3VUTA

Crystal structures of non-phosphorylated map2k4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
247
structure length
203
Chain Sequence
QKQLLMDLDVVMRSSDCPYIVQFCMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 4
publication title Crystal and solution structures disclose a putative transient state of mitogen-activated protein kinase kinase 4
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 203
sequence length 247
chains with identical sequence B
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vutA02
3OWJA 2GNHA 3NNUA 3OBJA 4JQ7A 3U6IA 1WFCA 4YJRA 5M4FA 4BCHA 4LUDA 2OFUA 2G2IA 1OECA 4O2ZA 4QQTA 1LEZA 3FSKA 4G3GA 3EN5A 4Y73A 3SXFA 2XMYA 4I0TA 4EK5A 2B9IA 3L1SA 2XK4A 5FG8A 3ZLWA 2B53A 4USFA 3RNYA 4DEBA 4YJSA 2VTHA 4RX7A 4J96A 2X9EA 3FMHA 3PIZA 2HAKA 4H3QA 2WIHA 4FSQA 4IX5A 5EYDA 5EYKA 3VJOA 4Z7HA 4I6HA 3B8RA 4GYGA 4QMQA 2WPAA 4BDAA 1ZYDA 3IW8A 5IA3A 4DYMA 3A8WA 5CLPA 4IJ9A 3UMXA 4BYIA 2ZV2A 3FLQA 3OW4A 5CU6A 3KA0A 3L9PA 3PXKA 4QYHA 1V1KA 3CIKA 5AAGA 3MFUA 1LR4A 4QQJA 4UZHA 2BRGA 3LJ2A 4O91A 5IUHA 3FMMA 2C0OA 5E7RA 4ALVA 3VRZA 5CF4A 3HLLA 3CKWA 3TTIA 3LE6A 4F6WA 1FGIA 2ITTA 1PXJA 4FX3A 4R5YA 1YXSA 4OTPA 5AUVA 4TNDA 4O21A 3CY2A 4F7LA 3CQWA 1JKKA 1UU3A 4NUSA 4BF2A 4F9WA 2PHKA 1XBBA 1H01A 3P86A 3TWJA 3IGGA 4YTHA 2Z2WA 2XM9A 3DQXA 3QC4A 4BDKA 2UZTA 1YKRA 4IDTA 3ZU7A 4IIRA 3EQIA 4GT4A 4KIQA 1M2RA 5AP7A 5HCXA 2IW6A 1Q62A 1LUFA 3VS5A 3FZPA 1OPJA 3TV6A 1DAWA 5HICA 4BICA 3BKBA 1B39A 3EQFA 3KB7A 5H2UA 3V5QA 1TQMA 2ITOA 3KRRA 5HD7A 5ANKA 2C3LA 4ENYA 5TO8A 4NM5A 3D4QA 4ZJJA 4C62A 1OI9A 4XV3A 3K5UA 2ETKA 3CY3A 3U8WA 3VVHA 5BNJA 3NSZA 4HYIA 2VUWA 1QPJA 2Y4IC 4EK4A 1YWVA 3FMLA 4ZS0A 3SVVA 1M17A 4PTGA 5IA1A 4EOLA 4EH4A 4JIAA 3UNJA 3IS5A 2OBJA 1U59A 5D41A 2XP2A 3H9RA 5L3AA 1YOLA 4NTTA 2YIWA 4RLLA 3TEIA 1OKZA 3NUYA 1PW2A 5AP5A 3W10A 2JC6A 1JNKA 2ZJWA 3MJ2A 2W5HA 3Q6WA 5H3QA 5M51A 2GHGA 3GB2A 1OPLA 5FM2A 1UU7A 3I5ZA 2QU6A 2WD1A 5CENA 3SW4A 2ITYA 3HMPA 3R9HA 1M2PA 1YVJA 3NYVA 3A7GA 3LAUA 3ORMA 2W05A 4X21A 4DLJA 1WVYA 3P4KA 3CKXA 3OZ6A 4AGDA 3UP2A 3KFAA 3KULB 5JZJA 4KBAA 3UTOA 2YJRA 4XOZA 2BMCA 3A7FA 4FKJA 4B8MA 4FTQA 5EYMA 1YQJA 1CTPE 1RQQA 2CN8A 3QXPA 3MH1A 2YACA 5IH6A 2OJGA 4S32A 4IZ5A 1HCKA 1H0VA 1RJBA 2R3HA 5CWZA 4QPSA 3PVBA 3G90X 3R9DA 4OT5A 3RZBA 4D2SA 3KY2A 5EM5A 2OICA 2C6MA 4GK2A 1P14A 2HENA 5AX9A 2IZUA 1XHAA 5F95A 4XP0A 2WTCA 3HMOA 4QRCA 4PNKA 5LMBA 3O50A 4XG9A 2UW9A 5IA4A 4L67A 3UO5A 4AW0A 4YZ9A 2RG5A 3FMEA 3PXZA 1GY3A 4EHZA 3VJNA 4GRBA 4FT7A 4FTLA 2C68A 3HUBA 3UBDA 3GNIB 1A06A 3LFDA 5FTQA 4QP3A 5JH6A 4YJNA 3TNQB 1NVSA 1XBAA 5EKNA 1QCFA 3OOMA 4RIXA 4AW1A 2UVYA 2XIXA 5JKGA 3COMA 4RA5A 2W0JA 4KBKA 3DY7A 3PZEA 3TJDA 4EYJA 1WMKA 2XUUA 5CYIA 2CPKE 5HG5A 4JBVA 5A14A 2UZNA 5A46A 1Y57A 3IKAA 3UZPA 3GVUA 3E5AA 1Z57A 4FGBA 2XNGA 1U54B 5LWMA 4JX3A 1EH4A 1OL5A 5E8SA 5F4NA 5CU4A 1NXKA 2GNJA 4WOVA 3ZLXA 5HNBA 4H3BA 4TKSA 5AR8A 4YURA 4M0ZA 4O6EA 3RP9A 5CVFA 4GYIA 2WMXA 3ALNA 3LQ8A 3OTUA 3TN8A 4EC8A 2NP8A 3OOGA 4FTCA 4XOYA 1PKGA 3QZFA 3EHAA 2W96B 2X7FA 3NEWA 4FV8A 4H1JA 4FT5A 2XEYA 1PMVA 1QPEA 4EHGA 2BZHB 4GUEA 3GU5A 4FSRA 4L7FA 5FEQA 3UYTA 4BBFA 4D1SA 3R7IA 3DCVA 4E20A 3TNHA 2NRYA 3QTRA 4ZK5A 5M53A 4RBLA 2YAAA 2JD5A 4RIYA 4MD7E 3ZSHA 4DFXE 5CALA 5L8LA 3FZOA 4RWLA 2QURA 2GNLA 3CC6A 1BKXA 2XJ1A 2C1AA 2HW7A 3MB7A 5K0XA 4BCNA 3VUIA 1ZLTA 4AE6A 2QR8A 4J71A 4XP2A 1PXIA 3OWPA 3UIUA 4XNEA 3KRJA 5CU0A 2BIKB 3GOPA 2ZDUA 4KRDA 2VX0A 3KXNA 2VWZA 3DBDA 2V55A 2VWUA 2I0HA 3G51A 4U45A 4WNMA 4X6QC 2WEIA 3R7OA 3VBXA 4APCA 4ZLOA 5E8ZA 4GU9A 4G34A 5KKRC 3IQ7A 4FTJA 4DH1A 2I0YA 4EZ7A 4D5HA 2WFYA 2CGUA 4BCMA 5AAEA 4RC2A 3A7IA 4IX3A 2XJ0A 1JKTA 4RIWA 4Z9LA 2ITPA 1NY3A 2OZOA 3E7OA 3F3UA 4NW5A 2YAKA 3FMDA 3QLGA 1UVRA 4LRKA 2VTIA 4YC8A 5DHJA 4ZIMA 3BLRA 4D9TA 4ZTMA 4TWNA 4FOBA 3F5GA 4CFUA 3BEAA 2X8DA 4UY9A 3TACA 4QMNA 2OFVA 1GIJA 1H08A 3Q5ZA 4AX8A 4RLKA 3HA8A 5GZ9A 2FUMA 4R3CA 4P5QA 1WBSA 3MYGA 3BPRA 3O0GA 5CY3A 4QO9A 3U4UA 2UZBA 3PE2A 1QPDA 4KS8A 3A2CA 5AJQA 4HCVA 4NU1A 3DJ6A 2BCJA 4EC9A 3QA0A 3UC3A 4BDEA 3EFKA 4I1ZA 4ZXTA 2ESMA 4YGAA 5ANOA 2VO6A 3AMBA 3DAKA 5J5TA 4I3ZA 1WBTA 4C33A 2FO0A 4PDSA 3R7YA 1J1CA 3K3IA 4ONAA 4QTCA 2J6MA 4D28A 4PV0A 4X2JA 5HO6A 4YUQA 4IC7A 4PMPA 4Y95A 3OCGA 4K33A 4IVAA 3LPBA 4QMWA 4WSYA 5C9CA 3UO6A 4FYNA 4FTRA 