4MJSB 2WGSA 2LUEA 2YEPF 5TSSA 2MBBB 1MPEA 4TQ1A 4S1YA 3QC8B 1MA9A 2FCNA 3TSSA 1T0QC 2EFDA 2OT3A 3ZW3A 1QOFA 2KFJA 2PW9A 2IY0B 1V80A 4W9GA 2KK8A 2R2OA 2DAFA 4HDOA 2NMQA 2IZVB 4PS8A 3CSTA 4MM3B 4BOZB 4JL9A 4OTUA 4HJGE 2K0NA 1LFDA 4LNNA 1AYFA 3N3KB 1JCKB 4LNOA 3NVIA 3I5JC 4W9KA 1P3QU 2K9XA 1SE2A 2O6VA 3GE3C 4ZC6A 1XT9B 3AEBB 1ZW7A 3PO0A 5JH5C 1KLVA 3MJ5A 4G04A 4KGRA 3MC0B 1QKZA 2HD5B 4GDKA 1D4BA 2KN5A 4C00A 2RDHA 2Z0EB 4QAYA 3KQ4A 3VFKA 2KN4A 1QZEA 2VH2A 1SGHA 4M8MA 4ARIA 3DHIC 2MEKA 3PPAA 2B3AA 1KF6B 3KUZA 4MGYE 3ZVVA 3VXWA 4IW2A 1TS2A 3NRZA 1D5ZC 2WXHA 2IBIB 2QHBA 4WJQA 2KDFB 3UF8A 2PE6B 3HUIA 4JE3B 1WXMA 4M70B 3QHTA 4W9HA 5LNK1 3PT2B 4DHJB 2BXGA 4HCPB 4BBNC 1WZ0A 4HPLB 3BZDB 5IJFA 4Q2JA 3V6EB 1HE8A 4K7UA 4HLEA 2TSSA 2BYEA 4GG2A 4N3ZA 2RPVA 4A90A 1F52A 1E7AA 2LVPA 5AZHA 4PS7A 1Y8RC 1L6VA 2BXHA 3MFGA 4M02A 3DBRB 1BMLC 1UWMA 1XEEA 4EFOA 4C56C 1OGWA 2CKHB 4H2AA 2DZMA 1SE9A 2O2VB 3AE2B 2AX5A 1AARA 2I1JA 1OFFA 4LNIA 1JWBD 4XE0A 1JNBA 2QSDA 1WGDA 2QMCA 1OQRA 1N61A 3JYUA 2FUHB 3DBHB 2L3ZA 1T0YA 4K81A 5DPRA 2LGXA 4XWWA 3EA6A 2KJHB 2DZKA 3I9V1 2ZNVB 4L8UA 2MBQA 4AS1A 1TXUA 1ZUD2 4GOCA 4P16A 1P7EA 1Q5WB 3A33B 4OZBA 1LNSA 3EUB2 3L16A 3SDLC 2W3RA 2N0SB 1ZKHA 3KWLA 3B0AA 3ZKJC 4I9OA 2FE8A 2D3BA 1E5WA 2I30A 1F2RC 3JW0X 2XBBC 1WXVA 4I6NB 4WJNA 3NMUA 4YT0B 2W9NA 1ZGUB 1WYWB 3AEGB 3NVWA 2KTRA 1GNIA 1VFIA 3TEXA 5CX3A 2IDYA 1WE6A 1O9XA 2XK5A 4BKTA 4ZRPA 4FJYA 3R2IA 4FA6A 1E0ZA 1J7EA 1AO6A 2HJ8A 3NVMA 2BXIA 1CMXB 1KH0A 3Q3OC 4ZBQA 3BINA 4OR0A 3VTUA 4GN1A 3UI3A 3DBRI 2BYTA 2Z8KA 4JLCA 1TYGB 3M63B 1KM7A 1RLFA 1UBQA 1WJNA 1P98A 2IO2B 2BT6A 3TCAA 2L7RA 3A1QA 4OZCA 2KJ6A 3AXCA 3DBHI 3HHMA 2E6XA 3C0RB 1V8CA 5B5TA 2MBHA 2LGYA 4HEA1 2N9PC 3ZXRA 5EE9A 1RRBA 1V1PA 3A9KB 4GDLB 3RZWC 4AJWA 4O1NA 3UQAA 1IJGA 1D6EC 3EC8A 4IWPA 2IO0B 1E6EB 2BXOA 3L4PA 1GPXA 1TJEA 3FWCC 2Z8LA 5FR6A 1YNTE 3VRBB 4KIKB 2OJRA 4EZKA 4PS3A 2WX1A 2ZW1A 3ZGZA 1E7IA 1N63A 4I6LB 5CHWA 3NS8A 2IGDA 4BZAA 5IIUA 2KYWA 3OAWA 2JWZA 2DZJA 4WWNA 3ZXVA 4XWTA 3B9MA 1P0RA 2RDGA 2V1YA 2G9HD 3AE5B 3HVZA 2ZVNA 3A4SC 3SHQA 3WHRA 3ZNGC 2YDFA 4IG7B 4XDDA 4URKA 3PGEA 1PGXA 2Y5BB 3I3TB 1C9FA 1JROA 2D5GA 2AWTA 1LXDA 1SIFA 2XMOA 1WJ6A 5D3IB 1OEYJ 3NVZA 2ZPYA 4KZCA 1E8YA 4W9JA 4CO7A 1XLPA 2LRWA 4PK1A 5T8IA 2GUTA 3M62B 1PYWD 4DDGD 1J7CA 1TKEA 3NZUA 3IBEA 4Z9OA 4DXGA 2FCQA 3NZSA 2WXKA 2N7DA 3ECPA 3BVGA 2LXCA 3RNAC 2MLBA 2I2ZA 3U52E 2MQJA 1P7FA 3PVLA 5GIOA 4ZCGA 5E6OA 4ANUA 1K52A 2WXNA 2NVUI 4F5SA 3UINB 4N0FD 5KHOA 2M0AA 2OJWA 1B9RA 2LGDA 2D11A 1R4NI 2LQIA 2INDC 4HROA 3JRYA 1L0VB 4AOFA 1WXAA 2MHJA 2L00B 1FPYA 3A9JA 1TT5B 2VZKB 5AUKA 4AJYB 1VZ7A 1WE7A 4NY0A 4W9CA 3H7SA 4NQKE 4E99A 4JPSA 4IM0A 1J78A 1L4ZB 3DWGC 3Q2AC 1NI2A 1V6EA 2LEKA 1B1ZA 4LA0A 4G3XB 4KGSA 1WGYA 3NUHB 3APCA 1PDXA 2ON8A 3KWVA 4LJOB 1VJKA 3QK0A 3KYCD 4UDUC 1NYQA 3PZ7A 2XNAC 4RGMA 1LO5D 5ID9A 4FN2A 2KDEB 3RUIB 2UU7A 3U7DA 1ENFA 3K9PB 2NQOA 2PVOD 4AP4C 1WJ4A 4NQLB 1KDXA 3HVDA 5D2MB 3NS1A 5KHQA 1KLGD 2AJEA 2PLPA 2GI9A 3CF6E 3WALA 3RNFC 2CJNA 3AEAB 1F2RI 2JPHA 1HZ5A 3N20C 4YTNB 2CHWA 2M19A 5FUOA 4JK4A 1I4HA 1GB4A 4REZA 1I4PA 3VRAB 1K50A 5D6JB 2JF5A 3UIOB 3TL5A 1I4RA 2D3AA 1OEYA 2CR5A 2L8JA 4LJPB 3VR8B 5HFYA 3IAS1 5BMIA 1IGDA 2N9KA 3LYYA 3BK2A 1FCLA 2QJLA 2QM6A 4YTMB 3AECB 4IW0A 1YQBA 2KO3A 5LXIB 2MJEA 3Q8AA 4MGIE 1R7SA 4IM3A 2M4NA 2BXPA 2ZEQA 1Z2MA 4B9KA 5C3JB 3V3XA 1T5XD 3JSVB 4K71A 5G5GA 4LK0M 5IOIA 2LHDA 1ZXHA 4C80A 3H7PB 3Q3NC 3TEWA 1J0GA 4R3DA 2O6VD 2FAZA 2WXJA 5DCNA 2KXJA 5JHBA 4MJSA 4A8XC 5GIPA 1YN3A 2KD0A 1WWTA 4RGNA 1E9MA 5GXGB 2KDMA 1MIWA 3UQBA 1UBIA 1WGKA 2WNMA 4XDCA 1ZP0B 2C60A 2M0XA 3ZTDA 4C7YA 1FNVA 2FCMA 4ANWA 2KWFA 4IDIA 1UNSA 2LWPA 2NBWB 1UWXA 4GIVA 3SD5A 4XGAB 1SEBD 4MM3A 1WZ3A 3URYA 3P42A 3KLSX 1XCQL 2HDEA 5FR3A 4TV3A 2N9XA 3VDZA 4IW1A 4MBEC 4RF1A 5C1ZA 2WXRA 2N7EA 2HTHA 1EF5A 1XF5L 2Y3AA 2DX5B 4EKUA 3E9SA 2KVZA 3X0WA 2BXFA 4A55A 3P4RB 4ASWC 3BYTB 1IPGA 1JWMD 4E71A 2KVRA 1E7VA 1TTNA 1KLUD 4DXAB 1FM0D 5GHKA 4FHJA 4RNAA 1WR6E 1ZPSA 4A20A 2WXFA 4F8CB 1F1HA 2J52A 4N9F4 1KW2A 1UELA 4EUTA 1SJHD 4DBGA 2KWCA 4FJZA 1XLNA 2XVWA 3Q8BA 3HM6X 4HPPA 3RNGC 2KKCA 2N7JA 3VUYA 4DXFA 3C19A 3IT4B 1YJIA 2GLSA 2JT4B 2I38A 5C23A 1TS5A 1NT2B 3BYYB 4ZBKA 5G2NA 1DOXA 1CJEA 4GMVA 2D3CA 1U4AA 3KUCB 1FXAA 2LXAA 4WH4A 2E0XA 4XC2A 4WAAA 2PIAA 3VTVA 2AQ3B 1KJTA 1NI3A 2AQ1B 2O2VA 2D2QA 2WLBA 3AM9A 1XLQA 1L0YB 1V81A 5LXHA 2JXXA 3LJ3A 2L1AA 4FHKA 3Q6BA 2NTSA 2G4DB 3VR9B 2D3GA 1H5WA 4NJ6A 2LUMA 3WHSA 3I57A 1FNWA 1GOZA 3N1ZC 3IAM1 1H8CA 3W1SA 4L2YA 2E0YA 1HXYD 3DDCB 3FILB 3W5VB 3P4QB 2CHZA 1RM6C 4XYCA 2MRPA 1E8ZA 1YJJA 1FEHA 2CKXA 2BXQA 3M3JA 2RGFA 3AEEB 2XSIA 4L9KA 4N59A 2DZIA 2MX2A 4OTTA 1FMAD 2V9HA 4P7IA 3GZNB 2EKIA 5BO4B 2G3QB 4F5VA 3BK1A 1EU4A 3AB5A 5J18A 2DBWA 2WXQA
chains in the Genus database with same CATH topology
2K8CA 3AEFB 3H1UA 5AEKB 2EELA 4WA6B 4W9DA 4GSWA 3RZFA 3JQZA 5J17A 2ZCBA 1C79A 4JWSC 1VD2A 4HVBA 3GB1A 1VCBA 1N62A 4NZLB 1YQ4B 1IP9A 1MIVA 2V4IB 3ZLZA 4J2VA 3EHVA 2INPE 3P2BA 3RD2A 3EGRA 2J4XA 2BXNA 4B6WA 4LB2A 4W9FA 3JVZX 4YTPB 3CSFA 3W1YA 4B95A 1ZOYB 2J0JA 3B9JA 3GP7A 3AE1B 1Z5SB 4US9A 4OHJA 4KX6B 3HRDD 2DYBA 4E3CA 2NPTB 2RPQA 4RH6A 1FFVA 1I35A 2KANA 3QWZB 1ESFA 1WYGA 5HHDG 5EE3A 3R66C 4A9AA 1UZXB 2PTLA 2WYQA 3A9KA 4GDLA 4F7ZA 2J7QB 2K6DB 5FKAC 3QIJA 1E78A 1V1OA 1CK1A 2L76A 4EZJA 4M0WA 3IHPC 4F5TA 1RWSA 1F0ZA 4GB9A 3E56A 4NAWB 1M94A 4KIKA 3L10B 2KTFA 2PEAA 2V3SA 2KAJA 3AU5A 3ZDMC 3WA0A 1OTRB 1E7EA 2KQSA 3TIXA 2IY1B 4FXCA 1EUVB 3TMPB 3GZNI 2JQRB 1XO3A 4ZYSA 3Q8EA 1EU3A 2R61A 3AE6B 2CJOA 3A4RA 2XVVA 1SB3C 2AL6A 2Z8JA 3T3OA 4Z69A 3AE7B 1UGMA 5HOZA 1JMLA 2C7NB 3P63A 3B2GA 2IYDB 1STEA 3LU6A 4JGHB 2KDBA 1HZ6A 1MHHE 3PREA 3AMZA 1HK1A 2JY6A 2KOXA 1ET6A 2GMIC 2DBUA 3U2SC 2BYVE 3LDZE 2EFCA 1GB1A 1SE3A 3DVGX 4JIOU 3UGBB 1YQ3B 3UIPB 1HEZE 1C1YB 2KJRA 3EECA 5H8YE 4XZ4A 4MSQB 4DWFA 4LCDE 1OQQA 4PT5A 4GDXA 4TKNA 2CU3A 5JHAA 2XW1A 1I4XA 4K7SA 1QT9A 1WY8A 1ISNA 4M0WB 4A3PA 2LVQA 3MHZA 1TKYA 2BWFA 3QQ8B 4LLGM 1SF0A 4W9EA 3P4PB 2NNWA 3N32A 4RGOS 1J7AA 3PZDA 1KXPD 2UYZB 2G45B 1QOGA 5IJ5A 5DBYA 5BYSA 3MHHB 4MGZE 1JWSD 1S3SG 2N4FA 1DOYA 1IBXB 2N1VA 4NJCA 1ET9A 2L0TA 1R4MI 4HJKA 2VRRB 2ZZPB 3WAPA 1N60A 1K51A 1NYRA 4W9IA 3Q8CA 1L0XB 4YXDB 1MG8A 4LDTD 4BKSA 1UORA 2KFKB 4G03A 2ZPNA 5EDSA 1QLBB 2H89B 3L08A 4L9QA 3ZJVA 2OZBB 2C9WB 3ZRFA 2XVUA 4HKZE 1K53A 3M99C 3L0WB 1WGHA 4ZYNA 4LUFA 1MI0A 1RFAA 2BS2B 4HGKA 4FIPB 2Y5PA 1SE4A 2KLCA 2AEHA 2MA9B 4K7WA 1EO6A 2K6QA 1FRDA 1FO4A 4C31B 4ANXA 1WRIA 3IFWB 4J6IA 3MHSD 4DDID 4WWOA 2MJ3A 4JX1C 3ZNHB 3L54A 2WXOA 3TEZA 1FFUA 4MT5A 1N5XA 4WIPA 1C4AA 4EOYA 1KOTA 2KMAA 2MP2B 3ENEA 2MH7A 3TBLD 3W9CB 1LM8B 1BM0A 3FAHA 1FNUA 5DPSA 3FNMA 4DHZB 2XW0A 1V2YA 2JZPA 5L95C 3QJZA 1L5PA 4DHZE 4W4UB 1QOBA 3CX9A 2BS3B 1D5MC 2KZRA 4KGTA 4TSSA 5BPKA 1C77A 4P6VF 2L05A 2W55A 3DOWA 4II2B 2LRUA 3MTNB 4WAFA 2GBKA 5MPOA 4FLHA 4N58A 2UWQA 3JSVA 4DHXB 3KUDB 1NVID 3RT3B 1NENB 1TBEA 1WRDB 2L83A 1E7UA 3H7PA 1WGGA 5AZFA 2MBOA 4EEWA 2DLBA 3ABVB 3U7ZA 1DGJA 4F5UA 2BKFA 4ZRIA 2QILA 2G1EA 3NVKA 1VZSA 1C3TA 4B0MA 4X57B 2JRIB 2AL3A 2GB1A 2LFIA 2LVOA 4WWPA 1WMHB 1RAXA 2EMSA 2ZVOA 5CTRC 2JZZA 2Q5WD 4ZDVA 2BTEA 2WDRB 2AYOB 4WQOB 4TUUA 4YWGG 3GS2A 1FD6A 4ICUA 3DBSA 2BXKA 1QOAA 4OVZA 2W3SA 2V4LA 4DHJD 3PZ8A 3V62A 2BXLA 1SIJA 2KMCA 3ZO5B 3CWIA 4FULA 1FCCC 2L0FA 1XLOA 3B1LX 4E74A 2JRHA 3PHXB 2K8HA 1ZDXA 2W54A 2WQYB 3WAMA 2WS3B 4K1RB 1WX9A 1EWYC 2GBNA 1I42A 2QIEB 5H92C 2OOBB 1M4VA 2FCSA 4IUMB 2KQ4X 2N9LA 2VUFA 3ML9A 4B0EA 1VDVA 3K9OB 1KTKA 2EMTA 3VHTC 3BVMA 1P1AA 3TEYA 2C7MB 1VLBA 3RPFC 1TS4A 2R2QA 2DWQA 2DAJA 4WQMA 1GC6A 3ALBA 3B08A 1FRRA 3AE4B 1E90A 1XXGA 3R8BA 5JXVA 4MH0E 3V03A 3PTFC 2BBCA 3A73A 5IIHA 5IAAC 1L4DB 1E8XA 3MP9A 1J8CA 4XX5A 3OJ4B 4AWJA 2BXMA 