3W1SA

Crystal structure of saccharomyces cerevisiae atg12-atg5 conjugate bound to the n-terminal domain of atg16
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
283
structure length
261
Chain Sequence
NDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFLSFDPLTDSEKYFWFEHNKTPIPWNYPVGVLFDCLADVLTFLRIHLVMGDSLPPTIIPIAKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKEDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Autophagy protein 5
publication title Structure of the Atg12-Atg5 conjugate reveals a platform for stimulating Atg8-PE conjugation
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 71
structure length 261
sequence length 283
ec nomenclature
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04106 APG5 Autophagy protein Apg5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.190 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3w1sA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1sA03
3.10.20.620 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w1sA01
4IM2A 4HPMB 2VRRB 3APDA 2M0XA 4NJ6A 4AWJA 4ICUA 2HE7A 4MGYE 2LI5A 1WX9A 5IA7A 4FJZA 1XQQA 2AL3A 4JGHB 4FBJB 1LXDA 3MTNB 4KZ0A 3TJPA 3ZNGC 2UWQA 4TKNA 1R4NI 4RM9A 4K7UA 3M95A 2A4ZA 2ZVOA 3V60A 2WWZA 3QAQA 4WJOA 3JSVB 3QA8A 2LRUA 3QX1A 3NOBA 2N9EB 4PYZA 4MEMA 1S3SG 3JVZX 3A33B 3TCAA 1ZKHA 3H1UA 4KSLC 2DYBA 3BY4B 2ZVNA 2BKFA 4CYEA 3KW5B 3OLMD 4MJSA 4A20A 2KX0A 1WY8A 3CSTA 3ZLZA 1WI0A 2IYDB 3DVNV 4M0WB 2KJHB 1VD2A 2N9XA 1J0GA 2LUEA 1UH6A 3S2AA 3W1YA 1KLVA 5DPTA 4HCPB 4W9GA 2O2VA 5G2NA 1E7VA 2G4DB 5EDSA 1WGGA 1YIWA 4JQWC 2LGDA 1V9JA 5L95C 1V86A 2ZPNA 3H7PA 5C23A 1VCBA 3DPDA 3UINB 4B9KA 3UQAA 1RLFA 3TBLD 2GBRA 3U30A 3VH3B 1V5OA 1WJ4A 2JRHA 3APFA 3IFWB 2C7MB 2W9NA 4GSWA 2IO0B 5DPRA 4B6WA 4DK5A 4ZRIA 4KSKC 3TIXA 1Q1OA 1WMHB 3P2BA 4XX5A 4URKA 3CSFA 5FR6A 4MSQB 4HCNB 2MBEA 3DBRI 2KFKA 3SD5A 3ZW3A 2NPTA 2MCNB 1WJNA 4TQ0A 1I42A 1WIAA 4E3CA 2KWVB 3V6EB 2IBIB 2KMAA 2K6DB 2KANA 3DVGY 2JZ3B 2WYQA 3A9KA 3M3JA 4W9FA 3ECIA 5CHVC 4HDOA 4BKSA 2L7RA 1NI2A 2OOBB 3WALA 3VXWA 4M8MA 4G3XB 1RRBA 1WGHA 2MW5A 1XT9B 1TBEA 1UELA 4GN1A 5BO4B 3UF8A 3WIMA 3ZO5B 3EC8A 2DAFA 5C1ZA 2K8BA 3NZUA 3B0AA 2KWCA 2MP2A 5DPWA 2KMCA 3AXCA 3L10B 1P1AA 3PRPB 2GBMA 4AJWA 2NR2A 4IM0A 2QHOA 4NJ7A 3JSVA 3ENEA 1C1YB 3H7SA 3N30A 2CS4A 3RZFA 4YL8A 2O6VB 4LDTD 4EZLA 1WGDA 3NHEB 4HLEA 2DAJA 2IO3B 4MH0E 4II2B 1GC7A 4HJKA 3MHSD 2N7EA 3M62B 1J8CA 1EF1A 1V6EA 1WE6A 2DZJA 1YD8U 3OAWA 2JXXA 2LRWA 4PS7A 2HTHA 2KNBA 3BINA 1SIFA 4AJYB 4EKUA 3ALBA 4BVUC 2LXCA 2D2QA 3VFKA 4ZRJA 1WZ3A 4FA6A 2KKCA 3PT2B 4MGIE 3TMPB 1V81A 3VDZA 2PEAA 5TR5A 4LJOB 1P9DU 4F1SA 2KK8A 2CHWA 1NBFC 3ZIMA 1EF5A 4IWPA 2CHZA 4HK2A 5DPSA 3RT3B 3VVWB 1GG3A 5D94A 3DVNU 4FLHA 3A4SC 3V6CB 4IG7B 1OTRB 2KFJA 2L8JA 3PGEA 2DYMA 2ZCBA 2FUHB 5J17A 3O65B 2JPHA 2M17A 3PHXB 3N32A 5JZEB 2FIDA 2KDIA 1V5TA 2M8SA 2CU1A 3DOWA 1XD3B 4ANXA 4IC7B 4PYUA 1OEYJ 1BT0A 2KLGA 4G50A 2K8HA 4MGZE 2MBHA 2IY0B 2KTRB 3U7DA 3NY5A 4G0NB 2N9PC 2DX5B 2AYOB 4HXDA 2A5UA 4AP4C 4N9F4 4BOZB 4GXBA 4BKSD 3EHVA 3H6NA 2B3AA 4DBGA 1AARA 1UZXB 2Z59B 4ASWC 3EECA 2GBJA 2YLMA 4B95A 5E6NA 3JW0X 2CKHB 2JRIB 4FN2A 1GNUA 3UGBB 2N4FA 1FXTB 4HVBA 2MQJA 2FNJB 3PREA 4WWOA 2KC1A 2BYVE 3QWZB 4GDKB 4KDIC 4WJPA 4GGQA 4A3PA 2KZRA 1K8RB 3DBHI 1OQYA 2K39A 4WWPA 2NVUI 1MG8A 2RPQA 3A9JB 3ZTCA 2MLBA 2EMTA 2AL6A 3VUWA 1IPGA 1E8WA 5AZFA 3QIJA 3MJWA 3ONSA 5CHFA 1RFAA 4GB9A 2KXJA 1RAXA 2I1KA 5AEKB 5L83A 2JZZA 3PSEB 1KM7A 2N1WA 4ZRKA 4DDID 2LASA 1Z2MA 3X23A 1IP9A 4HDQA 5E6PA 1D3ZA 2WDTB 1WXSA 2C5LC 2KQSA 4RM8A 3QARA 2BWES 2JUOA 4OVUA 1SE9A 3ZNHB 4K7WA 4AOFA 1E7UA 4I6PA 3V62A 4MGKE 1E8YA 1P3QU 3GOEA 4G11A 3VUYA 2LVQA 3L13A 1WM3A 4TUUA 5D2MB 2KDFB 2MSED 2RGFA 1WXMA 1GJZA 2ZEQA 3PS6A 2C9WB 2NBUA 3R7RA 5CX3A 4NAWA 2DHZA 3LDZE 4KZCA 4FJVB 2KX3A 4RMAA 1WF9A 4I6LB 3A1QB 5GMVA 1UGMA 2PJHA 2LWPA 3WAPA 4DHJB 1WFYA 2BGFA 4NPNA 2LVOA 1WM2A 3L54A 3RZWC 3RD2A 2L3ZA 1ZGUB 3ZVVA 1KJTA 3L08A 1V80A 1UD7A 2YVCA 5D6JB 1E8ZA 2EKEC 3QC8B 1E90A 4K1RB 2DYOA 2R2QA 3Q3JA 4NY0A 2FIFA 4ICVA 3LJ3A 4LCDE 2L00B 1H4RA 5CHWA 4GDKA 2NCNA 4XC2A 2REXA 2K25A 2J7QB 2ZNVB 2RD0A 2LD9A 2PPHA 1Y8RC 3C0RB 2DZIA 3HK0A 2G3QB 2KVRA 3HIZA 2KTFA 2O6VD 1Z5SB 4GIVA 3A9JA 4CHKA 2FCSA 4BBNF 3NZSA 4PS8A 4EZKA 2KC2A 2BF8B 3VTUA 3HHMA 3SHQA 3AI5A 4BKGA 4MM3A 2MBQA 1P98A 4M8NA 4WQOB 2LXAA 4JIOU 2FCMA 4KVGB 4W9CA 1L2NA 1WR6E 2K1FA 2ZZPB 1WYWB 3R66C 3T8MA 4HWIB 3AULA 3QK0A 1ZW7A 2L05A 2HD5B 4ANUA 2OJRA 4DDGD 1C3TA 3HM6X 5DCNA 3H7PB 2M1MA 3IHPC 2N7DA 3ML9A 4FHKA 1V2YA 2D11A 4K7SA 4KIKB 2I1JA 1Q5WB 4BOSC 2XEWA 1WMHA 1WGRA 3UIOB 3WANA 3PZDA 1OEYA 1J19A 1EO6A 3VAWA 2JWZA 2C60A 3VQIA 4EOYA 3KYDD 1S1QB 2MBBB 2JVCA 5KHQA 4CO7A 3QHTA 5KHOA 2XBBC 1GUAB 4JL9A 2LGYA 4IWQA 3WA0A 3ZTDA 3ZDTA 3ZRFA 2J0KA 2GMIC 1WX8A 3AU4A 3GZNI 4BFRA 4A3OA 1LQBA 1TZ1A 2NS5A 3AU5A 4GU2A 2C7NB 3JYUA 4IM3A 3A9KB 4EFOA 1WXAA 3DBLI 2G45B 4W9LA 3ZNZB 2EMSA 3IVFA 3K9OB 3K9PB 3VHTC 3L16A 2DENB 2JF5A 3RYTA 4E71A 1WR1A 2KD0A 3VTWA 4DHZB 2L76A 4ZDVA 2RSUA 1WRDB 2KDEB 2XK5B 1PQSA 5E6OA 2O6VA 1LM8B 2MP2B 4W9DA 5JH5C 1A5RA 5LXHA 2MWSB 2KLCA 1X1MA 4XZ4A 2L0FA 2Z0DB 2AEHA 1WX7A 1T0YA 3WAOA 2KHWB 4W9EA 1YJ1A 4MELA 5LXIB 4FHJA 3NS8A 4AUQC 4IUMB 3CF6E 2L0TA 2GBKA 1WXVA 2CHXA 3OJ3A 3UIPB 2Y5BB 2M4NA 4II3B 1LFDA 3X0WA 2ZCCA 4X57B 2ZJDA 2ASQA 2D07B 3DDCB 4W9KA 3PLVA 2D10A 1TTNA 1G6JA 2MRPA 3T9LA 2RR9A 1F9JA 3U8ZA 4IWOA 3W1SA 2KJ6A 3ZNID 3QQ8B 4NNJB 4I6NB 2WX1A 4IW0A 2LJ5A 4W9IA 4KIKA 2K8CA 1KOTA 1H8CA 2MA9B 4GDLB 3D32A 4WJQA 3N3KB 3KUCB 1E5WA 3A4RA 3VH4B 3VTVA 3B1LX 1WJ6A 4P7IA 4W9HA 1V49A 2KTRA 4F8CB 2JY6A 3HM3A 3RUIB 1UBIA 1UBQA 2BYEA 2AWTA 3KYCD 1EUVB 3DBSA 4BKTA 5J2RA 3I3TB 4F7ZA 1YX6B 2N1VA 2PE9A 4DHJD 4NQKE 5LLIA 3KUZA 3PVLA 5AZHA 2CR5A 3PHWB 3PV1A 3ZDMC 1U4AA 1WZ0A 2HJ8A 1E8XA 2IY1B 3TL5A 3M63B 2IZVB 4NQLB 4W9JA 1GC6A 2V3SA 3KVFB 3PRMB 3R7QA 3V61A 3ML8A 1L7YA 4FADA 3UQBA 4OVVA 2DZKA 1NDDA 5JHAA 4DHZE 2V4LA 4KDLB 2XK5A 5G55A 4DWFA 3WAMA 2C7HA 4FULA 1QZEA 4LDTB 1ISNA 3EFUA 2KQ7A 3APCA 4KV2A 5D7GA 2BKRB 2IO1B 1WH3A 1WGYA 2LGXA 4LJPB 2ZNVC 2BPSA 3H9DA 1CMXB 4FJYA 2MBOA 4MJSB 4PS3A 2K6QA 3PLUA 3QCAA 1R4MI 2WX0A 2GBNA 3KUDB 3Q3FA 4K81A 3SDLC 1YX5B 2IO2B 2O2VB 4HPLB 3IBEA 2FCQA 5AZGA 4ANVA 3RULA 1TGZB 2NBWB 1P0RA 2R2OA 1HE8A 1JRUA 2DZMA 2FAZA 1OGWA 2GOWA 2J0JA 3CMMB 2ZPYA 3QJZA 4EZJA 1YQBA 3DCGA 3DQVA 4GOCA 3ZKJC 3PPAA 3PRZA 2BWFA 2J0MA 3R3MA 2KN5A 4JLCA 5J18A 4MDKE 1WE7A 4TQ1A 2MX2A 3SU8X 2KJRA 4MSMB 1IYFA 3PTFC 2KO3A 1SGHA 3W1SC 4EEWA 2V1YA 3L17A 2JT4B 3IG3A 3KH0A 2D3GA 1M94A 4EUTA 3DVGX 3A1QA 4GDLA 4ZYNA 3ZUNA 5HKHA 5CTRC 3VUXA 2KDBA 2G4SA 2LZ6A 4E74A 4WAAA 4BBNC 2Z0EB 2FCNA 2KFKB 4ANWA 4WJNA 2NPTB 1I35A 3L0WB 2KWUB 2UYZB 3OJ4B 2NBVB 4GMVA 4NAWB 4DXAB 5JHBA 2LVPA 4J6IA 1WJUA 4TV3A 3RCZA 3ZRCA 1Q0WB 2BYFA 2PE6B 2KOXA 5IAAC 3B08A 4WWNA
chains in the Genus database with same CATH superfamily
4AWJA 4ICUA 4MGYE 3U4EG 1I4GA 3MTNB 3N1ZC 3ZNGC 3M95A 1FRRA 3V60A 4L8UA 2H88B 2LRUA 5IIHA 3QX1A 4A8XC 1OQRA 1ZKHA 3H1UA 2LXSA 2D3BA 4MJSA 5DBYA 4A55A 2XVWA 5T8IA 1SE2A 4ZBRA 1E7VA 4YSZB 2G4DB 2XNAC 5HHDG 2LGIA 1ROEA 2PVGC 3V05A 4L2YA 1JNBA 2GBRA 3UIVA 3APFA 3MP9A 2C7MB 3RNFC 2HTME 4HROA 5DPRA 1PFDA 4KSKC 4FXCA 1Q1OA 3P2BA 3CSFA 1QOBA 2KFKA 3ZW3A 3W9CB 3VRAB 4YXDB 4E3CA 2KMAA 1JW9D 3DVGY 3A9KA 3M3JA 3SIUB 2L7RA 1NI2A 3MHZA 4IKGA 1RRBA 1WGHA 2MW5A 2NQOA 2BS4B 3I9V1 4GN1A 2IJ0A 3V03A 3EC8A 4ZCGA 3B0AA 2KWCA 5DPWA 3AMZA 2NR2A 4IM0A 3SFDB 3GQXA 3CIRB 4G03A 2QHOA 3N30A 2QJLA 4EZLA 4LA0A 1VFIA 1WGDA 4Q2JA 3NHEB 4MH0E 1T6BX 4OHJA 2X8XX 3MHSD 1XLQA 1I4HA 4P16A 3M62B 1R4NB 5FK9C 2VH1A 2INPE 4M0WA 4EKUA 3VFKA 4ZRJA 1WZ3A 2BX8A 2KKCA 3TMPB 4GLSC 1V81A 2PEAA 3BIID 2R61A 3ETRA 1FIQA 4F1SA 4RCOA 1TIFA 4HK2A 5DPSA 5C3JB 4FLHA 3P4PB 1DYQA 1JRPA 1OTRB 4ZYSA 3L4PA 1ET6A 2YDFA 2L32A 3E9SA 1FD6A 3WCQA 2M8SA 4LUHA 1XD3B 3PZ8A 1VRAB 3AE7B 3GP7A 2K8HA 4MGZE 4DXGA 2KQ4X 4G0NB 4HXDA 3BK2A 3P42A 1ZXIA 3NG0A 1AARA 1UZXB 2Z59B 3Q14C 1MUSA 2GBJA 3JW0X 3OG5A 1FXTB 2DWQA 3DBRB 5GHKA 1J7EA 3PREA 4HEA1 4LNOA 4A3PA 5JXVA 5GIPA 1K8RB 2RDBC 2LUMA 1N6ZA 3EGRA 4WWPA 1MG8A 3M99C 3VUWA 2AL6A 1FCLA 4JWUC 3AE8B 2KAJA 4YSYB 1HK3A 3AEAB 4C7ZA 3H3AA 1K52A 3RNBC 2N1WA 4OW0A 4ZRKA 4DDID 3B9JA 4HDQA 1I4PA 1D3ZA 2WDTB 2C5LC 4C00A 2ROHA 2JUOA 1DOYA 3ZNHB 3MC0B 4C7YA 4I6PA 3V62A 4MGKE 3GOEA 1B9RA 3SQJA 3VUYA 2JYTA 4QAYA 4TUUA 3ICXA 1T0SC 1BKEA 3R7RA 1QQRA 1WF9A 2DBUA 5GMVA 1KLUD 1B1ZA 3KWVA 1JALA 1WFYA 1E6EB 2LVOA 2BXAA 3TDLA 3NVIA 1E7CA 2BXOA 1AW7A 1E8ZA 2EKEC 3E56A 4OT2A 4K1RB 2N9KA 3ZGZA 1LO5D 1H4RA 2NCNA 3ZYYX 2OHFA 2J7QB 2LD9A 3P4RB 2D3AA 2PPHA 1Y8RC 2G3QB 2KTFA 4GIVA 2PMVA 1PGAA 4EZKA 2KC2A 3EUB2 2MBQA 1KF6B 2FCMA 2XVVA 1N60A 2ZZPB 1C9FA 3R66C 1ZW7A 4ANUA 1C3TA 2QHBA 3NVYA 3C19A 4MT5A 2M1MA 2N7DA 1Q5WB 2SAKA 4BOSC 5IO9A 3UIOB 2WXRA 4M02A 1J19A 3VAWA 2JWZA 5IJEA 4CO7A 1AWDA 3WA0A 1JCKB 3ZRFA 1V8CA 2GMIC 4US8A 2NS5A 4US9A 2LHDA 4IM3A 3A9KB 2WXGA 1L0VB 3IVFA 1JWSD 2IGDA 1YQ3B 2GB1A 4TSSA 1GNJA 3RNEC 1MA9A 4DXFA 2LOQA 4OTUA 2XSIA 1PQSA 2INNE 1LM8B 2JWUA 3N1YC 3ZXVA 2KLCA 4XZ4A 2L0FA 4ARIA 2Z0DB 4LNIA 1DOXA 1AO6A 3WAOA 1HXYD 2KHWB 4MELA 5LXIB 5HI1A 3NS8A 4AUQC 4IUMB 2L0TA 2GBKA 1WXVA 2CHXA 2BXQA 1LFDA 3T3OA 4X57B 2WP9B 2PTLA 2D10A 3PLVA 2XW1A 1VZ8A 3T9LA 3U8ZA 3W1SA 1UGJA 4I6NB 1RFKA 2LJ5A 2K8CA 1KOTA 1JWUD 3D32A 3W2DA 2EFCA 3VTVA 3B1LX 1WJ6A 1SJED 1V49A 2KTRA 4N0FD 4LB2A 2V3NA 1UBQA 1JWBD 2AWTA 1EUVB 1HEZE 4LNKA 4C4VB 1YOVB 4HJGE 3I3TB 3KQ4A 4P1CC 2PE9A 5AZHA 3U7ZA 4JE3B 3DHGC 2CR5A 1U4AA 2INDC 4UDUC 1E8XA 2IY1B 3M63B 4NQLB 3RNCC 2V3SA 3KVFB 3R7QA 1JWMD 