1XKKA 1UKHA 1OIQA 2VWXA 4I5CA 4BCIA 4PUZA 4P90A 3ZBFA 3SHEA 2YM6A 1W98A 3O96A 4FKVA 4WUAA 3S0OA 2QKRA 1GZKA 2P2HA 5A6OA 5JFSA 1UNHA 4MXYA 3EQRA 3I5NA 4EH9A 4F6SA 5FWKK 2WU7A 4CEGA 3NR9A 4D1XA 2JAMA 5HE2A 4IXPA 3ZOSA 4M66A 4ZZOA 2YABA 4AFJA 4FV1A 4QP2A 4AZSA 2WTVA 2WO6A 4WNOA 1ZYJA 2ETRA 2ACXA 3A4OX 4YBJA 4ZLYA 5G1XA 2C6IA 2XB7A 4FKSA 4J97A 4EI4A 5HEZA 4RX5A 4PL5A 3VHEA 4PPCA 4TRLA 4AW5A 3S95A 5HNIX 5IH4A 1CKPA 4YSJA 1Q8YA 2OW3A 4EH3A 4FKTA 5T6KA 4JAIA 5T68A 3R9OA 4NZWB 4ZTSA 3UE4A 4ANLA 4IC8A 2ITQA 4S33A 4BCPA 5EDPA 3A8XA 4NH1A 1V0BA 1I44A 1PY5A 2JDVA 3EYHA 4KD1A 3FKNA 4LMNA 2IVSA 1KWPA 4OBQA 5D11A 1STCE 4U97A 3RK5A 4UMPA 5LVLA 3JVRA 5LMKA 2BTSA 4UXLA 5IKWA 1PJKA 5JRSA 4FL2A 4CV8A 4Y85A 3D5VA 1ZOGA 3F9NA 5D1JA 5IDPA 5AR3A 1AQ1A 4FZFB 5HIBA 5CI7A 1Z5MA 5KMOA 1H8FA 3CS9A 2ZDTA 2F2CB 2R3FA 4XHKB 4C02A 5CAQA 2VRXA 4H3PA 4E4MA 3DAJA 3BHVA 4AE9A 3NDMA 4RJ5A 5IH5A 4YJUA 4I22A 2KTYA 4XG6A 4YZCA 4DG3E 1YXXA 2VO3A 2F7ZE 2ZM3A 3A62A 4NIFB 3AGLA 4YBKA 2PVHA 2JKQA 4IAZA 2X6EA 2BUJA 3FI4A 4JVGA 1YXUA 3QRJA 2UW0A 4APPA 3GI3A 3D5XA 4E5BA 3WZJA 3Q3BA 2YCQA 4HYHA 3VQUA 2X1NA 2X7GA 3MW1A 2W9ZB 3CPCA 4G17A 5K5XA 2QOQA 4DITA 4AOJA 5FTOA 1KOAA 1NVQA 3NGAA 4XV2A 2W4OA 3TKUA 4JG6A 4R7HA 2J50A 3LZBA 4G6LA 4KWPA 1Q4LA 5HORA 4FBXA 4WRSA 3OY3A 4AA4A 3SW7A 5DR9A 1Y8YA 3QCYA 5TR6A 5M4CA 2W7XA 4EL9A 2OZAB 2XYNA 2G01A 3COHA 3OD6X 2Z7SA 4YC3A 3Q9XA 4EOQA 3VIDA 5J9YA 3SKCA 5LQFA 2F9GA 3NNXA 1FQ1B 3PY3A 2R3NA 3M11A 4IVDA 3VUDA 1TQIA 3PJCA 3F6XA 3U6HA 1AGWA 5A4CA 1ZAOA 3WF7A 2WIPA 3ORLA 4YJPA 4DEHA 4F64A 2W17A 3GFWA 1JSVA 3P0MA 3UOHA 4B7TA 2JITA 4MH7A 2P2IA 5EI8A 3IW5A 4LG4A 5E8WA 5FLFA 5DI1A 4Y46A 3FC2A 1SVHA 2X7OA 3L8VA 3AD6A 4BIEA 2JEDA 2O64A 4IVCA 3QHWA 3A61A 3PRFA 4FKLA 4FODA 3PA4A 3QD2B 1OL2A 3ZCLA 3WZUA 2QKWB 2W1GA 4A9TA 3HRFA 3Q52A 3FUPA 3PRIA 4TW9A 5HNGA 2QR7A 5AP4A 3R1YA 1O9UA 3UNZA 3VS7A 3ACJA 4ZTHA 3PPKA 4IWDA 3JYAA 4FZAB 4ALUA 3MPAA 4FL3A 4OTWA 3F61A 4X0MA 4UWBA 2X81A 2WMUA 1XH6A 4E6CA 1B38A 4UMTA 3LOKA 4AA5A 4JI9A 5A4TA 4D58A 1H26A 1OB3A 2PSQA 3F5UA 4JG8A 4HOKA 3RM6A 3T3UA 4G1WA 4AZFA 2VV9A 1U5RA 2IW8A 4RWIA 2VTOA 3NWWA 1URWA 2GFCA 4FSTA 4F4PA 3DJ7A 3Q9YA 1SM2A 3EH9A 3EN9A 3GCVA 4TTHB 5AP1A 3ZYAA 4AT4A 4OAUC 5E1SA 2WTIA 4C7TA 2UW7A 1Y91A 3BV2A 4PY1A 1W8CA 2PMNX 1J91A 3JVSA 3RHKA 3ZUUA 3UIBA 4F6UA 3HRBA 4U41A 3MV5A 2C6TA 3F3ZA 2BDWA 2ZOQA 3WOWA 4CMUA 3AQVA 4FK6A 4ZSAA 5K0KA 4TWOA 3W2QA 4BIBA 5CXHA 5I9VA 4BL1A 2ZV8A 2SRCA 2A19B 1G3NA 4K6ZA 3ZM4A 5D9HA 2G2HA 3W2RA 2PVRA 4X2NA 4ZTRA 3V5TA 3ELJA 4CFNA 4YTCA 3Q9ZA 4KA3A 4L01A 2QOKA 5HVJA 3VUMA 2HWOA 2UZDA 3KCKA 3QQFA 3RMFA 3ZO1A 3NUXA 2XBAA 3G0FA 2GNFA 3Q4CA 4JQEA 4RT7A 4YSMA 3FQHA 5BPYA 2PE0A 2IJMA 3RBWA 4FIJA 2W9FB 4YNEA 3F5XA 4GCJA 2PL0A 2XCHA 3RNIA 3FMNA 5FBOA 4D4YA 3DKGA 3FXXA 1H00A 3R01A 3ETAA 3GGFA 3QZGA 3W2PA 3ZEPA 3WE4A 1TVOA 4KIOA 3WBLA 4NW6A 3QTIA 2HXLA 3KF7A 3ZTXA 5M44A 5AUUA 1IASA 2JKKA 4QTDA 4U8ZA 4FIGA 3EL7A 2BRNA 2NO3A 5CU3A 4JBPA 1GIIA 2FYSA 4DINA 3OW3A 3PIXA 5AR2A 3VW6A 4MKCA 4JAJA 3E62A 4FIIA 2EU9A 3CTQA 5ANIA 1A9UA 4GVJA 1BUHA 5CAVA 3IK3A 5D7VA 4C38A 4E73A 5KO1A 5E92A 3R28A 3TUBA 4XG2A 3G9NA 4YLLA 4RGJA 4ZAUA 4K1BA 5KBRA 3KC3A 4ANSA 4CLIA 4QP6A 1QL6A 1ZMVA 2YIYA 4B0GA 4WG5A 3UQCA 5LMKC 5IA2A 2VWBA 2O0UA 4R5SA 3LFFA 2RGPA 3DU8A 3DGKA 4GK3A 4ZTNA 3I4BA 4JJRA 4BCFA 1T45A 2F49A 3ANRA 3IOPA 1ZXEA 3M1SA 3ORNA 4GIHA 5CI6A 3GT8A 3QGWA 5FD2A 4UALA 4TYJA 3R7GA 5G6VA 2HY81 4EH7A 3KQ7A 3Q53A 4OTHA 4PP9A 4PNIA 3P23A 2WTKB 3R8VA 2Q0BA 3BCEA 1HCLA 5HE3A 4EQUA 4BDGA 3TUCA 3M2WA 4J7BA 4GMYA 2VTAA 3NNWA 5KBQA 1H4LA 4X3FA 4EH2A 2VU3A 3VQHA 5CVHA 4Q9ZA 3DBEA 2ITZA 3H3CA 3H0ZA 3Q4TA 1O6LA 1YW2A 4ZY6A 1FVTA 1QPCA 2O2UA 2UZLA 4JDJA 5EDQA 2P55A 5J1WA 4LUEA 5LJJA 5EOBA 2WXVA 4GIIA 3MVMA 4JDKA 5JEBA 4FSWA 3FC1X 3DQWA 4M67A 4NKSA 2YITA 2BZJA 4M69B 2XK6A 4D1ZA 4F9CA 3BYVA 5A4QA 1ZY4A 2X8IA 3HNGA 2QNJA 1YDSE 2YLFA 4O0VA 4QP9A 3UODA 2H9VA 4U43A 4XG4A 4D2RA 3BBWA 5DH3A 2OSCA 4MVFA 3UVPA 4F08A 2GHMA 2GPHA 2JDTA 4NSTA 5AWMA 1DI9A 2V22A 4W4XA 4ACDA 3DLZA 2OIDA 4I41A 4RJ8A 4RWKA 5BMSA 2C5YA 3O17A 2QLQA 3RI1A 5CF8A 3S3IA 4DFLA 2W1HA 5DNRA 3BHTA 1OKVA 2WTJA 2IVUA 4DFNA 2QG5A 4U80A 5EI6A 3VBWA 4DFZE 4U79A 1T46A 3C50A 4CRLA 5I9ZA 4F1TA 4IFCA 1FMKA 1ZOEA 5EW9A 3RPSA 1SNXA 2CLXA 4CSVA 3RM7A 2W1CA 4Z55A 