3H6NA 2ICIA 3SIVB 4IOIE 2JXTA 4A6QA 1L6UA 2BXCA 2A4ZA 1UUPA 3D32A 2BWES 1YJ1A 3WIMA 4BKEA 3N9YC 1VRAB 2V0GA 3TDLA 1WJUA 2MJDA 5IIXA 2KX3A 2WU2B 1I4GA 3APFA 1PUTA 1E7CA 2KBZA 2LJ5A 2REXA 2M8SA 3H3AA 2ROHA 3VUWA 2C5LC 1C76A 1HQRD 3KH0A 3EFUA 4NPNA 2ZCCA 3WAOA 1HK5A 4ZHOA 4GGQA 2LASA 3X23A 3FILA 3WHQA 1C78A 1SBBB 3PV1A 3W1SC 2AQ2B 2KACA 1TY2A 5AZGA 4YL8A 3IG3A 1WX8A 2ZW0A 2J53A 5GMVA 3OLMD 1H4RA 3WCQA 4OW0A 5G55A 4FK5B 3NHEB 3NVYA 2BXAA 2PPHA 3FWBC 1GC7A 1K8RB 1YD8U 2M17A 2XEWA 3R2TA 1NDDA 1YX5B 4HK2A 3SIUB 1AN8A 4KKIA 4TQ0A 1XCTL 2NCNA 4GU2A 3APDA 3OWEB 4OT2A 4BBNF 2JUOA 1AW7A 1GG3A 3O65B 2H88B 4RFBA 4ITKA 1I7HA 2JSVX 4N0UD 3PRPB 2OEDA 1PFDA 3S2AA 1HK3A 2LJIA 3AI5A 1WGRA 1RFKA 3SFDB 2IPKD 2KWDA 4F1SA 4YSXB 4BKGA 2EFHA 1SSNA 1Q10A 2NPTA 4JWUC 4ZBRA 4AUQC 2RSUA 1E10A 2NBUA 1QILA 1YX6B 4RMAA 1FXIA 2WXGA 2NS5A 5BMHA 1FOUA 1UH6A 2BXEA 4ZRKA 2DYOA 4EE2A 4IC7B 2RD0A 4FADA 3T9LA 3SFEB 2WXIA 1KFYB 3R7RA 2Z8IA 2NTTA 3DWMA 1SXTA 4NAWA 4US8A 2PVGC 1NEKB 1EM7A 1UD7A 1PGAA 2WWZA 3BVZA 2J0MA 2MBEA 3AE9B 4HKQA 4KV2A 3AULA 3VVWB 1WM2A 1IGCA 4ZHPA 1NBFC 4OVVA 2JWUA 3PLVA 4II3B 2IO1B 4RM8A 4ANVA 2K5PA 5CHVC 2Z0DB 4CQNA 3R7QA 2V36A 4MEMA 4DQOC 4MH8A 2O6VB 2FNJB 3AH7A 1UGJA 2B76B 4GDKB 4L23A 2DENB 2VDBA 3NOBA 5ID7A 1P9DU 4WJPA 2L52A 4JQWC 1ACCA 4OZAA 2BS4B 3QA8A 3IXSA 5HG2A 4KDLB 2VZKD 2IJ0A 1D3ZA 2FIDA 2N1WA 1EWCA 4USAA 3DQVA 1GNUA 4WJOA 4BKSD 2KC1A 1CZPA 3NY5A 4ARCA 4LB9A 2HE7A 4PYZA 2XN9C 2V3NA 3PHWB 1BT0A 3AE8B 4MDKE 5G5HA 4K2CA 4WWMA 3BWUD 1E7PB 3BIID 1JRPA 2K1FA 2J0KA 1H9ZA 1MVKA 1BKEA 1N5UA 1WXSA 3V08A 2K3UA 2GOWA 3CMMB 1YN4A 3T3NA 2K8BA 4MELA 1G6JA 4HRSA 1IBXA 2MW5A 1WSPA 4ZRJA 2K22A 2I2YA 4ZOHC 3HK0A 3C8YA 5E6PA 4PO0A 3OJ3A 3W2DA 4RGTA 1ROEA 2KFKA 3A75A 2QMTA 1D5XC 1VZ6A 3N30A 4CYEA 2YEPB 2JUHA 3W5UB 2Y5CA 1BXTA 1WX7A 2BX8A 2YLMA 1LOTA 3WANA 2D07B 2XVQA 3Q69A 5EE1A 2K0PA 3VH4B 3T8MA 3ZNID 3U4EG 2EFEA 1V5OA 4BY9C 2KWUB 2M1MA 4MSMB 1TZOA 1QQRA 2BB5A 1X1MA 2DYMA 2SEBD 2JU6X 3VQIA 3AE3B 2WXLA 1N5WA 3ZTCA 2IGHA 1S1QB 4TMAB 2GRIA 2E3TA 5GINA 3NZ3A 1EF1A 5JZEB 4YSZB 4LTUA 2MP2A 2KTRB 1KRHA 2MCNB 4IWQA 3QX1A 3TJPA 3ZJUA 4FBJB 4NNJB 1HK4A 3KVFB 2LI5A 2DBYA 3PSEB 4MGKE 1PGBA 2XK5B 1HA2A 1C4PA 2KNBA 4EZLA 1FXTB 3GQXA 3O13A 3ZYYX 3RULA 3DBLI 2BXDA 3P4SB 5FK9C 3R3MA 1T6BX 3GQUA 4M8NA 3ZQ4A 4D2KA 2BKRB 4KKJA 2Z59B 2WXPA 5HKHA 5DPWA 4HXDA 3ETRA 3RFZB 2G4SA 2DG5A 4G0NB 4IKGA 3ML8A 5D3DA 5BYRA 3UIVA 2C7HA 1YIWA 4FJCB 3BY4B 5BMGA 3A1QB 5CHFA 1IYFA 1DYQA 4KSKC 1RYJA 2KDIA 1E8WA 1HK2A 2ONQA 2JZ3B 3GA9L 2FUG1 3J9CA 2CU1A 2PE9A 3L13A 2K25A 4N6EB 2BF8B 5E6JA 5EE0A 1XD3B 2KWVB 1WXQA 2GBRA 2WXMA 3B9LA 1WH3A 1BJ5A 1I4QA 4G01A 2EKEC 1WMHA 3H9DA 1V1PB 3KW5B 2WU5B 2W82A 2CHXA 3GOEA 3SEBA 1Q1OA 3Q3JA 4ZRQA 4J3OD 1WIAA 2ACZB 1AWDA 4RF0A 2PJHA 1TS3A 4L1BA 1XQQA 2GBMA 2JX5A 1E7BA 3V61A 3V05A 1WM3A 4HPMB 2RR9A 4BFRA 2GBJA 3ZRCA 3ZUNA 2DHZA 2WDQB 4EMXA 1MHXA 1FIQA 1JW9D 5BYQA 3V60A 4AQ7A 5I4DA 4A3OA 3AV8A 2J42A 4BOSC 3PRMB 1JQ4A 3H37A 2WX0A 4KVGB 4ICVA 4HDQA 2VUEA 3M95A 3DVGY 2JYTA 1BUIC 2N9EB 2JVCA 2K39A 2WDTB 1WFYA 3HM3A 1L7YA 1C4CA 1ZDVA 2KMMA 2WDVB 2LD9A 2KLGA 4DK5A 1A5RA 3PLUA 1E7GA 4IWOA 2M56B 3PRZA 2BGFA 4NJ7A 4ZUXV 4HWIB 4RM9A 4G11A 1IUEA 1DOIA 3IT6B 2QHOA 2L32A 2BYFA 2MWSB 1JWUD 5J2RA 2PMVA 4KZ0A 1JWAD 2LOQA 3HIZA 3SR6A 2FBWB 3VUXA 1F77A 1V86A 1TKGA 1V5TA 2I1KA 3Q8FA 1MIYA 3RYTA 3L17A 3P1MA 3U30A 1J7BA 3FC4A 4GLSC 3A9JB 1V97A 3G9KD 1V9JA 4G50A 4I6PA 3ZIMA 5AUIA 1YN5A 5L83A 1L2NA 3VTWA 2RMMA 1V49A 2KC2A 5E6NA 1VZ8A 2BPSA 1GUAB 4HCNB 4NAMA 3VAWA 1PQSA 4W9LA 3LB8C 3AU4A 3ECIA 1VR9A 5D94A 3VH3B 5HI1A 1GJZA 2BW2A 1LQBA 2YVCA 3ZJTA 2BXBA 3TUOA 4GXBA 4KDIC 4IM2A 4C7ZA 2MSED 5DQFA 3DVNV 3QAQA 2OHFA 2CS4A 3RCZA 2NBVB 3KIKA 1E7FA 2QEJC 3DVNU 5TR5A 1GAQB 1A70A 4KSLC 4YSYB 2KQ7A 2KHWB 3V09A 2A5UA 1HA5A 3AN1A 1WF9A 5DPTA 1F9JA 4LUHA 3IVFA 5D7GA 1TF0A 1T3QA 2V3PA 5C2TB 2JYEA 1WR1A 3QARA 2SAKA 3CIRB 3H8HA 2KX0A 4LDTB 1J19A 2DBXA 3ZNZB 3NVVA 3ICXA 1TY0A 1CQVA 1OQYA 2LZ6A 4OVUA 3KYDD 3QCAA 2LHEA 3SU8X 1SJED 3B2FA 4PYUA 3PLAA 4MACA 2X38A 3DCGA 2INNE 1Q0WB 5IA7A 3LU8A 1QF6A 3ONSA 3LU7A 1JRUA 1GNJA 1JALA 3AEDB 3Q3FA 3MHSB 2IGGA 2BB6A 3DPDA 3ZDTA 2ZNVC 2FIFA 1TGZB 4WURA 3LXFA 1E7HA 1ZE3D 4FJVB 2LMCA 1YMHE 2ASQA 5LLIA 4HGMB 3V6CB 2IO3B 3MJWA 5IFOA 2NR2A 2ZJDA 5IJEA 3PS6A 1ZXIA 2PKOA 2D10A 3SQJA 2LGIA 1WI0A 1TZ1A 2HTME 4RCOA 4BVUC 3KJLA 3U8ZA 1Y56A 2WP9B 4CHKA 4MJSB 2LUEA 2YEPF 5TSSA 2MBBB 1MPEA 4TQ1A 4S1YA 3QC8B 1MA9A 2FCNA 3TSSA 2EFDA 2OT3A 3ZW3A 1QOFA 2KFJA 2PW9A 2IY0B 1V80A 4W9GA 2KK8A 2R2OA 2DAFA 4HDOA 2NMQA 2IZVB 4PS8A 3CSTA 4BOZB 4MM3B 4JL9A 4OTUA 4HJGE 1LFDA 3N3KB 1AYFA 1JCKB 3NVIA 4W9KA 1P3QU 2K9XA 1SE2A 2O6VA 4ZC6A 1XT9B 3AEBB 1ZW7A 5JH5C 1KLVA 3PO0A 3MJ5A 4G04A 4KGRA 3MC0B 1QKZA 2HD5B 4GDKA 1D4BA 2KN5A 2RDHA 2Z0EB 3KQ4A 3VFKA 2KN4A 1QZEA 1SGHA 4M8MA 4ARIA 2MEKA 3PPAA 2B3AA 1KF6B 3KUZA 4MGYE 3ZVVA 3VXWA 4IW2A 1TS2A 3NRZA 1D5ZC 2WXHA 2IBIB 2QHBA 4WJQA 2KDFB 3UF8A 2PE6B 3HUIA 4JE3B 1WXMA 4M70B 3QHTA 4W9HA 5LNK1 3PT2B 4DHJB 2BXGA 4HCPB 4BBNC 1WZ0A 4HPLB 3V6EB 5IJFA 3BZDB 4Q2JA 1HE8A 4K7UA 4HLEA 2TSSA 2BYEA 4GG2A 4N3ZA 2RPVA 4A90A 1E7AA 2LVPA 5AZHA 4PS7A 1Y8RC 1L6VA 2BXHA 3MFGA 1BMLC 1UWMA 1XEEA 4EFOA 4C56C 1OGWA 2CKHB 4H2AA 2DZMA 1SE9A 2O2VB 3AE2B 2AX5A 1AARA 2I1JA 1OFFA 1JWBD 4XE0A 1JNBA 2QSDA 1WGDA 2QMCA 1OQRA 3JYUA 1N61A 2FUHB 2L3ZA 1T0YA 4K81A 5DPRA 2LGXA 4XWWA 3EA6A 2KJHB 2DZKA 3I9V1 2ZNVB 4L8UA 2MBQA 4AS1A 1TXUA 4GOCA 1ZUD2 4P16A 1Q5WB 1P7EA 3A33B 4OZBA 1LNSA 3EUB2 3L16A 3SDLC 2W3RA 2N0SB 1ZKHA 3KWLA 3B0AA 3ZKJC 2FE8A 1E5WA 2I30A 1F2RC 3JW0X 2XBBC 1WXVA 4I6NB 4WJNA 3NMUA 4YT0B 2W9NA 1ZGUB 1WYWB 3AEGB 3NVWA 2KTRA 1GNIA 1VFIA 3TEXA 5CX3A 2IDYA 1WE6A 1O9XA 2XK5A 4BKTA 4ZRPA 4FJYA 3R2IA 4FA6A 1E0ZA 1J7EA 1AO6A 2HJ8A 3NVMA 2BXIA 1CMXB 1KH0A 4ZBQA 3BINA 4OR0A 3VTUA 4GN1A 3UI3A 3DBRI 2BYTA 2Z8KA 4JLCA 3M63B 1TYGB 1KM7A 1RLFA 1UBQA 1WJNA 1P98A 2IO2B 2BT6A 3TCAA 2L7RA 3A1QA 4OZCA 2KJ6A 3AXCA 3DBHI 3HHMA 2E6XA 3C0RB 1V8CA 5B5TA 2MBHA 2LGYA 4HEA1 2N9PC 5EE9A 1RRBA 1V1PA 3A9KB 4GDLB 3RZWC 4AJWA 4O1NA 3UQAA 1IJGA 1D6EC 3EC8A 4IWPA 2IO0B 1E6EB 2BXOA 3L4PA 1GPXA 1TJEA 3FWCC 2Z8LA 5FR6A 1YNTE 3VRBB 4KIKB 2OJRA 4EZKA 4PS3A 2WX1A 2ZW1A 3ZGZA 1E7IA 4I6LB 5CHWA 1N63A 3NS8A 2IGDA 5IIUA 3OAWA 2JWZA 2DZJA 4WWNA 4XWTA 3B9MA 1P0RA 2RDGA 2V1YA 2G9HD 3AE5B 3SHQA 2ZVNA 3A4SC 3ZNGC 3WHRA 3HVZA 2YDFA 4IG7B 4XDDA 4URKA 3PGEA 1PGXA 2Y5BB 3I3TB 1C9FA 1JROA 2D5GA 2AWTA 1LXDA 1SIFA 2XMOA 1WJ6A 5D3IB 1OEYJ 3NVZA 2ZPYA 4KZCA 1E8YA 4W9JA 4CO7A 1XLPA 2LRWA 5T8IA 3M62B 1PYWD 4DDGD 1J7CA 3NZUA 1TKEA 3IBEA 4Z9OA 4DXGA 2FCQA 3NZSA 2WXKA 2N7DA 3BVGA 2LXCA 2MLBA 2I2ZA 3U52E 2MQJA 1P7FA 3PVLA 5GIOA 4ZCGA 5E6OA 4ANUA 1K52A 2WXNA 2NVUI 4F5SA 3UINB 4N0FD 5KHOA 2M0AA 1B9RA 2LGDA 2D11A 1R4NI 4HROA 3JRYA 1L0VB 4AOFA 1WXAA 2L00B 3A9JA 2VZKB 5AUKA 4AJYB 1VZ7A 1WE7A 4NY0A 4W9CA 3H7SA 4NQKE 4E99A 4JPSA 4IM0A 1J78A 1L4ZB 3DWGC 1NI2A 1V6EA 2LEKA 1B1ZA 4LA0A 4G3XB 4KGSA 1WGYA 3NUHB 3APCA 1PDXA 2ON8A 3KWVA 4LJOB 1VJKA 3QK0A 3KYCD 4UDUC 1NYQA 3PZ7A 2XNAC 4RGMA 1LO5D 5ID9A 4FN2A 2KDEB 3RUIB 3U7DA 1ENFA 3K9PB 2NQOA 4AP4C 2PVOD 1WJ4A 4NQLB 3HVDA 5D2MB 3NS1A 5KHQA 1KLGD 2AJEA 2PLPA 3WALA 3CF6E 2GI9A 2CJNA 3AEAB 1F2RI 2JPHA 1HZ5A 4YTNB 2CHWA 2M19A 5FUOA 4JK4A 1I4HA 1GB4A 4REZA 1I4PA 3VRAB 1K50A 5D6JB 2JF5A 3UIOB 3TL5A 1I4RA 1OEYA 2CR5A 2L8JA 4LJPB 3VR8B 5HFYA 3IAS1 5BMIA 1IGDA 2N9KA 3LYYA 3BK2A 1FCLA 2QJLA 2QM6A 4YTMB 3AECB 4IW0A 1YQBA 2KO3A 5LXIB 2MJEA 3Q8AA 4MGIE 1R7SA 4IM3A 2M4NA 2BXPA 2ZEQA 1Z2MA 4B9KA 5C3JB 3V3XA 3JSVB 1T5XD 4K71A 5G5GA 4LK0M 2LHDA 1ZXHA 4C80A 3H7PB 1J0GA 3TEWA 4R3DA 2O6VD 2FAZA 5DCNA 2WXJA 2KXJA 5JHBA 4MJSA 4A8XC 5GIPA 2KD0A 1YN3A 1WWTA 4RGNA 1E9MA 5GXGB 2KDMA 1MIWA 3UQBA 1UBIA 1WGKA 