3UQBA 1MIWA 4DHZE 3MC9A 4FULA 4LK0M 3GZNB 1E9MA 3APCA 5D7GA 5G5GA 3DBLB 2E0YA 2ZNVC 2BPSA 2WXJA 3NS1A 4PS3A 1HK5A 2JSVX 5B5TA 3KUDB 3Q3FA 2GBNA 2IO2B 3IBEA 4J2VA 5AZGA 4ANVA 3RULA 4XDDA 2J0JA 4EZJA 1YQBA 1JQ4A 1SB3C 3IAS1 4RGNA 4GOCA 1KRHA 2J0MA 3R2IA 5J18A 4MDKE 4TQ1A 1L5PA 1SGHA 4NJCA 2JT4B 5HOZA 1E7EA 3DVGX 2PW9A 3FWBC 3VUXA 4FIPB 4E74A 5IP4D 4ANWA 2NPTB 4GMVA 3PZ7A 2LVPA 1TXUA 4YT0B 2KOXA 4ZRPA 5IAAC 2V9HA 3U52E 4WWNA 4IM2A 2VRRB 1TS5A 3U2SC 4JGHB 3LB8C 1EWCA 1GAQB 1V1PA 3Q8FA 1R4NI 4RM9A 4OZCA 4N0UD 3KWLA 2ZVOA 4WJOA 2WXQA 3JSVB 3QA8A 3NOBA 2QMTA 1S3SG 1TY0A 4OZBA 3A33B 3NZ3A 1E10A 4KSLC 2ZVNA 4CYEA 3OLMD 4A20A 1YN4A 4F5VA 3Q3OC 1WI0A 3A75A 2IYDB 2XN9C 2KJHB 1VD2A 2N9XA 2LUEA 1UH6A 1F2RI 1KLVA 5DPTA 4HCPB 5G2NA 1WGGA 1L6VA 2LGDA 4B0EA 1V9JA 1GOZA 4RF0A 3DPDA 4LLGM 4B9KA 3Q3MC 4S17A 3VH3B 2JRHA 2V4IB 2W9NA 1R4MB 2W55A 4DK5A 4XWTA 5IKCM 4XX5A 4MSQB 2MBEA 3DBRI 2KWDA 2MCNB 4BY9C 1WJNA 1I42A 1WIAA 2KWVB 2WYQA 4W9FA 3NUHB 2TSSA 3ECIA 4KKJA 4BKSA 2OOBB 3LYYA 4G3XB 2MJDA 1KLGD 5E6JA 4G04A 2BBCA 3P1MA 5IIUA 5BO4B 3BWUD 2EELA 1V97A 2MP2A 1TYGB 1HA5A 2KMCA 3GB1A 4HGMB 1E7GA 3AXCA 3PRPB 1P1AA 2GBMA 3RNGC 2JQRB 2GUTA 4NJ7A 2E3TA 3ENEA 2CS4A 4KGRA 4YL8A 3MC8A 4LDTD 2IDYA 4HLEA 2DAJA 2EKIA 4II2B 3AV8A 2N7EA 1J8CA 1CQVA 1WE6A 2JU6X 1QILA 1YD8U 3P63A 3OAWA 1H9ZA 3UI3A 4PT5A 2HTHA 1A70A 3BINA 4AJYB 3ALBA 2KACA 4FA6A 1ZE3D 1HK2A 2I2ZA 4AS1A 2KK8A 2CHWA 1HTQA 4REZA 5D94A 4K71A 1XXGA 3IT6B 2DYMA 2ZCBA 3O65B 2JPHA 2LQIA 3PHXB 1CZPA 3N32A 5JZEB 5FUOA 2CU1A 3DOWA 4ANXA 4IC7B 1UWMA 2IY0B 2KTRB 2DBWA 1K53A 1VZ7A 4OZAA 2BXBA 2DX5B 2IGHA 4BOZB 2KN4A 3FILB 4GXBA 4BKSD 2B3AA 4DBGA 2D5GA 4ASWC 2WXNA 2M0AA 2KBZA 4HVBA 2FNJB 2DBXA 1FNVA 4WWOA 2BYVE 1QOAA 4OR0A 1ZXHA 2GLSA 2KZRA 1N62A 1QT9A 1ZPSA 2KWFA 3SEBA 2K39A 4OVZA 4MACA 3A9JB 1IPGA 5AZFA 5MPOA 5CHFA 1RFAA 5GINA 1RAXA 5L83A 3FNMA 3PSEB 1KM7A 2WDVB 1Z2MA 3X23A 5E6PA 5FKAC 3VRBB 4RM8A 4NAMA 2BWES 3SIVB 4OVUA 4K7WA 4AOFA 2WU2B 1GPXA 1P3QU 2Z8JA 1NVID 1VJKA 2WQYB 5D2MB 2MSED 2DNFA 2I38A 1KW2A 5CX3A 2DHZA 3LDZE 1FEHA 2PJHA 2JUHA 4KGTA 1L4DB 2LWPA 3WAPA 4DHJB 2BGFA 1WM2A 1M4VA 3ZVVA 1E7AA 3L08A 1V80A 4DM0A 1VR9A 5D6JB 3QC8B 3DHHC 1D5MC 4NY0A 4ZOHC 3AE6B 2FIFA 2L00B 2JX5A 4GDKA 3G9KD 4F5SA 2NTTA 2RD0A 3C0RB 2AQ2B 2O6VD 2K0PA 2V0GA 4BBNF 3NZSA 3TSSA 3I63C 3RN9C 4MM3A 3ZJUA 1P98A 2LXAA 4KVGB 4W9CA 3IXSA 1P7FA 5BMHA 1WR6E 3DBHB 3AULA 3QK0A 4DDGD 2ON8A 2HD5B 4ARCA 3HM6X 5DCNA 3BYYB 1FNUA 4FHKA 3IHPC 3ML9A 1V2YA 2D11A 4K7SA 4KIKB 1WMHA 5FR3A 3NVZA 1MVKA 2LEKA 3N20C 1F2RC 2C60A 3VQIA 3GE8C 4K3CA 3KYDD 1S1QB 2MBBB 1C4PA 5KHQA 4H2AA 1E0ZA 3Q2AC 4XWWA 2KT7A 3QHTA 5KHOA 3GQUA 3V08A 3AECB 1XCQL 2LGYA 4IWQA 1MUHA 1WX8A 3VR8B 2KVZA 3GZNI 4A3OA 4GU2A 1J7AA 3AU5A 4XGAB 4FJCB 2MEKA 3DBLI 1HA2A 3ZNZB 5LNK1 3B2GA 1DGJA 3VHTC 4E71A 1WR1A 2KD0A 4ZDVA 2RSUA 2KDEB 1MM8A 5E6OA 2MP2B 4HRSA 3TUOA 5LXHA 5BYQA 1D4BA 1TJEA 2JZPA 2BVCA 3AEDB 2AEHA 1WX7A 4FHJA 1T0QC 2BXCA 2J53A 5IJ5A 1ACCA 3SR6A 1TF0A 2M4NA 2LXTA 1O9XA 4II3B 2ZJDA 1TZOA 1G6JA 3JQZA 1D6EC 1F9JA 2M19A 4NNJB 3JRYA 3Q69A 1YN5A 5G5HA 3PO0A 3FKYA 2WGSA 4GDLB 4WJQA 1C76A 2ACZB 2WU5B 3KUCB 2INCC 4W9HA 2K0NA 1KXPD 3HM3A 2XVUA 3RUIB 2H89B 3Q8AA 1C78A 5J2RA 4F7ZA 2MJEA 1YX6B 2PLPA 4YTPB 4DQOC 4KX6B 2PVOD 4NQKE 3KUZA 3PVLA 3IT4B 1K51A 2IZVB 1IBXA 3PRMB 1L7YA 5ID7A 3Q3NC 2N0SB 5D3DA 2Q5WD 2XK5A 3BVMA 1IGCA 1PDXA 4L9QA 3FC4A 2IO1B 1WGYA 3BPJA 3MHSB 2MBOA 4MJSB 3P4QB 5H8YE 1UF0A 3PLUA 3QCAA 1LNSA 1R4MI 1NI3A 2CU3A 2FCQA 1HE8A 3QJZA 3CX9A 1OGWA 4ACFA 2ZPYA 1H5WA 1XLOA 3ZKJC 2OJWA 5D3IB 3WHRA 1F52A 2KN5A 2VZKD 1EWYC 3SU8X 2MX2A 2KJRA 1IYFA 2J42A 3W5VB 4EEWA 2V1YA 1F77A 4J3OD 4EUTA 4LUFA 3A1QA 2KDBA 4HKZE 2LZ6A 2G1EA 2KFKB 1MIYA 4WJNA 1PGXA 3L0WB 2KWUB 3OJ4B 2NBVB 1N5WA 4DXAB 5JHBA 1WJUA 4TV3A 3RCZA 3ZRCA 4Z9OA 1Q0WB 4HPPA 2WDQB 2DBYA 2VUEA 1L6UA 4NJ6A 5IA7A 1WX9A 1XLPA 4FJZA 4FBJB 4KZ0A 2UWQA 2WWZA 1FPYA 5I4DA 3QAQA 4ZRQA 3WHQA 4PYZA 4MEMA 3JVZX 3TCAA 2DYBA 3Q6BA 4WA6B 2Z8IA 2KX0A 2I2YA 5TSSA 4AQ7A 2Y5CA 3B9MA 4M0WB 1JROA 1J0GA 3S2AA 3W1YA 4W9GA 2O2VA 1YIWA 4MH8A 5L95C 5C23A 4OTTA 2BXKA 3KIKA 3UINB 3UQAA 3TBLD 1I7HA 3U30A 1WJ4A 2K3UA 2SEBD 2IO0B 4ZRIA 3TIXA 2LQHA 1WMHB 4N3ZA 1ZDXA 4M01A 2AGHB 3AE9B 1D5XC 5GIOA 2RMMA 2JZ3B 2VH2A 4HDOA 3WALA 1UUPA 4M8MA 3HVDA 1T3QA 3Q8BA 3TEWA 2PIAA 3I5JC 1KTKA 1TBEA 5IIXA 1UELA 4XE0A 3ZO5B 5C1ZA 2K8BA 2WXOA 1BM0A 2E6XA 2WHIA 4KKIA 4AJWA 1IUEA 2LFIA 1MHXA 4P1BC 3A73A 3H7SA 3B9LA 2IO3B 4HJKA 2BS2B 1EF1A 1V6EA 2WXIA 3GE3C 2LRWA 3MJ5A 5EE3A 4ZHPA 4BVUC 2QDFA 4WIPA 2D2QA 4ZHOA 3PT2B 1SJHD 2N7JA 3FWCC 1I4XA 3KLSX 4LJOB 1P9DU 4RH6A 3ZIMA 2KMMA 2NNWA 2B76B 2Y3AA 4IWPA 3VVWB 1F1HA 1E78A 3AEEB 2J52A 2EFHA 3A4SC 2WXFA 1D5ZC 2KFJA 2VDBA 2XVQA 3PGEA 4YWGG 2M17A 1ZDVA 4IOIE 1E7PB 4L1BA 4PYUA 1OEYJ 3BZDB 2MBHA 3U7DA 4ZC6A 1N61A 3NY5A 2ZW1A 2N9PC 4BZAA 4YTNB 1L0YB 4AP4C 2Y5PA 2ZW0A 2JYEA 3H6NA 4N58A 2YLMA 3DWGC 4B95A 5GXGB 2CKHB 5IFOA 2JRIB 1GNUA 4FN2A 3UGBB 3TEXA 2MQJA 5BPKA 2KC1A 3P4SB 3BYTB 2XMOA 2WXMA 4WJPA 2V3PA 4EMXA 1Y56A 3DBHI 1OQYA 1CK1A 5EE1A 1BUIC 2NVUI 2NMQA 2RPQA 1VLBA 2EMTA 1ZUD2 2GRIA 1SBBB 3MJWA 1QOFA 2WNMA 3RI7C 5AEKB 2ICIA 2JZZA 1C4AA 1PUTA 1IP9A 2MHJA 4EE2A 1YN3A 3RMKC 2DG5A 1WXSA 2W54A 1TS4A 1SEBD 3NVMA 3AE3B 5EE9A 3HVZA 1SB0A 1C4CA 1E8YA 3H37A 1WM3A 2UU7A 4S1YA 2KDFB 3FAHA 4YTMB 5BYRA 1GJZA 2BXDA 4ITKA 2NBUA 3TEZA 4XYCA 4RMAA 3A1QB 1AYFA 2BXGA 1UGMA 1TT5B 2M56B 4NPNA 5AUIA 1QKZA 4A9AA 3RZWC 1ZGUB 1E7BA 2YVCA 1T0RC 3AE2B 4LCDE 2BXNA 5CHWA 5ID9A 2AQ3B 2OEDA 1FFUA 4XC2A 2K25A 2BXLA 2DZIA 2KVRA 2WXHA 3AM9A 1GB1A 1Z5SB 2FCSA 4PS8A 1YNTE 2JXTA 3VTUA 2W82A 3HHMA 4JIOU 1R7SA 5DQFA 4WH4A 1FCCC 2K1FA 3T8MA 2L05A 2OJRA 1I4RA 3LXFA 1HZ5A 1PGBA 3AEBB 2XEWA 3WANA 2AJEA 3PZDA 3Q8EA 2BB5A 2LJIA 2MH7A 2JVCA 1FMAD 1SE4A 1BMLC 2XBBC 1GUAB 4JL9A 3LU8A 4USAA 4ZUXV 1LQBA 1TZ1A 3URYA 2C7NB 3JYUA 4EFOA 4K2CA 1WXAA 3T3NA 1QLBB 2G45B 4W9LA 4XDCA 2JF5A 3RYTA 3VTWA 4DHZB 2L76A 1CJEA 2O6VA 3WHSA 1STEA 2MWSB 1X1MA 1ZOYB 1T0YA 1YJ1A 3CF6E 2QSDA 2Z8KA 3OJ3A 4GDXA 4TMAB 3X0WA 3V3XA 2IGGA 4RFBA 3LU6A 3DDCB 3MHHB 4W9KA 2MRPA 2RR9A 4RGMA 3QQ8B 4IW0A 2WX1A 1YQ4B 4B0MA 1VZSA 1H8CA 2MA9B 1XF5L 2XW0A 1WYGA 3N3KB 4F5TA 4F8CB 1UBIA 2BYEA 1I4QA 1ZP0B 3Q8CA 3PLAA 3PHWB 3ZDMC 2BXIA 2YEPB 1V1PB 5AUKA 1GC6A 3ML8A 1WRIA 3GS2A 5BYSA 2K5PA 2QMCA 2DZKA 5JHAA 2V4LA 4L9KA 4KDLB 4DWFA 3WAMA 2C7HA 4C56C 4LDTB 2KQ7A 4KGSA 3IAM1 1WXQA 1WH3A 1BJ5A 4LJPB 3H9DA 1CMXB 4FJYA 2BYTA 2K6QA 2WXKA 1E7IA 3I57A 2QEJC 2WX0A 3SDLC 1YX5B 1OFFA 2WDRB 1TGZB 1P0RA 3O13A 3CMMB 1JRUA 4A90A 4BKTA 2N9LA 2GOWA 1MG4A 3DQVA 4MBEC 3N1XC 3PPAA 3PRZA 4GG2A 4D2KA 2HDEA 4JLCA 4MSMB 3PTFC 3AE1B 3ZQ4A 3KH0A 3IG3A 2D3GA 1M94A 5BMIA 4BKEA 3ZUNA 4FK5B 3TEYA 5CTRC 3H8HA 4WAAA 4CQNA 2Z0EB 1I35A 2UYZB 3B2FA 2BYFA 2PE6B 1ESFA 2BQQA 4C4VA 2IPKD 3B08A 3ABVB 4HPMB 3APDA 2M0XA 1VZ6A 2HE7A 2LI5A 2EFEA 1FXIA 4RNAA 1XQQA 2AL3A 1LXDA 3TJPA 1WWTA 4TKNA 1SIJA 4HKQA 4K7UA 2A4ZA 4JK4A 2FUG1 5HG2A 2N9EB 2QC8A 1RM6C 3BY4B 3RPFC 2BKFA 2FE8A 3KW5B 1WY8A 3CSTA 4WAFA 3ZLZA 4NZLB 3DVNV 5EDSA 4JQWC 1EU4A 1V86A 2ZPNA 3H7PA 1VCBA 2YEPF 2K9XA 4LNFA 1RLFA 1V5OA 3IFWB 3AEGB 4GSWA 2J4XA 1XCTL 3DWMA 1NYRA 4B6WA 1FRDA 3NRZA 1AN8A 2BS3B 4URKA 1MJDA 5FR6A 4HCNB 3ECPA 3SD5A 2NPTA 2K22A 4TQ0A 1FXAA 3V6EB 2IBIB 3MFGA 2K6DB 2KANA 2QCZA 5CHVC 1EU3A 4WQMA 3VXWA 1GB4A 1UORA 1XT9B 3UF8A 3WIMA 2DAFA 2HJ1A 3NZUA 3L10B 4JX1C 2BT6A 2AX5A 3JSVA 1C1YB 3RZFA 3ZJVA 2O6VB 1J7BA 1E7FA 1GC7A 1YJJA 3VR9B 3EFCA 2V36A 3W5UB 2DZJA 2JXXA 1V1OA 4PS7A 1Q10A 1FOUA 2KNBA 1SIFA 3OWEB 2LXCA 4A6QA 4MGIE 1LGRA 3VDZA 1HK1A 4HGKA 5TR5A 4IW1A 3GA9L 1HQRD 1TKEA 1C79A 1NBFC 3N9YC 1EF5A 2CHZA 4LB9A 3RT3B 1GG3A 3DVNU 3V6CB 4IG7B 5H92C 5HFYA 2X38A 2L8JA 4WURA 2FUHB 5EE0A 5J17A 2CKXA 4M00A 2AQ1B 3C8YA 2EFDA 4G01A 2FIDA 2KDIA 1V5TA 1BT0A 3ZJTA 2KLGA 2WS3B 1IGDA 4G50A 4L23A 4LTUA 4C80A 3AB5A 1TS3A 2QM6A 2AYOB 2A5UA 4N9F4 4BAXA 3EHVA 1IJGA 1UWXA 3EECA 5E6NA 2N4FA 1KDXA 1XLNA 2BXPA 4O1NA 3QWZB 4KDIC 4GDKB 4GGQA 3V09A 3RFZB 4C31B 3ZTCA 2MLBA 1E8WA 3QIJA 3ONSA 4GB9A 2KXJA 1HTOA 3J9CA 2I1KA 2L52A 4MM3B 2VUFA 4M70B 1F0ZA 2FBWB 2LASA 1MFWA 4S0RA 1TKYA 1NENB 1DOIA 2KQSA 3QARA 5BMGA 2QIEB 1SE9A 1FM0D 1E7UA 1YMHE 3R2TA 4G11A 2LVQA 3L13A 1LOTA 1SSNA 3SFEB 2RGFA 1WXMA 2ZEQA 2DLBA 3PS6A 2C9WB 4NAWA 4KZCA 4FJVB 2KX3A 2G9HD 4I6LB 3NMUA 1SE3A 1YJIA 2WLBA 2OT3A 3L54A 3RD2A 2L3ZA 3FILA 1KJTA 4PK1A 1ENFA 1UD7A 4N6EB 1P7EA 1KH0A 1E90A 4JWSC 2DYOA 1MPEA 2R2QA 3Q3JA 4IW2A 1MHHE 4ICVA 4RGOS 3LJ3A 2REXA 2BXMA 2ZNVB 2QILA 4Z69A 3HK0A 3HIZA 1ET9A 3A9JA 4CHKA 2BXFA 4I9OA 2BB6A 2L1AA 2BF8B 3SHQA 3AI5A 4BKGA 4M8NA 4R3DA 4WQOB 2Z8LA 1L2NA 2RPVA 1WYWB 1NT2B 4HWIB 2VZKB 1N5UA 4F5UA 2LHEA 2KYWA 4WWMA 3H7PB 5C2TB 3HUIA 2I1JA 1J78A 1WGRA 3LU7A 1TKGA 3CWIA 1J7CA 2I30A 1OEYA 4JPSA 1EO6A 4EOYA 3EA6A 1EM7A 3DHIC 4RF1A 1FO4A 4LNNA 4P6VF 1XEEA 3ZTDA 3ZDTA 2J0KA 3AU4A 1MIVA 4BFRA 1T5XD 1L4ZB 4W4UB 1JMLA 1N5XA 2EMSA 3K9OB 2NTSA 1IBXB 3K9PB 3L16A 2DENB 2KDMA 1WRDB 2XK5B 3NVWA 2E0XA 4W9DA 2ONQA 5JH5C 1A5RA 3AE5B 4N59A 4PO0A 2D3CA 4ZBKA 4W9EA 1RYJA 4D7XA 1FFVA 1K50A 2LMCA 3UIPB 2RDGA 2Y5BB 1VDVA 2ZCCA 1N63A 2ASQA 2D07B 3ZXRA 2BXEA 1TTNA 2RDHA 3BVZA 4IWOA 2KJ6A 3ZNID 2BW2A 2CJOA 1FNWA 4W9IA 4KIKA 2CJNA 1QOGA 1GNIA 1E5WA 3A4RA 3VH4B 1C77A 4P7IA 2JY6A 1NEKB 2GI9A 5IOIA 2MJ3A 3KYCD 1UNSA 3DBSA 4DHXB 5IJFA 1QF6A 2N1VA 3HRDD 4DHJD 2BTEA 5LLIA 2PKOA 1OQQA 3PV1A 1TY2A 1WZ0A 2BXHA 2HJ8A 3BVGA 3TL5A 5IN7A 1NYQA 1RWSA 4W9JA 4IDIA 3V61A 4FADA 2LGSA 2WXPA 4OVVA 1NDDA 5G55A 3R8BA 1QZEA 1ISNA 3EFUA 3NJTA 4KV2A 1SXTA 1E7HA 2BKRB 1JWAD 1XO3A 2LGXA 2WXLA 1HK4A 3KJLA 2W3SA 4K81A 2O2VB 4HPLB 2NBWB 2R2OA 3NVKA 2DZMA 3NVVA 2FAZA 3DCGA 1L0XB 3BK1A 4YSXB 2BWFA 3R3MA 4ZBQA 1HZ6A 4K3BA 1WE7A 2KO3A 3AN1A 3W1SC 1PYWD 3L17A 3AEFB 1KFYB 4GDLA 4ZYNA 5HKHA 4RGTA 2W3RA 1MI0A 2G4SA 2OZBB 1BXTA 4BBNC 1TS2A 2L83A 1WGKA 2FCNA 3AE4B 4NAWB 4J6IA 1WSPA 4E99A 1SF0A 3AH7A 3RNAC