3QUEA 2LGCA 2UVXA 4FVRA 5CZHA 4A9UA 3RALA 4O1PA 3NW6A 4LRMA 3QCXA 3ZO3A 4DAWA 2C3KA 1M14A 3POOA 2WMBA 4QMUA 1PXNA 1WBNA 2HZIA 5C03A 3TIYA 5BYYA 2QI8A 4D0XA 1WAKA 3ZFMA 4ANOA 5AADA 3IECA 1UKIA 3AMAA 3EQBA 2UW8A 3C4WA 4CCUA 2QOIA 3C9WA 2BAJA 5B2LA 2IZTA 3LLTA 4J8MA 3CR0A 3TUDA 4DGOA 1MUOA 3UQFA 1ZYCA 4KKHA 4C4JA 3P7CA 4IDVA 3KMUA 4MCVA 4EEVA 2J90A 3PIYA 3OT3A 2X9FA 3BYMA 2EXMA 4G9RA 4LGDA 3SLSA 2VTQA 4EZ5A 3UG1A 3KK8A 4FVPA 3R22A 5DLSA 2UZUE 5HBEA 3TNIA 2B55A 3KMMA 1FINA 2WOUA 4FKIA 4FEQA 2Y8OA 4A4LA 3C4ZA 2JBPA 4HYSA 1BYGA 4F7NA 3FY0A 2HY0A 3OCSA 5DIAA 4ZY4A 3OUKA 5CAUA 2WMRA 3Q04A 4N0SA 3CE3A 2I40A 2F57A 3FLZA 3BLHA 4IAIA 4U44A 3C51A 4ZSGA 2J0MB 1UV5A 2BFXA 2W99B 5CTPA 3R7EA 2C6LA 4HCUA 3PG3A 3ZSGA 3R02A 3QUDA 1REKA 4ZY5A 3JPVA 4G6NA 3ENMA 1KE6A 1H1WA 4OTRA 3BGPA 4LRJA 1W84A 3QRIA 3JS2A 2OO8X 2R3LA 3P7AA 4C4GA 1H25A 2PE1A 4J95A 5JGAA 3D94A 2AUHA 3BGZA 3G33A 4I92A 3SA0A 2YM4A 4UWCA 4BI2A 2VTNA 4KKEA 4HZSA 5AV1A 3VO3A 2GS7A 4G2FA 3ODYX 4EK6A 2VX1A 3II5A 4EOKA 1VEBA 3R7VA 2VTMA 3R2BA 1AD5A 3RAWA 3QD3A 3WYXA 5AV3A 3L8SA 3MA6A 4FC0A 4GU6A 3D7TA 2R9SA 3U87A 4ITJA 4JRNA 2F2UA 2ZVAA 3I60A 4O1OA 2BROA 4R7IA 4ZSLA 2IVTA 5J95A 4TYHB 4PDOA 4XBRA 3PSDA 4P7EA 5E8XA 3THBA 3KKVA 3UPZA 5C27A 4QMYA 3BYOA 4JDHA 4XX9A 2HCKA 3REPA 3QZIA 5C1QB 3R0TA 3LW0A 4C57A 4JG7A 4BYJA 2R3JA 4IAKA 3VHKA 4ARKA 4I23A 5A6NA 2WQEA 1H1RA 1YWRA 1W7HA 3DLSA 3MJ1A 2YCRA 4LYNA 5CEPA 1R0PA 2QOOA 3UGCA 4I5HA 4QTBA 2EB3A 2ZYBA 3UQGA 4JIKA 4BCGA 2QQ7A 2WQMA 3G0EA 4JBQA 3PJ1A 5DOSA 4D4RA 4XV1A 5GNKA 1H1SA 3ROYA 3FYKX 5DT0A 3RVGA 3MPTA 5EM7A 2IO6A 3KXGA 3UMWA 5L6OA 4BC6A 3FYJX 5DE2A 2C5VA 2VO7A 4DH8A 4FZ6A 4I5PA 3D7ZA 3L9MA 3KRWA 3VW8A 4AUAA 3R8ZA 4BZNA 4PPBA 3L9LA 4WT6A 4EK8A 2PVYA 2H34A 3QQJA 1XH4A 2GSFA 2W4JA 4AQCA 3MDYA 2XBJA 4XV9A 5TE0A 2W4KA 4IADA 3SAYA 5AX3A 1OGUA 3G5DA 3UP7A 1YDTE 3QC9A 4DBNA 3K2LA 3QQHA 5L2SA 3O51A 3DPKA 4BDFA 3OXZA 4TT7A 5AM7A 1TKIA 2UV2A 3ZUTA 2GCDA 3R1QA 4D0WA 4BTJA 3AC8A 4ZLZA 4X3FC 1R0EA 2GHLA 3L9NA 5CAPA 2EXEA 5A4LA 4ZTQA 4TN6A 4TYGA 2C5NA 1XJDA 3RAKA 5HESA 3GCQA 4YP8A 2Y4IB 2Y6MA 3W18A 3KRLA 5L6WL 2V62A 5IPJA 3E93A 2QOHA 3HEGA 3OHTA 1MRYA 5I3OA 2PWLA 3D0EA 3B2TA 4O0YA 4AN3A 3A7JA 4G5PA 5ETIA 4FSNA 3Q6UA 4RX9A 3DKFA 3F7WA 1OUKA 4L43A 3KK9A 1YI3A 3RWQA 4H39A 4DLIA 4YHJA 1V0OA 3R30A 3BHYA 2EB2A 5H8BA 3DOGA 3ZRLA 2X4ZA 3BQRA 4C37A 5IA0A 1DAYA 5K4IA 1BMKA 5H9BA 3UVQA 4AOTA 3FBVA 2Z7QA 3FLWA 1YHVA 1CKJA 4JDIA 2PMOX 2VNWA 4L8MA 3VBTA 1JKLA 4J8NA 1H0WA 3VRYA 2W06A 3MSSA 4DEAA 3KXMA 3LXKA 2G15A 5K9IA 5F1ZA 3IG7A 3PXFA 4A4XA 5CSPA 5HVKA 3UIXA 2PZPA 3HZTA 3HRCA 3ORTA 1IG1A 5CANA 3EL8A 4FKUA 3WE8A 2JFMA 4BWKA 5DEYA 4M12A 4FTOA 4QQ5A 4U40A 5DRBA 4D4SA 4F09A 2A4LA 1OMWA 3DB6A 2BALA 3DFAA 5IA5A 4EQCA 2XKCA 5EHOA 2WHBA 3VUKA 4IH8A 2OGVA 4XYFA 2HXQA 5AM6A 3CQEA 4CYJA 2X8EA 4FI1A 2CCIA 3DFCB 3SC1A 2Y6OA 3I6UA 1TQPA 1CM8A 3C5UA 3WIGA 2VWVA 4EONA 5E8YA 1R3CA 2AYPA 4NJDA 3MVJA 4QMZA 4D2WA 2J0LA 3QLFA 4E3CA 3U6JA 4KS7A 3O8PA 2X0GA 4R8QA 4X2KA 4X6RA 4U42A 4AZTA 4EWQA 1Q41A 5EYCA 1PXLA 4H58A 4U5JA 4O96A 1Y6BA 2BDFA 4Y5QA 5F20A 5BVWA 4AWIA 4BZOA 4CFVA 5C26A 4WNPA 4TZRA 5F9EA 5TKDA 3GCPA 3AC5A 5HCYA 2YFXA 4FOCA 4BBMA 4HGEA 2Q0NA 3Q4UA 3K3JA 1ZZ2A 3OWLA 5JFWA 4AACA 3CQUA 3QCQA 3QZHA 4L00A 2PZ5A 3SRVA 4EHEA 4QYYA 3DZOA 3FHRA 2J0IA 4MNFA 2RL5A 2JFLA 2BVAA 4OGRA 4Q2AA 3NYOA 3F3TA 3OROA 4FG8A 1PXPA 4EKLA 3IGOA 2J4ZA 1W83A 3FE3A 3AXWA 4M3QA 4U9AA 2GDOA 3EQPA 5ETCA 3FPQA 2OIBA 3NAXA 3QWKA 2GS6A 4L3PA 4MWIA 2JIVA 4NTSA 4UBAA 2XYUA 4PTEA 4YO4A 1OUYA 4LOOA 3GBZA 3R8UA 4ACHA 4NM0A 3L8PA 5CS6A 1VZOA 3QWJA 3WARA 3QGYA 5CNOA 3TCPA 1JAMA 2FH9A 5EOLA 1H24A 5KMLA 3TZ7A 4FR4A 3QYZA 3LFQA 3PJ2A 3LCKA 4NEUA 4P2KA 3GU6A 3ZC6A 4ZEGA 5L8JA 3ZLSA 4CQEA 2UW4A 3TZ8A 5IEXA 4BTKA 3PJ3A 3LQ5A 5FP5A 4TPTA 4U0IA 2VD5A 2XKFA 2OXDA 3CP9A 3A4PA 4WUNA 3PY1A 5KHWA 3SX9A 3EFWA 4LMUA 3M42A 4NM7A 3F88A 3OCTA 4CFXA 3QD4A 3CXWA 4ITHA 1PMUA 4K18A 3R00A 5CSXA 3GP0A 5HI2A 2X2KA 4W4WA 3SXRA 3VNTA 3PSCA 4A9SA 4BKYA 4BIDA 4L45A 4C0TA 4MXZA 5CSHA 4E6DA 1JBPE 2WQOA 2ZV9A 4BZDA 2VN9A 3NW5A 3PUPA 1IEPA 3DDPA 3P08A 2ITNA 2V7OA 2GQGA 3IW6A 4G9CA 4O0WA 3JY0A 4FSUA 4F7JA 2VGPA 3QKLA 2PTKA 4BHZA 5HX6A 3ACKA 3HKOA 5JRQA 2DWBA 2IWIA 3NNVA 5A54A 5KMMA 2CHLA 3MH3A 4OTIA 2YIQA 5KUPA 2CCHA 2JDSA 5AUTA 3H30A 