2WNMA 4XDCA 2C60A 2M0XA 1ZP0B 3ZTDA 4C7YA 1FNVA 2FCMA 4ANWA 4IDIA 1UNSA 2LWPA 2NBWB 4GIVA 1UWXA 3SD5A 1SEBD 4MM3A 1WZ3A 3URYA 3P42A 3KLSX 1XCQL 2HDEA 5FR3A 4TV3A 2N9XA 3VDZA 4IW1A 4MBEC 4RF1A 5C1ZA 2WXRA 2N7EA 2HTHA 1EF5A 1XF5L 2Y3AA 2DX5B 4EKUA 3E9SA 3X0WA 2BXFA 4A55A 4ASWC 3P4RB 3BYTB 1IPGA 4E71A 1JWMD 2KVRA 1E7VA 1TTNA 1KLUD 4DXAB 1FM0D 5GHKA 4FHJA 4RNAA 1WR6E 1ZPSA 4A20A 2WXFA 4F8CB 2J52A 4N9F4 1KW2A 1UELA 4EUTA 1SJHD 4DBGA 2KWCA 4FJZA 1XLNA 2XVWA 3Q8BA 3HM6X 2KKCA 2N7JA 3VUYA 4DXFA 3IT4B 1YJIA 2JT4B 2I38A 5C23A 1TS5A 1NT2B 5G2NA 4ZBKA 3BYYB 1DOXA 1CJEA 4GMVA 1U4AA 3KUCB 1FXAA 2LXAA 4WH4A 2E0XA 4XC2A 4WAAA 2PIAA 3VTVA 2AQ3B 1KJTA 1NI3A 2AQ1B 2O2VA 2D2QA 2WLBA 3AM9A 1XLQA 1L0YB 1V81A 5LXHA 2JXXA 3LJ3A 2L1AA 4FHKA 2NTSA 2G4DB 3VR9B 2D3GA 1H5WA 4NJ6A 2LUMA 3WHSA 3I57A 1FNWA 1GOZA 3IAM1 1H8CA 3W1SA 4L2YA 2E0YA 3DDCB 1HXYD 3FILB 3W5VB 3P4QB 2CHZA 1RM6C 2MRPA 1E8ZA 1YJJA 1FEHA 2CKXA 2BXQA 3M3JA 2RGFA 3AEEB 2XSIA 4L9KA 4N59A 2DZIA 2MX2A 4OTTA 1FMAD 4P7IA 2EKIA 5BO4B 2G3QB 4F5VA 3BK1A 1EU4A 3AB5A 5J18A 2DBWA 2WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9K B;  3HM3 A;  2K8C A;  4GDL B;  1L7Y A;  3APF A;  3RZW C;  3H1U A;  5AEK B;  2LJ5 A;  2REX A;  4AJW A;  4W9D A;  2M8S A;  4GSW A;  3RZF A;  3UQA A;  3EC8 A;  4IWP A;  5J17 A;  2IO0 B;  2LD9 A;  2KLG A;  4DK5 A;  2ZCB A;  3PLU A;  1A5R A;  4IWO A;  5FR6 A;  3VUW A;  4KIK B;  2C5L C;  2OJR A;  1VD2 A;  3KH0 A;  4HVB A;  4EZK A;  1VCB A;  3EFU A;  3PRZ A;  2WX1 A;  4PS3 A;  1IP9 A;  4NPN A;  2BGF A;  4NJ7 A;  3ZLZ A;  2ZCC A;  4I6L B;  5CHW A;  3EHV A;  3NS8 A;  3WAO A;  3P2B A;  3RD2 A;  4GGQ A;  2LAS A;  4HWI B;  3OAW A;  4RM9 A;  4G11 A;  2JWZ A;  3X23 A;  4B6W A;  4W9F A;  2DZJ A;  3JVZ X;  4WWN A;  2QHO A;  3PV1 A;  3W1S C;  1P0R A;  2BYF A;  3CSF A;  2MWS B;  2V1Y A;  3SHQ A;  2ZVN A;  3A4S C;  4KZ0 A;  3ZNG C;  5J2R A;  3W1Y A;  5AZG A;  4B95 A;  4IG7 B;  2J0J A;  4YL8 A;  4URK A;  3IG3 A;  1WX8 A;  3HIZ A;  1Z5S B;  3PGE A;  3VUX A;  2Y5B B;  1V86 A;  3I3T B;  1V5T A;  5GMV A;  3OLM D;  1H4R A;  2I1K A;  5G55 A;  2AWT A;  3RYT A;  3L17 A;  3NHE B;  2DYB A;  4E3C A;  3U30 A;  1LXD A;  2NPT B;  1SIF A;  2RPQ A;  1I35 A;  2KAN A;  2PPH A;  3QWZ B;  1WJ6 A;  3A9J B;  1OEY J;  2ZPY A;  3R66 C;  1GC7 A;  1V9J A;  1K8R B;  1UZX B;  1YD8 U;  4G50 A;  4I6P A;  4KZC A;  3ZIM A;  1E8Y A;  4W9J A;  2WYQ A;  3A9K A;  2M17 A;  5L83 A;  1L2N A;  2XEW A;  3VTW A;  4GDL A;  4CO7 A;  1NDD A;  1V49 A;  1YX5 B;  2J7Q B;  2K6D B;  2KC2 A;  2LRW A;  5E6N A;  3QIJ A;  4HK2 A;  2BPS A;  1GUA B;  4HCN B;  2L76 A;  4EZJ A;  3IHP C;  3M62 B;  3VAW A;  4TQ0 A;  1PQS A;  4GB9 A;  4W9L A;  4NAW B;  3AU4 A;  4DDG D;  2NCN A;  3ECI A;  4GU2 A;  3APD A;  5D94 A;  3VH3 B;  1M94 A;  4KIK A;  3NZU A;  3L10 B;  2KTF A;  2PEA A;  2V3S A;  3IBE A;  1GJZ A;  2FCQ A;  3AU5 A;  3ZDM C;  1LQB A;  1OTR B;  2YVC A;  2KQS A;  3NZS A;  3WA0 A;  3TIX A;  4BBN F;  2JUO A;  2IY1 B;  1GG3 A;  2N7D A;  4GXB A;  1EUV B;  4KDI C;  4IM2 A;  3O65 B;  2MSE D;  2LXC A;  3TMP B;  3DVN V;  2MLB A;  3GZN I;  3QAQ A;  2CS4 A;  2MQJ A;  3RCZ A;  3PVL A;  2NBV B;  5E6O A;  3PRP B;  3DVN U;  5TR5 A;  4ANU A;  3A4R A;  4KSL C;  3S2A A;  2KQ7 A;  2KHW B;  2AL6 A;  3AI5 A;  2A5U A;  2NVU I;  1WGR A;  3UIN B;  1UGM A;  1WF9 A;  5DPT A;  1F9J A;  5KHO A;  3IVF A;  5D7G A;  4F1S A;  2LGD A;  4BKG A;  2C7N B;  2D11 A;  1R4N I;  2IYD B;  1WR1 A;  3QAR A;  4JGH B;  1WXA A;  2KDB A;  2NPT A;  4AOF A;  2L00 B;  4AUQ C;  2RSU A;  3PRE A;  2NBU A;  2KX0 A;  3A9J A;  4LDT B;  1J19 A;  2JY6 A;  3ZNZ B;  1YX6 B;  4RMA A;  2KOX A;  2NS5 A;  1OQY A;  2GMI C;  2LZ6 A;  4AJY B;  1UH6 A;  1WE7 A;  4NY0 A;  3KYD D;  4OVU A;  2BYV E;  3H7S A;  3LDZ E;  3QCA A;  4IM0 A;  4NQK E;  4W9C A;  4ZRK A;  3DVG X;  3SU8 X;  2DYO A;  4JIO U;  4IC7 B;  2RD0 A;  1NI2 A;  1V6E A;  3UGB B;  4FAD A;  3T9L A;  3UIP B;  4PYU A;  1C1Y B;  2KJR A;  3EEC A;  4XZ4 A;  3R7R A;  4MSQ B;  4DWF A;  4LCD E;  4G3X B;  4NAW A;  3DCG A;  1WGY A;  1UD7 A;  1Q0W B;  5IA7 A;  2WWZ A;  3APC A;  4TKN A;  2J0M A;  2MBE A;  3ONS A;  5JHA A;  4K7S A;  1JRU A;  4LJO B;  4KV2 A;  1WY8 A;  3AUL A;  1ISN A;  3QK0 A;  3Q3F A;  4M0W B;  3KYC D;  3VVW B;  4A3P A;  1WM2 A;  3DPD A;  2LVQ A;  1NBF C;  4OVV A;  3ZDT A;  2BWF A;  2FIF A;  2ZNV C;  3PLV A;  3QQ8 B;  4II3 B;  4W9E A;  1TGZ B;  2IO1 B;  4RM8 A;  3N32 A;  4FJV B;  4ANV A;  5CHV C;  2ASQ A;  2Z0D B;  3PZD A;  2UYZ B;  5LLI A;  2G45 B;  4FN2 A;  4MEM A;  3R7Q A;  2IO3 B;  3MJW A;  3V6C B;  2KDE B;  2NR2 A;  2ZJD A;  3RUI B;  2O6V B;  2FNJ B;  3U7D A;  3K9P B;  4AP4 C;  4MGZ E;  1WJ4 A;  1S3S G;  2N4F A;  4NQL B;  3PS6 A;  2D10 A;  2N1V A;  5D2M B;  1WI0 A;  1TZ1 A;  5KHQ A;  2L0T A;  4GDK B;  1R4M I;  4HJK A;  2DEN B;  3NOB A;  4BVU C;  2VRR B;  3U8Z A;  3CF6 E;  2ZZP B;  3WAL A;  4CHK A;  4MJS B;  1P9D U;  2JPH A;  2LUE A;  3WAP A;  2MBB B;  4WJP A;  4W9I A;  4JQW C;  1MG8 A;  2CHW A;  4LDT D;  3QA8 A;  4BKS A;  4KDL B;  2KFK B;  2ZPN A;  5EDS A;  4TQ1 A;  3QC8 B;  2FCN A;  1D3Z A;  2FID A;  3L08 A;  2N1W A;  5D6J B;  3DQV A;  2JF5 A;  3UIO B;  3ZW3 A;  1GNU A;  2KFJ A;  2C9W B;  3TL5 A;  3ZRF A;  4WJO A;  4BKS D;  2KC1 A;  2IY0 B;  3L0W B;  1V80 A;  1WGH A;  3NY5 A;  4W9G A;  4ZYN A;  1RFA A;  2KK8 A;  2HE7 A;  2R2O A;  4PYZ A;  1OEY A;  3PHW B;  1BT0 A;  2DAF A;  4HDO A;  4MDK E;  2CR5 A;  2L8J A;  4LJP B;  2KLC A;  2IZV B;  4PS8 A;  3CST A;  4BOZ B;  2AEH A;  2MA9 B;  4JL9 A;  1EO6 A;  4K7W A;  2K6Q A;  1LFD A;  2K1F A;  4IW0 A;  1YQB A;  2KO3 A;  3N3K B;  5LXI B;  2J0K A;  4ANX A;  4MGI E;  3IFW B;  4J6I A;  4W9K A;  3MHS D;  4DDI D;  1P3Q U;  4WWO A;  4IM3 A;  2M4N A;  2ZEQ A;  1Z2M A;  1WXS A;  3ZNH B;  2O6V A;  4B9K A;  3L54 A;  2GOW A;  3CMM B;  3JSV B;  1XT9 B;  1ZW7 A;  5JH5 C;  2K8B A;  4MEL A;  1KLV A;  1G6J A;  3H7P B;  2MW5 A;  1J0G A;  2O6V D;  4ZRJ A;  2HD5 B;  4GDK A;  4EOY A;  2FAZ A;  5DCN A;  2KN5 A;  2KXJ A;  5JHB A;  4MJS A;  2KMA A;  2MP2 B;  1KOT A;  2Z0E B;  3HK0 A;  2KD0 A;  3ENE A;  5E6P A;  3VFK A;  3TBL D;  1QZE A;  3OJ3 A;  1LM8 B;  1SGH A;  2KFK A;  4M8M A;  3UQB A;  1UBI A;  3N30 A;  4CYE A;  3PPA A;  2B3A A;  2C60 A;  2M0X A;  3KUZ A;  4MGY E;  5DPS A;  3ZTD A;  3ZVV A;  4DHZ B;  3VXW A;  1V2Y A;  4F7Z A;  2FCM A;  4ANW A;  5L95 C;  1WX7 A;  2IBI B;  3QJZ A;  4DHZ E;  2LWP A;  2YLM A;  3WAN A;  2NBW B;  4WJQ A;  2D07 B;  2KDF B;  4GIV A;  3UF8 A;  2PE6 B;  2KZR A;  3SD5 A;  1WXM A;  4MM3 A;  1WZ3 A;  3QHT A;  3T8M A;  4W9H A;  3VH4 B;  2L05 A;  3ZNI D;  3PT2 B;  1V5O A;  4DHJ B;  2KWU B;  4HCP B;  2M1M A;  2N9X A;  3DOW A;  4TV3 A;  4II2 B;  3VDZ A;  4BBN C;  2LRU A;  3MTN B;  4MSM B;  1WZ0 A;  1X1M A;  2GBK A;  4HPL B;  3V6E B;  4FLH A;  2DYM A;  1HE8 A;  5C1Z A;  4K7U A;  3VQI A;  4HLE A;  2N7E A;  2BYE A;  2UWQ A;  2HTH A;  3JSV A;  1EF5 A;  3ZTC A;  3KUD B;  3RT3 B;  1S1Q B;  1TBE A;  1WRD B;  2DX5 B;  4EKU A;  1E7U A;  2LVP A;  5AZH A;  3H7P A;  4PS7 A;  1Y8R C;  3X0W A;  4ASW C;  1WGG A;  1EF1 A;  5AZF A;  2MBO A;  1IPG A;  5JZE B;  4EEW A;  4E71 A;  2KVR A;  2MP2 A;  1E7V A;  2KTR B;  1TTN A;  4EFO A;  2MCN B;  1OGW A;  2CKH B;  2BKF A;  3QX1 A;  4IWQ A;  4ZRI A;  3TJP A;  4DXA B;  4FBJ B;  4NNJ B;  3KVF B;  2LI5 A;  4FHJ A;  1WR6 E;  2DZM A;  1C3T A;  1SE9 A;  2O2V B;  3PSE B;  4MGK E;  4A20 A;  1AAR A;  4X57 B;  2I1J A;  2JRI B;  2XK5 B;  2AL3 A;  4F8C B;  4N9F 4;  1WGD A;  2KNB A;  4EZL A;  2LVO A;  1FXT B;  3JYU A;  1UEL A;  2FUH B;  4WWP A;  1WMH B;  1RAX A;  2EMS A;  4EUT A;  2L3Z A;  1T0Y A;  2ZVO A;  4K81 A;  5DPR A;  3RUL A;  2LGX A;  3DBL I;  5CTR C;  3R3M A;  