chains in the Genus database with same CATH topology
4AWJA 4ICUA 4MGYE 3U4EG 1I4GA 3MTNB 3ZNGC 3M95A 3V60A 1FRRA 4L8UA 2H88B 2LRUA 5IIHA 3QX1A 4A8XC 1OQRA 1ZKHA 3H1UA 4MJSA 5DBYA 4A55A 2XVWA 5T8IA 1SE2A 4ZBRA 1E7VA 4YSZB 2G4DB 2XNAC 5HHDG 2LGIA 1ROEA 2PVGC 3V05A 4L2YA 1JNBA 2GBRA 3UIVA 3APFA 3MP9A 2C7MB 2HTME 4HROA 5DPRA 1PFDA 4KSKC 4FXCA 1Q1OA 3P2BA 3CSFA 1QOBA 2KFKA 3ZW3A 3W9CB 3VRAB 4YXDB 4E3CA 2KMAA 1JW9D 3DVGY 3A9KA 3M3JA 3SIUB 2L7RA 1NI2A 3MHZA 4IKGA 1RRBA 1WGHA 2MW5A 2NQOA 2BS4B 4GN1A 3I9V1 2IJ0A 3V03A 3EC8A 4ZCGA 3B0AA 2KWCA 5DPWA 3AMZA 2NR2A 4IM0A 3SFDB 3GQXA 3CIRB 4G03A 2QHOA 3N30A 2QJLA 4EZLA 4LA0A 1VFIA 1WGDA 4Q2JA 3NHEB 4MH0E 1T6BX 4OHJA 3MHSD 1XLQA 1I4HA 4P16A 3M62B 5FK9C 2INPE 4M0WA 4EKUA 3VFKA 4ZRJA 1WZ3A 2BX8A 2KKCA 3TMPB 4GLSC 1V81A 2PEAA 3BIID 2R61A 3ETRA 1FIQA 4F1SA 4RCOA 4HK2A 5DPSA 5C3JB 4FLHA 3P4PB 1DYQA 1JRPA 1OTRB 4ZYSA 3L4PA 1ET6A 2YDFA 2L32A 3E9SA 1FD6A 3WCQA 2M8SA 4LUHA 1XD3B 3PZ8A 1VRAB 3AE7B 3GP7A 2K8HA 4MGZE 4DXGA 2KQ4X 4G0NB 4HXDA 3BK2A 3P42A 1ZXIA 1AARA 1UZXB 2Z59B 2GBJA 3JW0X 1FXTB 2DWQA 5GHKA 1J7EA 3PREA 4HEA1 4A3PA 5JXVA 5GIPA 1K8RB 2LUMA 3EGRA 4WWPA 1MG8A 3M99C 3VUWA 2AL6A 1FCLA 4JWUC 3AE8B 2KAJA 4YSYB 1HK3A 3AEAB 4C7ZA 3H3AA 1K52A 2N1WA 4ZRKA 4DDID 4OW0A 3B9JA 4HDQA 1I4PA 1D3ZA 2WDTB 2C5LC 2ROHA 2JUOA 1DOYA 3ZNHB 3MC0B 4C7YA 4I6PA 3V62A 4MGKE 3GOEA 1B9RA 3SQJA 3VUYA 2JYTA 4TUUA 3ICXA 1BKEA 3R7RA 1QQRA 1WF9A 2DBUA 5GMVA 1KLUD 1B1ZA 3KWVA 1JALA 1WFYA 1E6EB 2LVOA 2BXAA 3TDLA 3NVIA 1E7CA 2BXOA 1AW7A 1E8ZA 2EKEC 3E56A 4OT2A 4K1RB 2N9KA 3ZGZA 1LO5D 1H4RA 2NCNA 3ZYYX 2OHFA 2J7QB 2LD9A 3P4RB 2PPHA 1Y8RC 2G3QB 2KTFA 4GIVA 2PMVA 1PGAA 4EZKA 2KC2A 3EUB2 2MBQA 1KF6B 2FCMA 2XVVA 1N60A 2ZZPB 1C9FA 3R66C 1ZW7A 4ANUA 1C3TA 2QHBA 3NVYA 4MT5A 2M1MA 2N7DA 1Q5WB 4BOSC 2SAKA 3UIOB 2WXRA 1J19A 3VAWA 2JWZA 5IJEA 4CO7A 1AWDA 3WA0A 1JCKB 3ZRFA 1V8CA 2GMIC 4US8A 2NS5A 4US9A 2LHDA 4IM3A 3A9KB 2WXGA 1L0VB 3IVFA 1JWSD 2IGDA 1YQ3B 2GB1A 4TSSA 1GNJA 1MA9A 4DXFA 2LOQA 4OTUA 2XSIA 1PQSA 2INNE 1LM8B 2JWUA 2KLCA 4XZ4A 2L0FA 4ARIA 2Z0DB 1DOXA 1AO6A 3WAOA 2KHWB 1HXYD 4MELA 5LXIB 5HI1A 3NS8A 4AUQC 4IUMB 2L0TA 2GBKA 1WXVA 2CHXA 2BXQA 1LFDA 3T3OA 4X57B 2WP9B 3PLVA 2D10A 2PTLA 2XW1A 3T9LA 1VZ8A 3U8ZA 3W1SA 1UGJA 4I6NB 1RFKA 2LJ5A 2K8CA 1KOTA 1JWUD 3D32A 3W2DA 2EFCA 3VTVA 3B1LX 1WJ6A 1V49A 1SJED 2KTRA 4N0FD 4LB2A 2V3NA 1UBQA 1JWBD 2AWTA 1EUVB 1HEZE 4HJGE 3I3TB 3KQ4A 2PE9A 5AZHA 3U7ZA 4JE3B 2CR5A 1U4AA 4UDUC 1E8XA 2IY1B 3M63B 4NQLB 2V3SA 3KVFB 3R7QA 1JWMD 3UQBA 1MIWA 4DHZE 4FULA 4LK0M 3APCA 1E9MA 5D7GA 5G5GA 2E0YA 2ZNVC 2BPSA 2WXJA 3NS1A 4PS3A 1HK5A 2JSVX 5B5TA 3KUDB 3Q3FA 2GBNA 2IO2B 3IBEA 4J2VA 5AZGA 4ANVA 3RULA 4XDDA 2J0JA 4EZJA 1YQBA 1JQ4A 1SB3C 3IAS1 4RGNA 4GOCA 1KRHA 2J0MA 3R2IA 5J18A 4MDKE 4TQ1A 1L5PA 1SGHA 4NJCA 2JT4B 5HOZA 1E7EA 3DVGX 2PW9A 3FWBC 3VUXA 4FIPB 4E74A 4ANWA 2NPTB 4GMVA 3PZ7A 2LVPA 1TXUA 4YT0B 2KOXA 4ZRPA 5IAAC 3U52E 4WWNA 4IM2A 2VRRB 1TS5A 3U2SC 4JGHB 3LB8C 1EWCA 1GAQB 1V1PA 3Q8FA 1R4NI 4RM9A 4OZCA 4N0UD 3KWLA 2ZVOA 4WJOA 2WXQA 3JSVB 3QA8A 3NOBA 2QMTA 1S3SG 1TY0A 4OZBA 3A33B 3NZ3A 1E10A 4KSLC 2ZVNA 4CYEA 3OLMD 4A20A 1YN4A 4F5VA 1WI0A 3A75A 2IYDB 2XN9C 2KJHB 1VD2A 2N9XA 2LUEA 1UH6A 1KLVA 1F2RI 5DPTA 4HCPB 5G2NA 1WGGA 2LGDA 1L6VA 4B0EA 1V9JA 1GOZA 4RF0A 3DPDA 4LLGM 4B9KA 3VH3B 2JRHA 2V4IB 2W9NA 2W55A 4DK5A 4XWTA 4XX5A 4MSQB 2MBEA 3DBRI 2KWDA 2MCNB 4BY9C 1WJNA 1I42A 1WIAA 2KWVB 2WYQA 4W9FA 3NUHB 2TSSA 3ECIA 4KKJA 4BKSA 2OOBB 3LYYA 4G3XB 2MJDA 1KLGD 5E6JA 4G04A 2BBCA 3P1MA 5IIUA 5BO4B 3BWUD 2EELA 1V97A 2MP2A 1TYGB 1HA5A 2KMCA 3GB1A 4HGMB 1E7GA 3AXCA 3PRPB 1P1AA 2GBMA 2JQRB 4NJ7A 2E3TA 3ENEA 2CS4A 4KGRA 4YL8A 4LDTD 4HLEA 2IDYA 2DAJA 2EKIA 4II2B 3AV8A 2N7EA 1J8CA 1WE6A 1CQVA 2JU6X 1QILA 1YD8U 3OAWA 3P63A 1H9ZA 3UI3A 4PT5A 2HTHA 1A70A 3BINA 4AJYB 3ALBA 2KACA 4FA6A 1ZE3D 1HK2A 2I2ZA 4AS1A 2KK8A 2CHWA 4REZA 5D94A 4K71A 1XXGA 3IT6B 2DYMA 2ZCBA 3O65B 2JPHA 3PHXB 1CZPA 3N32A 5JZEB 5FUOA 2CU1A 3DOWA 4ANXA 4IC7B 1UWMA 2IY0B 2KTRB 2DBWA 1K53A 1VZ7A 4OZAA 2BXBA 2DX5B 2IGHA 4BOZB 4GXBA 2KN4A 3FILB 4BKSD 2B3AA 4DBGA 2D5GA 4ASWC 2WXNA 2M0AA 2KBZA 4HVBA 2FNJB 2DBXA 1FNVA 4WWOA 2BYVE 1QOAA 4OR0A 2KZRA 1ZXHA 1N62A 1QT9A 1ZPSA 3SEBA 2K39A 4OVZA 4MACA 3A9JB 1IPGA 5AZFA 5MPOA 5CHFA 1RFAA 5GINA 1RAXA 5L83A 3FNMA 3PSEB 1KM7A 2WDVB 1Z2MA 3X23A 5E6PA 5FKAC 3VRBB 4RM8A 4NAMA 2BWES 3SIVB 4OVUA 4K7WA 4AOFA 2WU2B 1GPXA 1P3QU 2Z8JA 1NVID 1VJKA 2WQYB 5D2MB 2MSED 2I38A 1KW2A 5CX3A 2DHZA 3LDZE 1FEHA 2PJHA 2JUHA 4KGTA 2LWPA 1L4DB 3WAPA 4DHJB 2BGFA 1WM2A 1M4VA 3ZVVA 1E7AA 3L08A 1V80A 1VR9A 5D6JB 3QC8B 1D5MC 4NY0A 4ZOHC 3AE6B 2FIFA 2L00B 2JX5A 4GDKA 3G9KD 4F5SA 2NTTA 2RD0A 3C0RB 2AQ2B 2O6VD 2K0PA 2V0GA 4BBNF 3NZSA 3TSSA 4MM3A 3ZJUA 1P98A 2LXAA 4KVGB 4W9CA 3IXSA 1P7FA 5BMHA 1WR6E 3AULA 3QK0A 4DDGD 2ON8A 2HD5B 4ARCA 3HM6X 5DCNA 3BYYB 1FNUA 4FHKA 3IHPC 3ML9A 1V2YA 2D11A 4K7SA 4KIKB 1WMHA 5FR3A 3NVZA 1MVKA 2LEKA 2C60A 1F2RC 3VQIA 3KYDD 1S1QB 2MBBB 1C4PA 5KHQA 4H2AA 1E0ZA 4XWWA 3QHTA 5KHOA 3GQUA 3V08A 3AECB 1XCQL 2LGYA 4IWQA 1WX8A 3VR8B 3GZNI 4A3OA 4GU2A 1J7AA 3AU5A 4FJCB 3DBLI 2MEKA 1HA2A 3ZNZB 5LNK1 3B2GA 1DGJA 3VHTC 4E71A 1WR1A 2KD0A 4ZDVA 2RSUA 2KDEB 5E6OA 2MP2B 4HRSA 3TUOA 5LXHA 5BYQA 1D4BA 1TJEA 2JZPA 3AEDB 2AEHA 1WX7A 4FHJA 2BXCA 2J53A 5IJ5A 1ACCA 3SR6A 1TF0A 2M4NA 4II3B 1O9XA 2ZJDA 1TZOA 1G6JA 3JQZA 1D6EC 1F9JA 2M19A 4NNJB 3JRYA 3Q69A 1YN5A 5G5HA 3PO0A 4GDLB 4WJQA 1C76A 2ACZB 3KUCB 2WU5B 4W9HA 1KXPD 3HM3A 2XVUA 3RUIB 2H89B 3Q8AA 1C78A 5J2RA 4F7ZA 2MJEA 1YX6B 2PLPA 4YTPB 4DQOC 4KX6B 4NQKE 2PVOD 3KUZA 3PVLA 3IT4B 1K51A 2IZVB 1IBXA 3PRMB 1L7YA 5ID7A 2N0SB 5D3DA 2Q5WD 2XK5A 3BVMA 1IGCA 1PDXA 4L9QA 3FC4A 2IO1B 1WGYA 3MHSB 2MBOA 4MJSB 3P4QB 5H8YE 3PLUA 3QCAA 1LNSA 1R4MI 1NI3A 2CU3A 2FCQA 1HE8A 3QJZA 3CX9A 1OGWA 2ZPYA 1H5WA 1XLOA 3ZKJC 5D3IB 3WHRA 2KN5A 2VZKD 1EWYC 3SU8X 2MX2A 2KJRA 1IYFA 2J42A 3W5VB 4EEWA 2V1YA 1F77A 4J3OD 4EUTA 4LUFA 3A1QA 2KDBA 4HKZE 2LZ6A 2G1EA 2KFKB 1MIYA 4WJNA 1PGXA 3L0WB 2KWUB 3OJ4B 2NBVB 1N5WA 4DXAB 5JHBA 1WJUA 4TV3A 3RCZA 3ZRCA 4Z9OA 1Q0WB 2WDQB 2DBYA 2VUEA 1L6UA 4NJ6A 5IA7A 1WX9A 1XLPA 4FJZA 4FBJB 4KZ0A 2UWQA 2WWZA 5I4DA 3QAQA 4ZRQA 3WHQA 4PYZA 4MEMA 3JVZX 3TCAA 2DYBA 4WA6B 2Z8IA 2KX0A 2I2YA 5TSSA 4AQ7A 2Y5CA 3B9MA 4M0WB 1JROA 1J0GA 3S2AA 3W1YA 4W9GA 2O2VA 1YIWA 4MH8A 5L95C 5C23A 4OTTA 2BXKA 3KIKA 3UINB 3UQAA 3TBLD 1I7HA 3U30A 1WJ4A 2K3UA 2SEBD 2IO0B 4ZRIA 3TIXA 1WMHB 4N3ZA 1ZDXA 3AE9B 1D5XC 5GIOA 2RMMA 2JZ3B 4HDOA 3WALA 1UUPA 4M8MA 3HVDA 1T3QA 3Q8BA 3TEWA 2PIAA 1KTKA 1TBEA 5IIXA 1UELA 3ZO5B 4XE0A 5C1ZA 2K8BA 2WXOA 1BM0A 2E6XA 4KKIA 4AJWA 1IUEA 2LFIA 1MHXA 3A73A 3H7SA 3B9LA 2IO3B 4HJKA 2BS2B 1EF1A 1V6EA 2WXIA 2LRWA 3MJ5A 5EE3A 4ZHPA 4BVUC 4WIPA 2D2QA 4ZHOA 3PT2B 1SJHD 2N7JA 3FWCC 1I4XA 3KLSX 4LJOB 1P9DU 4RH6A 3ZIMA 2KMMA 2NNWA 4IWPA 2B76B 2Y3AA 3VVWB 1E78A 3AEEB 2J52A 2EFHA 3A4SC 2WXFA 1D5ZC 2KFJA 2VDBA 2XVQA 3PGEA 4YWGG 2M17A 1ZDVA 4IOIE 1E7PB 4L1BA 4PYUA 1OEYJ 3BZDB 2MBHA 3U7DA 4ZC6A 1N61A 3NY5A 2ZW1A 2N9PC 4YTNB 1L0YB 4AP4C 2Y5PA 2ZW0A 2JYEA 3H6NA 4N58A 2YLMA 4B95A 3DWGC 5GXGB 2CKHB 5IFOA 2JRIB 1GNUA 4FN2A 3UGBB 3TEXA 2MQJA 5BPKA 2KC1A 3P4SB 3BYTB 2XMOA 2WXMA 4WJPA 2V3PA 4EMXA 1Y56A 3DBHI 1OQYA 1CK1A 5EE1A 1BUIC 2NVUI 2NMQA 2RPQA 1VLBA 2EMTA 1ZUD2 2GRIA 1SBBB 3MJWA 1QOFA 2WNMA 5AEKB 2JZZA 2ICIA 1C4AA 1IP9A 1PUTA 4EE2A 1YN3A 2DG5A 1WXSA 2W54A 1TS4A 1SEBD 3NVMA 3AE3B 5EE9A 3HVZA 1E8YA 1C4CA 3H37A 1WM3A 4S1YA 2KDFB 3FAHA 4YTMB 5BYRA 1GJZA 2BXDA 4ITKA 2NBUA 3TEZA 4RMAA 3A1QB 1AYFA 2BXGA 1UGMA 4NPNA 2M56B 5AUIA 1QKZA 4A9AA 3RZWC 1ZGUB 1E7BA 2YVCA 3AE2B 4LCDE 2BXNA 5CHWA 5ID9A 2AQ3B 2OEDA 4XC2A 1FFUA 2K25A 2BXLA 2DZIA 2KVRA 2WXHA 3AM9A 1GB1A 1Z5SB 2FCSA 4PS8A 1YNTE 2JXTA 3VTUA 3HHMA 2W82A 4JIOU 1R7SA 5DQFA 4WH4A 1FCCC 2K1FA 3T8MA 2L05A 2OJRA 1I4RA 3LXFA 1HZ5A 1PGBA 3AEBB 2XEWA 3WANA 2AJEA 3PZDA 3Q8EA 2BB5A 2LJIA 2MH7A 2JVCA 1FMAD 1SE4A 1BMLC 2XBBC 1GUAB 4JL9A 3LU8A 4USAA 4ZUXV 1LQBA 1TZ1A 3URYA 2C7NB 3JYUA 4EFOA 4K2CA 1WXAA 3T3NA 2G45B 4W9LA 1QLBB 4XDCA 2JF5A 3RYTA 3VTWA 4DHZB 2L76A 1CJEA 2O6VA 3WHSA 2MWSB 1STEA 1X1MA 1ZOYB 1T0YA 1YJ1A 3CF6E 2QSDA 2Z8KA 3OJ3A 4GDXA 4TMAB 3X0WA 3V3XA 2IGGA 4RFBA 3LU6A 3DDCB 3MHHB 4W9KA 2MRPA 2RR9A 4RGMA 3QQ8B 4IW0A 2WX1A 1YQ4B 4B0MA 1VZSA 1H8CA 2MA9B 1XF5L 2XW0A 3N3KB 1WYGA 4F5TA 4F8CB 1UBIA 2BYEA 1I4QA 1ZP0B 3Q8CA 3PLAA 3PHWB 3ZDMC 2BXIA 2YEPB 1V1PB 5AUKA 1GC6A 3ML8A 1WRIA 3GS2A 5BYSA 2K5PA 2QMCA 2DZKA 5JHAA 2V4LA 4L9KA 4KDLB 4DWFA 3WAMA 2C7HA 4C56C 4LDTB 2KQ7A 4KGSA 3IAM1 1WXQA 1WH3A 1BJ5A 4LJPB 3H9DA 1CMXB 4FJYA 2BYTA 2K6QA 2WXKA 1E7IA 3I57A 2QEJC 2WX0A 3SDLC 1YX5B 1OFFA 2WDRB 1TGZB 1P0RA 3O13A 4BKTA 1JRUA 3CMMB 4A90A 2N9LA 2GOWA 3DQVA 4MBEC 3PPAA 3PRZA 4GG2A 4D2KA 2HDEA 4JLCA 4MSMB 3PTFC 3AE1B 3ZQ4A 3KH0A 3IG3A 2D3GA 1M94A 5BMIA 4BKEA 3ZUNA 4FK5B 3TEYA 5CTRC 3H8HA 4WAAA 4CQNA 2Z0EB 1I35A 2UYZB 3B2FA 2BYFA 2PE6B 1ESFA 2IPKD 3B08A 3ABVB 4HPMB 3APDA 2M0XA 1VZ6A 2HE7A 2LI5A 2EFEA 1FXIA 4RNAA 1XQQA 2AL3A 1LXDA 3TJPA 1WWTA 4TKNA 1SIJA 4HKQA 4K7UA 2A4ZA 4JK4A 2FUG1 5HG2A 2N9EB 1RM6C 3BY4B 3RPFC 2BKFA 2FE8A 3KW5B 1WY8A 3CSTA 3ZLZA 4WAFA 4NZLB 3DVNV 5EDSA 4JQWC 1EU4A 1V86A 2ZPNA 3H7PA 1VCBA 2YEPF 2K9XA 1RLFA 1V5OA 3IFWB 3AEGB 4GSWA 2J4XA 1XCTL 3DWMA 1NYRA 4B6WA 1FRDA 3NRZA 1AN8A 2BS3B 