3EFLA 2UZOA 3LHJA 4A7CA 4FIHA 2YHVA 2XK9A 3GFEA 4QPMA 1Q24A 2Z7LA 3GC9A 2GTNA 4IB0A 3DB8A 3PZHA 4G5JA 4JOAA 4CD0A 3OTVA 4FV3A 4BTFA 4TY1A 3P78A 3UG2A 3V8TA 4QTEA 4CMOA 5HX8A 4Y83A 3LM5A 4YHTA 4ERWA 5CSVA 3ORPA 3TG1A 5HU9A 4CFFA 4HVGA 1XR1A 3AT2A 5KKRB 3FDNA 3HV3A 4ANNA 4BDBA 4EH8A 3KU2A 4EQMA 5CEOA 2G9XA 4BI0A 4MXAA 4M68A 3IW7A 5EKOA 4XBUA 3LFSA 4I6BA 5B0XA 3FQEA 3PPJA 3AOXA 4E4LA 3VBQA 1M7QA 2A2AA 3HMNA 3R9NA 1ZMUA 1ZRZA 3ULIA 4BDJA 3DKCA 4IFGA 3LXLA 4LL5A 2YM7A 4S30A 3RZFA 2FVDA 2WQBA 4C34A 4EH5A 4L3JA 3ANQA 3CLYA 1GZOA 1RW8A 1K2PA 2R3MA 3NZ0A 3WIKA 4H1MA 2OF4A 3COIA 5K4JA 4CQGA 1JLUE 2YCFA 3O71A 2RFNA 2X2LA 4X2FA 5J79A 2CMWA 5HCZA 2GU8A 4U81A 3ZO4A 1JPAA 5FQDC 3NIEA 3ORIA 3BIZA 4IACA 2P33A 3W33A 3CGFA 1LP4A 3U9CA 3UVRA 1BI8A 3C1XA 1XH5A 4O0TA 3K5VA 5EDRA 5AR4A 2XK3A 4LQMA 1SVEA 4ANBA 1V0PA 2XZSA 3KGAA 2PUUA 4USDA 5KHXA 3POZA 3QAME 5AA9A 3MB6A 4OTQA 3D83A 4PL3A 5CNNA 1OVEA 3L8XA 4XG7A 3SD0A 1E1XA 1ERKA 4F0FA 1MRVA 2C3IB 5C8MA 4ID7A 4BCJA 4MNEA 2X39A 5FM3A 2ITWA 5LCKA 3QKKA 3QBNA 4RFZA 4BFMA 4MD9E 4FZ7A 2E9NA 2IZRA 4I21A 3BYSA 1XQZA 3DBCA 3FZRA 2W1ZA 2XKDA 4BRXA 2YISA 4YO6A 4BGGA 1I09A 5ANEA 4FKWA 4QQCA 2YM5A 3HV6A 4RFMA 2XA4A 3W2OA 2JIIA 4CKJA 3EJ1A 4MTAA 1YOJA 2BFYA 2A27A 2I6LA 3R04A 3HV7A 3MBLA 3PXYA 2B9JA 2BHHA 3E8CA 2RFDA 4O0SA 3V5WA 3R21A 2F7XE 4CZUA 1FMOE 1K9AA 4NT4A 5ANGA 5M4IA 3I79A 1YI4A 3HYHA 4AZVA 3EQGA 4RIXB 3PE1A 4BCOA 3E87A 4L6QA 2HYYA 4BVUA 3QKMA 3FJQE 3JY9A 4O22A 5AV0A 3FLSA 3C13A 3AC4A 2XEZA 4AG8A 5HOAA 3VULA 4FKQA 4HW7A 1YXTA 2R3GA 5A4EA 3GC8A 1E1VA 2ERZE 2QODA 3S2PA 3F7ZA 4BKJA 4MYGA 1YXVA 1WVXA 4QYGA 2OKRA 4AOIA 5AUYA 1YI6A 3OXTA 2ZM1A 3SOAA 4RVTA 3PY0A 2RKUA 4UXQA 4RFYA 4WA9A 4TYIA 3RPVA 3FI3A 5JSMA 3DZQA 5EM8A 2B1PA 2ZV7A 3PXQA 2WKMA 2WGJA 4L42A 5T3QA 1IR3A 4AW2A 5CVGA 1UNGA 2I0EA 4MEDA 4OT6A 4F0IA 4G6OA 2PMLX 3VF8A 3BE9A 3QXOA 3VUTA 3RPOA 2XNNA 5B2MA 2W5AA 4YPDA 1Q97A 3PA5A 4PF4A 4AGUA 5L2QA 3MH0A 2XH5A 5CEIA 4FV6A 4RIYB 1UU9A 3H4JA 4PMTA 4YC6A 3ZZEA 3D5UA 5ACKA 5C8NA 5FEEA 3B8QA 1WBPA 5EFQA 4GT5A 3TZMA 4WKQA 2HZNA 3Q2MA 4Z7GA 5GHVA 5EW3A 1OL1A 4CTCA 5GJFA 4ALWA 3AD5A 4F99A 2QD9A 1P2AA 3IOKA 4UEUA 5A3XA 4CT2A 4M0YA 5JGBA 1KE8A 4FT9A 4ASXA 2ERKA 4FV9A 4BB4A 1ZYSA 4FG7A 4RWJA 3GCSA 1Q3DA 3ZDUA 3DXNA 3DDQA 1YWNA 2O65A 3C4XA 3MN3A 4DH7A 2CGXA 4EOSA 5ETAA 3BU3A 2HK5A 2CGWA 2QONA 4RIWB 4BTMA 3CTHA 5J9LA 3TXOA 4QMOA 3ZRMA 3AT3A 5DRDA 4PX6A 2A0CX 4A9RA 3WF6A 2XIZA 5B2KA 5DBXA 4OTDA 4WG3A 4RVLA 3BX5A 3BRBA 4QMSA 4L46A 5EHLA 4R3PA 3OEZA 4JBOA 4C3PA 5CQUA 3SDJA 2OG8A 4ZOGA 1PXKA 4ASDA 5HD4A 4FG9A 4ENXA 4C3RA 4F7SA 3I6WA 3IW4A 4N4SA 1CMKE 5CASA 2YERA 4E5AX 5AIRA 4I93A 2BRHA 2GMXA 3MIYA 4QD6A 3VS3A 4BDDA 3BBTB 5IEYA 5EG3A 2J5FA 3MVHA 3D14A 4AZWA 4BBEA 4O0UA 3KULA 3IPHA 5CSWA 4QYEA 3FY2A 4C4FA 5LVOA 5BYZA 3R83A 5J5SA 2C30A 3FV8A 4MBJA 4ZJIA 4L3LA 3FLYA 4YLJA 3EB0A 3BE2A 2UW3A 3SQQA 4FVQA 5HLNA 3VWAA 4EOMA 2YDJA 4WNKA 3HECA 4PMSA 3H9OA 2YM3A 2VX3A 3B2WA 3FMJA 5LVMA 3COKA 5LXMA 2OJFE 4K11A 3NCGA 1UU8A 3EMGA 4LGGA 4TWPA 5E90A 3ZSIA 3DK3A 4HVSA 3QTWA 3UIMA 4GFOA 2UUEA 3RK9A 4CZTA 3TI1A 4BDCA 4B9DA 3PYYA 5H8GA 2OXXA 2YWPA 3ALOA 3FQSA 2PK9A 2DS1A 4JR7A 2WMVA 3PTGA 4E5WA 3T9TA 3VBYA 1GAGA 5C8KA 4F9YA 3TZ9A 3KVXA 3RAIA 4E26A 5DGZA 5CX9A 3ZEWA 4GS6A 1J1BA 5IUIA 3TNPC 4ERKA 5JK3A 5M57A 4IB1A 4II5A 4XCUA 2WMTA 2EVAA 3LMGA 1FGKA 4V0GA 2VTTA 3I0QA 4NCTA 4Y5HA 4CNHA 2V5QA 3U51A 3UDBA 3CD3A 3GENA 1U54A 2VTSA 3TT0A 5BX0A 3LFEA 5CU2A 2C6KA 2VZ6A 4FT0A 4L68A 4X2GA 4FNWA 3V5JA 3ORKA 4UN0C 3CCNA 3R8MA 3AC3A 3F66A 3CPBA 4E6AA 4YLKA 2J0JA 3QTSA 3TIZA 3LXPA 3U4WA 4K0YA 3OG7A 3KN6A 1Q99A 2C5XA 2PVKA 4FV2A 4XG8A 2B7AA 4F0GA 1PMNA 5ITAA 3F5PA 3NAYA 4NK9A 4IM3A 3SV0A 3UZTA 3GUBA 5CT7A 3EQCA 3MGYA 4FNXA 5AP2A 4CCBA 3RPYA 2HOGA 1SZMA 2PZYA 2YN8A 2OH4A 1ZMWA 4USEA 3QQLA 5DPVA 3W16A 5ETFA 1KE5A 3E3PA 4E93A 5HO7A 3CJGA 3VAPA 5DVRA 2QO2A 3C4FA 1DI8A 4GG7A 4ZZMA 4CKIA 3KMWA 3P5KA 2XJ2A 4V05A 3HUCA 2X4FA 4JQ8A 5DWRA 4C35A 4PWNA 5E8UA 3D5WA 5LOHA 4IAAA 4PL4A 2BKZA 4QP8A 5I9WA 5J8IA 4DFYA 1ZARA 4G3DA 4N6YA 3BZ3A 4IWOA 1URCA 3HX4A 5KCVA 4IEBA 5KX8A 4CRSA 4HGLA 4C2VA 1FVRA 1Y8GA 4EOIA 3PVUA 4JX7A 4CFMA 1WBOA 4N70A 5DFPA 3TKIA 2F7EE 4QMXA 5EI2A 4FUYA 3QD0A 1BL7A 4WRGA 4G16A 3VUGA 4W4YA 1F0QA 3KL8A 3RWPA 4A06A 4XH6A 2WMSA 1OIYA 2QVSE 4MWHA 