4DBG A;  2JZZ A;  2DZK A;  2KJH B;  2KWC A;  4FJZ A;  2ZNV B;  4ZDV A;  2MBQ A;  3HM6 X;  2AYO B;  4WQO B;  4GOC A;  4TUU A;  1Q5W B;  2KKC A;  3A33 B;  4M8N A;  4ICU A;  3L16 A;  3VUY A;  2BKR B;  3DBS A;  3SDL C;  2Z59 B;  2V4L A;  5HKH A;  5DPW A;  1ZKH A;  2JT4 B;  3B0A A;  4HXD A;  5C23 A;  3ZKJ C;  4DHJ D;  5G2N A;  2G4S A;  1E5W A;  3V62 A;  3JW0 X;  4GMV A;  2KMC A;  2XBB C;  4G0N B;  3ZO5 B;  3ML8 A;  4FUL A;  2L0F A;  1U4A A;  1WXV A;  2C7H A;  3B1L X;  1YIW A;  4I6N B;  4WJN A;  4E74 A;  3BY4 B;  2JRH A;  3PHX B;  2W9N A;  2K8H A;  3KUC B;  3A1Q B;  5CHF A;  1IYF A;  2LXA A;  1ZGU B;  1WYW B;  4KSK C;  2KDI A;  1E8W A;  2KTR A;  3WAM A;  2JZ3 B;  1WX9 A;  4K1R B;  5CX3 A;  2GBN A;  2CU1 A;  1I42 A;  4XC2 A;  4WAA A;  3VTV A;  2OOB B;  2PE9 A;  3L13 A;  1KJT A;  2FCS A;  2K25 A;  2BF8 B;  4IUM B;  2O2V A;  2D2Q A;  1WE6 A;  1XD3 B;  2KWV B;  2XK5 A;  3ML9 A;  4BKT A;  2GBR A;  4FJY A;  1WH3 A;  3K9O B;  4FA6 A;  2EMT A;  3VHT C;  1P1A A;  1V81 A;  2C7M B;  1WMH A;  2EKE C;  3H9D A;  2HJ8 A;  5LXH A;  3KW5 B;  2JXX A;  3LJ3 A;  1CMX B;  2CHX A;  2R2Q A;  3GOE A;  4FHK A;  2DAJ A;  1Q1O A;  3Q3J A;  1GC6 A;  1WIA A;  3ALB A;  2G4D B;  3B08 A;  3BIN A;  2PJH A;  3VTU A;  2D3G A;  1E90 A;  4GN1 A;  4NJ6 A;  4MH0 E;  3PTF C;  1XQQ A;  3DBR I;  2GBM A;  5IAA C;  1H8C A;  1E8X A;  3W1S A;  4JLC A;  3DDC B;  3M63 B;  3V61 A;  1WM3 A;  4XX5 A;  4HPM B;  1J8C A;  1KM7 A;  2RR9 A;  3OJ4 B;  1RLF A;  1UBQ A;  2CHZ A;  2GBJ A;  3ZRC A;  4AWJ A;  4BFR A;  3H6N A;  2DHZ A;  1WJN A;  3ZUN A;  2MRP A;  1E8Z A;  1P98 A;  2IO2 B;  3M3J A;  2RGF A;  3TCA A;  2L7R A;  3V60 A;  3A1Q A;  4A3O A;  2A4Z A;  2KJ6 A;  3AXC A;  4BOS C;  3D32 A;  3DBH I;  2BWE S;  2DZI A;  2MX2 A;  1YJ1 A;  3HHM A;  3WIM A;  3PRM B;  2WX0 A;  4KVG B;  4P7I A;  3C0R B;  4ICV A;  5BO4 B;  2G3Q B;  4HDQ A;  3M95 A;  3DVG Y;  2MBH A;  2LGY A;  2N9E B;  2JVC A;  1WJU A;  2N9P C;  2K39 A;  5J18 A;  2WDT B;  2KX3 A;  1WFY A;  1RRB A; 
#chains in the Genus database with same CATH topology
 2K8C A;  3AEF B;  3H1U A;  2EEL A;  5AEK B;  4WA6 B;  4W9D A;  4GSW A;  3RZF A;  3JQZ A;  5J17 A;  4P1C C;  2ZCB A;  1C79 A;  4JWS C;  1VD2 A;  4HVB A;  3GB1 A;  1VCB A;  1N62 A;  4NZL B;  1YQ4 B;  1IP9 A;  1MIV A;  2V4I B;  3ZLZ A;  4J2V A;  3EHV A;  4ACF A;  2INP E;  3P2B A;  3RD2 A;  2DNF A;  3EGR A;  2J4X A;  2BXN A;  4B6W A;  4LB2 A;  4W9F A;  3JVZ X;  1LGR A;  4YTP B;  3CSF A;  3W1Y A;  1ZOY B;  4B95 A;  2J0J A;  3B9J A;  3GP7 A;  3AE1 B;  1Z5S B;  4US9 A;  4OHJ A;  4KX6 B;  3HRD D;  2DYB A;  4E3C A;  2NPT B;  2RPQ A;  4RH6 A;  1FFV A;  1I35 A;  3FKY A;  1ESF A;  1WYG A;  2KAN A;  3QWZ B;  5HHD G;  5EE3 A;  3R66 C;  4A9A A;  1UZX B;  2PTL A;  2WYQ A;  3A9K A;  4GDL A;  4F7Z A;  2J7Q B;  2K6D B;  5FKA C;  3QIJ A;  1E78 A;  1V1O A;  1CK1 A;  2L76 A;  4EZJ A;  4M0W A;  3IHP C;  4F5T A;  1RWS A;  1F0Z A;  4GB9 A;  3E56 A;  4NAW B;  1M94 A;  4KIK A;  3L10 B;  2KTF A;  2PEA A;  2V3S A;  2KAJ A;  3BPJ A;  3AU5 A;  3ZDM C;  3WA0 A;  1OTR B;  1E7E A;  2KQS A;  3TIX A;  2IY1 B;  4FXC A;  1EUV B;  3TMP B;  2JQR B;  3GZN I;  1XO3 A;  4ZYS A;  3Q8E A;  1EU3 A;  2R61 A;  3AE6 B;  2CJO A;  3A4R A;  2XVV A;  1SB3 C;  2AL6 A;  2Z8J A;  3T3O A;  4Z69 A;  3AE7 B;  1UGM A;  5HOZ A;  1JML A;  2C7N B;  3P63 A;  3B2G A;  1STE A;  2IYD B;  3LU6 A;  4JGH B;  1HZ6 A;  2KDB A;  1MHH E;  3PRE A;  3AMZ A;  1HK1 A;  2JY6 A;  3Q3M C;  2KOX A;  1ET6 A;  2GMI C;  2DBU A;  3U2S C;  4K3B A;  2BYV E;  3LDZ E;  2EFC A;  2BQQ A;  1SE3 A;  3DVG X;  1GB1 A;  4JIO U;  2LXS A;  3UGB B;  1YQ3 B;  3UIP B;  1HEZ E;  1C1Y B;  2KJR A;  3EEC A;  5H8Y E;  4XZ4 A;  4MSQ B;  4DWF A;  4LCD E;  1OQQ A;  4PT5 A;  4GDX A;  4TKN A;  3DHH C;  2CU3 A;  5JHA A;  3OG5 A;  2XW1 A;  1I4X A;  4K7S A;  4M01 A;  1QT9 A;  1WY8 A;  1R4N B;  1ISN A;  4M0W B;  4A3P A;  2LVQ A;  3MHZ A;  1TKY A;  2BWF A;  3QQ8 B;  4LLG M;  1SF0 A;  4W9E A;  3P4P B;  2NNW A;  3N32 A;  4RGO S;  1J7A A;  3PZD A;  1KXP D;  2UYZ B;  2G45 B;  1QOG A;  5IJ5 A;  5DBY A;  5BYS A;  3MHH B;  4MGZ E;  1JWS D;  1S3S G;  2N4F A;  1DOY A;  1IBX B;  2N1V A;  4NJC A;  1ET9 A;  2L0T A;  1R4M I;  4HJK A;  2VRR B;  2ZZP B;  4LNF A;  1N60 A;  3WAP A;  1UF0 A;  1K51 A;  1NYR A;  4W9I A;  3Q8C A;  1L0X B;  4YXD B;  1MG8 A;  4LDT D;  4BKS A;  1UOR A;  2KFK B;  4G03 A;  2ZPN A;  5EDS A;  1QLB B;  2H89 B;  3L08 A;  5IKC M;  4L9Q A;  3ZJV A;  2OZB B;  2C9W B;  3ZRF A;  2XVU A;  4HKZ E;  1K53 A;  3M99 C;  3L0W B;  1WGH A;  4ZYN A;  4LUF A;  1MI0 A;  1RFA A;  5IN7 A;  2BS2 B;  4HGK A;  4FIP B;  4P1B C;  2Y5P A;  1SE4 A;  2KLC A;  2AEH A;  2MA9 B;  4K7W A;  1EO6 A;  2K6Q A;  1FRD A;  1FO4 A;  4C31 B;  1WRI A;  4ANX A;  3IFW B;  4J6I A;  3MHS D;  4DDI D;  4WWO A;  2MJ3 A;  4JX1 C;  3ZNH B;  3L54 A;  2WXO A;  3TEZ A;  1FFU A;  4MT5 A;  1N5X A;  4WIP A;  3Q14 C;  1C4A A;  4EOY A;  1MJD A;  1KOT A;  2KMA A;  2MP2 B;  3ENE A;  2MH7 A;  3TBL D;  3W9C B;  1LM8 B;  1BM0 A;  3FAH A;  1FNU A;  5DPS A;  3FNM A;  4DHZ B;  2XW0 A;  1V2Y A;  2JZP A;  5L95 C;  3QJZ A;  1L5P A;  4DHZ E;  3N1X C;  4W4U B;  1QOB A;  3CX9 A;  2BS3 B;  1D5M C;  2KZR A;  5IO9 A;  4KGT A;  4TSS A;  5BPK A;  1C77 A;  4P6V F;  2L05 A;  2W55 A;  3DOW A;  4II2 B;  2LRU A;  3MTN B;  4S17 A;  4WAF A;  2GBK A;  5MPO A;  4FLH A;  4N58 A;  2UWQ A;  3JSV A;  4DHX B;  3KUD B;  1NVI D;  3RT3 B;  1NEN B;  1TBE A;  1WRD B;  2L83 A;  1E7U A;  3H7P A;  1WGG A;  5AZF A;  2MBO A;  5IP4 D;  4EEW A;  2DLB A;  4S0R A;  3ABV B;  3U7Z A;  1DGJ A;  4F5U A;  2BKF A;  3I63 C;  4ZRI A;  2QIL A;  2G1E A;  3NVK A;  1VZS A;  3DHG C;  1C3T A;  4B0M A;  4X57 B;  2JRI B;  2AL3 A;  2GB1 A;  2LFI A;  2LVO A;  4WWP A;  1WMH B;  1RAX A;  2EMS A;  2ZVO A;  5CTR C;  2JZZ A;  2QC8 A;  2Q5W D;  4ZDV A;  2BTE A;  2WDR B;  2AYO B;  4WQO B;  4TUU A;  4YWG G;  3GS2 A;  1FD6 A;  4ICU A;  3DBS A;  2BXK A;  1QOA A;  4OVZ A;  2W3S A;  2V4L A;  4DHJ D;  3PZ8 A;  3V62 A;  2BXL A;  1SIJ A;  2KMC A;  3CWI A;  3ZO5 B;  1FCC C;  4FUL A;  2L0F A;  1XLO A;  3B1L X;  4E74 A;  2JRH A;  3PHX B;  2K8H A;  1ZDX A;  2W54 A;  2WQY B;  3WAM A;  2WS3 B;  4K1R B;  1EWY C;  1WX9 A;  2GBN A;  1I42 A;  2QIE B;  5H92 C;  2OOB B;  1M4V A;  2FCS A;  4IUM B;  2KQ4 X;  2N9L A;  2VUF A;  3ML9 A;  4B0E A;  1VDV A;  3K9O B;  1KTK A;  2EMT A;  3VHT C;  3BVM A;  1P1A A;  2KT7 A;  3TEY A;  2C7M B;  4DM0 A;  1VLB A;  3RPF C;  1TS4 A;  2R2Q A;  2DWQ A;  2DAJ A;  4WQM A;  1GC6 A;  3ALB A;  4LNK A;  1FRR A;  3B08 A;  3AE4 B;  1E90 A;  1XXG A;  3R8B A;  5JXV A;  4MH0 E;  1MUH A;  1SB0 A;  3V03 A;  3PTF C;  2BBC A;  3A73 A;  5IIH A;  5IAA C;  1L4D B;  1E8X A;  3MP9 A;  3GE8 C;  1J8C A;  4XX5 A;  3OJ4 B;  4AWJ A;  2BXM A;  3H6N A;  2ICI A;  3SIV B;  4IOI E;  2JXT A;  4A6Q A;  1L6U A;  2BXC A;  2A4Z A;  1UUP A;  3D32 A;  2BWE S;  1HTO A;  1YJ1 A;  3WIM A;  4BKE A;  3N9Y C;  3RNE C;  1VRA B;  2V0G A;  3TDL A;  1WJU A;  1MFW A;  2MJD A;  5IIX A;  3RNB C;  2KX3 A;  2WU2 B;  1I4G A;  1PUT A;  3APF A;  1E7C A;  2KBZ A;  2LJ5 A;  2REX A;  2M8S A;  3H3A A;  2ROH A;  3VUW A;  2C5L C;  1C76 A;  1HQR D;  3KH0 A;  3EFU A;  4NPN A;  2ZCC A;  4D7X A;  3WAO A;  1HK5 A;  4ZHO A;  4GGQ A;  2LAS A;  3X23 A;  3FIL A;  3WHQ A;  1C78 A;  1SBB B;  3PV1 A;  3W1S C;  2AQ2 B;  2KAC A;  1TY2 A;  2LQH A;  5AZG A;  4YL8 A;  3IG3 A;  1WX8 A;  1YOV B;  2ZW0 A;  2J53 A;  5GMV A;  3OLM D;  1H4R A;  3WCQ A;  4OW0 A;  5G55 A;  4FK5 B;  3NHE B;  1N6Z A;  3NVY A;  2BXA A;  2PPH A;  3FWB C;  1GC7 A;  1K8R B;  1YD8 U;  2M17 A;  2XEW A;  3R2T A;  1NDD A;  1YX5 B;  4HK2 A;  3SIU B;  1AN8 A;  4KKI A;  4TQ0 A;  1XCT L;  2NCN A;  