4URKA 5FR6A 4HCNB 3SD5A 2NPTA 2K22A 4TQ0A 1FXAA 3V6EB 2IBIB 3MFGA 2K6DB 2KANA 5CHVC 3VXWA 1EU3A 4WQMA 1GB4A 1UORA 1XT9B 3UF8A 3WIMA 2DAFA 3NZUA 3L10B 4JX1C 2BT6A 2AX5A 3JSVA 1C1YB 3RZFA 3ZJVA 2O6VB 1J7BA 1E7FA 1GC7A 1YJJA 3VR9B 2V36A 3W5UB 2DZJA 2JXXA 1V1OA 4PS7A 1Q10A 1FOUA 2KNBA 1SIFA 3OWEB 2LXCA 4A6QA 4MGIE 3VDZA 1HK1A 4HGKA 5TR5A 4IW1A 3GA9L 1HQRD 1TKEA 1C79A 1NBFC 3N9YC 1EF5A 2CHZA 4LB9A 3RT3B 1GG3A 3DVNU 3V6CB 4IG7B 5H92C 5HFYA 2X38A 2L8JA 4WURA 2FUHB 5EE0A 5J17A 2CKXA 2AQ1B 3C8YA 2EFDA 4G01A 2FIDA 2KDIA 1V5TA 1BT0A 3ZJTA 2KLGA 2WS3B 1IGDA 4G50A 4L23A 4LTUA 4C80A 3AB5A 1TS3A 2QM6A 2AYOB 2A5UA 4N9F4 3EHVA 1IJGA 1UWXA 3EECA 5E6NA 2N4FA 1XLNA 2BXPA 4O1NA 3QWZB 4KDIC 4GDKB 4GGQA 3V09A 3RFZB 4C31B 3ZTCA 2MLBA 1E8WA 3QIJA 3ONSA 4GB9A 2KXJA 3J9CA 2I1KA 2L52A 4MM3B 2VUFA 4M70B 1F0ZA 2FBWB 2LASA 1TKYA 1NENB 1DOIA 2KQSA 3QARA 5BMGA 2QIEB 1SE9A 1FM0D 1E7UA 1YMHE 3R2TA 4G11A 2LVQA 3L13A 1LOTA 1SSNA 3SFEB 2RGFA 1WXMA 2ZEQA 3PS6A 2DLBA 2C9WB 4NAWA 4KZCA 4FJVB 2KX3A 4I6LB 2G9HD 3NMUA 1SE3A 1YJIA 2WLBA 2OT3A 3L54A 3RD2A 2L3ZA 3FILA 1KJTA 1UD7A 1ENFA 4N6EB 1P7EA 1KH0A 1E90A 4JWSC 2DYOA 1MPEA 2R2QA 3Q3JA 4IW2A 4ICVA 1MHHE 4RGOS 3LJ3A 2REXA 2BXMA 2ZNVB 2QILA 4Z69A 3HK0A 3HIZA 1ET9A 3A9JA 4CHKA 2BXFA 2BB6A 2L1AA 2BF8B 3SHQA 3AI5A 4BKGA 4M8NA 4R3DA 4WQOB 2Z8LA 1L2NA 2RPVA 1WYWB 1NT2B 4HWIB 2VZKB 1N5UA 4F5UA 2LHEA 4WWMA 3H7PB 5C2TB 3HUIA 2I1JA 1J78A 1WGRA 3LU7A 1TKGA 3CWIA 1J7CA 2I30A 1OEYA 4JPSA 1EO6A 4EOYA 3EA6A 1EM7A 4RF1A 1FO4A 4P6VF 1XEEA 3ZTDA 3ZDTA 2J0KA 3AU4A 1MIVA 4BFRA 1T5XD 1L4ZB 4W4UB 1JMLA 2EMSA 1N5XA 3K9OB 2NTSA 1IBXB 3K9PB 3L16A 2DENB 2KDMA 1WRDB 2XK5B 3NVWA 2E0XA 4W9DA 2ONQA 5JH5C 1A5RA 3AE5B 4N59A 4PO0A 4ZBKA 4W9EA 1RYJA 1FFVA 1K50A 3UIPB 2LMCA 2RDGA 2Y5BB 1VDVA 2ZCCA 1N63A 2ASQA 2D07B 2BXEA 1TTNA 2RDHA 3BVZA 4IWOA 2KJ6A 3ZNID 2BW2A 2CJOA 1FNWA 4W9IA 4KIKA 2CJNA 1QOGA 1GNIA 1E5WA 3A4RA 3VH4B 1C77A 4P7IA 2JY6A 1NEKB 2GI9A 2MJ3A 3KYCD 1UNSA 3DBSA 4DHXB 5IJFA 1QF6A 2N1VA 4DHJD 3HRDD 2BTEA 5LLIA 2PKOA 1OQQA 3PV1A 1TY2A 1WZ0A 2BXHA 2HJ8A 3TL5A 3BVGA 1NYQA 4W9JA 1RWSA 3V61A 4IDIA 4FADA 2WXPA 4OVVA 1NDDA 5G55A 3R8BA 1QZEA 1ISNA 3EFUA 4KV2A 1SXTA 1E7HA 2BKRB 1JWAD 1XO3A 2LGXA 2WXLA 1HK4A 3KJLA 2W3SA 4K81A 2O2VB 4HPLB 2NBWB 2R2OA 3NVKA 2DZMA 3NVVA 2FAZA 3DCGA 1L0XB 3BK1A 4YSXB 2BWFA 3R3MA 4ZBQA 1HZ6A 1WE7A 2KO3A 3AN1A 3W1SC 1PYWD 3L17A 3AEFB 1KFYB 4GDLA 4ZYNA 5HKHA 4RGTA 2W3RA 1MI0A 2G4SA 2OZBB 1BXTA 4BBNC 1TS2A 2L83A 2FCNA 1WGKA 3AE4B 4NAWB 4J6IA 1WSPA 4E99A 1SF0A 3AH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IM2 A;  4HPM B;  2VRR B;  3APD A;  2M0X A;  4NJ6 A;  4AWJ A;  4ICU A;  2HE7 A;  4MGY E;  2LI5 A;  1WX9 A;  5IA7 A;  4FJZ A;  1XQQ A;  2AL3 A;  4JGH B;  4FBJ B;  1LXD A;  3MTN B;  4KZ0 A;  3TJP A;  3ZNG C;  2UWQ A;  4TKN A;  1R4N I;  4RM9 A;  4K7U A;  3M95 A;  2A4Z A;  2ZVO A;  3V60 A;  2WWZ A;  3QAQ A;  4WJO A;  3JSV B;  3QA8 A;  2LRU A;  3QX1 A;  3NOB A;  2N9E B;  4PYZ A;  4MEM A;  1S3S G;  3JVZ X;  3A33 B;  3TCA A;  1ZKH A;  3H1U A;  4KSL C;  2DYB A;  3BY4 B;  2ZVN A;  2BKF A;  4CYE A;  3KW5 B;  3OLM D;  4MJS A;  4A20 A;  2KX0 A;  1WY8 A;  3CST A;  3ZLZ A;  1WI0 A;  2IYD B;  3DVN V;  4M0W B;  2KJH B;  1VD2 A;  2N9X A;  1J0G A;  2LUE A;  1UH6 A;  3S2A A;  3W1Y A;  1KLV A;  5DPT A;  4HCP B;  4W9G A;  2O2V A;  5G2N A;  1E7V A;  2G4D B;  5EDS A;  1WGG A;  1YIW A;  4JQW C;  2LGD A;  1V9J A;  5L95 C;  1V86 A;  2ZPN A;  3H7P A;  5C23 A;  1VCB A;  3DPD A;  3UIN B;  4B9K A;  3UQA A;  1RLF A;  3TBL D;  2GBR A;  3U30 A;  3VH3 B;  1V5O A;  1WJ4 A;  2JRH A;  3APF A;  3IFW B;  2C7M B;  2W9N A;  4GSW A;  2IO0 B;  5DPR A;  4B6W A;  4DK5 A;  4ZRI A;  4KSK C;  3TIX A;  1Q1O A;  1WMH B;  3P2B A;  4XX5 A;  4URK A;  3CSF A;  5FR6 A;  4MSQ B;  4HCN B;  2MBE A;  3DBR I;  2KFK A;  3SD5 A;  3ZW3 A;  2NPT A;  2MCN B;  1WJN A;  4TQ0 A;  1I42 A;  1WIA A;  4E3C A;  2KWV B;  3V6E B;  2IBI B;  2KMA A;  2K6D B;  2KAN A;  3DVG Y;  2JZ3 B;  2WYQ A;  3A9K A;  3M3J A;  4W9F A;  3ECI A;  5CHV C;  4HDO A;  4BKS A;  2L7R A;  1NI2 A;  2OOB B;  3WAL A;  3VXW A;  4M8M A;  4G3X B;  1RRB A;  1WGH A;  2MW5 A;  1XT9 B;  1TBE A;  1UEL A;  4GN1 A;  5BO4 B;  3UF8 A;  3WIM A;  3ZO5 B;  3EC8 A;  2DAF A;  5C1Z A;  2K8B A;  3NZU A;  3B0A A;  2KWC A;  2MP2 A;  5DPW A;  2KMC A;  3AXC A;  3L10 B;  1P1A A;  3PRP B;  2GBM A;  4AJW A;  2NR2 A;  4IM0 A;  2QHO A;  4NJ7 A;  3JSV A;  3ENE A;  1C1Y B;  3H7S A;  3N30 A;  2CS4 A;  3RZF A;  4YL8 A;  2O6V B;  4LDT D;  4EZL A;  1WGD A;  3NHE B;  4HLE A;  2DAJ A;  2IO3 B;  4MH0 E;  4II2 B;  1GC7 A;  4HJK A;  3MHS D;  2N7E A;  3M62 B;  1J8C A;  1EF1 A;  1V6E A;  1WE6 A;  2DZJ A;  1YD8 U;  3OAW A;  2JXX A;  2LRW A;  4PS7 A;  2HTH A;  2KNB A;  3BIN A;  1SIF A;  4AJY B;  4EKU A;  3ALB A;  4BVU C;  2LXC A;  2D2Q A;  3VFK A;  4ZRJ A;  1WZ3 A;  4FA6 A;  2KKC A;  3PT2 B;  4MGI E;  3TMP B;  1V81 A;  3VDZ A;  2PEA A;  5TR5 A;  4LJO B;  1P9D U;  4F1S A;  2KK8 A;  2CHW A;  1NBF C;  3ZIM A;  1EF5 A;  4IWP A;  2CHZ A;  4HK2 A;  5DPS A;  3RT3 B;  3VVW B;  1GG3 A;  5D94 A;  3DVN U;  4FLH A;  3A4S C;  3V6C B;  4IG7 B;  1OTR B;  2KFJ A;  2L8J A;  3PGE A;  2DYM A;  2ZCB A;  2FUH B;  5J17 A;  3O65 B;  2JPH A;  2M17 A;  3PHX B;  3N32 A;  5JZE B;  2FID A;  2KDI A;  1V5T A;  2M8S A;  2CU1 A;  3DOW A;  1XD3 B;  4ANX A;  4IC7 B;  4PYU A;  1OEY J;  1BT0 A;  2KLG A;  4G50 A;  2K8H A;  4MGZ E;  2MBH A;  2IY0 B;  2KTR B;  3U7D A;  3NY5 A;  4G0N B;  2N9P C;  2DX5 B;  2AYO B;  4HXD A;  2A5U A;  4AP4 C;  4N9F 4;  4BOZ B;  4GXB A;  4BKS D;  3EHV A;  3H6N A;  2B3A A;  4DBG A;  1AAR A;  1UZX B;  2Z59 B;  4ASW C;  3EEC A;  2GBJ A;  2YLM A;  4B95 A;  5E6N A;  3JW0 X;  2CKH B;  2JRI B;  4FN2 A;  1GNU A;  3UGB B;  2N4F A;  1FXT B;  4HVB A;  2MQJ A;  2FNJ B;  3PRE A;  4WWO A;  2KC1 A;  2BYV E;  3QWZ B;  4GDK B;  4KDI C;  4WJP A;  4GGQ A;  4A3P A;  2KZR A;  1K8R B;  3DBH I;  1OQY A;  2K39 A;  4WWP A;  2NVU I;  1MG8 A;  2RPQ A;  3A9J B;  3ZTC A;  2MLB A;  2EMT A;  2AL6 A;  3VUW A;  1IPG A;  1E8W A;  5AZF A;  3QIJ A;  3MJW A;  3ONS A;  5CHF A;  1RFA A;  4GB9 A;  2KXJ A;  1RAX A;  2I1K A;  5AEK B;  5L83 A;  2JZZ A;  3PSE B;  1KM7 A;  2N1W A;  4ZRK A;  4DDI D;  2LAS A;  1Z2M A;  3X23 A;  1IP9 A;  4HDQ A;  5E6P A;  1D3Z A;  2WDT B;  1WXS A;  2C5L C;  2KQS A;  4RM8 A;  3QAR A;  2BWE S;  2JUO A;  4OVU A;  1SE9 A;  3ZNH B;  4K7W A;  4AOF A;  1E7U A;  4I6P A;  3V62 A;  4MGK E;  1E8Y A;  1P3Q U;  3GOE A;  4G11 A;  3VUY A;  2LVQ A;  3L13 A;  1WM3 A;  4TUU A;  5D2M B;  2KDF B;  2MSE D;  2RGF A;  1WXM A;  1GJZ A;  2ZEQ A;  3PS6 A;  2C9W B;  2NBU A;  3R7R A;  5CX3 A;  4NAW A;  2DHZ A;  3LDZ E;  4KZC A;  4FJV B;  2KX3 A;  4RMA A;  1WF9 A;  4I6L B;  3A1Q B;  5GMV A;  1UGM A;  2PJH A;  2LWP A;  3WAP A;  4DHJ B;  1WFY A;  2BGF A;  4NPN A;  2LVO A;  1WM2 A;  3L54 A;  3RZW C;  3RD2 A;  2L3Z A;  1ZGU B;  3ZVV A;  1KJT A;  3L08 A;  1V80 A;  1UD7 A;  2YVC A;  5D6J B;  1E8Z A;  2EKE C;  3QC8 B;  1E90 A;  4K1R B;  2DYO A;  2R2Q A;  3Q3J A;  4NY0 A;  2FIF A;  4ICV A;  3LJ3 A;  4LCD E;  2L00 B;  1H4R A;  5CHW A;  4GDK A;  2NCN A;  4XC2 A;  2REX A;  2K25 A;  2J7Q B;  2ZNV B;  2RD0 A;  2LD9 A;  2PPH A;  1Y8R C;  3C0R B;  2DZI A;  3HK0 A;  2G3Q B;  2KVR A;  3HIZ A;  2KTF A;  2O6V D;  1Z5S B;  4GIV A;  3A9J A;  4CHK A;  2FCS A;  4BBN F;  3NZS A;  4PS8 A;  4EZK A;  2KC2 A;  2BF8 B;  3VTU A;  3HHM A;  3SHQ A;  3AI5 A;  4BKG A;  4MM3 A;  2MBQ A;  1P98 A;  4M8N A;  4WQO B;  2LXA A;  4JIO U;  2FCM A;  4KVG B;  4W9C A;  1L2N A;  1WR6 E;  2K1F A;  2ZZP B;  1WYW B;  3R66 C;  3T8M A;  4HWI B;  3AUL A;  3QK0 A;  1ZW7 A;  2L05 A;  2HD5 B;  4ANU A;  2OJR A;  4DDG D;  1C3T A;  3HM6 X;  5DCN A;  3H7P B;  2M1M A;  3IHP C;  2N7D A;  3ML9 A;  4FHK A;  1V2Y A;  2D11 A;  4K7S A;  4KIK B;  2I1J A;  1Q5W B;  4BOS C;  2XEW A;  1WMH A;  1WGR A;  3UIO B;  3WAN A;  3PZD A;  1OEY A;  1J19 A;  1EO6 A;  3VAW A;  2JWZ A;  2C60 A;  3VQI A;  4EOY A;  3KYD D;  1S1Q B;  2MBB B;  2JVC A;  5KHQ A;  4CO7 A;  3QHT A;  5KHO A;  2XBB C;  1GUA B;  4JL9 A;  2LGY A;  4IWQ A;  3WA0 A;  3ZTD A;  3ZDT A;  3ZRF A;  2J0K A;  2GMI C;  1WX8 A;  3AU4 A;  3GZN I;  4BFR A;  4A3O A;  1LQB A;  1TZ1 A;  2NS5 A;  3AU5 A;  4GU2 A;  2C7N B;  3JYU A;  4IM3 A;  3A9K B;  4EFO A;  1WXA A;  3DBL I;  2G45 B;  4W9L A;  3ZNZ B;  2EMS A;  3IVF A;  3K9O B;  3K9P B;  3VHT C;  3L16 A;  2DEN B;  2JF5 A;  3RYT A;  4E71 A;  1WR1 A;  2KD0 A;  3VTW A;  4DHZ B;  2L76 A;  4ZDV A;  2RSU A;  1WRD B;  2KDE B;  2XK5 B;  1PQS A;  5E6O A;  2O6V A;  1LM8 B;  2MP2 B;  4W9D A;  5JH5 C;  1A5R A;  5LXH A;  2MWS B;  2KLC A;  1X1M A;  4XZ4 A;  2L0F A;  2Z0D B;  2AEH A;  1WX7 A;  1T0Y A;  3WAO A;  2KHW B;  4W9E A;  1YJ1 A;  4MEL A;  5LXI B;  4FHJ A;  3NS8 A;  4AUQ C;  4IUM B;  3CF6 E;  2L0T A;  2GBK A;  1WXV A;  2CHX A;  3OJ3 A;  3UIP B;  2Y5B B;  2M4N A;  4II3 B;  1LFD A;  3X0W A;  2ZCC A;  4X57 B;  2ZJD A;  2ASQ A;  2D07 B;  3DDC B;  4W9K A;  3PLV A;  2D10 A;  1TTN A;  1G6J A;  2MRP A;  3T9L A;  2RR9 A;  1F9J A;  3U8Z A;  4IWO A;  3W1S A;  2KJ6 A;  3ZNI D;  3QQ8 B;  4NNJ B;  4I6N B;  2WX1 A;  4IW0 A;  2LJ5 A;  4W9I A;  4KIK A;  2K8C A;  1KOT A;  1H8C A;  2MA9 B;  4GDL B;  3D32 A;  4WJQ A;  3N3K B;  3KUC B;  1E5W A;  3A4R A;  3VH4 B;  3VTV A;  3B1L X;  1WJ6 A;  4P7I A;  4W9H A;  1V49 A;  2KTR A;  4F8C B;  2JY6 A;  3HM3 A;  3RUI B;  1UBI A;  1UBQ A;  2BYE A;  2AWT A;  3KYC D;  1EUV B;  3DBS A;  4BKT A;  5J2R A;  3I3T B;  4F7Z A;  1YX6 B;  2N1V A;  2PE9 A;  4DHJ D;  4NQK E;  