1ZWSA 4ACCA 4GSBA 3LFAA 3NUUA 4DEDA 4F9AA 5B7VA 5LWNA 1O6KA 5CF5A 4F65A 3MPMA 2OF2A 5DT4A 4DEGA 4K8AA 2OH0E 2Y0AA 1OKYA 3QRUA 4FTNA 5BVDA 4HCTA 2VO0A 4E4NA 3BGQA 2ZMCA 4IHPA 3O23A 2DYLA 3AD4A 3C0GA 4L52A 3BYUA 2RF9A 1XWSA 2PZRA 5CQWA 1CSNA 2ITUA 3FKOA 3TV7A 4DC2A 5AAFA 2P4IA 3WF8A 4TL0A 4U3YA 3QA8A 2OJJA 4C36A 1Q3WA 3QRKA 3PVGA 3PJ8A 3UPXA 3KXXA 3VS4A 2ZB0A 1R1WA 5KMJA 3V51A 4CMTA 2X6DA 3Q9WA 4D55A 2B52A 3S4QA 2Z60A 3E88A 4FSYA 3Q96A 3HA6A 4RVKA 3MS9A 4P4CA 2GNIA 5LARA 3T3VA 2X2MA 4LFIA 5BQ0A 4HPUE 3C4CA 1B6CB 2B9HA 4M8TA 2VWYA 5C01A 2BZKB 4PDPA 3ZH8A 4ZJVA 4IANA 3F69A 5L8KA 2YA9A 4HGSA 4RSSA 4I94A 1UNLA 4A9YA 5FXSA 3FXZA 4YPSA 3E3BX 4ZP5A 3VUHA 2QO9A 4CT1A 3ZLYA 1NVRA 2BZIB 5AV2A 3MY0A 4GJ3A 4M13A 4F9BA 3TV4A 4AS0A 1DM2A 2FA2A 3EYGA 4FICA 5CZIA 2LAVA 4BDHA 4X7QA 5JZNA 4O0RA 4Q9SA 1OKWA 2RFEA 4IB3A 2EWAA 4YJTA 3V04A 3IONA 5IISA 4MBLA 4MQ1A 5L4QA 4FSZA 4AGCA 4WBBB 2NRUA 2OU7A 2R7BA 3GQLA 4UX9A 4FSMA 1MQBA 2XNBA 4IX4A 4DN5A 5DA3A 4C4EA 5HLWA 2Y9QA 3NRMA 3EQHA 3GC0A 1P5EA 3WZEA 4BKZA 4MK0A 1U5QA 3VBVA 5JN2A 2QLUA 4V01A 4PPAA 2IZSA 3MFTA 4RPVA 4IE9A 2HZ4A 1PKDA 5D7AA 2I0VA 2B54A 2O5KA 3ZO2A 3Q32A 3V3VA 2REIA 4B8LA 2PVNA 4MD8E 2R5TA 5H8EA 4BGQA 5DR6A 1JVPP 1PF8A 2IVVA 1KE9A 2J0KA 3WYYA 3QRTA 2WMWA 3DTWA 3QX2A 4YR8A 3LJ0A 4W4VA 3GU4A 3U9NA 5HGIA 5HE1A 4KINA 2R3RA 4NFNA 1REJA 2PVLA 4C8BA 5I9XA 4FA2A 3CJFA 4FIEA 2VWIA 3MH2A 2VTPA 5JMSA 2CKEA 4BCKA 5KMNA 2IN6A 3EZRA 5KNJA 3LFBA 4LV8A 4AN9A 4GUBA 2FGIA 3GXLA 3OWKA 3A7HA 3HMIA 2BAQA 4O27B 4D9UA 3ZONA 3NS9A 4LI5A 2WTWA 5DR2A 4C2WA 3H9FA 5FDXA 3PWYA 1KSWA 2B9FA 4QMTA 4JT3A 3CBLA 2ZM4A 4RA4A 4EKKA 1L3RE 1Q8WA 3HVCA 2C6DA 3PG1A 4NIFA 4RG0A 4V04A 3UOJA 2BDJA 4RX8A 3LFNA 3VS6A 2R0IA 4XP3A 1GZ8A 3KXHA 4UMUA 4S31A 3FWQA 4J1RA 4DEEA 3OXIA 3PXRA 4NCTC 4DGGA 3GEQA 3EN6A 2VGOA 5HE0A 4FL1A 5L2WA 1E9HA 1H1PA 2E9UA 2HWPA 3FZTA 2WAJA 5IG1A 1JKSA 3OF0A 2VAGA 3GU7A 4FIFA 5EHYA 4S34A 4JXFA 3P79A 2YM8A 3BHHA 2AC5A 3WZKA 5J9ZA 5LVPA 3KF4A 3FXWA 3I7BA 5A9UA 4GT3A 4OTGA 4AF3A 4CYIA 3GC7A 4Y8DA 4YHFA 2YZAA 4CVAA 2BHEA 3HMMA 4AT3A 1OIRA 4NJ3A 4B6LA 4JR3A 5F94A 3MIAA 3KVWA 4PRJA 5AMNA 2OZAA 4I5MA 5AP0A 5I9UA 5I4NA 1OIUA 3FKLA 4E4XA 1ATPE 1DS5A 4FTKA 3OS3A 1VJYA 3HV5A 4R1VA 4QPAA 4E8AA 1MRUA 4UYAA 2Z8CA 3AC2A 3OY1A 3R73A 4KB8A 4KIKA 3JUHA 3QQGA 3MA3A 4HNIA 2XCKA 3ORXA 4O0XA 4UMQA 5E91A 1WZYA 2BPMA 2J7TA 3ZUVA 5HTBA 4X3FB 5K3YA 5DT3A 4BWXA 3C0IA 4GVAA 2YIRA 4IW0A 3OT8A 4KAOA 4JRVA 4L7SA 5JFVA 2RFSA 4MQ2A 4HNFA 2GNGA 3D15A 1SMHA 4V0GB 3MI9A 3DBFA 4M97A 5AUZA 3W55A 2OWBA 1GIHA 1YDRE 3HP5A 3RCJA 2UZVA 4XMOA 1Q5KA 4BGHA 5EH0A 3LIJA 2AC3A 4OBPA 4PMMA 3FZ1A 3K54A 1JOWB 5I0BA 3MY5A 2QO7A 2WU6A 2O3PA 3UYSA 5IMEA 4I4EA 5L6PA 2R3OA 3N9XA 1UA2A 3OUNB 4ZTLA 3VC4A 4BHNA 1OZ1A 2JGZA 3NUPA 2XNOA 1QMZA 2P0CA 3HV4A 4YJQA 1S9IA 2QHMA 1XH8A 3RPRA 2XK8A 3PWDA 3BHUA 4KABA 3PFQA 4M7IA 4Z3VA 3AT4A 4W9WA 4JNWA 1BX6A 4FV7A 2PY3A 4WHZA 4ANQA 1YHWA 2YLEA 3ZXZA 4F1MA 4EYMA 5JFXA 1Q8TA 2CJMA 3RK7A 1VYZA 2XF0A 4PTCA 4I24A 4TYEA 4AGWA 4AZEA 4EWHA 3LVPA 1WCCA 1FPUA 1UWHA 2HZ0A 2XS0A 3GQIA 5BVOA 2ZMDA 5IMXA 3T8OA 4UMRA 2A1AB 1KV2A 3NW7A 4K9YA 2BILB 2C0TA 3NIZA 5FXRA 3R6XA 5J7BA 3NUNA 3MFRA 3ENHA 5HQ0A 2XNMA 3DAEA 3PP1A 4XRLA 2PZIA 1WBWA 2CLQA 3ORZA 4FK3A 4YZNA 3T9IA 2WMQA 4J99A 3Q60A 2E2BA 2VTRA 4IWPA 4ZSJA 3BU5A 5AR7A 4E1ZA 5IUGA 4EUTA 2R2PA 4QNAA 2BRBA 3R1NA 1ZOHA 3DNDA 3P9JA 2OI4X 4H36A 4IBMA 3E64A 3ZBXA 2NPQA 2FSMX 3V8WA 4WSQA 1OL7A 4HZRA 5CF6A 4IB5A 1H07A 4W8EA 2W1FA 4NM3A 2QOLA 1O6YA 5GJDA 3R1SA 5BMMA 2JDRA 4EHVA 2WELA 2QOBA 4J52A 4BDIA 3LCOA 2ONLA 3H0YA 1SYKA 4A07A 4C58A 4GG5A 3RKBA 3DKOA 3D2IA 3RAHA 5KMIA 2EUFB 4FTMA 4DH3A 3V5PA 5TOZA 4CKRA 3F3VA 3O8TA 1PHKA 5FDPA 3QTQA 1GOLA 2PE2A 2QU5A 5EW8A 2ZAZA 3HL7A 2B4SB 5M56A 4A4OA 5ANJA 4FMQA 4L9IA 3KXZA 1RE8A 3VS2A 4JLCA 1BL6A 3W1FA 2YIXA 3ZS5A 3QQUA 5EK7A 4YTFA 3D9VA 1CDKA 4X3JA 3S00A 4E7WA 2HELA 3ET7A 3Q5IA 3R63A 4RJ3A 4OBOA 3I0OA 4LGHA 3A60A 3NLBA 3EKNA 1PMEA 2XVDA 4S2ZA 1FVVA 4ANMA 4M84A 5CEQA 1FOTA 4RJ4A 3BWFA 4NKAA 4QP7A 4UV0A 5J87A 2XM8A 2JAVA 4BI1A 4C61A 4O38A 4UWYA 4D2TA 5E8VA 3BWJA 4BWPA 3D7TB 4KKGA 2XIKA 3ULZA 4UB7A 4KBCA 4KSQA 5HBJA 2VTJA 4QYFA 1YHSA 4QT1A 4ASEA 3DS6A 1CKIA 4GH2A 3MFSA 3PLSA 4D2VA 3VS0A 2PMIA 2ITXA 3E92A 5AV4A 3OCBA 5FBNC 5TT7A 4EBVA 5ICPA 2O8YA 