4GU2 A;  3APD A;  3OWE B;  4OT2 A;  1AW7 A;  2JUO A;  4BBN F;  1GG3 A;  3O65 B;  2H88 B;  4RFB A;  4C4V B;  4ITK A;  2HJ1 A;  1I7H A;  2JSV X;  4N0U D;  3PRP B;  2OED A;  1PFD A;  3S2A A;  1HK3 A;  2LJI A;  3AI5 A;  1T0S C;  1RFK A;  1WGR A;  3SFD B;  2IPK D;  2KWD A;  4F1S A;  4YSX B;  4BKG A;  2EFH A;  1SSN A;  1Q10 A;  2NPT A;  4JWU C;  4ZBR A;  4AUQ C;  2RSU A;  1E10 A;  2NBU A;  1QIL A;  1YX6 B;  4RMA A;  1FXI A;  2WXG A;  2NS5 A;  5BMH A;  1FOU A;  1UH6 A;  2BXE A;  4ZRK A;  2DYO A;  4EE2 A;  4IC7 B;  2RD0 A;  4FAD A;  3T9L A;  3SFE B;  2WXI A;  1KFY B;  3DWM A;  2Z8I A;  2NTT A;  3R7R A;  1SXT A;  4NAW A;  4US8 A;  2PVG C;  1NEK B;  1EM7 A;  1UD7 A;  1PGA A;  2WWZ A;  3BVZ A;  2J0M A;  2MBE A;  3AE9 B;  4HKQ A;  4KV2 A;  3AUL A;  3VVW B;  1WM2 A;  1IGC A;  4ZHP A;  1NBF C;  4OVV A;  2JWU A;  3PLV A;  4II3 B;  2IO1 B;  4RM8 A;  4ANV A;  2K5P A;  5CHV C;  2Z0D B;  4CQN A;  3R7Q A;  2V36 A;  4MEM A;  4DQO C;  4MH8 A;  2O6V B;  2FNJ B;  3AH7 A;  1UGJ A;  2B76 B;  4GDK B;  4L23 A;  2DEN B;  2VDB A;  3NOB A;  5ID7 A;  1P9D U;  4WJP A;  2L52 A;  4JQW C;  1ACC A;  4OZA A;  2BS4 B;  2RDB C;  3IXS A;  3QA8 A;  5HG2 A;  4KDL B;  2VZK D;  2IJ0 A;  1D3Z A;  2FID A;  1EWC A;  2N1W A;  4USA A;  3DQV A;  1GNU A;  4WJO A;  4BKS D;  2KC1 A;  1CZP A;  3NY5 A;  4ARC A;  4LB9 A;  2HE7 A;  4PYZ A;  2XN9 C;  2V3N A;  3PHW B;  1BT0 A;  3AE8 B;  4MDK E;  5G5H A;  4K2C A;  4WWM A;  3BWU D;  1E7P B;  3BII D;  1JRP A;  2K1F A;  2J0K A;  1H9Z A;  1R4M B;  1MVK A;  1BKE A;  1N5U A;  1WXS A;  3DBL B;  3V08 A;  2K3U A;  2GOW A;  3CMM B;  1YN4 A;  3T3N A;  2K8B A;  1T0R C;  4MEL A;  1G6J A;  4HRS A;  1IBX A;  2MW5 A;  1WSP A;  4ZRJ A;  2K22 A;  2I2Y A;  4ZOH C;  3HK0 A;  3C8Y A;  5E6P A;  4PO0 A;  3OJ3 A;  3W2D A;  4RGT A;  1ROE A;  2KFK A;  3A75 A;  2QMT A;  1D5X C;  1VZ6 A;  3N30 A;  4CYE A;  2YEP B;  2JUH A;  3W5U B;  2Y5C A;  1BXT A;  1WX7 A;  2BX8 A;  2YLM A;  1LOT A;  3WAN A;  2D07 B;  2XVQ A;  3Q69 A;  3MC8 A;  1MUS A;  5EE1 A;  2K0P A;  3VH4 B;  3T8M A;  3ZNI D;  3U4E G;  2EFE A;  1V5O A;  4BY9 C;  2KWU B;  2M1M A;  4MSM B;  1TZO A;  1QQR A;  2BB5 A;  1X1M A;  2DYM A;  2SEB D;  2JU6 X;  3VQI A;  3AE3 B;  2WXL A;  1N5W A;  3ZTC A;  2IGH A;  1S1Q B;  3RMK C;  4TMA B;  2GRI A;  2E3T A;  5GIN A;  3NZ3 A;  1EF1 A;  5JZE B;  4YSZ B;  4LTU A;  2MP2 A;  2KTR B;  1KRH A;  2MCN B;  2BVC A;  4IWQ A;  3QX1 A;  3TJP A;  3ZJU A;  4FBJ B;  4NNJ B;  1HK4 A;  3KVF B;  2LI5 A;  2DBY A;  3PSE B;  4MGK E;  1PGB A;  2XK5 B;  1HA2 A;  1C4P A;  2KNB A;  4EZL A;  1FXT B;  3GQX A;  3O13 A;  3ZYY X;  3RUL A;  3DBL I;  2BXD A;  2QCZ A;  3P4S B;  4K3C A;  5FK9 C;  3R3M A;  1T6B X;  1HTQ A;  3GQU A;  4M8N A;  3ZQ4 A;  4D2K A;  2BKR B;  4KKJ A;  2Z59 B;  2WXP A;  5HKH A;  5DPW A;  4HXD A;  3ETR A;  3RFZ B;  2G4S A;  2DG5 A;  4G0N B;  4IKG A;  3ML8 A;  5D3D A;  5BYR A;  3UIV A;  2C7H A;  1YIW A;  4FJC B;  3BY4 B;  1TIF A;  5BMG A;  3A1Q B;  5CHF A;  1IYF A;  1DYQ A;  2QDF A;  4KSK C;  1RYJ A;  2KDI A;  1E8W A;  1HK2 A;  2ONQ A;  2JZ3 B;  3GA9 L;  2FUG 1;  3J9C A;  2CU1 A;  2PE9 A;  3L13 A;  2K25 A;  4N6E B;  2BF8 B;  5E6J A;  5EE0 A;  1XD3 B;  2KWV B;  1WXQ A;  2GBR A;  2WXM A;  3B9L A;  1WH3 A;  1BJ5 A;  1I4Q A;  4G01 A;  2EKE C;  1V1P B;  1WMH A;  3H9D A;  3KW5 B;  2WU5 B;  2W82 A;  2CHX A;  3GOE A;  3SEB A;  1Q1O A;  3Q3J A;  4ZRQ A;  4J3O D;  1WIA A;  2ACZ B;  1AWD A;  4RF0 A;  2PJH A;  1TS3 A;  4L1B A;  1XQQ A;  2GBM A;  2JX5 A;  1E7B A;  2WHI A;  3V61 A;  3V05 A;  1WM3 A;  4HPM B;  2RR9 A;  4BFR A;  2GBJ A;  3ZRC A;  3ZUN A;  2DHZ A;  2WDQ B;  4EMX A;  1MHX A;  1FIQ A;  1JW9 D;  5BYQ A;  3V60 A;  4AQ7 A;  5I4D A;  4A3O A;  3AV8 A;  2J42 A;  4BOS C;  3PRM B;  1JQ4 A;  3H37 A;  2WX0 A;  4KVG B;  4ICV A;  4HDQ A;  2VUE A;  3M95 A;  3DVG Y;  2JYT A;  1BUI C;  2LGS A;  2N9E B;  2JVC A;  2K39 A;  2WDT B;  1WFY A;  2AGH B;  3HM3 A;  3MC9 A;  1L7Y A;  1C4C A;  1ZDV A;  2KMM A;  2WDV B;  2LD9 A;  2KLG A;  4DK5 A;  1A5R A;  3PLU A;  1E7G A;  4IWO A;  2M56 B;  3PRZ A;  2BGF A;  4NJ7 A;  4ZUX V;  4HWI B;  4RM9 A;  4G11 A;  1IUE A;  1DOI A;  3IT6 B;  2QHO A;  2L32 A;  2BYF A;  3NJT A;  2MWS B;  1JWU D;  2PMV A;  5J2R A;  4KZ0 A;  1JWA D;  3RNC C;  2LOQ A;  3HIZ A;  3SR6 A;  3N1Y C;  2FBW B;  3VUX A;  1F77 A;  1V86 A;  1TKG A;  1V5T A;  2I1K A;  3Q8F A;  1MIY A;  3RYT A;  3L17 A;  3P1M A;  3U30 A;  1J7B A;  3FC4 A;  1MM8 A;  4GLS C;  1V97 A;  3A9J B;  3G9K D;  1V9J A;  3NG0 A;  4G50 A;  4I6P A;  3ZIM A;  5AUI A;  1YN5 A;  4M00 A;  5L83 A;  1L2N A;  1MG4 A;  3VTW A;  2RMM A;  1V49 A;  2KC2 A;  5E6N A;  1VZ8 A;  2BPS A;  1GUA B;  4HCN B;  4NAM A;  3VAW A;  1PQS A;  4W9L A;  3LB8 C;  3AU4 A;  1VR9 A;  3ECI A;  5D94 A;  3VH3 B;  5HI1 A;  2VH1 A;  1GJZ A;  2BW2 A;  1LQB A;  2YVC A;  4BAX A;  3ZJT A;  2BXB A;  3TUO A;  4GXB A;  4KDI C;  4IM2 A;  4C7Z A;  2MSE D;  5DQF A;  3DVN V;  3QAQ A;  2OHF A;  2CS4 A;  3RCZ A;  2NBV B;  3KIK A;  1E7F A;  2QEJ C;  1GAQ B;  3DVN U;  5TR5 A;  1A70 A;  4KSL C;  4YSY B;  2KQ7 A;  2KHW B;  3V09 A;  2A5U A;  1HA5 A;  3AN1 A;  3RN9 C;  1WF9 A;  5DPT A;  1F9J A;  4LUH A;  3IVF A;  5D7G A;  1TF0 A;  1T3Q A;  2V3P A;  5C2T B;  2JYE A;  1WR1 A;  3EFC A;  3QAR A;  3RI7 C;  2SAK A;  3CIR B;  3H8H A;  2KX0 A;  4LDT B;  1J19 A;  2DBX A;  3ZNZ B;  3NVV A;  3ICX A;  1TY0 A;  1CQV A;  1OQY A;  2LZ6 A;  4OVU A;  3KYD D;  3QCA A;  2LHE A;  3SU8 X;  1SJE D;  3B2F A;  4PYU A;  2LXT A;  3PLA A;  4MAC A;  2X38 A;  3DCG A;  2INN E;  1Q0W B;  5IA7 A;  3LU8 A;  1QF6 A;  3ONS A;  3LU7 A;  1JRU A;  1GNJ A;  1JAL A;  4C4V A;  3AED B;  3Q3F A;  3MHS B;  2IGG A;  2BB6 A;  3DPD A;  3ZDT A;  2ZNV C;  2FIF A;  2X8X X;  1TGZ B;  4WUR A;  3LXF A;  1E7H A;  1ZE3 D;  4FJV B;  2LMC A;  2INC C;  1YMH E;  2ASQ A;  5LLI A;  4HGM B;  2IO3 B;  3MJW A;  3V6C B;  5IFO A;  2NR2 A;  2ZJD A;  5IJE A;  3PS6 A;  1ZXI A;  2PKO A;  2D10 A;  3SQJ A;  2LGI A;  1WI0 A;  1TZ1 A;  2HTM E;  4RCO A;  4BVU C;  3KJL A;  3U8Z A;  1Y56 A;  2WP9 B;  4CHK A;  4MJS B;  2WGS A;  2LUE A;  2YEP F;  5TSS A;  2MBB B;  1MPE A;  4TQ1 A;  4S1Y A;  3QC8 B;  1MA9 A;  2FCN A;  3TSS A;  1T0Q C;  2EFD A;  2OT3 A;  3ZW3 A;  1QOF A;  2KFJ A;  2PW9 A;  2IY0 B;  1V80 A;  4W9G A;  2KK8 A;  2R2O A;  2DAF A;  4HDO A;  2NMQ A;  2IZV B;  4PS8 A;  3CST A;  4MM3 B;  4BOZ B;  4JL9 A;  4OTU A;  4HJG E;  2K0N A;  1LFD A;  4LNN A;  1AYF A;  3N3K B;  1JCK B;  4LNO A;  3NVI A;  3I5J C;  4W9K A;  1P3Q U;  2K9X A;  1SE2 A;  2O6V A;  3GE3 C;  4ZC6 A;  1XT9 B;  3AEB B;  1ZW7 A;  3PO0 A;  5JH5 C;  1KLV A;  3MJ5 A;  4G04 A;  4KGR A;  3MC0 B;  1QKZ A;  2HD5 B;  4GDK A;  1D4B A;  2KN5 A;  4C00 A;  2RDH A;  2Z0E B;  4QAY A;  3KQ4 A;  3VFK A;  2KN4 A;  1QZE A;  2VH2 A;  1SGH A;  4M8M A;  4ARI A;  3DHI C;  2MEK A;  3PPA A;  2B3A A;  1KF6 B;  3KUZ A;  4MGY E;  3ZVV A;  3VXW A;  4IW2 A;  1TS2 A;  3NRZ A;  1D5Z C;  2WXH A;  2IBI B;  2QHB A;  4WJQ A;  2KDF B;  3UF8 A;  2PE6 B;  3HUI A;  4JE3 B;  1WXM A;  4M70 B;  3QHT A;  4W9H A;  5LNK 1;  3PT2 B;  4DHJ B;  2BXG A;  4HCP B;  4BBN C;  1WZ0 A;  4HPL B;  3BZD B;  5IJF A;  4Q2J A;  3V6E B;  1HE8 A;  4K7U A;  4HLE A;  2TSS A;  2BYE A;  4GG2 A;  4N3Z A;  2RPV A;  4A90 A;  1F52 A;  1E7A A;  2LVP A;  5AZH A;  4PS7 A;  1Y8R C;  1L6V A;  2BXH A;  3MFG A;  4M02 A;  3DBR B;  1BML C;  1UWM A;  1XEE A;  4EFO A;  4C56 C;  1OGW A;  2CKH B;  4H2A A;  2DZM A;  1SE9 A;  2O2V B;  3AE2 B;  2AX5 A;  1AAR A;  2I1J A;  1OFF A;  4LNI A;  1JWB D;  4XE0 A;  1JNB A;  2QSD A;  1WGD A;  2QMC A;  1OQR A;  1N61 A;  3JYU A;  2FUH B;  3DBH B;  2L3Z A;  1T0Y A;  4K81 A;  5DPR A;  2LGX A;  4XWW A;  3EA6 A;  2KJH B;  