5LLI A;  3KUZ A;  3PVL A;  5AZH A;  2CR5 A;  3PHW B;  3PV1 A;  3ZDM C;  1U4A A;  1WZ0 A;  2HJ8 A;  1E8X A;  2IY1 B;  3TL5 A;  3M63 B;  2IZV B;  4NQL B;  4W9J A;  1GC6 A;  2V3S A;  3KVF B;  3PRM B;  3R7Q A;  3V61 A;  3ML8 A;  1L7Y A;  4FAD A;  3UQB A;  4OVV A;  2DZK A;  1NDD A;  5JHA A;  4DHZ E;  2V4L A;  4KDL B;  2XK5 A;  5G55 A;  4DWF A;  3WAM A;  2C7H A;  4FUL A;  1QZE A;  4LDT B;  1ISN A;  3EFU A;  2KQ7 A;  3APC A;  4KV2 A;  5D7G A;  2BKR B;  2IO1 B;  1WH3 A;  1WGY A;  2LGX A;  4LJP B;  2ZNV C;  2BPS A;  3H9D A;  1CMX B;  4FJY A;  2MBO A;  4MJS B;  4PS3 A;  2K6Q A;  3PLU A;  3QCA A;  1R4M I;  2WX0 A;  2GBN A;  3KUD B;  3Q3F A;  4K81 A;  3SDL C;  1YX5 B;  2IO2 B;  2O2V B;  4HPL B;  3IBE A;  2FCQ A;  5AZG A;  4ANV A;  3RUL A;  1TGZ B;  2NBW B;  1P0R A;  2R2O A;  1HE8 A;  1JRU A;  2DZM A;  2FAZ A;  1OGW A;  2GOW A;  2J0J A;  3CMM B;  2ZPY A;  3QJZ A;  4EZJ A;  1YQB A;  3DCG A;  3DQV A;  4GOC A;  3ZKJ C;  3PPA A;  3PRZ A;  2BWF A;  2J0M A;  3R3M A;  2KN5 A;  4JLC A;  5J18 A;  4MDK E;  1WE7 A;  4TQ1 A;  2MX2 A;  3SU8 X;  2KJR A;  4MSM B;  1IYF A;  3PTF C;  2KO3 A;  1SGH A;  3W1S C;  4EEW A;  2V1Y A;  3L17 A;  2JT4 B;  3IG3 A;  3KH0 A;  2D3G A;  1M94 A;  4EUT A;  3DVG X;  3A1Q A;  4GDL A;  4ZYN A;  3ZUN A;  5HKH A;  5CTR C;  3VUX A;  2KDB A;  2G4S A;  2LZ6 A;  4E74 A;  4WAA A;  4BBN C;  2Z0E B;  2FCN A;  2KFK B;  4ANW A;  4WJN A;  2NPT B;  1I35 A;  3L0W B;  2KWU B;  2UYZ B;  3OJ4 B;  2NBV B;  4GMV A;  4NAW B;  4DXA B;  5JHB A;  2LVP A;  4J6I A;  1WJU A;  4TV3 A;  3RCZ A;  3ZRC A;  1Q0W B;  2BYF A;  2PE6 B;  2KOX A;  5IAA C;  3B08 A;  4WWN A; 
#chains in the Genus database with same CATH topology
 4AWJ A;  4ICU A;  4MGY E;  3U4E G;  1I4G A;  3MTN B;  3N1Z C;  3ZNG C;  3M95 A;  1FRR A;  3V60 A;  4L8U A;  2H88 B;  2LRU A;  5IIH A;  3QX1 A;  4A8X C;  1OQR A;  1ZKH A;  3H1U A;  2LXS A;  2D3B A;  4MJS A;  5DBY A;  4A55 A;  2XVW A;  5T8I A;  1SE2 A;  4ZBR A;  1E7V A;  4YSZ B;  2G4D B;  2XNA C;  5HHD G;  2LGI A;  1ROE A;  2PVG C;  3V05 A;  4L2Y A;  1JNB A;  2GBR A;  3UIV A;  3APF A;  3MP9 A;  2C7M B;  3RNF C;  2HTM E;  4HRO A;  5DPR A;  1PFD A;  4KSK C;  4FXC A;  1Q1O A;  3P2B A;  3CSF A;  1QOB A;  2KFK A;  3ZW3 A;  3W9C B;  3VRA B;  4YXD B;  4E3C A;  2KMA A;  1JW9 D;  3DVG Y;  3A9K A;  3M3J A;  3SIU B;  2L7R A;  1NI2 A;  3MHZ A;  4IKG A;  1RRB A;  1WGH A;  2MW5 A;  2NQO A;  2BS4 B;  3I9V 1;  4GN1 A;  2IJ0 A;  3V03 A;  3EC8 A;  4ZCG A;  3B0A A;  2KWC A;  5DPW A;  3AMZ A;  2NR2 A;  4IM0 A;  3SFD B;  3GQX A;  3CIR B;  4G03 A;  2QHO A;  3N30 A;  2QJL A;  4EZL A;  4LA0 A;  1VFI A;  1WGD A;  4Q2J A;  3NHE B;  4MH0 E;  1T6B X;  4OHJ A;  2X8X X;  3MHS D;  1XLQ A;  1I4H A;  4P16 A;  3M62 B;  1R4N B;  5FK9 C;  2VH1 A;  2INP E;  4M0W A;  4EKU A;  3VFK A;  4ZRJ A;  1WZ3 A;  2BX8 A;  2KKC A;  3TMP B;  4GLS C;  1V81 A;  2PEA A;  3BII D;  2R61 A;  3ETR A;  1FIQ A;  4F1S A;  4RCO A;  1TIF A;  4HK2 A;  5DPS A;  5C3J B;  4FLH A;  3P4P B;  1DYQ A;  1JRP A;  1OTR B;  4ZYS A;  3L4P A;  1ET6 A;  2YDF A;  2L32 A;  3E9S A;  1FD6 A;  3WCQ A;  2M8S A;  4LUH A;  1XD3 B;  3PZ8 A;  1VRA B;  3AE7 B;  3GP7 A;  2K8H A;  4MGZ E;  4DXG A;  2KQ4 X;  4G0N B;  4HXD A;  3BK2 A;  3P42 A;  1ZXI A;  3NG0 A;  1AAR A;  1UZX B;  2Z59 B;  3Q14 C;  1MUS A;  2GBJ A;  3JW0 X;  3OG5 A;  1FXT B;  2DWQ A;  3DBR B;  5GHK A;  1J7E A;  3PRE A;  4HEA 1;  4LNO A;  4A3P A;  5JXV A;  5GIP A;  1K8R B;  2RDB C;  2LUM A;  1N6Z A;  3EGR A;  4WWP A;  1MG8 A;  3M99 C;  3VUW A;  2AL6 A;  1FCL A;  4JWU C;  3AE8 B;  2KAJ A;  4YSY B;  1HK3 A;  3AEA B;  4C7Z A;  3H3A A;  1K52 A;  3RNB C;  2N1W A;  4OW0 A;  4ZRK A;  4DDI D;  3B9J A;  4HDQ A;  1I4P A;  1D3Z A;  2WDT B;  2C5L C;  4C00 A;  2ROH A;  2JUO A;  1DOY A;  3ZNH B;  3MC0 B;  4C7Y A;  4I6P A;  3V62 A;  4MGK E;  3GOE A;  1B9R A;  3SQJ A;  3VUY A;  2JYT A;  4QAY A;  4TUU A;  3ICX A;  1T0S C;  1BKE A;  3R7R A;  1QQR A;  1WF9 A;  2DBU A;  5GMV A;  1KLU D;  1B1Z A;  3KWV A;  1JAL A;  1WFY A;  1E6E B;  2LVO A;  2BXA A;  3TDL A;  3NVI A;  1E7C A;  2BXO A;  1AW7 A;  1E8Z A;  2EKE C;  3E56 A;  4OT2 A;  4K1R B;  2N9K A;  3ZGZ A;  1LO5 D;  1H4R A;  2NCN A;  3ZYY X;  2OHF A;  2J7Q B;  2LD9 A;  3P4R B;  2D3A A;  2PPH A;  1Y8R C;  2G3Q B;  2KTF A;  4GIV A;  2PMV A;  1PGA A;  4EZK A;  2KC2 A;  3EUB 2;  2MBQ A;  1KF6 B;  2FCM A;  2XVV A;  1N60 A;  2ZZP B;  1C9F A;  3R66 C;  1ZW7 A;  4ANU A;  1C3T A;  2QHB A;  3NVY A;  3C19 A;  4MT5 A;  2M1M A;  2N7D A;  1Q5W B;  2SAK A;  4BOS C;  5IO9 A;  3UIO B;  2WXR A;  4M02 A;  1J19 A;  3VAW A;  2JWZ A;  5IJE A;  4CO7 A;  1AWD A;  3WA0 A;  1JCK B;  3ZRF A;  1V8C A;  2GMI C;  4US8 A;  2NS5 A;  4US9 A;  2LHD A;  4IM3 A;  3A9K B;  2WXG A;  1L0V B;  3IVF A;  1JWS D;  2IGD A;  1YQ3 B;  2GB1 A;  4TSS A;  1GNJ A;  3RNE C;  1MA9 A;  4DXF A;  2LOQ A;  4OTU A;  2XSI A;  1PQS A;  2INN E;  1LM8 B;  2JWU A;  3N1Y C;  3ZXV A;  2KLC A;  4XZ4 A;  2L0F A;  4ARI A;  2Z0D B;  4LNI A;  1DOX A;  1AO6 A;  3WAO A;  1HXY D;  2KHW B;  4MEL A;  5LXI B;  5HI1 A;  3NS8 A;  4AUQ C;  4IUM B;  2L0T A;  2GBK A;  1WXV A;  2CHX A;  2BXQ A;  1LFD A;  3T3O A;  4X57 B;  2WP9 B;  2PTL A;  2D10 A;  3PLV A;  2XW1 A;  1VZ8 A;  3T9L A;  3U8Z A;  3W1S A;  1UGJ A;  4I6N B;  1RFK A;  2LJ5 A;  2K8C A;  1KOT A;  1JWU D;  3D32 A;  3W2D A;  2EFC A;  3VTV A;  3B1L X;  1WJ6 A;  1SJE D;  1V49 A;  2KTR A;  4N0F D;  4LB2 A;  2V3N A;  1UBQ A;  1JWB D;  2AWT A;  1EUV B;  1HEZ E;  4LNK A;  4C4V B;  1YOV B;  4HJG E;  3I3T B;  3KQ4 A;  4P1C C;  2PE9 A;  5AZH A;  3U7Z A;  4JE3 B;  3DHG C;  2CR5 A;  1U4A A;  2IND C;  4UDU C;  1E8X A;  2IY1 B;  3M63 B;  4NQL B;  3RNC C;  2V3S A;  3KVF B;  3R7Q A;  1JWM D;  3UQB A;  1MIW A;  4DHZ E;  3MC9 A;  4FUL A;  4LK0 M;  3GZN B;  1E9M A;  3APC A;  5D7G A;  5G5G A;  3DBL B;  2E0Y A;  2ZNV C;  2BPS A;  2WXJ A;  3NS1 A;  4PS3 A;  1HK5 A;  2JSV X;  5B5T A;  3KUD B;  3Q3F A;  2GBN A;  2IO2 B;  3IBE A;  4J2V A;  5AZG A;  4ANV A;  3RUL A;  4XDD A;  2J0J A;  4EZJ A;  1YQB A;  1JQ4 A;  1SB3 C;  3IAS 1;  4RGN A;  4GOC A;  1KRH A;  2J0M A;  3R2I A;  5J18 A;  4MDK E;  4TQ1 A;  1L5P A;  1SGH A;  4NJC A;  2JT4 B;  5HOZ A;  1E7E A;  3DVG X;  2PW9 A;  3FWB C;  3VUX A;  4FIP B;  4E74 A;  5IP4 D;  4ANW A;  2NPT B;  4GMV A;  3PZ7 A;  2LVP A;  1TXU A;  4YT0 B;  2KOX A;  4ZRP A;  5IAA C;  2V9H A;  3U52 E;  4WWN A;  4IM2 A;  2VRR B;  1TS5 A;  3U2S C;  4JGH B;  3LB8 C;  1EWC A;  1GAQ B;  1V1P A;  3Q8F A;  1R4N I;  4RM9 A;  4OZC A;  4N0U D;  3KWL A;  2ZVO A;  4WJO A;  2WXQ A;  3JSV B;  3QA8 A;  3NOB A;  2QMT A;  1S3S G;  1TY0 A;  4OZB A;  3A33 B;  3NZ3 A;  1E10 A;  4KSL C;  2ZVN A;  4CYE A;  3OLM D;  4A20 A;  1YN4 A;  4F5V A;  3Q3O C;  1WI0 A;  3A75 A;  2IYD B;  2XN9 C;  2KJH B;  1VD2 A;  2N9X A;  2LUE A;  1UH6 A;  1F2R I;  1KLV A;  5DPT A;  4HCP B;  5G2N A;  1WGG A;  1L6V A;  2LGD A;  4B0E A;  1V9J A;  1GOZ A;  4RF0 A;  3DPD A;  4LLG M;  4B9K A;  3Q3M C;  4S17 A;  3VH3 B;  2JRH A;  2V4I B;  2W9N A;  1R4M B;  2W55 A;  4DK5 A;  4XWT A;  5IKC M;  4XX5 A;  4MSQ B;  2MBE A;  3DBR I;  2KWD A;  2MCN B;  4BY9 C;  1WJN A;  1I42 A;  1WIA A;  2KWV B;  2WYQ A;  4W9F A;  3NUH B;  2TSS A;  3ECI A;  4KKJ A;  4BKS A;  2OOB B;  3LYY A;  4G3X B;  2MJD A;  1KLG D;  5E6J A;  4G04 A;  2BBC A;  3P1M A;  5IIU A;  5BO4 B;  3BWU D;  2EEL A;  1V97 A;  2MP2 A;  1TYG B;  1HA5 A;  2KMC A;  3GB1 A;  4HGM B;  1E7G A;  3AXC A;  3PRP B;  1P1A A;  2GBM A;  3RNG C;  2JQR B;  2GUT A;  4NJ7 A;  2E3T A;  3ENE A;  2CS4 A;  4KGR A;  4YL8 A;  3MC8 A;  4LDT D;  2IDY A;  4HLE A;  2DAJ A;  2EKI A;  4II2 B;  3AV8 A;  2N7E A;  1J8C A;  1CQV A;  1WE6 A;  2JU6 X;  1QIL A;  1YD8 U;  3P63 A;  3OAW A;  1H9Z A;  3UI3 A;  4PT5 A;  2HTH A;  1A70 A;  3BIN A;  4AJY B;  3ALB A;  2KAC A;  4FA6 A;  1ZE3 D;  1HK2 A;  2I2Z A;  4AS1 A;  2KK8 A;  2CHW A;  1HTQ A;  4REZ A;  5D94 A;  4K71 A;  1XXG A;  3IT6 B;  2DYM A;  2ZCB A;  3O65 B;  2JPH A;  2LQI A;  3PHX B;  1CZP A;  3N32 A;  5JZE B;  5FUO A;  2CU1 A;  3DOW A;  4ANX A;  4IC7 B;  1UWM A;  2IY0 B;  2KTR B;  2DBW A;  1K53 A;  1VZ7 A;  4OZA A;  2BXB A;  2DX5 B;  2IGH A;  4BOZ B;  2KN4 A;  3FIL B;  4GXB A;  4BKS D;  2B3A A;  4DBG A;  2D5G A;  4ASW C;  2WXN A;  2M0A A;  2KBZ A;  4HVB A;  2FNJ B;  2DBX A;  1FNV A;  4WWO A;  2BYV E;  1QOA A;  4OR0 A;  1ZXH A;  2GLS A;  2KZR A;  1N62 A;  1QT9 A;  1ZPS A;  2KWF A;  3SEB A;  2K39 A;  4OVZ A;  4MAC A;  3A9J B;  1IPG A;  5AZF A;  5MPO A;  5CHF A;  1RFA A;  5GIN A;  1RAX A;  5L83 A;  3FNM A;  3PSE B;  1KM7 A;  2WDV B;  1Z2M A;  3X23 A;  5E6P A;  5FKA C;  3VRB B;  4RM8 A;  4NAM A;  2BWE S;  3SIV B;  4OVU A;  4K7W A;  4AOF A;  2WU2 B;  1GPX A;  1P3Q U;  2Z8J A;  1NVI D;  1VJK A;  2WQY B;  5D2M B;  2MSE D;  2DNF A;  2I38 A;  1KW2 A;  5CX3 A;  2DHZ A;  3LDZ E;  1FEH A;  2PJH A;  2JUH A;  4KGT A;  1L4D B;  2LWP A;  3WAP A;  4DHJ B;  2BGF A;  1WM2 A;  1M4V A;  3ZVV A;  1E7A A;  3L08 A;  1V80 A;  4DM0 A;  1VR9 A;  5D6J B;  3QC8 B;  3DHH C;  1D5M C;  4NY0 A;  4ZOH C;  3AE6 B;  2FIF A;  2L00 B;  2JX5 A;  4GDK A;  3G9K D;  4F5S A;  2NTT A;  2RD0 A;  3C0R B;  2AQ2 B;  2O6V D;  2K0P A;  2V0G A;  4BBN F;  3NZS A;  3TSS A;  3I63 C;  3RN9 C;  4MM3 A;  3ZJU A;  1P98 A;  2LXA A;  4KVG B;  4W9C A;  3IXS A;  1P7F A;  5BMH A;  1WR6 E;  3DBH B;  3AUL A;  3QK0 A;  4DDG D;  2ON8 A;  2HD5 B;  4ARC A;  3HM6 X;  5DCN A;  3BYY B;  1FNU A;  4FHK A;  3IHP C;  3ML9 A;  1V2Y A;  2D11 A;  4K7S A;  4KIK B;  1WMH A;  5FR3 A;  3NVZ A;  1MVK A;  2LEK A;  3N20 C;  