5BUJA 3KCFA 2OXYA 5HG9A 4RC4A 4IZYA 4EH6A 1HOWA 1M7NA 2XIRA 4EOJA 3QTUA 1Q8ZA 2H8HA 2JKMA 4D5KA 3V6RA 1U46A 2H6DA 4FTIA 2C0IA 2C6EA 3SOCA 1F5QA 3NX8A 4M69A 4WBOA 3PPZA 4J53A 3VS1A 3W8QA 4EK3A 1X8BA 3KRXA 4QMMA 5JT2A 3H10A 4I6FA 4CV9A 4DG2E 2WEVA 3ZC5A 5I9YA 4BN1A 4DTKA 3EZVA 3QQKA 2I1MA 3EKKA 3KEXA 1H27A 5BUIA 5FRIA 1APME 4ZZNA 3DV3A 3OVVA 1S9JA 2Y4PA 2J51A 3ZRKA 4AN2A 3E8EA 4WIHA 3IDPA 3QF9A 1KV1A 1JQHA 3DNEA 3G9LX 3E63A 3QL8A 4IM2A 4XLIA 5AIKA 2E9OA 4RQKA 5KZIA 3TKHA 5HU3A 3FHIA 3QCSA 1G5SA 4KIPA 1NA7A 5HHWA 3G6GA 3OBGA 1ZZLA 4XG3A 4IAFA 2YDIA 3FL5A 3QTXA 4YU2A 3AMYA 4ZSEA 5HG7A 1OL6A 3E8DA 2FB8A 3VN9A 4F70A 4K77A 3CGOA 5HZNA 3RGFA 2JKOA 2OK1A 2JLDA 5L2IA 4P5ZA 2V0DA 1P4OA 3V6SA 4DH5A 3P7BA 2OJ9A 3UO4A 2CGVA 5HKMA 2GS2A 4C59A 3EFJA 4QP4A 3OMVA 5M4UA 1LEWA 3G2FA 1RDQE 2CDZA 2J9MA 3LCTA 2UW6A 2QOCA 5BVEA 1F3MC 4J98A 5E8TA 4FNZA 4RMZA 4ACGA 3W32A 2WQNA 4RJ6A 4EORA 3WF5A 3NCZA 4GW8A 4D4VA 3F2NA 3QUPA 1R39A 5K5NA 4XS2A 4FNYA 2R7IA 3NUSA 3ZZWA 3ZFXA 4C4HA 1WBVA 2J5EA 5BVFA 4LL0A 4AXAA 2XRWA 1Z9XA 3FL4A 4FKGA 2WMAA 5DG5A 3FI2A 4MXCA 4IX6A 5GJGA 3RINA 5D10A 3WILA 3WI6A 4GL9A 4PQNA 4QNYA 1PXMA 4QMVA 3D2KA 1KOBA 2YJSA 3BLQA 2C47A 4QOXA 3ZHPC 3FAAA 5KE0A 2OIQA 3R8LA 3F82A 2W1IA 3ROCA 3FMKA 2J2IB 3NPCA 2JDOA 4QTAA 2YCSA 4KIKB 3ZDIA 1XH9A 2BRMA 5JQ5A 4FV4A 4IMYA 4RQVA 4G3FA 5CXZA 1VYWA 4FYOA 2FSOX 4RZVA 2XKEA 3FSFA 2R0UA 1LPUA 3BV3A 4ITIA 4WO5A 3JXWA 4OR5A 3O7LD 2C1BA 3DK6A 4FV0A 5EM6A 3ZMMA 4I6QA 5FP6A 4QP1A 4HVDA 5J1VA 3LM0A 5LCJA 3F2AA 1XH7A 3C7QA 1ZY5A 4YZMA 3R8PA 4TWCA 4MF1A 3UC4A 3GOKA 4RC3A 4L53A 4Z16A 5DMZA 3UOLA 3BELA 1JSTA 3V5LA 2KULA 4G3EA 4EBWA 3UJGA 2BR1A 4LM5A 4F1OA 4GV1A 1KE7A 4RVMA 5HIDA 2RSVA 2FSLX 4C3FA 4MXXA 5AA8A 4FT3A 3W8LA 5AUXA 4TYHA 5HIEA 1K3AA 3GCUA 5CT0A 4UZDA 2BIYA 4DEIA 4G31A 5BVNA 4XEYA 2P3GX 2PVFA 2VWWA 4IWQA 4E6QA 5I5ZA 2VNYA 2R3QA 4M14A 2QCSA 4GK4A 4OW8A 3QYWA 3WZDA 4I4FA 5FXQA 2C3JA 4U3ZA 4ASZA 3SRVB 4B99A 2ONLC 3UOKA 3LCSA 4YJOA 4MHAA 4KRCA 3EWHA 3AC1A 2IW9A 2C69A 4OLIA 4WG4A 2E9VA 5HTCA 3NYXA 3TL8A 5FGKA 4CLJA 2O63A 4MF0A 5KMKA 2R4BA 1PYEA 5JQ8A 3OFMA 2HW6A 3DA6A 2XK7A 3CD8A 4JL9A 4W9XA 3ZFYA 2ITVA 3HP2A 3LFCA 3LCDA 1Q8UA 5HBHA 3V8SA 2EXCX 4XRJA 4Y72A 5GZAA 3G6HA 3ITZA 5HTIA 2JBOA 1H28A 5AP3A 1YRPA 2PVMA 3IDCA 4CTBA 5AP6A 4BCQA 1PXOA 4GEOA 2UZWE 4HPTE 4MBIA 4LV5A 3P1AA 3FPMA 2XNEA 3S1HA 5I3RA 3O7LB 3BEGA 4IJPA 3PVWA 3PSBA 4AFEA 1SVGA 2QC6A 2G2FA 1GNGA 3ZXTA 2G1TA 1IA8A 3MWUA 2WTKC 4Q5HA 3OEFX 2ETMA 3W2SA 4EJNA 5CEMA 4YZBA 1IRKA 2H96A 4AA0A 4QMPA 3DTCA 2JIUA 4MX9A 3I81A 4CZYB 1ZYLA 3MTLA 4IAYA 4XLVA 5HO8A 4R3RA 4KSPA 4OTFA 1XO2B 2C5OA 4RIOA 3I7CA 5AR5A 3LJ1A 4ACMA 3QALE 2GFSA 2C4GA 2GTMA 3FLNC 4U7ZA 4B4LA 1H1QA 4FZDB 4HGTA 5LMAA 5AEPA 4IZAA 3BQCA 2Y7JA 5IEVA 3BU6A 5IZFA 4GFMA 2DUVA 1Y6AA 3MVLA 2CSNA 2C6OA 5HVYA 3QFVA 2RG6A 4RRVA 5AUWA 4EUUA 1M52A 3AGMA 1YOMA 4FTTA 4IQ6A 3CTJA 4DCEA 1W0XC 5E1EA 5CEKA 4U6RA 4YNOA 3HDNA 3N51A 4QMLA 4FV5A 5IF1A 3F3WA 2WZJA 3KN5A 3TJCA 2UW5A 2PVJA 2V7AA 4HVHA 4CXAA 4FTUA 3VF9A 3V01A 4NFMA 4AAAA 2W1DA 4FUXA 4FF8A 4DGNA 3DJ5A 5D12A 4YTIA 4C4IA 3RTPA 5J7HA 4KNBA 4DG0E 1W82A 5DEWA 1BLXA 3PA3A 2R3IA 5HLPA 4LOPA 3EN7A 3R7UA 3CEKA 1J3HA 2QHNA 2UVZA 2Z7RA 5BVKA 5IU2A 4FKRA 3RCDA 4O6LA 3DT1A 2UZEA 3TTJA 3QTZA 4K2RA 3WF9A 1MP8A 2R3KA 2WTDA 5ANDA 1OITA 1U4DA 1R78A 3DK7A 4YJVA 1GZNA 2XNPA 4UYNA 3QHRA 5HG8A 2HIWA 2DQ7X 2QOFA 3LXNA 4HYUA 5TF9A 4D2PA 1XBCA 1UWJA 2E9PA 4I0RA 4RZWA 4IM0A 5L2TA 3EQDA 3R71A 2XIYA 1OPKA 2BTRA 4GJ2A 4I0SA 3OP5A 2ZB1A 2RIOA 3Q4ZA 5IDNA 1WVWA 4XJ0A 4O2PA 4MAOA 4MXOA 4XUFA 3TNWA 3RHXA 3QX4A 3MY1A 2WNTA 3BI6A 4LOQA 4FTAA 3I1AA 3HDMA 3GU8A 4R6VA 4PP7A 2FSTX 3DBQA 4L44A 5FEDA 2YDKA 2CN5A 5M55A 2XRUA 4EOPA 3R2YA 4GFGA 4DHFA 5GZ8A 1OM1A 4WD5A 4TXCA 5BUEA 4DGLC 3IDBA 3RJCA 4IZ7A 4AU8A 2F4JA 3C4EA 4MNEB 3W2CA 4R1YA 4OUCA 4FKPA 5ACBC 4EOOA 4Q5EA 2W1EA 2VTLA 3EN4A 3O2MA 4DGMA 5CAOA 4EZ3A 3QU0A 5KZ0A 3MTFA 4HJOA 2WB8A 5DN3A 3O8UA 3E8NA 3UNKA 3ODZX 1JSUA 2W5BA 4RJ7A 3SXSA 3HGKA 2YEXA 1M2QA 4YMJA 1JWHA 4NWMA 4YZDA 1MQ4A 3EIDA 4W8DA 4I20A 2R3PA 2R64A 1P4FA 3AG9A 5JGDA 3C0HA 3PP0A 4AT5A 1SNUA 3OC1A 4TNBA 4JS8A 4N6ZA 1Q61A 4M15A 3ERKA 1PYXA 3E7VA 1BI7A 4AP7A 5LVNA 3A99A 3NYNA 4F63A 2BAKA 4IVBA 4FKOA 2OJIA 2WOTA 3EOCA 4G3CA 4HVIA 4CFWA 4OAVB 1VR2A 3FZSA 1GJOA 3IO7A