2DZK A;  3I9V 1;  2ZNV B;  4L8U A;  2MBQ A;  4AS1 A;  1TXU A;  1ZUD 2;  4GOC A;  4P16 A;  1P7E A;  1Q5W B;  3A33 B;  4OZB A;  1LNS A;  3EUB 2;  3L16 A;  3SDL C;  2W3R A;  2N0S B;  1ZKH A;  3KWL A;  3B0A A;  3ZKJ C;  4I9O A;  2FE8 A;  2D3B A;  1E5W A;  2I30 A;  1F2R C;  3JW0 X;  2XBB C;  1WXV A;  4I6N B;  4WJN A;  3NMU A;  4YT0 B;  2W9N A;  1ZGU B;  1WYW B;  3AEG B;  3NVW A;  2KTR A;  1GNI A;  1VFI A;  3TEX A;  5CX3 A;  2IDY A;  1WE6 A;  1O9X A;  2XK5 A;  4BKT A;  4ZRP A;  4FJY A;  3R2I A;  4FA6 A;  1E0Z A;  1J7E A;  1AO6 A;  2HJ8 A;  3NVM A;  2BXI A;  1CMX B;  1KH0 A;  3Q3O C;  4ZBQ A;  3BIN A;  4OR0 A;  3VTU A;  4GN1 A;  3UI3 A;  3DBR I;  2BYT A;  2Z8K A;  4JLC A;  1TYG B;  3M63 B;  1KM7 A;  1RLF A;  1UBQ A;  1WJN A;  1P98 A;  2IO2 B;  2BT6 A;  3TCA A;  2L7R A;  3A1Q A;  4OZC A;  2KJ6 A;  3AXC A;  3DBH I;  3HHM A;  2E6X A;  3C0R B;  1V8C A;  5B5T A;  2MBH A;  2LGY A;  4HEA 1;  2N9P C;  3ZXR A;  5EE9 A;  1RRB A;  1V1P A;  3A9K B;  4GDL B;  3RZW C;  4AJW A;  4O1N A;  3UQA A;  1IJG A;  1D6E C;  3EC8 A;  4IWP A;  2IO0 B;  1E6E B;  2BXO A;  3L4P A;  1GPX A;  1TJE A;  3FWC C;  2Z8L A;  5FR6 A;  1YNT E;  3VRB B;  4KIK B;  2OJR A;  4EZK A;  4PS3 A;  2WX1 A;  2ZW1 A;  3ZGZ A;  1E7I A;  1N63 A;  4I6L B;  5CHW A;  3NS8 A;  2IGD A;  4BZA A;  5IIU A;  2KYW A;  3OAW A;  2JWZ A;  2DZJ A;  4WWN A;  3ZXV A;  4XWT A;  3B9M A;  1P0R A;  2RDG A;  2V1Y A;  2G9H D;  3AE5 B;  3HVZ A;  2ZVN A;  3A4S C;  3SHQ A;  3WHR A;  3ZNG C;  2YDF A;  4IG7 B;  4XDD A;  4URK A;  3PGE A;  1PGX A;  2Y5B B;  3I3T B;  1C9F A;  1JRO A;  2D5G A;  2AWT A;  1LXD A;  1SIF A;  2XMO A;  1WJ6 A;  5D3I B;  1OEY J;  3NVZ A;  2ZPY A;  4KZC A;  1E8Y A;  4W9J A;  4CO7 A;  1XLP A;  2LRW A;  4PK1 A;  5T8I A;  2GUT A;  3M62 B;  1PYW D;  4DDG D;  1J7C A;  1TKE A;  3NZU A;  3IBE A;  4Z9O A;  4DXG A;  2FCQ A;  3NZS A;  2WXK A;  2N7D A;  3ECP A;  3BVG A;  2LXC A;  3RNA C;  2MLB A;  2I2Z A;  3U52 E;  2MQJ A;  1P7F A;  3PVL A;  5GIO A;  4ZCG A;  5E6O A;  4ANU A;  1K52 A;  2WXN A;  2NVU I;  4F5S A;  3UIN B;  4N0F D;  5KHO A;  2M0A A;  2OJW A;  1B9R A;  2LGD A;  2D11 A;  1R4N I;  2LQI A;  2IND C;  4HRO A;  3JRY A;  1L0V B;  4AOF A;  1WXA A;  2MHJ A;  2L00 B;  1FPY A;  3A9J A;  1TT5 B;  2VZK B;  5AUK A;  4AJY B;  1VZ7 A;  1WE7 A;  4NY0 A;  4W9C A;  3H7S A;  4NQK E;  4E99 A;  4JPS A;  4IM0 A;  1J78 A;  1L4Z B;  3DWG C;  3Q2A C;  1NI2 A;  1V6E A;  2LEK A;  1B1Z A;  4LA0 A;  4G3X B;  4KGS A;  1WGY A;  3NUH B;  3APC A;  1PDX A;  2ON8 A;  3KWV A;  4LJO B;  1VJK A;  3QK0 A;  3KYC D;  4UDU C;  1NYQ A;  3PZ7 A;  2XNA C;  4RGM A;  1LO5 D;  5ID9 A;  4FN2 A;  2KDE B;  3RUI B;  2UU7 A;  3U7D A;  1ENF A;  3K9P B;  2NQO A;  2PVO D;  4AP4 C;  1WJ4 A;  4NQL B;  1KDX A;  3HVD A;  5D2M B;  3NS1 A;  5KHQ A;  1KLG D;  2AJE A;  2PLP A;  2GI9 A;  3CF6 E;  3WAL A;  3RNF C;  2CJN A;  3AEA B;  1F2R I;  2JPH A;  1HZ5 A;  3N20 C;  4YTN B;  2CHW A;  2M19 A;  5FUO A;  4JK4 A;  1I4H A;  1GB4 A;  4REZ A;  1I4P A;  3VRA B;  1K50 A;  5D6J B;  2JF5 A;  3UIO B;  3TL5 A;  1I4R A;  2D3A A;  1OEY A;  2CR5 A;  2L8J A;  4LJP B;  3VR8 B;  5HFY A;  3IAS 1;  5BMI A;  1IGD A;  2N9K A;  3LYY A;  3BK2 A;  1FCL A;  2QJL A;  2QM6 A;  4YTM B;  3AEC B;  4IW0 A;  1YQB A;  2KO3 A;  5LXI B;  2MJE A;  3Q8A A;  4MGI E;  1R7S A;  4IM3 A;  2M4N A;  2BXP A;  2ZEQ A;  1Z2M A;  4B9K A;  5C3J B;  3V3X A;  1T5X D;  3JSV B;  4K71 A;  5G5G A;  4LK0 M;  5IOI A;  2LHD A;  1ZXH A;  4C80 A;  3H7P B;  3Q3N C;  3TEW A;  1J0G A;  4R3D A;  2O6V D;  2FAZ A;  2WXJ A;  5DCN A;  2KXJ A;  5JHB A;  4MJS A;  4A8X C;  5GIP A;  1YN3 A;  2KD0 A;  1WWT A;  4RGN A;  1E9M A;  5GXG B;  2KDM A;  1MIW A;  3UQB A;  1UBI A;  1WGK A;  2WNM A;  4XDC A;  1ZP0 B;  2C60 A;  2M0X A;  3ZTD A;  4C7Y A;  1FNV A;  2FCM A;  4ANW A;  2KWF A;  4IDI A;  1UNS A;  2LWP A;  2NBW B;  1UWX A;  4GIV A;  3SD5 A;  4XGA B;  1SEB D;  4MM3 A;  1WZ3 A;  3URY A;  3P42 A;  3KLS X;  1XCQ L;  2HDE A;  5FR3 A;  4TV3 A;  2N9X A;  3VDZ A;  4IW1 A;  4MBE C;  4RF1 A;  5C1Z A;  2WXR A;  2N7E A;  2HTH A;  1EF5 A;  1XF5 L;  2Y3A A;  2DX5 B;  4EKU A;  3E9S A;  2KVZ A;  3X0W A;  2BXF A;  4A55 A;  3P4R B;  4ASW C;  3BYT B;  1IPG A;  1JWM D;  4E71 A;  2KVR A;  1E7V A;  1TTN A;  1KLU D;  4DXA B;  1FM0 D;  5GHK A;  4FHJ A;  4RNA A;  1WR6 E;  1ZPS A;  4A20 A;  2WXF A;  4F8C B;  1F1H A;  2J52 A;  4N9F 4;  1KW2 A;  1UEL A;  4EUT A;  1SJH D;  4DBG A;  2KWC A;  4FJZ A;  1XLN A;  2XVW A;  3Q8B A;  3HM6 X;  4HPP A;  3RNG C;  2KKC A;  2N7J A;  3VUY A;  4DXF A;  3C19 A;  3IT4 B;  1YJI A;  2GLS A;  2JT4 B;  2I38 A;  5C23 A;  1TS5 A;  1NT2 B;  3BYY B;  4ZBK A;  5G2N A;  1DOX A;  1CJE A;  4GMV A;  2D3C A;  1U4A A;  3KUC B;  1FXA A;  2LXA A;  4WH4 A;  2E0X A;  4XC2 A;  4WAA A;  2PIA A;  3VTV A;  2AQ3 B;  1KJT A;  1NI3 A;  2AQ1 B;  2O2V A;  2D2Q A;  2WLB A;  3AM9 A;  1XLQ A;  1L0Y B;  1V81 A;  5LXH A;  2JXX A;  3LJ3 A;  2L1A A;  4FHK A;  3Q6B A;  2NTS A;  2G4D B;  3VR9 B;  2D3G A;  1H5W A;  4NJ6 A;  2LUM A;  3WHS A;  3I57 A;  1FNW A;  1GOZ A;  3N1Z C;  3IAM 1;  1H8C A;  3W1S A;  4L2Y A;  2E0Y A;  1HXY D;  3DDC B;  3FIL B;  3W5V B;  3P4Q B;  2CHZ A;  1RM6 C;  4XYC A;  2MRP A;  1E8Z A;  1YJJ A;  1FEH A;  2CKX A;  2BXQ A;  3M3J A;  2RGF A;  3AEE B;  2XSI A;  4L9K A;  4N59 A;  2DZI A;  2MX2 A;  4OTT A;  1FMA D;  2V9H A;  4P7I A;  3GZN B;  2EKI A;  5BO4 B;  2G3Q B;  4F5V A;  3BK1 A;  1EU4 A;  3AB5 A;  5J18 A;  2DBW A;  2WXQ A; 
#chains in the Genus database with same CATH homology
 2K8C A;  3AEF B;  3H1U A;  5AEK B;  2EEL A;  4WA6 B;  4W9D A;  4GSW A;  3RZF A;  3JQZ A;  5J17 A;  2ZCB A;  1C79 A;  4JWS C;  1VD2 A;  4HVB A;  3GB1 A;  1VCB A;  1N62 A;  4NZL B;  1YQ4 B;  1IP9 A;  1MIV A;  2V4I B;  3ZLZ A;  4J2V A;  3EHV A;  2INP E;  3P2B A;  3RD2 A;  3EGR A;  2J4X A;  2BXN A;  4B6W A;  4LB2 A;  4W9F A;  3JVZ X;  4YTP B;  3CSF A;  3W1Y A;  4B95 A;  1ZOY B;  2J0J A;  3B9J A;  3GP7 A;  3AE1 B;  1Z5S B;  4US9 A;  4OHJ A;  4KX6 B;  3HRD D;  2DYB A;  4E3C A;  2NPT B;  2RPQ A;  4RH6 A;  1FFV A;  1I35 A;  2KAN A;  3QWZ B;  1ESF A;  1WYG A;  5HHD G;  5EE3 A;  3R66 C;  4A9A A;  1UZX B;  2PTL A;  2WYQ A;  3A9K A;  4GDL A;  4F7Z A;  2J7Q B;  2K6D B;  5FKA C;  3QIJ A;  1E78 A;  1V1O A;  1CK1 A;  2L76 A;  4EZJ A;  4M0W A;  3IHP C;  4F5T A;  1RWS A;  1F0Z A;  4GB9 A;  3E56 A;  4NAW B;  1M94 A;  4KIK A;  3L10 B;  2KTF A;  2PEA A;  2V3S A;  2KAJ A;  3AU5 A;  3ZDM C;  3WA0 A;  1OTR B;  1E7E A;  2KQS A;  3TIX A;  2IY1 B;  4FXC A;  1EUV B;  3TMP B;  3GZN I;  2JQR B;  1XO3 A;  4ZYS A;  3Q8E A;  1EU3 A;  2R61 A;  3AE6 B;  2CJO A;  3A4R A;  2XVV A;  1SB3 C;  2AL6 A;  2Z8J A;  3T3O A;  4Z69 A;  3AE7 B;  1UGM A;  5HOZ A;  1JML A;  2C7N B;  3P63 A;  3B2G A;  2IYD B;  1STE A;  3LU6 A;  4JGH B;  2KDB A;  1HZ6 A;  1MHH E;  3PRE A;  3AMZ A;  1HK1 A;  2JY6 A;  2KOX A;  1ET6 A;  2GMI C;  2DBU A;  3U2S C;  2BYV E;  3LDZ E;  2EFC A;  1GB1 A;  1SE3 A;  3DVG X;  4JIO U;  3UGB B;  1YQ3 B;  3UIP B;  1HEZ E;  1C1Y B;  2KJR A;  3EEC A;  5H8Y E;  4XZ4 A;  4MSQ B;  4DWF A;  4LCD E;  1OQQ A;  4PT5 A;  4GDX A;  4TKN A;  2CU3 A;  5JHA A;  2XW1 A;  1I4X A;  4K7S A;  1QT9 A;  1WY8 A;  1ISN A;  4M0W B;  4A3P A;  2LVQ A;  3MHZ A;  1TKY A;  2BWF A;  3QQ8 B;  4LLG M;  1SF0 A;  4W9E A;  3P4P B;  2NNW A;  3N32 A;  4RGO S;  1J7A A;  3PZD A;  1KXP D;  2UYZ B;  2G45 B;  1QOG A;  5IJ5 A;  5DBY A;  5BYS A;  3MHH B;  4MGZ E;  1JWS D;  1S3S G;  2N4F A;  1DOY A;  1IBX B;  2N1V A;  4NJC A;  1ET9 A;  2L0T A;  1R4M I;  4HJK A;  2VRR B;  2ZZP B;  3WAP A;  1N60 A;  1K51 A;  1NYR A;  4W9I A;  3Q8C A;  1L0X B;  4YXD B;  1MG8 A;  4LDT D;  4BKS A;  1UOR A;  2KFK B;  4G03 A;  2ZPN A;  