1F2R C;  2C60 A;  3VQI A;  3GE8 C;  4K3C A;  3KYD D;  1S1Q B;  2MBB B;  1C4P A;  5KHQ A;  4H2A A;  1E0Z A;  3Q2A C;  4XWW A;  2KT7 A;  3QHT A;  5KHO A;  3GQU A;  3V08 A;  3AEC B;  1XCQ L;  2LGY A;  4IWQ A;  1MUH A;  1WX8 A;  3VR8 B;  2KVZ A;  3GZN I;  4A3O A;  4GU2 A;  1J7A A;  3AU5 A;  4XGA B;  4FJC B;  2MEK A;  3DBL I;  1HA2 A;  3ZNZ B;  5LNK 1;  3B2G A;  1DGJ A;  3VHT C;  4E71 A;  1WR1 A;  2KD0 A;  4ZDV A;  2RSU A;  2KDE B;  1MM8 A;  5E6O A;  2MP2 B;  4HRS A;  3TUO A;  5LXH A;  5BYQ A;  1D4B A;  1TJE A;  2JZP A;  2BVC A;  3AED B;  2AEH A;  1WX7 A;  4FHJ A;  1T0Q C;  2BXC A;  2J53 A;  5IJ5 A;  1ACC A;  3SR6 A;  1TF0 A;  2M4N A;  2LXT A;  1O9X A;  4II3 B;  2ZJD A;  1TZO A;  1G6J A;  3JQZ A;  1D6E C;  1F9J A;  2M19 A;  4NNJ B;  3JRY A;  3Q69 A;  1YN5 A;  5G5H A;  3PO0 A;  3FKY A;  2WGS A;  4GDL B;  4WJQ A;  1C76 A;  2ACZ B;  2WU5 B;  3KUC B;  2INC C;  4W9H A;  2K0N A;  1KXP D;  3HM3 A;  2XVU A;  3RUI B;  2H89 B;  3Q8A A;  1C78 A;  5J2R A;  4F7Z A;  2MJE A;  1YX6 B;  2PLP A;  4YTP B;  4DQO C;  4KX6 B;  2PVO D;  4NQK E;  3KUZ A;  3PVL A;  3IT4 B;  1K51 A;  2IZV B;  1IBX A;  3PRM B;  1L7Y A;  5ID7 A;  3Q3N C;  2N0S B;  5D3D A;  2Q5W D;  2XK5 A;  3BVM A;  1IGC A;  1PDX A;  4L9Q A;  3FC4 A;  2IO1 B;  1WGY A;  3BPJ A;  3MHS B;  2MBO A;  4MJS B;  3P4Q B;  5H8Y E;  1UF0 A;  3PLU A;  3QCA A;  1LNS A;  1R4M I;  1NI3 A;  2CU3 A;  2FCQ A;  1HE8 A;  3QJZ A;  3CX9 A;  1OGW A;  4ACF A;  2ZPY A;  1H5W A;  1XLO A;  3ZKJ C;  2OJW A;  5D3I B;  3WHR A;  1F52 A;  2KN5 A;  2VZK D;  1EWY C;  3SU8 X;  2MX2 A;  2KJR A;  1IYF A;  2J42 A;  3W5V B;  4EEW A;  2V1Y A;  1F77 A;  4J3O D;  4EUT A;  4LUF A;  3A1Q A;  2KDB A;  4HKZ E;  2LZ6 A;  2G1E A;  2KFK B;  1MIY A;  4WJN A;  1PGX A;  3L0W B;  2KWU B;  3OJ4 B;  2NBV B;  1N5W A;  4DXA B;  5JHB A;  1WJU A;  4TV3 A;  3RCZ A;  3ZRC A;  4Z9O A;  1Q0W B;  4HPP A;  2WDQ B;  2DBY A;  2VUE A;  1L6U A;  4NJ6 A;  5IA7 A;  1WX9 A;  1XLP A;  4FJZ A;  4FBJ B;  4KZ0 A;  2UWQ A;  2WWZ A;  1FPY A;  5I4D A;  3QAQ A;  4ZRQ A;  3WHQ A;  4PYZ A;  4MEM A;  3JVZ X;  3TCA A;  2DYB A;  3Q6B A;  4WA6 B;  2Z8I A;  2KX0 A;  2I2Y A;  5TSS A;  4AQ7 A;  2Y5C A;  3B9M A;  4M0W B;  1JRO A;  1J0G A;  3S2A A;  3W1Y A;  4W9G A;  2O2V A;  1YIW A;  4MH8 A;  5L95 C;  5C23 A;  4OTT A;  2BXK A;  3KIK A;  3UIN B;  3UQA A;  3TBL D;  1I7H A;  3U30 A;  1WJ4 A;  2K3U A;  2SEB D;  2IO0 B;  4ZRI A;  3TIX A;  2LQH A;  1WMH B;  4N3Z A;  1ZDX A;  4M01 A;  2AGH B;  3AE9 B;  1D5X C;  5GIO A;  2RMM A;  2JZ3 B;  2VH2 A;  4HDO A;  3WAL A;  1UUP A;  4M8M A;  3HVD A;  1T3Q A;  3Q8B A;  3TEW A;  2PIA A;  3I5J C;  1KTK A;  1TBE A;  5IIX A;  1UEL A;  4XE0 A;  3ZO5 B;  5C1Z A;  2K8B A;  2WXO A;  1BM0 A;  2E6X A;  2WHI A;  4KKI A;  4AJW A;  1IUE A;  2LFI A;  1MHX A;  4P1B C;  3A73 A;  3H7S A;  3B9L A;  2IO3 B;  4HJK A;  2BS2 B;  1EF1 A;  1V6E A;  2WXI A;  3GE3 C;  2LRW A;  3MJ5 A;  5EE3 A;  4ZHP A;  4BVU C;  2QDF A;  4WIP A;  2D2Q A;  4ZHO A;  3PT2 B;  1SJH D;  2N7J A;  3FWC C;  1I4X A;  3KLS X;  4LJO B;  1P9D U;  4RH6 A;  3ZIM A;  2KMM A;  2NNW A;  2B76 B;  2Y3A A;  4IWP A;  3VVW B;  1F1H A;  1E78 A;  3AEE B;  2J52 A;  2EFH A;  3A4S C;  2WXF A;  1D5Z C;  2KFJ A;  2VDB A;  2XVQ A;  3PGE A;  4YWG G;  2M17 A;  1ZDV A;  4IOI E;  1E7P B;  4L1B A;  4PYU A;  1OEY J;  3BZD B;  2MBH A;  3U7D A;  4ZC6 A;  1N61 A;  3NY5 A;  2ZW1 A;  2N9P C;  4BZA A;  4YTN B;  1L0Y B;  4AP4 C;  2Y5P A;  2ZW0 A;  2JYE A;  3H6N A;  4N58 A;  2YLM A;  3DWG C;  4B95 A;  5GXG B;  2CKH B;  5IFO A;  2JRI B;  1GNU A;  4FN2 A;  3UGB B;  3TEX A;  2MQJ A;  5BPK A;  2KC1 A;  3P4S B;  3BYT B;  2XMO A;  2WXM A;  4WJP A;  2V3P A;  4EMX A;  1Y56 A;  3DBH I;  1OQY A;  1CK1 A;  5EE1 A;  1BUI C;  2NVU I;  2NMQ A;  2RPQ A;  1VLB A;  2EMT A;  1ZUD 2;  2GRI A;  1SBB B;  3MJW A;  1QOF A;  2WNM A;  3RI7 C;  5AEK B;  2ICI A;  2JZZ A;  1C4A A;  1PUT A;  1IP9 A;  2MHJ A;  4EE2 A;  1YN3 A;  3RMK C;  2DG5 A;  1WXS A;  2W54 A;  1TS4 A;  1SEB D;  3NVM A;  3AE3 B;  5EE9 A;  3HVZ A;  1SB0 A;  1C4C A;  1E8Y A;  3H37 A;  1WM3 A;  2UU7 A;  4S1Y A;  2KDF B;  3FAH A;  4YTM B;  5BYR A;  1GJZ A;  2BXD A;  4ITK A;  2NBU A;  3TEZ A;  4XYC A;  4RMA A;  3A1Q B;  1AYF A;  2BXG A;  1UGM A;  1TT5 B;  2M56 B;  4NPN A;  5AUI A;  1QKZ A;  4A9A A;  3RZW C;  1ZGU B;  1E7B A;  2YVC A;  1T0R C;  3AE2 B;  4LCD E;  2BXN A;  5CHW A;  5ID9 A;  2AQ3 B;  2OED A;  1FFU A;  4XC2 A;  2K25 A;  2BXL A;  2DZI A;  2KVR A;  2WXH A;  3AM9 A;  1GB1 A;  1Z5S B;  2FCS A;  4PS8 A;  1YNT E;  2JXT A;  3VTU A;  2W82 A;  3HHM A;  4JIO U;  1R7S A;  5DQF A;  4WH4 A;  1FCC C;  2K1F A;  3T8M A;  2L05 A;  2OJR A;  1I4R A;  3LXF A;  1HZ5 A;  1PGB A;  3AEB B;  2XEW A;  3WAN A;  2AJE A;  3PZD A;  3Q8E A;  2BB5 A;  2LJI A;  2MH7 A;  2JVC A;  1FMA D;  1SE4 A;  1BML C;  2XBB C;  1GUA B;  4JL9 A;  3LU8 A;  4USA A;  4ZUX V;  1LQB A;  1TZ1 A;  3URY A;  2C7N B;  3JYU A;  4EFO A;  4K2C A;  1WXA A;  3T3N A;  1QLB B;  2G45 B;  4W9L A;  4XDC A;  2JF5 A;  3RYT A;  3VTW A;  4DHZ B;  2L76 A;  1CJE A;  2O6V A;  3WHS A;  1STE A;  2MWS B;  1X1M A;  1ZOY B;  1T0Y A;  1YJ1 A;  3CF6 E;  2QSD A;  2Z8K A;  3OJ3 A;  4GDX A;  4TMA B;  3X0W A;  3V3X A;  2IGG A;  4RFB A;  3LU6 A;  3DDC B;  3MHH B;  4W9K A;  2MRP A;  2RR9 A;  4RGM A;  3QQ8 B;  4IW0 A;  2WX1 A;  1YQ4 B;  4B0M A;  1VZS A;  1H8C A;  2MA9 B;  1XF5 L;  2XW0 A;  1WYG A;  3N3K B;  4F5T A;  4F8C B;  1UBI A;  2BYE A;  1I4Q A;  1ZP0 B;  3Q8C A;  3PLA A;  3PHW B;  3ZDM C;  2BXI A;  2YEP B;  1V1P B;  5AUK A;  1GC6 A;  3ML8 A;  1WRI A;  3GS2 A;  5BYS A;  2K5P A;  2QMC A;  2DZK A;  5JHA A;  2V4L A;  4L9K A;  4KDL B;  4DWF A;  3WAM A;  2C7H A;  4C56 C;  4LDT B;  2KQ7 A;  4KGS A;  3IAM 1;  1WXQ A;  1WH3 A;  1BJ5 A;  4LJP B;  3H9D A;  1CMX B;  4FJY A;  2BYT A;  2K6Q A;  2WXK A;  1E7I A;  3I57 A;  2QEJ C;  2WX0 A;  3SDL C;  1YX5 B;  1OFF A;  2WDR B;  1TGZ B;  1P0R A;  3O13 A;  3CMM B;  1JRU A;  4A90 A;  4BKT A;  2N9L A;  2GOW A;  1MG4 A;  3DQV A;  4MBE C;  3N1X C;  3PPA A;  3PRZ A;  4GG2 A;  4D2K A;  2HDE A;  4JLC A;  4MSM B;  3PTF C;  3AE1 B;  3ZQ4 A;  3KH0 A;  3IG3 A;  2D3G A;  1M94 A;  5BMI A;  4BKE A;  3ZUN A;  4FK5 B;  3TEY A;  5CTR C;  3H8H A;  4WAA A;  4CQN A;  2Z0E B;  1I35 A;  2UYZ B;  3B2F A;  2BYF A;  2PE6 B;  1ESF A;  2BQQ A;  4C4V A;  2IPK D;  3B08 A;  3ABV B;  4HPM B;  3APD A;  2M0X A;  1VZ6 A;  2HE7 A;  2LI5 A;  2EFE A;  1FXI A;  4RNA A;  1XQQ A;  2AL3 A;  1LXD A;  3TJP A;  1WWT A;  4TKN A;  1SIJ A;  4HKQ A;  4K7U A;  2A4Z A;  4JK4 A;  2FUG 1;  5HG2 A;  2N9E B;  2QC8 A;  1RM6 C;  3BY4 B;  3RPF C;  2BKF A;  2FE8 A;  3KW5 B;  1WY8 A;  3CST A;  4WAF A;  3ZLZ A;  4NZL B;  3DVN V;  5EDS A;  4JQW C;  1EU4 A;  1V86 A;  2ZPN A;  3H7P A;  1VCB A;  2YEP F;  2K9X A;  4LNF A;  1RLF A;  1V5O A;  3IFW B;  3AEG B;  4GSW A;  2J4X A;  1XCT L;  3DWM A;  1NYR A;  4B6W A;  1FRD A;  3NRZ A;  1AN8 A;  2BS3 B;  4URK A;  1MJD A;  5FR6 A;  4HCN B;  3ECP A;  3SD5 A;  2NPT A;  2K22 A;  4TQ0 A;  1FXA A;  3V6E B;  2IBI B;  3MFG A;  2K6D B;  2KAN A;  2QCZ A;  5CHV C;  1EU3 A;  4WQM A;  3VXW A;  1GB4 A;  1UOR A;  1XT9 B;  3UF8 A;  3WIM A;  2DAF A;  2HJ1 A;  3NZU A;  3L10 B;  4JX1 C;  2BT6 A;  2AX5 A;  3JSV A;  1C1Y B;  3RZF A;  3ZJV A;  2O6V B;  1J7B A;  1E7F A;  1GC7 A;  1YJJ A;  3VR9 B;  3EFC A;  2V36 A;  3W5U B;  2DZJ A;  2JXX A;  1V1O A;  4PS7 A;  1Q10 A;  1FOU A;  2KNB A;  1SIF A;  3OWE B;  2LXC A;  4A6Q A;  4MGI E;  1LGR A;  3VDZ A;  1HK1 A;  4HGK A;  5TR5 A;  4IW1 A;  3GA9 L;  1HQR D;  1TKE A;  1C79 A;  1NBF C;  3N9Y C;  1EF5 A;  2CHZ A;  4LB9 A;  3RT3 B;  1GG3 A;  3DVN U;  3V6C B;  4IG7 B;  5H92 C;  5HFY A;  2X38 A;  2L8J A;  4WUR A;  2FUH B;  5EE0 A;  5J17 A;  2CKX A;  4M00 A;  2AQ1 B;  3C8Y A;  2EFD A;  4G01 A;  2FID A;  2KDI A;  1V5T A;  1BT0 A;  3ZJT A;  2KLG A;  2WS3 B;  1IGD A;  4G50 A;  4L23 A;  4LTU A;  4C80 A;  3AB5 A;  1TS3 A;  2QM6 A;  2AYO B;  2A5U A;  4N9F 4;  4BAX A;  3EHV A;  1IJG A;  1UWX A;  3EEC A;  5E6N A;  2N4F A;  1KDX A;  1XLN A;  2BXP A;  4O1N A;  3QWZ B;  4KDI C;  4GDK B;  4GGQ A;  3V09 A;  3RFZ B;  4C31 B;  3ZTC A;  2MLB A;  1E8W A;  3QIJ A;  3ONS A;  4GB9 A;  2KXJ A;  1HTO A;  3J9C A;  2I1K A;  2L52 A;  4MM3 B;  2VUF A;  4M70 B;  1F0Z A;  2FBW B;  2LAS A;  1MFW A;  4S0R A;  1TKY A;  1NEN B;  1DOI A;  2KQS A;  3QAR A;  5BMG A;  2QIE B;  1SE9 A;  1FM0 D;  1E7U A;  1YMH E;  3R2T A;  4G11 A;  2LVQ A;  3L13 A;  1LOT A;  1SSN A;  3SFE B;  2RGF A;  1WXM A;  2ZEQ A;  2DLB A;  3PS6 A;  2C9W B;  4NAW A;  4KZC A;  4FJV B;  2KX3 A;  2G9H D;  4I6L B;  3NMU A;  1SE3 A;  1YJI A;  2WLB A;  2OT3 A;  3L54 A;  3RD2 A;  2L3Z A;  3FIL A;  1KJT A;  4PK1 A;  1ENF A;  1UD7 A;  4N6E B;  1P7E A;  1KH0 A;  1E90 A;  4JWS C;  2DYO A;  1MPE A;  2R2Q A;  3Q3J A;  4IW2 A;  1MHH E;  4ICV A;  4RGO S;  3LJ3 A;  2REX A;  2BXM A;  2ZNV B;  2QIL A;  4Z69 A;  3HK0 A;  3HIZ A;  1ET9 A;  3A9J A;  4CHK A;  2BXF A;  4I9O A;  2BB6 A;  2L1A A;  2BF8 B;  3SHQ A;  3AI5 A;  4BKG A;  4M8N A;  4R3D A;  4WQO B;  2Z8L A;  1L2N A;  2RPV A;  1WYW B;  1NT2 B;  4HWI B;  2VZK B;  1N5U A;  4F5U A;  2LHE A;  2KYW A;  4WWM A;  3H7P B;  5C2T B;  3HUI A;  2I1J A;  1J78 A;  1WGR A;  3LU7 A;  1TKG A;  3CWI A;  1J7C A;  2I30 A;  1OEY A;  4JPS A;  1EO6 A;  4EOY A;  3EA6 A;  1EM7 A;  3DHI C;  4RF1 A;  1FO4 A;  4LNN A;  4P6V F;  1XEE A;  3ZTD A;  3ZDT A;  2J0K A;  3AU4 A;  1MIV A;  4BFR A;  1T5X D;  1L4Z B;  4W4U B;  1JML A;  1N5X A;  2EMS A;  3K9O B;  2NTS A;  1IBX B;  3K9P B;  3L16 A;  2DEN B;  2KDM A;  1WRD B;  2XK5 B;  3NVW A;  2E0X A;  4W9D A;  2ONQ A;  5JH5 C;  1A5R A;  3AE5 B;  4N59 A;  4PO0 A;  2D3C A;  4ZBK A;  4W9E A;  1RYJ A;  4D7X A;  1FFV A;  1K50 A;  2LMC A;  3UIP B;  2RDG A;  2Y5B B;  1VDV A;  2ZCC A;  1N63 A;  2ASQ A;  2D07 B;  3ZXR A;  2BXE A;  1TTN A;  2RDH A;  3BVZ A;  4IWO A;  2KJ6 A;  3ZNI D;  2BW2 A;  2CJO A;  1FNW A;  4W9I A;  4KIK A;  2CJN A;  1QOG A;  1GNI A;  1E5W A;  3A4R A;  3VH4 B;  1C77 A;  4P7I A;  2JY6 A;  1NEK B;  2GI9 A;  5IOI A;  2MJ3 A;  3KYC D;  1UNS A;  3DBS A;  4DHX B;  5IJF A;  1QF6 A;  2N1V A;  3HRD D;  4DHJ D;  2BTE A;  5LLI A;  2PKO A;  1OQQ A;  3PV1 A;  1TY2 A;  1WZ0 A;  2BXH A;  2HJ8 A;  3BVG A;  3TL5 A;  5IN7 A;  1NYQ A;  1RWS A;  4W9J A;  4IDI A;  3V61 A;  4FAD A;  2LGS A;  2WXP A;  4OVV A;  1NDD A;  5G55 A;  3R8B A;  1QZE A;  1ISN A;  3EFU A;  3NJT A;  4KV2 A;  1SXT A;  1E7H A;  2BKR B;  1JWA D;  1XO3 A;  2LGX A;  2WXL A;  1HK4 A;  3KJL A;  2W3S A;  4K81 A;  2O2V B;  4HPL B;  2NBW B;  2R2O A;  3NVK A;  2DZM A;  3NVV A;  2FAZ A;  3DCG A;  1L0X B;  3BK1 A;  4YSX B;  2BWF A;  3R3M A;  4ZBQ A;  1HZ6 A;  4K3B A;  1WE7 A;  2KO3 A;  3AN1 A;  3W1S C;  1PYW D;  3L17 A;  3AEF B;  1KFY B;  4GDL A;  4ZYN A;  5HKH A;  4RGT A;  2W3R A;  1MI0 A;  2G4S A;  2OZB B;  1BXT A;  4BBN C;  1TS2 A;  2L83 A;  1WGK A;  2FCN A;  3AE4 B;  4NAW B;  4J6I A;  1WSP A;  4E99 A;  1SF0 A;  3AH7 A;  3RNA C; 