chains in the Genus database with same CATH superfamily
3OWJA 2GNHA 3NNUA 3OBJA 4JQ7A 3U6IA 1WFCA 4YJRA 5M4FA 4BCHA 4LUDA 2OFUA 2G2IA 1OECA 4O2ZA 4QQTA 1LEZA 3FSKA 4G3GA 3EN5A 4Y73A 3SXFA 2XMYA 4I0TA 4EK5A 2B9IA 3L1SA 2XK4A 5FG8A 3ZLWA 2B53A 4USFA 3RNYA 4DEBA 4YJSA 2VTHA 4RX7A 4J96A 2X9EA 3FMHA 3PIZA 2HAKA 4H3QA 2WIHA 4FSQA 4IX5A 5EYDA 5EYKA 3VJOA 4Z7HA 4I6HA 3B8RA 4GYGA 4QMQA 2WPAA 4BDAA 1ZYDA 3IW8A 5IA3A 4DYMA 3A8WA 5CLPA 4IJ9A 3UMXA 4BYIA 2ZV2A 3FLQA 3OW4A 5CU6A 3KA0A 3L9PA 3PXKA 4QYHA 1V1KA 3CIKA 5AAGA 3MFUA 1LR4A 4QQJA 4UZHA 2BRGA 3LJ2A 4O91A 5IUHA 3FMMA 2C0OA 5E7RA 4ALVA 3VRZA 5CF4A 3HLLA 3CKWA 3TTIA 3LE6A 4F6WA 1FGIA 2ITTA 1PXJA 4FX3A 4R5YA 1YXSA 4OTPA 5AUVA 4TNDA 4O21A 3CY2A 4F7LA 3CQWA 1JKKA 1UU3A 4NUSA 4BF2A 4F9WA 2PHKA 1XBBA 1H01A 3P86A 3TWJA 3IGGA 4YTHA 2Z2WA 2XM9A 3DQXA 3QC4A 4BDKA 2UZTA 1YKRA 4IDTA 3ZU7A 4IIRA 3EQIA 4GT4A 4KIQA 1M2RA 5AP7A 5HCXA 2IW6A 1Q62A 1LUFA 3VS5A 3FZPA 1OPJA 3TV6A 1DAWA 5HICA 4BICA 3BKBA 1B39A 3EQFA 3KB7A 5H2UA 3V5QA 1TQMA 2ITOA 3KRRA 5HD7A 5ANKA 2C3LA 4ENYA 5TO8A 4NM5A 3D4QA 4ZJJA 4C62A 1OI9A 4XV3A 3K5UA 2ETKA 3CY3A 3U8WA 3VVHA 5BNJA 3NSZA 4HYIA 2VUWA 1QPJA 2Y4IC 4EK4A 1YWVA 3FMLA 4ZS0A 3SVVA 1M17A 4PTGA 5IA1A 4EOLA 4EH4A 4JIAA 3UNJA 3IS5A 2OBJA 1U59A 5D41A 2XP2A 3H9RA 5L3AA 1YOLA 4NTTA 2YIWA 4RLLA 3TEIA 1OKZA 3NUYA 1PW2A 5AP5A 3W10A 2JC6A 1JNKA 2ZJWA 3MJ2A 2W5HA 3Q6WA 5H3QA 5M51A 2GHGA 3GB2A 1OPLA 5FM2A 1UU7A 3I5ZA 2QU6A 2WD1A 5CENA 3SW4A 2ITYA 3HMPA 3R9HA 1M2PA 1YVJA 3NYVA 3A7GA 3LAUA 3ORMA 2W05A 4X21A 4DLJA 1WVYA 3P4KA 3CKXA 3OZ6A 4AGDA 3UP2A 3KFAA 3KULB 5JZJA 4KBAA 3UTOA 2YJRA 4XOZA 2BMCA 3A7FA 4FKJA 4B8MA 4FTQA 5EYMA 1YQJA 1CTPE 1RQQA 2CN8A 3QXPA 3MH1A 2YACA 5IH6A 2OJGA 4S32A 4IZ5A 1HCKA 1H0VA 1RJBA 2R3HA 5CWZA 4QPSA 3PVBA 3G90X 3R9DA 4OT5A 3RZBA 4D2SA 3KY2A 5EM5A 2OICA 2C6MA 4GK2A 1P14A 2HENA 5AX9A 2IZUA 1XHAA 5F95A 4XP0A 2WTCA 3HMOA 4QRCA 4PNKA 5LMBA 3O50A 4XG9A 2UW9A 5IA4A 4L67A 3UO5A 4AW0A 4YZ9A 2RG5A 3FMEA 3PXZA 1GY3A 4EHZA 3VJNA 4GRBA 4FT7A 4FTLA 2C68A 3HUBA 3UBDA 3GNIB 1A06A 3LFDA 5FTQA 4QP3A 5JH6A 4YJNA 3TNQB 1NVSA 1XBAA 5EKNA 1QCFA 3OOMA 4RIXA 4AW1A 2UVYA 2XIXA 5JKGA 3COMA 4RA5A 2W0JA 4KBKA 3DY7A 3PZEA 3TJDA 4EYJA 1WMKA 2XUUA 5CYIA 2CPKE 5HG5A 4JBVA 5A14A 2UZNA 5A46A 1Y57A 3IKAA 3UZPA 3GVUA 3E5AA 1Z57A 4FGBA 2XNGA 1U54B 5LWMA 4JX3A 1EH4A 1OL5A 5E8SA 5F4NA 5CU4A 1NXKA 2GNJA 4WOVA 3ZLXA 5HNBA 4H3BA 4TKSA 5AR8A 4YURA 4M0ZA 4O6EA 3RP9A 5CVFA 4GYIA 2WMXA 3ALNA 3LQ8A 3OTUA 3TN8A 4EC8A 2NP8A 3OOGA 4FTCA 4XOYA 1PKGA 3QZFA 3EHAA 2W96B 2X7FA 3NEWA 4FV8A 4H1JA 4FT5A 2XEYA 1PMVA 1QPEA 4EHGA 2BZHB 4GUEA 3GU5A 4FSRA 4L7FA 5FEQA 3UYTA 4BBFA 4D1SA 3R7IA 3DCVA 4E20A 3TNHA 2NRYA 1TZDA 3QTRA 4ZK5A 5M53A 4RBLA 2YAAA 2JD5A 4RIYA 4MD7E 3ZSHA 4DFXE 5CALA 5L8LA 3FZOA 4RWLA 2QURA 2GNLA 3CC6A 1BKXA 2XJ1A 2C1AA 2HW7A 3MB7A 5K0XA 4BCNA 3VUIA 1ZLTA 4AE6A 2QR8A 4J71A 4XP2A 1PXIA 3OWPA 3UIUA 4XNEA 3KRJA 5CU0A 2BIKB 3GOPA 2ZDUA 4KRDA 2VX0A 3KXNA 2VWZA 3DBDA 2V55A 2VWUA 2I0HA 3G51A 4U45A 4WNMA 4X6QC 2WEIA 3R7OA 3VBXA 4APCA 4ZLOA 5E8ZA 4GU9A 4G34A 5KKRC 3IQ7A 4FTJA 4DH1A 2I0YA 4EZ7A 4D5HA 2WFYA 2CGUA 4BCMA 5AAEA 4RC2A 3A7IA 4IX3A 2XJ0A 1JKTA 4RIWA 4Z9LA 2ITPA 1NY3A 2OZOA 3E7OA 3F3UA 4NW5A 2YAKA 3FMDA 3QLGA 1UVRA 4LRKA 2VTIA 4YC8A 5DHJA 4ZIMA 3BLRA 4D9TA 4ZTMA 4TWNA 4FOBA 3F5GA 4CFUA 3BEAA 2X8DA 4UY9A 3TACA 4QMNA 2OFVA 1GIJA 1H08A 3Q5ZA 4AX8A 4RLKA 3HA8A 5GZ9A 2FUMA 4R3CA 4P5QA 1WBSA 3MYGA 3BPRA 3O0GA 5CY3A 4QO9A 3U4UA 2UZBA 3PE2A 1QPDA 4KS8A 3A2CA 5AJQA 4HCVA 4NU1A 3DJ6A 2BCJA 4EC9A 3QA0A 3UC3A 4BDEA 3EFKA 4I1ZA 4ZXTA 2ESMA 4YGAA 5ANOA 2VO6A 3AMBA 3DAKA 5J5TA 4I3ZA 1WBTA 4C33A 2FO0A 4PDSA 3R7YA 1J1CA 3K3IA 4ONAA 4QTCA 2J6MA 4D28A 4PV0A 4X2JA 5HO6A 4YUQA 4IC7A 4PMPA 4Y95A 3OCGA 4K33A 4IVAA 3LPBA 4QMWA 4WSYA 5C9CA 3UO6A 4FYNA 4FTRA 1XKKA 1UKHA 1OIQA 2VWXA 4I5CA 4BCIA 4PUZA 4P90A 3ZBFA 3SHEA 2YM6A 1W98A 3O96A 4FKVA 4WUAA 3S0OA 2QKRA 1GZKA 2P2HA 5A6OA 5JFSA 1UNHA 4MXYA 3EQRA 3I5NA 4EH9A 4F6SA 5FWKK 2WU7A 4CEGA 3NR9A 4D1XA 2JAMA 5HE2A 4IXPA 3ZOSA 4M66A 4ZZOA 2YABA 4AFJA 4FV1A 4QP2A 4AZSA 2WTVA 2WO6A 4WNOA 1ZYJA 2ETRA 2ACXA 2X0PA 3A4OX 4YBJA 4ZLYA 5G1XA 2C6IA 2XB7A 4FKSA 4J97A 4EI4A 5HEZA 4RX5A 4PL5A 3VHEA 4PPCA 4TRLA 4AW5A 3S95A 5HNIX 5IH4A 1CKPA 4YSJA 1Q8YA 2OW3A 4EH3A 4FKTA 5T6KA 4JAIA 