5EDS A;  1QLB B;  2H89 B;  3L08 A;  4L9Q A;  3ZJV A;  2OZB B;  2C9W B;  3ZRF A;  2XVU A;  4HKZ E;  1K53 A;  3M99 C;  3L0W B;  1WGH A;  4ZYN A;  4LUF A;  1MI0 A;  1RFA A;  2BS2 B;  4HGK A;  4FIP B;  2Y5P A;  1SE4 A;  2KLC A;  2AEH A;  2MA9 B;  4K7W A;  1EO6 A;  2K6Q A;  1FRD A;  1FO4 A;  4C31 B;  4ANX A;  1WRI A;  3IFW B;  4J6I A;  3MHS D;  4DDI D;  4WWO A;  2MJ3 A;  4JX1 C;  3ZNH B;  3L54 A;  2WXO A;  3TEZ A;  1FFU A;  4MT5 A;  1N5X A;  4WIP A;  1C4A A;  4EOY A;  1KOT A;  2KMA A;  2MP2 B;  3ENE A;  2MH7 A;  3TBL D;  3W9C B;  1LM8 B;  1BM0 A;  3FAH A;  1FNU A;  5DPS A;  3FNM A;  4DHZ B;  2XW0 A;  1V2Y A;  2JZP A;  5L95 C;  3QJZ A;  1L5P A;  4DHZ E;  4W4U B;  1QOB A;  3CX9 A;  2BS3 B;  1D5M C;  2KZR A;  4KGT A;  4TSS A;  5BPK A;  1C77 A;  4P6V F;  2L05 A;  2W55 A;  3DOW A;  4II2 B;  2LRU A;  3MTN B;  4WAF A;  2GBK A;  5MPO A;  4FLH A;  4N58 A;  2UWQ A;  3JSV A;  4DHX B;  3KUD B;  1NVI D;  3RT3 B;  1NEN B;  1TBE A;  1WRD B;  2L83 A;  1E7U A;  3H7P A;  1WGG A;  5AZF A;  2MBO A;  4EEW A;  2DLB A;  3ABV B;  3U7Z A;  1DGJ A;  4F5U A;  2BKF A;  4ZRI A;  2QIL A;  2G1E A;  3NVK A;  1VZS A;  1C3T A;  4B0M A;  4X57 B;  2JRI B;  2AL3 A;  2GB1 A;  2LFI A;  2LVO A;  4WWP A;  1WMH B;  1RAX A;  2EMS A;  2ZVO A;  5CTR C;  2JZZ A;  2Q5W D;  4ZDV A;  2BTE A;  2WDR B;  2AYO B;  4WQO B;  4TUU A;  4YWG G;  3GS2 A;  1FD6 A;  4ICU A;  3DBS A;  2BXK A;  1QOA A;  4OVZ A;  2W3S A;  2V4L A;  4DHJ D;  3PZ8 A;  3V62 A;  2BXL A;  1SIJ A;  2KMC A;  3ZO5 B;  3CWI A;  4FUL A;  1FCC C;  2L0F A;  1XLO A;  3B1L X;  4E74 A;  2JRH A;  3PHX B;  2K8H A;  1ZDX A;  2W54 A;  2WQY B;  3WAM A;  2WS3 B;  4K1R B;  1WX9 A;  1EWY C;  2GBN A;  1I42 A;  2QIE B;  5H92 C;  2OOB B;  1M4V A;  2FCS A;  4IUM B;  2KQ4 X;  2N9L A;  2VUF A;  3ML9 A;  4B0E A;  1VDV A;  3K9O B;  1KTK A;  2EMT A;  3VHT C;  3BVM A;  1P1A A;  3TEY A;  2C7M B;  1VLB A;  3RPF C;  1TS4 A;  2R2Q A;  2DWQ A;  2DAJ A;  4WQM A;  1GC6 A;  3ALB A;  3B08 A;  1FRR A;  3AE4 B;  1E90 A;  1XXG A;  3R8B A;  5JXV A;  4MH0 E;  3V03 A;  3PTF C;  2BBC A;  3A73 A;  5IIH A;  5IAA C;  1L4D B;  1E8X A;  3MP9 A;  1J8C A;  4XX5 A;  3OJ4 B;  4AWJ A;  2BXM A;  3H6N A;  2ICI A;  3SIV B;  4IOI E;  2JXT A;  4A6Q A;  1L6U A;  2BXC A;  2A4Z A;  1UUP A;  3D32 A;  2BWE S;  1YJ1 A;  3WIM A;  4BKE A;  3N9Y C;  1VRA B;  2V0G A;  3TDL A;  1WJU A;  2MJD A;  5IIX A;  2KX3 A;  2WU2 B;  1I4G A;  3APF A;  1PUT A;  1E7C A;  2KBZ A;  2LJ5 A;  2REX A;  2M8S A;  3H3A A;  2ROH A;  3VUW A;  2C5L C;  1C76 A;  1HQR D;  3KH0 A;  3EFU A;  4NPN A;  2ZCC A;  3WAO A;  1HK5 A;  4ZHO A;  4GGQ A;  2LAS A;  3X23 A;  3FIL A;  3WHQ A;  1C78 A;  1SBB B;  3PV1 A;  3W1S C;  2AQ2 B;  2KAC A;  1TY2 A;  5AZG A;  4YL8 A;  3IG3 A;  1WX8 A;  2ZW0 A;  2J53 A;  5GMV A;  3OLM D;  1H4R A;  3WCQ A;  4OW0 A;  5G55 A;  4FK5 B;  3NHE B;  3NVY A;  2BXA A;  2PPH A;  3FWB C;  1GC7 A;  1K8R B;  1YD8 U;  2M17 A;  2XEW A;  3R2T A;  1NDD A;  1YX5 B;  4HK2 A;  3SIU B;  1AN8 A;  4KKI A;  4TQ0 A;  1XCT L;  2NCN A;  4GU2 A;  3APD A;  3OWE B;  4OT2 A;  4BBN F;  2JUO A;  1AW7 A;  1GG3 A;  3O65 B;  2H88 B;  4RFB A;  4ITK A;  1I7H A;  2JSV X;  4N0U D;  3PRP B;  2OED A;  1PFD A;  3S2A A;  1HK3 A;  2LJI A;  3AI5 A;  1WGR A;  1RFK A;  3SFD B;  2IPK D;  2KWD A;  4F1S A;  4YSX B;  4BKG A;  2EFH A;  1SSN A;  1Q10 A;  2NPT A;  4JWU C;  4ZBR A;  4AUQ C;  2RSU A;  1E10 A;  2NBU A;  1QIL A;  1YX6 B;  4RMA A;  1FXI A;  2WXG A;  2NS5 A;  5BMH A;  1FOU A;  1UH6 A;  2BXE A;  4ZRK A;  2DYO A;  4EE2 A;  4IC7 B;  2RD0 A;  4FAD A;  3T9L A;  3SFE B;  2WXI A;  1KFY B;  3R7R A;  2Z8I A;  2NTT A;  3DWM A;  1SXT A;  4NAW A;  4US8 A;  2PVG C;  1NEK B;  1EM7 A;  1UD7 A;  1PGA A;  2WWZ A;  3BVZ A;  2J0M A;  2MBE A;  3AE9 B;  4HKQ A;  4KV2 A;  3AUL A;  3VVW B;  1WM2 A;  1IGC A;  4ZHP A;  1NBF C;  4OVV A;  2JWU A;  3PLV A;  4II3 B;  2IO1 B;  4RM8 A;  4ANV A;  2K5P A;  5CHV C;  2Z0D B;  4CQN A;  3R7Q A;  2V36 A;  4MEM A;  4DQO C;  4MH8 A;  2O6V B;  2FNJ B;  3AH7 A;  1UGJ A;  2B76 B;  4GDK B;  4L23 A;  2DEN B;  2VDB A;  3NOB A;  5ID7 A;  1P9D U;  4WJP A;  2L52 A;  4JQW C;  1ACC A;  4OZA A;  2BS4 B;  3QA8 A;  3IXS A;  5HG2 A;  4KDL B;  2VZK D;  2IJ0 A;  1D3Z A;  2FID A;  2N1W A;  1EWC A;  4USA A;  3DQV A;  1GNU A;  4WJO A;  4BKS D;  2KC1 A;  1CZP A;  3NY5 A;  4ARC A;  4LB9 A;  2HE7 A;  4PYZ A;  2XN9 C;  2V3N A;  3PHW B;  1BT0 A;  3AE8 B;  4MDK E;  5G5H A;  4K2C A;  4WWM A;  3BWU D;  1E7P B;  3BII D;  1JRP A;  2K1F A;  2J0K A;  1H9Z A;  1MVK A;  1BKE A;  1N5U A;  1WXS A;  3V08 A;  2K3U A;  2GOW A;  3CMM B;  1YN4 A;  3T3N A;  2K8B A;  4MEL A;  1G6J A;  4HRS A;  1IBX A;  2MW5 A;  1WSP A;  4ZRJ A;  2K22 A;  2I2Y A;  4ZOH C;  3HK0 A;  3C8Y A;  5E6P A;  4PO0 A;  3OJ3 A;  3W2D A;  4RGT A;  1ROE A;  2KFK A;  3A75 A;  2QMT A;  1D5X C;  1VZ6 A;  3N30 A;  4CYE A;  2YEP B;  2JUH A;  3W5U B;  2Y5C A;  1BXT A;  1WX7 A;  2BX8 A;  2YLM A;  1LOT A;  3WAN A;  2D07 B;  2XVQ A;  3Q69 A;  5EE1 A;  2K0P A;  3VH4 B;  3T8M A;  3ZNI D;  3U4E G;  2EFE A;  1V5O A;  4BY9 C;  2KWU B;  2M1M A;  4MSM B;  1TZO A;  1QQR A;  2BB5 A;  1X1M A;  2DYM A;  2SEB D;  2JU6 X;  3VQI A;  3AE3 B;  2WXL A;  1N5W A;  3ZTC A;  2IGH A;  1S1Q B;  4TMA B;  2GRI A;  2E3T A;  5GIN A;  3NZ3 A;  1EF1 A;  5JZE B;  4YSZ B;  4LTU A;  2MP2 A;  2KTR B;  1KRH A;  2MCN B;  4IWQ A;  3QX1 A;  3TJP A;  3ZJU A;  4FBJ B;  4NNJ B;  1HK4 A;  3KVF B;  2LI5 A;  2DBY A;  3PSE B;  4MGK E;  1PGB A;  2XK5 B;  1HA2 A;  1C4P A;  2KNB A;  4EZL A;  1FXT B;  3GQX A;  3O13 A;  3ZYY X;  3RUL A;  3DBL I;  2BXD A;  3P4S B;  5FK9 C;  3R3M A;  1T6B X;  3GQU A;  4M8N A;  3ZQ4 A;  4D2K A;  2BKR B;  4KKJ A;  2Z59 B;  2WXP A;  5HKH A;  5DPW A;  4HXD A;  3ETR A;  3RFZ B;  2G4S A;  2DG5 A;  4G0N B;  4IKG A;  3ML8 A;  5D3D A;  5BYR A;  3UIV A;  2C7H A;  1YIW A;  4FJC B;  3BY4 B;  5BMG A;  3A1Q B;  5CHF A;  1IYF A;  1DYQ A;  4KSK C;  1RYJ A;  2KDI A;  1E8W A;  1HK2 A;  2ONQ A;  2JZ3 B;  3GA9 L;  2FUG 1;  3J9C A;  2CU1 A;  2PE9 A;  3L13 A;  2K25 A;  4N6E B;  2BF8 B;  5E6J A;  5EE0 A;  1XD3 B;  2KWV B;  1WXQ A;  2GBR A;  2WXM A;  3B9L A;  1WH3 A;  1BJ5 A;  1I4Q A;  4G01 A;  2EKE C;  1WMH A;  3H9D A;  1V1P B;  3KW5 B;  2WU5 B;  2W82 A;  2CHX A;  3GOE A;  3SEB A;  1Q1O A;  3Q3J A;  4ZRQ A;  4J3O D;  1WIA A;  2ACZ B;  1AWD A;  4RF0 A;  2PJH A;  1TS3 A;  4L1B A;  1XQQ A;  2GBM A;  2JX5 A;  1E7B A;  3V61 A;  3V05 A;  1WM3 A;  4HPM B;  2RR9 A;  4BFR A;  2GBJ A;  3ZRC A;  3ZUN A;  2DHZ A;  2WDQ B;  4EMX A;  1MHX A;  1FIQ A;  1JW9 D;  5BYQ A;  3V60 A;  4AQ7 A;  5I4D A;  4A3O A;  3AV8 A;  2J42 A;  4BOS C;  3PRM B;  1JQ4 A;  3H37 A;  2WX0 A;  4KVG B;  4ICV A;  4HDQ A;  2VUE A;  3M95 A;  3DVG Y;  2JYT A;  1BUI C;  2N9E B;  2JVC A;  2K39 A;  2WDT B;  1WFY A;  3HM3 A;  1L7Y A;  1C4C A;  1ZDV A;  2KMM A;  2WDV B;  2LD9 A;  2KLG A;  4DK5 A;  1A5R A;  3PLU A;  1E7G A;  4IWO A;  2M56 B;  3PRZ A;  2BGF A;  4NJ7 A;  4ZUX V;  4HWI B;  4RM9 A;  4G11 A;  1IUE A;  1DOI A;  3IT6 B;  2QHO A;  2L32 A;  2BYF A;  2MWS B;  1JWU D;  5J2R A;  2PMV A;  4KZ0 A;  1JWA D;  2LOQ A;  3HIZ A;  3SR6 A;  2FBW B;  3VUX A;  1F77 A;  1V86 A;  1TKG A;  1V5T A;  2I1K A;  3Q8F A;  1MIY A;  3RYT A;  3L17 A;  3P1M A;  3U30 A;  1J7B A;  3FC4 A;  4GLS C;  3A9J B;  1V97 A;  3G9K D;  1V9J A;  4G50 A;  4I6P A;  3ZIM A;  5AUI A;  1YN5 A;  5L83 A;  1L2N A;  3VTW A;  2RMM A;  1V49 A;  2KC2 A;  5E6N A;  1VZ8 A;  2BPS A;  1GUA B;  4HCN B;  4NAM A;  3VAW A;  1PQS A;  4W9L A;  3LB8 C;  3AU4 A;  3ECI A;  1VR9 A;  5D94 A;  3VH3 B;  5HI1 A;  1GJZ A;  2BW2 A;  1LQB A;  2YVC A;  3ZJT A;  2BXB A;  3TUO A;  4GXB A;  4KDI C;  4IM2 A;  4C7Z A;  2MSE D;  5DQF A;  3DVN