#chains in the Genus database with same CATH homology
 4AWJ A;  4ICU A;  4MGY E;  3U4E G;  1I4G A;  3MTN B;  3ZNG C;  3M95 A;  3V60 A;  1FRR A;  4L8U A;  2H88 B;  2LRU A;  5IIH A;  3QX1 A;  4A8X C;  1OQR A;  1ZKH A;  3H1U A;  4MJS A;  5DBY A;  4A55 A;  2XVW A;  5T8I A;  1SE2 A;  4ZBR A;  1E7V A;  4YSZ B;  2G4D B;  2XNA C;  5HHD G;  2LGI A;  1ROE A;  2PVG C;  3V05 A;  4L2Y A;  1JNB A;  2GBR A;  3UIV A;  3APF A;  3MP9 A;  2C7M B;  2HTM E;  4HRO A;  5DPR A;  1PFD A;  4KSK C;  4FXC A;  1Q1O A;  3P2B A;  3CSF A;  1QOB A;  2KFK A;  3ZW3 A;  3W9C B;  3VRA B;  4YXD B;  4E3C A;  2KMA A;  1JW9 D;  3DVG Y;  3A9K A;  3M3J A;  3SIU B;  2L7R A;  1NI2 A;  3MHZ A;  4IKG A;  1RRB A;  1WGH A;  2MW5 A;  2NQO A;  2BS4 B;  4GN1 A;  3I9V 1;  2IJ0 A;  3V03 A;  3EC8 A;  4ZCG A;  3B0A A;  2KWC A;  5DPW A;  3AMZ A;  2NR2 A;  4IM0 A;  3SFD B;  3GQX A;  3CIR B;  4G03 A;  2QHO A;  3N30 A;  2QJL A;  4EZL A;  4LA0 A;  1VFI A;  1WGD A;  4Q2J A;  3NHE B;  4MH0 E;  1T6B X;  4OHJ A;  3MHS D;  1XLQ A;  1I4H A;  4P16 A;  3M62 B;  5FK9 C;  2INP E;  4M0W A;  4EKU A;  3VFK A;  4ZRJ A;  1WZ3 A;  2BX8 A;  2KKC A;  3TMP B;  4GLS C;  1V81 A;  2PEA A;  3BII D;  2R61 A;  3ETR A;  1FIQ A;  4F1S A;  4RCO A;  4HK2 A;  5DPS A;  5C3J B;  4FLH A;  3P4P B;  1DYQ A;  1JRP A;  1OTR B;  4ZYS A;  3L4P A;  1ET6 A;  2YDF A;  2L32 A;  3E9S A;  1FD6 A;  3WCQ A;  2M8S A;  4LUH A;  1XD3 B;  3PZ8 A;  1VRA B;  3AE7 B;  3GP7 A;  2K8H A;  4MGZ E;  4DXG A;  2KQ4 X;  4G0N B;  4HXD A;  3BK2 A;  3P42 A;  1ZXI A;  1AAR A;  1UZX B;  2Z59 B;  2GBJ A;  3JW0 X;  1FXT B;  2DWQ A;  5GHK A;  1J7E A;  3PRE A;  4HEA 1;  4A3P A;  5JXV A;  5GIP A;  1K8R B;  2LUM A;  3EGR A;  4WWP A;  1MG8 A;  3M99 C;  3VUW A;  2AL6 A;  1FCL A;  4JWU C;  3AE8 B;  2KAJ A;  4YSY B;  1HK3 A;  3AEA B;  4C7Z A;  3H3A A;  1K52 A;  2N1W A;  4ZRK A;  4DDI D;  4OW0 A;  3B9J A;  4HDQ A;  1I4P A;  1D3Z A;  2WDT B;  2C5L C;  2ROH A;  2JUO A;  1DOY A;  3ZNH B;  3MC0 B;  4C7Y A;  4I6P A;  3V62 A;  4MGK E;  3GOE A;  1B9R A;  3SQJ A;  3VUY A;  2JYT A;  4TUU A;  3ICX A;  1BKE A;  3R7R A;  1QQR A;  1WF9 A;  2DBU A;  5GMV A;  1KLU D;  1B1Z A;  3KWV A;  1JAL A;  1WFY A;  1E6E B;  2LVO A;  2BXA A;  3TDL A;  3NVI A;  1E7C A;  2BXO A;  1AW7 A;  1E8Z A;  2EKE C;  3E56 A;  4OT2 A;  4K1R B;  2N9K A;  3ZGZ A;  1LO5 D;  1H4R A;  2NCN A;  3ZYY X;  2OHF A;  2J7Q B;  2LD9 A;  3P4R B;  2PPH A;  1Y8R C;  2G3Q B;  2KTF A;  4GIV A;  2PMV A;  1PGA A;  4EZK A;  2KC2 A;  3EUB 2;  2MBQ A;  1KF6 B;  2FCM A;  2XVV A;  1N60 A;  2ZZP B;  1C9F A;  3R66 C;  1ZW7 A;  4ANU A;  1C3T A;  2QHB A;  3NVY A;  4MT5 A;  2M1M A;  2N7D A;  1Q5W B;  4BOS C;  2SAK A;  3UIO B;  2WXR A;  1J19 A;  3VAW A;  2JWZ A;  5IJE A;  4CO7 A;  1AWD A;  3WA0 A;  1JCK B;  3ZRF A;  1V8C A;  2GMI C;  4US8 A;  2NS5 A;  4US9 A;  2LHD A;  4IM3 A;  3A9K B;  2WXG A;  1L0V B;  3IVF A;  1JWS D;  2IGD A;  1YQ3 B;  2GB1 A;  4TSS A;  1GNJ A;  1MA9 A;  4DXF A;  2LOQ A;  4OTU A;  2XSI A;  1PQS A;  2INN E;  1LM8 B;  2JWU A;  2KLC A;  4XZ4 A;  2L0F A;  4ARI A;  2Z0D B;  1DOX A;  1AO6 A;  3WAO A;  2KHW B;  1HXY D;  4MEL A;  5LXI B;  5HI1 A;  3NS8 A;  4AUQ C;  4IUM B;  2L0T A;  2GBK A;  1WXV A;  2CHX A;  2BXQ A;  1LFD A;  3T3O A;  4X57 B;  2WP9 B;  3PLV A;  2D10 A;  2PTL A;  2XW1 A;  3T9L A;  1VZ8 A;  3U8Z A;  3W1S A;  1UGJ A;  4I6N B;  1RFK A;  2LJ5 A;  2K8C A;  1KOT A;  1JWU D;  3D32 A;  3W2D A;  2EFC A;  3VTV A;  3B1L X;  1WJ6 A;  1V49 A;  1SJE D;  2KTR A;  4N0F D;  4LB2 A;  2V3N A;  1UBQ A;  1JWB D;  2AWT A;  1EUV B;  1HEZ E;  4HJG E;  3I3T B;  3KQ4 A;  2PE9 A;  5AZH A;  3U7Z A;  4JE3 B;  2CR5 A;  1U4A A;  4UDU C;  1E8X A;  2IY1 B;  3M63 B;  4NQL B;  2V3S A;  3KVF B;  3R7Q A;  1JWM D;  3UQB A;  1MIW A;  4DHZ E;  4FUL A;  4LK0 M;  3APC A;  1E9M A;  5D7G A;  5G5G A;  2E0Y A;  2ZNV C;  2BPS A;  2WXJ A;  3NS1 A;  4PS3 A;  1HK5 A;  2JSV X;  5B5T A;  3KUD B;  3Q3F A;  2GBN A;  2IO2 B;  3IBE A;  4J2V A;  5AZG A;  4ANV A;  3RUL A;  4XDD A;  2J0J A;  4EZJ A;  1YQB A;  1JQ4 A;  1SB3 C;  3IAS 1;  4RGN A;  4GOC A;  1KRH A;  2J0M A;  3R2I A;  5J18 A;  4MDK E;  4TQ1 A;  1L5P A;  1SGH A;  4NJC A;  2JT4 B;  5HOZ A;  1E7E A;  3DVG X;  2PW9 A;  3FWB C;  3VUX A;  4FIP B;  4E74 A;  4ANW A;  2NPT B;  4GMV A;  3PZ7 A;  2LVP A;  1TXU A;  4YT0 B;  2KOX A;  4ZRP A;  5IAA C;  3U52 E;  4WWN A;  4IM2 A;  2VRR B;  1TS5 A;  3U2S C;  4JGH B;  3LB8 C;  1EWC A;  1GAQ B;  1V1P A;  3Q8F A;  1R4N I;  4RM9 A;  4OZC A;  4N0U D;  3KWL A;  2ZVO A;  4WJO A;  2WXQ A;  3JSV B;  3QA8 A;  3NOB A;  2QMT A;  1S3S G;  1TY0 A;  4OZB A;  3A33 B;  3NZ3 A;  1E10 A;  4KSL C;  2ZVN A;  4CYE A;  3OLM D;  4A20 A;  1YN4 A;  4F5V A;  1WI0 A;  3A75 A;  2IYD B;  2XN9 C;  2KJH B;  1VD2 A;  2N9X A;  2LUE A;  1UH6 A;  1KLV A;  1F2R I;  5DPT A;  4HCP B;  5G2N A;  1WGG A;  2LGD A;  1L6V A;  4B0E A;  1V9J A;  1GOZ A;  4RF0 A;  3DPD A;  4LLG M;  4B9K A;  3VH3 B;  2JRH A;  2V4I B;  2W9N A;  2W55 A;  4DK5 A;  4XWT A;  4XX5 A;  4MSQ B;  2MBE A;  3DBR I;  2KWD A;  2MCN B;  4BY9 C;  1WJN A;  1I42 A;  1WIA A;  2KWV B;  2WYQ A;  4W9F A;  3NUH B;  2TSS A;  3ECI A;  4KKJ A;  4BKS A;  2OOB B;  3LYY A;  4G3X B;  2MJD A;  1KLG D;  5E6J A;  4G04 A;  2BBC A;  3P1M A;  5IIU A;  5BO4 B;  3BWU D;  2EEL A;  1V97 A;  2MP2 A;  1TYG B;  1HA5 A;  2KMC A;  3GB1 A;  4HGM B;  1E7G A;  3AXC A;  3PRP B;  1P1A A;  2GBM A;  2JQR B;  4NJ7 A;  2E3T A;  3ENE A;  2CS4 A;  4KGR A;  4YL8 A;  4LDT D;  4HLE A;  2IDY A;  2DAJ A;  2EKI A;  4II2 B;  3AV8 A;  2N7E A;  1J8C A;  1WE6 A;  1CQV A;  2JU6 X;  1QIL A;  1YD8 U;  3OAW A;  3P63 A;  1H9Z A;  3UI3 A;  4PT5 A;  2HTH A;  1A70 A;  3BIN A;  4AJY B;  3ALB A;  2KAC A;  4FA6 A;  1ZE3 D;  1HK2 A;  2I2Z A;  4AS1 A;  2KK8 A;  2CHW A;  4REZ A;  5D94 A;  4K71 A;  1XXG A;  3IT6 B;  2DYM A;  2ZCB A;  3O65 B;  2JPH A;  3PHX B;  1CZP A;  3N32 A;  5JZE B;  5FUO A;  2CU1 A;  3DOW A;  4ANX A;  4IC7 B;  1UWM A;  2IY0 B;  2KTR B;  2DBW A;  1K53 A;  1VZ7 A;  4OZA A;  2BXB A;  2DX5 B;  2IGH A;  4BOZ B;  4GXB A;  2KN4 A;  3FIL B;  4BKS D;  2B3A A;  4DBG A;  2D5G A;  4ASW C;  2WXN A;  2M0A A;  2KBZ A;  4HVB A;  2FNJ B;  2DBX A;  1FNV A;  4WWO A;  2BYV E;  1QOA A;  4OR0 A;  2KZR A;  1ZXH A;  1N62 A;  1QT9 A;  1ZPS A;  3SEB A;  2K39 A;  4OVZ A;  4MAC A;  3A9J B;  1IPG A;  5AZF A;  5MPO A;  5CHF A;  1RFA A;  5GIN A;  1RAX A;  5L83 A;  3FNM A;  3PSE B;  1KM7 A;  2WDV B;  1Z2M A;  3X23 A;  5E6P A;  5FKA C;  3VRB B;  4RM8 A;  4NAM A;  2BWE S;  3SIV B;  4OVU A;  4K7W A;  4AOF A;  2WU2 B;  1GPX A;  1P3Q U;  2Z8J A;  1NVI D;  1VJK A;  2WQY B;  5D2M B;  2MSE D;  2I38 A;  1KW2 A;  5CX3 A;  2DHZ A;  3LDZ E;  1FEH A;  2PJH A;  2JUH A;  4KGT A;  2LWP A;  1L4D B;  3WAP A;  4DHJ B;  2BGF A;  1WM2 A;  1M4V A;  3ZVV A;  1E7A A;  3L08 A;  1V80 A;  1VR9 A;  5D6J B;  3QC8 B;  1D5M C;  4NY0 A;  4ZOH C;  3AE6 B;  2FIF A;  2L00 B;  2JX5 A;  4GDK A;  3G9K D;  4F5S A;  2NTT A;  2RD0 A;  3C0R B;  2AQ2 B;  2O6V D;  2K0P A;  2V0G A;  4BBN F;  3NZS A;  3TSS A;  4MM3 A;  3ZJU A;  1P98 A;  2LXA A;  4KVG B;  4W9C A;  3IXS A;  1P7F A;  5BMH A;  1WR6 E;  3AUL A;  3QK0 A;  4DDG D;  2ON8 A;  2HD5 B;  4ARC A;  3HM6 X;  5DCN A;  3BYY B;  1FNU A;  4FHK A;  3IHP C;  3ML9 A;  1V2Y A;  2D11 A;  4K7S A;  4KIK B;  1WMH A;  5FR3 A;  3NVZ A;  1MVK A;  2LEK A;  2C60 A;  1F2R C;  3VQI A;  3KYD D;  1S1Q B;  2MBB B;  1C4P A;  5KHQ A;  4H2A A;  1E0Z A;  4XWW A;  3QHT A;  5KHO A;  3GQU A;  3V08 A;  3AEC B;  1XCQ L;  2LGY A;  4IWQ A;  1WX8 A;  3VR8 B;  3GZN I;  4A3O A;  4GU2 A;  1J7A A;  3AU5 A;  4FJC B;  3DBL I;  2MEK A;  1HA2 A;  3ZNZ B;  5LNK 1;  3B2G A;  1DGJ A;  3VHT C;  4E71 A;  1WR1 A;  2KD0 A;  4ZDV A;  2RSU A;  2KDE B;  5E6O A;  2MP2 B;  4HRS A;  3TUO A;  5LXH A;  5BYQ A;  1D4B A;  1TJE A;  2JZP A;  3AED B;  2AEH A;  1WX7 A;  4FHJ A;  2BXC A;  2J53 A;  5IJ5 A;  1ACC A;  3SR6 A;  1TF0 A;  2M4N A;  4II3 B;  1O9X A;  2ZJD A;  1TZO A;  1G6J A;  3JQZ A;  1D6E C;  1F9J A;  2M19 A;  4NNJ B;  3JRY A;  3Q69 A;  1YN5 A;  5G5H A;  3PO0 A;  4GDL B;  4WJQ A;  1C76 A;  2ACZ B;  3KUC B;  2WU5 B;  4W9H A;  1KXP D;  3HM3 A;  2XVU A;  3RUI B;  2H89 B;  3Q8A A;  1C78 A;  5J2R A;  4F7Z A;  2MJE A;  1YX6 B;  2PLP A;  4YTP B;  4DQO C;  4KX6 B;  4NQK E;  2PVO D;  3KUZ A;  3PVL A;  3IT4 B;  1K51 A;  2IZV B;  1IBX A;  3PRM B;  1L7Y A;  5ID7 A;  2N0S B;  5D3D A;  2Q5W D;  2XK5 A;  3BVM A;  1IGC A;  1PDX A;  4L9Q A;  3FC4 A;  2IO1 B;  1WGY A;  3MHS B;  2MBO A;  4MJS B;  3P4Q B;  5H8Y E;  3PLU A;  3QCA A;  1LNS A;  1R4M I;  1NI3 A;  2CU3 A;  2FCQ A;  1HE8 A;  3QJZ A;  3CX9 A;  1OGW A;  2ZPY A;  1H5W A;  1XLO A;  3ZKJ C;  5D3I B;  3WHR A;  2KN5 A;  2VZK D;  1EWY C;  3SU8 X;  2MX2 A;  2KJR A;  1IYF A;  2J42 A;  3W5V B;  4EEW A;  2V1Y A;  1F77 A;  4J3O D;  4EUT A;  4LUF A;  3A1Q A;  2KDB A;  4HKZ E;  2LZ6 A;  2G1E A;  2KFK B;  1MIY A;  4WJN A;  1PGX A;  3L0W B;  2KWU B;  3OJ4 B;  2NBV B;  1N5W A;  4DXA B;  5JHB A;  1WJU A;  4TV3 A;  3RCZ A;  3ZRC A;  4Z9O A;  1Q0W B;  2WDQ B;  2DBY A;  2VUE A;  1L6U A;  4NJ6 A;  5IA7 A;  1WX9 A;  1XLP A;  4FJZ A;  4FBJ B;  4KZ0 A;  2UWQ A;  2WWZ A;  5I4D A;  3QAQ A;  4ZRQ A;  3WHQ A;  4PYZ A;  4MEM A;  3JVZ X;  3TCA A;  2DYB A;  4WA6 B;  2Z8I A;  2KX0 A;  2I2Y A;  5TSS A;  4AQ7 A;  2Y5C A;  3B9M A;  4M0W B;  1JRO A;  1J0G A;  3S2A A;  3W1Y A;  4W9G A;  2O2V A;  1YIW A;  4MH8 A;  5L95 C;  5C23 A;  4OTT A;  2BXK A;  3KIK A;  3UIN B;  3UQA A;  3TBL D;  1I7H A;  3U30 A;  1WJ4 A;  2K3U A;  2SEB D;  2IO0 B;  4ZRI A;  3TIX A;  1WMH B;  4N3Z A;  1ZDX A;  3AE9 B;  1D5X C;  5GIO A;  2RMM A;  2JZ3 B;  4HDO A;  3WAL A;  1UUP A;  4M8M A;  3HVD A;  1T3Q A;  3Q8B A;  3TEW A;  2PIA A;  1KTK A;  1TBE A;  5IIX A;  1UEL A;  3ZO5 B;  4XE0 A;  5C1Z A;  2K8B A;  2WXO A;  1BM0 A;  2E6X A;  4KKI A;  4AJW A;  1IUE A;  2LFI A;  1MHX A;  3A73 A;  3H7S A;  3B9L A;  2IO3 B;  4HJK A;  2BS2 B;  1EF1 A;  1V6E A;  2WXI A;  2LRW A;  3MJ5 A;  5EE3 A;  4ZHP A;  4BVU C;  4WIP A;  2D2Q A;  4ZHO A;  3PT2 B;  1SJH D;  2N7J A;  3FWC C;  1I4X A;  3KLS X;  4LJO B;  1P9D U;  4RH6 A;  3ZIM A;  2KMM A;  2NNW A;  4IWP A;  2B76 B;  2Y3A A;  3VVW B;  1E78 A;  3AEE B;  2J52 A;  2EFH A;  3A4S C;  2WXF A;  1D5Z C;  2KFJ A;  2VDB A;  2XVQ A;  3PGE A;  4YWG G;  2M17 A;  1ZDV A;  4IOI E;  1E7P B;  4L1B A;  4PYU A;  1OEY J;  3BZD B;  2MBH A;  3U7D A;  4ZC6 A;  1N61 A;  3NY5 A;  2ZW1 A;  2N9P C;  4YTN B;  1L0Y B;  4AP4 C;  2Y5P A;  2ZW0 A;  2JYE A;  3H6N A;  4N58 A;  2YLM A;  4B95 A;  3DWG C;  5GXG B;  2CKH B;  5IFO A;  2JRI B;  1GNU A;  4FN2 A;  3UGB B;  3TEX A;  2MQJ A;  5BPK A;  2KC1 A;  3P4S B;  3BYT B;  2XMO A;  2WXM A;  4WJP A;  2V3P A;  4EMX A;  1Y56 A;  3DBH I;  1OQY A;  1CK1 A;  5EE1 A;  1BUI C;  2NVU I;  2NMQ A;  2RPQ A;  1VLB A;  2EMT A;  1ZUD 2;  2GRI A;  1SBB B;  3MJW A;  1QOF A;  2WNM A;  5AEK B;  2JZZ A;  2ICI A;  1C4A A;  1IP9 A;  1PUT A;  4EE2 A;  1YN3 A;  2DG5 A;  1WXS A;  2W54 A;  1TS4 A;  1SEB D;  3NVM A;  3AE3 B;  5EE9 A;  3HVZ A;  1E8Y A;  1C4C A;  3H37 A;  1WM3 A;  4S1Y A;  2KDF B;  3FAH A;  4YTM B;  5BYR A;  1GJZ A;  2BXD A;  4ITK A;  2NBU A;  3TEZ A;  4RMA A;  3A1Q B;  1AYF A;  2BXG A;  1UGM A;  4NPN A;  2M56 B;  5AUI A;  1QKZ A;  4A9A A;  3RZW C;  1ZGU B;  1E7B A;  2YVC A;  3AE2 B;  4LCD E;  2BXN A;  5CHW A;  5ID9 A;  2AQ3 B;  2OED A;  4XC2 A;  1FFU A;  2K25 A;  2BXL A;  2DZI A;  2KVR A;  2WXH A;  3AM9 A;  1GB1 A;  1Z5S B;  2FCS A;  4PS8 A;  1YNT E;  2JXT A;  3VTU A;  3HHM A;  2W82 A;  4JIO U;  1R7S A;  5DQF A;  4WH4 A;  1FCC C;  2K1F A;  3T8M A;  2L05 A;  2OJR A;  1I4R A;  3LXF A;  1HZ5 A;  1PGB A;  3AEB B;  2XEW A;  3WAN A;  2AJE A;  3PZD A;  3Q8E A;  2BB5 A;  2LJI A;  2MH7 A;  2JVC A;  1FMA D;  1SE4 A;  1BML C;  2XBB C;  1GUA B;  4JL9 A;  3LU8 A;  4USA A;  4ZUX V;  1LQB A;  1TZ1 A;  3URY A;  2C7N B;  3JYU A;  4EFO A;  4K2C A;  1WXA A;  3T3N A;  2G45 B;  4W9L A;  1QLB B;  4XDC A;  2JF5 A;  3RYT A;  3VTW A;  4DHZ B;  2L76 A;  1CJE A;  2O6V A;  3WHS A;  2MWS B;  1STE A;  1X1M A;  1ZOY B;  1T0Y A;  1YJ1 A;  3CF6 E;  2QSD A;  2Z8K A;  3OJ3 A;  4GDX A;  4TMA B;  3X0W A;  3V3X A;  2IGG A;  4RFB A;  3LU6 A;  3DDC B;  3MHH B;  4W9K A;  2MRP A;  2RR9 A;  4RGM A;  3QQ8 B;  4IW0 A;  2WX1 A;  1YQ4 B;  4B0M A;  1VZS A;  1H8C A;  2MA9 B;  1XF5 L;  2XW0 A;  3N3K B;  1WYG A;  4F5T A;  4F8C B;  1UBI A;  2BYE A;  1I4Q A;  1ZP0 B;  3Q8C A;  3PLA A;  3PHW B;  3ZDM C;  2BXI A;  2YEP B;  1V1P B;  5AUK A;  1GC6 A;  3ML8 A;  1WRI A;  3GS2 A;  5BYS A;  2K5P A;  2QMC A;  2DZK A;  5JHA A;  2V4L A;  4L9K A;  4KDL B;  4DWF A;  3WAM A;  2C7H A;  4C56 C;  4LDT B;  2KQ7 A;  4KGS A;  3IAM 1;  1WXQ A;  1WH3 A;  1BJ5 A;  4LJP B;  3H9D A;  1CMX B;  4FJY A;  2BYT A;  2K6Q A;  2WXK A;  1E7I A;  3I57 A;  2QEJ C;  2WX0 A;  3SDL C;  1YX5 B;  1OFF A;  2WDR B;  1TGZ B;  1P0R A;  3O13 A;  4BKT A;  1JRU A;  3CMM B;  4A90 A;  2N9L A;  2GOW A;  3DQV A;  4MBE C;  3PPA A;  3PRZ A;  4GG2 A;  4D2K A;  2HDE A;  4JLC A;  4MSM B;  3PTF C;  3AE1 B;  3ZQ4 A;  3KH0 A;  3IG3 A;  2D3G A;  1M94 A;  5BMI A;  4BKE A;  3ZUN A;  4FK5 B;  3TEY A;  5CTR C;  3H8H A;  4WAA A;  4CQN A;  2Z0E B;  1I35 A;  2UYZ B;  3B2F A;  2BYF A;  2PE6 B;  1ESF A;  2IPK D;  3B08 A;  3ABV B;  4HPM B;  3APD A;  2M0X A;  1VZ6 A;  2HE7 A;  2LI5 A;  2EFE A;  1FXI A;  4RNA A;  1XQQ A;  2AL3 A;  1LXD A;  3TJP A;  1WWT A;  4TKN A;  1SIJ A;  4HKQ A;  4K7U A;  2A4Z A;  4JK4 A;  2FUG 1;  5HG2 A;  2N9E B;  1RM6 C;  3BY4 B;  3RPF C;  2BKF A;  2FE8 A;  3KW5 B;  1WY8 A;  3CST A;  3ZLZ A;  4WAF A;  4NZL B;  3DVN V;  5EDS A;  4JQW C;  1EU4 A;  1V86 A;  2ZPN A;  3H7P A;  1VCB A;  2YEP F;  2K9X A;  1RLF A;  1V5O A;  3IFW B;  3AEG B;  4GSW A;  2J4X A;  1XCT L;  3DWM A;  1NYR A;  4B6W A;  1FRD A;  3NRZ A;  1AN8 A;  2BS3 B;  4URK A;  5FR6 A;  4HCN B;  3SD5 A;  2NPT A;  2K22 A;  4TQ0 A;  1FXA A;  3V6E B;  2IBI B;  3MFG A;  2K6D B;  2KAN A;  5CHV C;  3VXW A;  1EU3 A;  4WQM A;  1GB4 A;  1UOR A;  1XT9 B;  3UF8 A;  3WIM A;  2DAF A;  3NZU A;  3L10 B;  4JX1 C;  2BT6 A;  2AX5 A;  3JSV A;  1C1Y B;  3RZF A;  3ZJV A;  2O6V B;  1J7B A;  1E7F A;  1GC7 A;  1YJJ A;  3VR9 B;  2V36 A;  3W5U B;  2DZJ A;  2JXX A;  1V1O A;  4PS7 A;  1Q10 A;  1FOU A;  2KNB A;  1SIF A;  3OWE B;  2LXC A;  4A6Q A;  4MGI E;  3VDZ A;  1HK1 A;  4HGK A;  5TR5 A;  4IW1 A;  3GA9 L;  1HQR D;  1TKE A;  1C79 A;  1NBF C;  3N9Y C;  1EF5 A;  2CHZ A;  4LB9 A;  3RT3 B;  1GG3 A;  3DVN U;  3V6C B;  4IG7 B;  5H92 C;  5HFY A;  2X38 A;  2L8J A;  4WUR A;  2FUH B;  5EE0 A;  5J17 A;  2CKX A;  2AQ1 B;  3C8Y A;  2EFD A;  4G01 A;  2FID A;  2KDI A;  1V5T A;  1BT0 A;  3ZJT A;  2KLG A;  2WS3 B;  1IGD A;  4G50 A;  4L23 A;  4LTU A;  4C80 A;  3AB5 A;  1TS3 A;  2QM6 A;  2AYO B;  2A5U A;  4N9F 4;  3EHV A;  1IJG A;  1UWX A;  3EEC A;  5E6N A;  2N4F A;  1XLN A;  2BXP A;  4O1N A;  3QWZ B;  4KDI C;  4GDK B;  4GGQ A;  3V09 A;  3RFZ B;  4C31 B;  3ZTC A;  2MLB A;  1E8W A;  3QIJ A;  3ONS A;  4GB9 A;  2KXJ A;  3J9C A;  2I1K A;  2L52 A;  4MM3 B;  2VUF A;  4M70 B;  1F0Z A;  2FBW B;  2LAS A;  1TKY A;  1NEN B;  1DOI A;  2KQS A;  3QAR A;  5BMG A;  2QIE B;  1SE9 A;  1FM0 D;  1E7U A;  1YMH E;  3R2T A;  4G11 A;  2LVQ A;  3L13 A;  1LOT A;  1SSN A;  3SFE B;  2RGF A;  1WXM A;  2ZEQ A;  3PS6 A;  2DLB A;  2C9W B;  4NAW A;  4KZC A;  4FJV B;  2KX3 A;  4I6L B;  2G9H D;  3NMU A;  1SE3 A;  1YJI A;  2WLB A;  2OT3 A;  3L54 A;  3RD2 A;  2L3Z A;  3FIL A;  1KJT A;  1UD7 A;  1ENF A;  4N6E B;  1P7E A;  1KH0 A;  1E90 A;  4JWS C;  2DYO A;  1MPE A;  2R2Q A;  3Q3J A;  4IW2 A;  4ICV A;  1MHH E;  4RGO S;  3LJ3 A;  2REX A;  2BXM A;  2ZNV B;  2QIL A;  4Z69 A;  3HK0 A;  3HIZ A;  1ET9 A;  3A9J A;  4CHK A;  2BXF A;  2BB6 A;  2L1A A;  2BF8 B;  3SHQ A;  3AI5 A;  4BKG A;  4M8N A;  4R3D A;  4WQO B;  2Z8L A;  1L2N A;  2RPV A;  1WYW B;  1NT2 B;  4HWI B;  2VZK B;  1N5U A;  4F5U A;  2LHE A;  4WWM A;  3H7P B;  5C2T B;  3HUI A;  2I1J A;  1J78 A;  1WGR A;  3LU7 A;  1TKG A;  3CWI A;  1J7C A;  2I30 A;  1OEY A;  4JPS A;  1EO6 A;  4EOY A;  3EA6 A;  1EM7 A;  4RF1 A;  1FO4 A;  4P6V F;  1XEE A;  3ZTD A;  3ZDT A;  2J0K A;  3AU4 A;  1MIV A;  4BFR A;  1T5X D;  1L4Z B;  4W4U B;  1JML A;  2EMS A;  1N5X A;  3K9O B;  2NTS A;  1IBX B;  3K9P B;  3L16 A;  2DEN B;  2KDM A;  1WRD B;  2XK5 B;  3NVW A;  2E0X A;  4W9D A;  2ONQ A;  5JH5 C;  1A5R A;  3AE5 B;  4N59 A;  4PO0 A;  4ZBK A;  4W9E A;  1RYJ A;  1FFV A;  1K50 A;  3UIP B;  2LMC A;  2RDG A;  2Y5B B;  1VDV A;  2ZCC A;  1N63 A;  2ASQ A;  2D07 B;  2BXE A;  1TTN A;  2RDH A;  3BVZ A;  4IWO A;  2KJ6 A;  3ZNI D;  2BW2 A;  2CJO A;  1FNW A;  4W9I A;  4KIK A;  2CJN A;  1QOG A;  1GNI A;  1E5W A;  3A4R A;  3VH4 B;  1C77 A;  4P7I A;  2JY6 A;  1NEK B;  2GI9 A;  2MJ3 A;  3KYC D;  1UNS A;  3DBS A;  4DHX B;  5IJF A;  1QF6 A;  2N1V A;  4DHJ D;  3HRD D;  2BTE A;  5LLI A;  2PKO A;  1OQQ A;  3PV1 A;  1TY2 A;  1WZ0 A;  2BXH A;  2HJ8 A;  3TL5 A;  3BVG A;  1NYQ A;  4W9J A;  1RWS A;  3V61 A;  4IDI A;  4FAD A;  2WXP A;  4OVV A;  1NDD A;  5G55 A;  3R8B A;  1QZE A;  1ISN A;  3EFU A;  4KV2 A;  1SXT A;  1E7H A;  2BKR B;  1JWA D;  1XO3 A;  2LGX A;  2WXL A;  1HK4 A;  3KJL A;  2W3S A;  4K81 A;  2O2V B;  4HPL B;  2NBW B;  2R2O A;  3NVK A;  2DZM A;  3NVV A;  2FAZ A;  3DCG A;  1L0X B;  3BK1 A;  4YSX B;  2BWF A;  3R3M A;  4ZBQ A;  1HZ6 A;  1WE7 A;  2KO3 A;  3AN1 A;  3W1S C;  1PYW D;  3L17 A;  3AEF B;  1KFY B;  4GDL A;  4ZYN A;  5HKH A;  4RGT A;  2W3R A;  1MI0 A;  2G4S A;  2OZB B;  1BXT A;  4BBN C;  1TS2 A;  2L83 A;  2FCN A;  1WGK A;  3AE4 B;  4NAW B;  4J6I A;  1WSP A;  4E99 A;  1SF0 A;  3AH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...