V;  3QAQ A;  2OHF A;  2CS4 A;  3RCZ A;  2NBV B;  3KIK A;  1E7F A;  2QEJ C;  3DVN U;  5TR5 A;  1GAQ B;  1A70 A;  4KSL C;  4YSY B;  2KQ7 A;  2KHW B;  3V09 A;  2A5U A;  1HA5 A;  3AN1 A;  1WF9 A;  5DPT A;  1F9J A;  4LUH A;  3IVF A;  5D7G A;  1TF0 A;  1T3Q A;  2V3P A;  5C2T B;  2JYE A;  1WR1 A;  3QAR A;  2SAK A;  3CIR B;  3H8H A;  2KX0 A;  4LDT B;  1J19 A;  2DBX A;  3ZNZ B;  3NVV A;  3ICX A;  1TY0 A;  1CQV A;  1OQY A;  2LZ6 A;  4OVU A;  3KYD D;  3QCA A;  2LHE A;  3SU8 X;  1SJE D;  3B2F A;  4PYU A;  3PLA A;  4MAC A;  2X38 A;  3DCG A;  2INN E;  1Q0W B;  5IA7 A;  3LU8 A;  1QF6 A;  3ONS A;  3LU7 A;  1JRU A;  1GNJ A;  1JAL A;  3AED B;  3Q3F A;  3MHS B;  2IGG A;  2BB6 A;  3DPD A;  3ZDT A;  2ZNV C;  2FIF A;  1TGZ B;  4WUR A;  3LXF A;  1E7H A;  1ZE3 D;  4FJV B;  2LMC A;  1YMH E;  2ASQ A;  5LLI A;  4HGM B;  3V6C B;  2IO3 B;  3MJW A;  5IFO A;  2NR2 A;  2ZJD A;  5IJE A;  3PS6 A;  1ZXI A;  2PKO A;  2D10 A;  3SQJ A;  2LGI A;  1WI0 A;  1TZ1 A;  2HTM E;  4RCO A;  4BVU C;  3KJL A;  3U8Z A;  1Y56 A;  2WP9 B;  4CHK A;  4MJS B;  2LUE A;  2YEP F;  5TSS A;  2MBB B;  1MPE A;  4TQ1 A;  4S1Y A;  3QC8 B;  1MA9 A;  2FCN A;  3TSS A;  2EFD A;  2OT3 A;  3ZW3 A;  1QOF A;  2KFJ A;  2PW9 A;  2IY0 B;  1V80 A;  4W9G A;  2KK8 A;  2R2O A;  2DAF A;  4HDO A;  2NMQ A;  2IZV B;  4PS8 A;  3CST A;  4BOZ B;  4MM3 B;  4JL9 A;  4OTU A;  4HJG E;  1LFD A;  3N3K B;  1AYF A;  1JCK B;  3NVI A;  4W9K A;  1P3Q U;  2K9X A;  1SE2 A;  2O6V A;  4ZC6 A;  1XT9 B;  3AEB B;  1ZW7 A;  5JH5 C;  1KLV A;  3PO0 A;  3MJ5 A;  4G04 A;  4KGR A;  3MC0 B;  1QKZ A;  2HD5 B;  4GDK A;  1D4B A;  2KN5 A;  2RDH A;  2Z0E B;  3KQ4 A;  3VFK A;  2KN4 A;  1QZE A;  1SGH A;  4M8M A;  4ARI A;  2MEK A;  3PPA A;  2B3A A;  1KF6 B;  3KUZ A;  4MGY E;  3ZVV A;  3VXW A;  4IW2 A;  1TS2 A;  3NRZ A;  1D5Z C;  2WXH A;  2IBI B;  2QHB A;  4WJQ A;  2KDF B;  3UF8 A;  2PE6 B;  3HUI A;  4JE3 B;  1WXM A;  4M70 B;  3QHT A;  4W9H A;  5LNK 1;  3PT2 B;  4DHJ B;  2BXG A;  4HCP B;  4BBN C;  1WZ0 A;  4HPL B;  3V6E B;  5IJF A;  3BZD B;  4Q2J A;  1HE8 A;  4K7U A;  4HLE A;  2TSS A;  2BYE A;  4GG2 A;  4N3Z A;  2RPV A;  4A90 A;  1E7A A;  2LVP A;  5AZH A;  4PS7 A;  1Y8R C;  1L6V A;  2BXH A;  3MFG A;  1BML C;  1UWM A;  1XEE A;  4EFO A;  4C56 C;  1OGW A;  2CKH B;  4H2A A;  2DZM A;  1SE9 A;  2O2V B;  3AE2 B;  2AX5 A;  1AAR A;  2I1J A;  1OFF A;  1JWB D;  4XE0 A;  1JNB A;  2QSD A;  1WGD A;  2QMC A;  1OQR A;  3JYU A;  1N61 A;  2FUH B;  2L3Z A;  1T0Y A;  4K81 A;  5DPR A;  2LGX A;  4XWW A;  3EA6 A;  2KJH B;  2DZK A;  3I9V 1;  2ZNV B;  4L8U A;  2MBQ A;  4AS1 A;  1TXU A;  4GOC A;  1ZUD 2;  4P16 A;  1Q5W B;  1P7E A;  3A33 B;  4OZB A;  1LNS A;  3EUB 2;  3L16 A;  3SDL C;  2W3R A;  2N0S B;  1ZKH A;  3KWL A;  3B0A A;  3ZKJ C;  2FE8 A;  1E5W A;  2I30 A;  1F2R C;  3JW0 X;  2XBB C;  1WXV A;  4I6N B;  4WJN A;  3NMU A;  4YT0 B;  2W9N A;  1ZGU B;  1WYW B;  3AEG B;  3NVW A;  2KTR A;  1GNI A;  1VFI A;  3TEX A;  5CX3 A;  2IDY A;  1WE6 A;  1O9X A;  2XK5 A;  4BKT A;  4ZRP A;  4FJY A;  3R2I A;  4FA6 A;  1E0Z A;  1J7E A;  1AO6 A;  2HJ8 A;  3NVM A;  2BXI A;  1CMX B;  1KH0 A;  4ZBQ A;  3BIN A;  4OR0 A;  3VTU A;  4GN1 A;  3UI3 A;  3DBR I;  2BYT A;  2Z8K A;  4JLC A;  3M63 B;  1TYG B;  1KM7 A;  1RLF A;  1UBQ A;  1WJN A;  1P98 A;  2IO2 B;  2BT6 A;  3TCA A;  2L7R A;  3A1Q A;  4OZC A;  2KJ6 A;  3AXC A;  3DBH I;  3HHM A;  2E6X A;  3C0R B;  1V8C A;  5B5T A;  2MBH A;  2LGY A;  4HEA 1;  2N9P C;  5EE9 A;  1RRB A;  1V1P A;  3A9K B;  4GDL B;  3RZW C;  4AJW A;  4O1N A;  3UQA A;  1IJG A;  1D6E C;  3EC8 A;  4IWP A;  2IO0 B;  1E6E B;  2BXO A;  3L4P A;  1GPX A;  1TJE A;  3FWC C;  2Z8L A;  5FR6 A;  1YNT E;  3VRB B;  4KIK B;  2OJR A;  4EZK A;  4PS3 A;  2WX1 A;  2ZW1 A;  3ZGZ A;  1E7I A;  4I6L B;  5CHW A;  1N63 A;  3NS8 A;  2IGD A;  5IIU A;  3OAW A;  2JWZ A;  2DZJ A;  4WWN A;  4XWT A;  3B9M A;  1P0R A;  2RDG A;  2V1Y A;  2G9H D;  3AE5 B;  3SHQ A;  2ZVN A;  3A4S C;  3ZNG C;  3WHR A;  3HVZ A;  2YDF A;  4IG7 B;  4XDD A;  4URK A;  3PGE A;  1PGX A;  2Y5B B;  3I3T B;  1C9F A;  1JRO A;  2D5G A;  2AWT A;  1LXD A;  1SIF A;  2XMO A;  1WJ6 A;  5D3I B;  1OEY J;  3NVZ A;  2ZPY A;  4KZC A;  1E8Y A;  4W9J A;  4CO7 A;  1XLP A;  2LRW A;  5T8I A;  3M62 B;  1PYW D;  4DDG D;  1J7C A;  3NZU A;  1TKE A;  3IBE A;  4Z9O A;  4DXG A;  2FCQ A;  3NZS A;  2WXK A;  2N7D A;  3BVG A;  2LXC A;  2MLB A;  2I2Z A;  3U52 E;  2MQJ A;  1P7F A;  3PVL A;  5GIO A;  4ZCG A;  5E6O A;  4ANU A;  1K52 A;  2WXN A;  2NVU I;  4F5S A;  3UIN B;  4N0F D;  5KHO A;  2M0A A;  1B9R A;  2LGD A;  2D11 A;  1R4N I;  4HRO A;  3JRY A;  1L0V B;  4AOF A;  1WXA A;  2L00 B;  3A9J A;  2VZK B;  5AUK A;  4AJY B;  1VZ7 A;  1WE7 A;  4NY0 A;  4W9C A;  3H7S A;  4NQK E;  4E99 A;  4JPS A;  4IM0 A;  1J78 A;  1L4Z B;  3DWG C;  1NI2 A;  1V6E A;  2LEK A;  1B1Z A;  4LA0 A;  4G3X B;  4KGS A;  1WGY A;  3NUH B;  3APC A;  1PDX A;  2ON8 A;  3KWV A;  4LJO B;  1VJK A;  3QK0 A;  3KYC D;  4UDU C;  1NYQ A;  3PZ7 A;  2XNA C;  4RGM A;  1LO5 D;  5ID9 A;  4FN2 A;  2KDE B;  3RUI B;  3U7D A;  1ENF A;  3K9P B;  2NQO A;  4AP4 C;  2PVO D;  1WJ4 A;  4NQL B;  3HVD A;  5D2M B;  3NS1 A;  5KHQ A;  1KLG D;  2AJE A;  2PLP A;  3WAL A;  3CF6 E;  2GI9 A;  2CJN A;  3AEA B;  1F2R I;  2JPH A;  1HZ5 A;  4YTN B;  2CHW A;  2M19 A;  5FUO A;  4JK4 A;  1I4H A;  1GB4 A;  4REZ A;  1I4P A;  3VRA B;  1K50 A;  5D6J B;  2JF5 A;  3UIO B;  3TL5 A;  1I4R A;  1OEY A;  2CR5 A;  2L8J A;  4LJP B;  3VR8 B;  5HFY A;  3IAS 1;  5BMI A;  1IGD A;  2N9K A;  3LYY A;  3BK2 A;  1FCL A;  2QJL A;  2QM6 A;  4YTM B;  3AEC B;  4IW0 A;  1YQB A;  2KO3 A;  5LXI B;  2MJE A;  3Q8A A;  4MGI E;  1R7S A;  4IM3 A;  2M4N A;  2BXP A;  2ZEQ A;  1Z2M A;  4B9K A;  5C3J B;  3V3X A;  3JSV B;  1T5X D;  4K71 A;  5G5G A;  4LK0 M;  2LHD A;  1ZXH A;  4C80 A;  3H7P B;  1J0G A;  3TEW A;  4R3D A;  2O6V D;  2FAZ A;  5DCN A;  2WXJ A;  2KXJ A;  5JHB A;  4MJS A;  4A8X C;  5GIP A;  2KD0 A;  1YN3 A;  1WWT A;  4RGN A;  1E9M A;  5GXG B;  2KDM A;  1MIW A;  3UQB A;  1UBI A;  1WGK A;  2WNM A;  4XDC A;  2C60 A;  2M0X A;  1ZP0 B;  3ZTD A;  4C7Y A;  1FNV A;  2FCM A;  4ANW A;  4IDI A;  1UNS A;  2LWP A;  2NBW B;  4GIV A;  1UWX A;  3SD5 A;  1SEB D;  4MM3 A;  1WZ3 A;  3URY A;  3P42 A;  3KLS X;  1XCQ L;  2HDE A;  5FR3 A;  4TV3 A;  2N9X A;  3VDZ A;  4IW1 A;  4MBE C;  4RF1 A;  5C1Z A;  2WXR A;  2N7E A;  2HTH A;  1EF5 A;  1XF5 L;  2Y3A A;  2DX5 B;  4EKU A;  3E9S A;  3X0W A;  2BXF A;  4A55 A;  4ASW C;  3P4R B;  3BYT B;  1IPG A;  4E71 A;  1JWM D;  2KVR A;  1E7V A;  1TTN A;  1KLU D;  4DXA B;  1FM0 D;  5GHK A;  4FHJ A;  4RNA A;  1WR6 E;  1ZPS A;  4A20 A;  2WXF A;  4F8C B;  2J52 A;  4N9F 4;  1KW2 A;  1UEL A;  4EUT A;  1SJH D;  4DBG A;  2KWC A;  4FJZ A;  1XLN A;  2XVW A;  3Q8B A;  3HM6 X;  2KKC A;  2N7J A;  3VUY A;  4DXF A;  3IT4 B;  1YJI A;  2JT4 B;  2I38 A;  5C23 A;  1TS5 A;  1NT2 B;  5G2N A;  4ZBK A;  3BYY B;  1DOX A;  1CJE A;  4GMV A;  1U4A A;  3KUC B;  1FXA A;  2LXA A;  4WH4 A;  2E0X A;  4XC2 A;  4WAA A;  2PIA A;  3VTV A;  2AQ3 B;  1KJT A;  1NI3 A;  2AQ1 B;  2O2V A;  2D2Q A;  2WLB A;  3AM9 A;  1XLQ A;  1L0Y B;  1V81 A;  5LXH A;  2JXX A;  3LJ3 A;  2L1A A;  4FHK A;  2NTS A;  2G4D B;  3VR9 B;  2D3G A;  1H5W A;  4NJ6 A;  2LUM A;  3WHS A;  3I57 A;  1FNW A;  1GOZ A;  3IAM 1;  1H8C A;  3W1S A;  4L2Y A;  2E0Y A;  3DDC B;  1HXY D;  3FIL B;  3W5V B;  3P4Q B;  2CHZ A;  1RM6 C;  2MRP A;  1E8Z A;  1YJJ A;  1FEH A;  2CKX A;  2BXQ A;  3M3J A;  2RGF A;  3AEE B;  2XSI A;  4L9K A;  4N59 A;  2DZI A;  2MX2 A;  4OTT A;  1FMA D;  4P7I A;  2EKI A;  5BO4 B;  2G3Q B;  4F5V A;  3BK1 A;  1EU4 A;  3AB5 A;  5J18 A;  2DBW A;  2WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...