5T68A 3R9OA 4NZWB 4ZTSA 3UE4A 4ANLA 4IC8A 2ITQA 4S33A 4BCPA 5EDPA 3A8XA 4NH1A 1V0BA 1I44A 1PY5A 2JDVA 3EYHA 4KD1A 3FKNA 4LMNA 2IVSA 1KWPA 4OBQA 5D11A 1STCE 4U97A 3RK5A 4UMPA 5LVLA 3JVRA 5LMKA 2BTSA 4UXLA 5IKWA 1PJKA 5JRSA 4FL2A 4CV8A 4Y85A 3D5VA 1ZOGA 3F9NA 5D1JA 5IDPA 5AR3A 1AQ1A 2AQXA 4FZFB 5HIBA 5CI7A 1Z5MA 5KMOA 1H8FA 2F2CB 2ZDTA 3CS9A 2R3FA 4XHKB 4C02A 5CAQA 2VRXA 4H3PA 4E4MA 3DAJA 3BHVA 4AE9A 3NDMA 4RJ5A 5IH5A 4YJUA 4I22A 2KTYA 4XG6A 4YZCA 4DG3E 1YXXA 2VO3A 2F7ZE 2ZM3A 3A62A 4NIFB 3AGLA 4YBKA 2PVHA 2JKQA 4IAZA 2X6EA 2BUJA 3FI4A 4JVGA 1YXUA 3QRJA 2UW0A 4APPA 3GI3A 3D5XA 4E5BA 3WZJA 3Q3BA 2YCQA 4HYHA 3VQUA 2X1NA 2X7GA 3MW1A 2W9ZB 3CPCA 4G17A 5K5XA 2QOQA 4DITA 4AOJA 5FTOA 1KOAA 1NVQA 3NGAA 4XV2A 2W4OA 3TKUA 4JG6A 4R7HA 2J50A 3LZBA 4G6LA 4KWPA 1Q4LA 5HORA 4FBXA 4WRSA 3OY3A 4AA4A 3SW7A 5DR9A 1Y8YA 3QCYA 5TR6A 5M4CA 2W7XA 4EL9A 2OZAB 2XYNA 2G01A 3COHA 3OD6X 2Z7SA 4YC3A 3Q9XA 4EOQA 3VIDA 5J9YA 3SKCA 5LQFA 2F9GA 3NNXA 1FQ1B 3PY3A 2R3NA 3M11A 4IVDA 3VUDA 1TQIA 3PJCA 3F6XA 3U6HA 1AGWA 5A4CA 1ZAOA 3WF7A 2WIPA 3ORLA 4YJPA 4DEHA 4F64A 2W17A 3GFWA 1JSVA 3P0MA 3UOHA 4B7TA 2JITA 4MH7A 2P2IA 5EI8A 3IW5A 4LG4A 5E8WA 5FLFA 5DI1A 4Y46A 3FC2A 1SVHA 2X7OA 3L8VA 3AD6A 4BIEA 2JEDA 2O64A 4IVCA 3QHWA 3A61A 3PRFA 4FKLA 4FODA 3PA4A 3QD2B 1OL2A 3ZCLA 3WZUA 2QKWB 2W1GA 4A9TA 3HRFA 3Q52A 3FUPA 3PRIA 4TW9A 5HNGA 2QR7A 5AP4A 3R1YA 1O9UA 3UNZA 3VS7A 3ACJA 4ZTHA 3PPKA 4IWDA 3JYAA 4FZAB 4ALUA 3MPAA 4FL3A 4OTWA 3F61A 4X0MA 4UWBA 2X81A 2WMUA 1XH6A 4E6CA 1B38A 4UMTA 3LOKA 4AA5A 4JI9A 5A4TA 4D58A 1H26A 1OB3A 2PSQA 3F5UA 4JG8A 4HOKA 3RM6A 3T3UA 4G1WA 4AZFA 2VV9A 1U5RA 2IW8A 4RWIA 2VTOA 3NWWA 1URWA 2GFCA 4FSTA 4F4PA 3DJ7A 3Q9YA 1SM2A 3EH9A 3EN9A 3GCVA 4TTHB 5AP1A 3ZYAA 4AT4A 4OAUC 5E1SA 2WTIA 4C7TA 2UW7A 1Y91A 3BV2A 4PY1A 1W8CA 2PMNX 1J91A 3JVSA 3RHKA 3ZUUA 3UIBA 4F6UA 3HRBA 4U41A 3MV5A 2C6TA 3F3ZA 2BDWA 2ZOQA 3WOWA 4CMUA 3AQVA 4FK6A 4ZSAA 5K0KA 4TWOA 3W2QA 4BIBA 5CXHA 5I9VA 4BL1A 2ZV8A 2SRCA 2A19B 1G3NA 4K6ZA 3ZM4A 5D9HA 2G2HA 3W2RA 2PVRA 4X2NA 4ZTRA 3V5TA 3ELJA 4CFNA 4YTCA 3Q9ZA 4KA3A 4L01A 2QOKA 5HVJA 3VUMA 2HWOA 2UZDA 3KCKA 3QQFA 3RMFA 3ZO1A 3NUXA 2XBAA 3G0FA 2GNFA 3Q4CA 4JQEA 4RT7A 4YSMA 3FQHA 5BPYA 2PE0A 2IJMA 3RBWA 4FIJA 2W9FB 4YNEA 3F5XA 4GCJA 2PL0A 2XCHA 3RNIA 3FMNA 5FBOA 4D4YA 3DKGA 3FXXA 1H00A 3R01A 3ETAA 3GGFA 3QZGA 3W2PA 3ZEPA 3WE4A 1TVOA 4KIOA 3WBLA 4NW6A 3QTIA 2HXLA 3KF7A 3ZTXA 5M44A 5AUUA 1IASA 2JKKA 4QTDA 4U8ZA 4FIGA 3EL7A 2BRNA 2NO3A 5CU3A 4JBPA 1GIIA 2FYSA 4DINA 3OW3A 3PIXA 5AR2A 3VW6A 4MKCA 4JAJA 3E62A 4FIIA 2EU9A 3CTQA 5ANIA 1A9UA 4GVJA 1BUHA 5CAVA 3IK3A 5D7VA 2IEWA 4C38A 4E73A 5KO1A 5E92A 3R28A 3TUBA 4XG2A 3G9NA 4YLLA 4RGJA 4ZAUA 4K1BA 5KBRA 3KC3A 4ANSA 4CLIA 4QP6A 1QL6A 1ZMVA 2YIYA 4B0GA 4WG5A 3UQCA 5LMKC 5IA2A 2VWBA 2O0UA 4R5SA 3LFFA 2RGPA 3DU8A 3DGKA 4GK3A 4ZTNA 3I4BA 4JJRA 4BCFA 1T45A 2F49A 3ANRA 3IOPA 1ZXEA 3M1SA 3ORNA 4GIHA 5CI6A 3GT8A 3QGWA 5FD2A 4UALA 4TYJA 3R7GA 5G6VA 2HY81 4EH7A 3KQ7A 3Q53A 4OTHA 4PP9A 4PNIA 3P23A 2WTKB 3R8VA 2Q0BA 3BCEA 1HCLA 5HE3A 4EQUA 4BDGA 3TUCA 3M2WA 4J7BA 4GMYA 2VTAA 3NNWA 5KBQA 1H4LA 4X3FA 4EH2A 2VU3A 3VQHA 5CVHA 4Q9ZA 3DBEA 2ITZA 3H3CA 3H0ZA 3Q4TA 1O6LA 1YW2A 4ZY6A 1FVTA 1QPCA 2O2UA 2UZLA 4JDJA 5EDQA 2P55A 5J1WA 4LUEA 5LJJA 5EOBA 2WXVA 4GIIA 3MVMA 4JDKA 5JEBA 4FSWA 3FC1X 3DQWA 4M67A 4NKSA 2YITA 2BZJA 4M69B 2XK6A 4D1ZA 4F9CA 3BYVA 5A4QA 1ZY4A 2X8IA 3HNGA 2QNJA 1YDSE 2YLFA 4O0VA 4QP9A 3UODA 2H9VA 4U43A 4XG4A 4D2RA 3BBWA 5DH3A 2OSCA 4MVFA 3UVPA 4F08A 2GHMA 2GPHA 2JDTA 4NSTA 5AWMA 1DI9A 2V22A 4W4XA 4ACDA 3DLZA 2OIDA 4I41A 4RJ8A 4RWKA 5BMSA 2C5YA 3O17A 2QLQA 3RI1A 5CF8A 3S3IA 4DFLA 2W1HA 5DNRA 3BHTA 1OKVA 2WTJA 2IVUA 4DFNA 2QG5A 4U80A 5EI6A 3VBWA 4DFZE 4U79A 1T46A 3C50A 4CRLA 5I9ZA 4F1TA 4IFCA 1FMKA 1ZOEA 5EW9A 3RPSA 1SNXA 2CLXA 4CSVA 3RM7A 2W1CA 4Z55A 3QUEA 2LGCA 2UVXA 4FVRA 5CZHA 4A9UA 3RALA 4O1PA 3NW6A 4LRMA 3QCXA 3ZO3A 4DAWA 2C3KA 1M14A 3POOA 2WMBA 4QMUA 1PXNA 1WBNA 2HZIA 5C03A 3TIYA 5BYYA 2QI8A 4D0XA 1WAKA 3ZFMA 4ANOA 5AADA 3IECA 1UKIA 3AMAA 3EQBA 2UW8A 3C4WA 4CCUA 2QOIA 3C9WA 2BAJA 5B2LA 2IZTA 3LLTA 4J8MA 3CR0A 3TUDA 4DGOA 1MUOA 3UQFA 1ZYCA 4KKHA 4C4JA 3P7CA 4IDVA 3KMUA 4MCVA 4EEVA 2J90A 3PIYA 3OT3A 2X9FA 3BYMA 2EXMA 4G9RA 4LGDA 3SLSA 2VTQA 4EZ5A 3UG1A 3KK8A 4FVPA 3R22A 5DLSA 2UZUE 5HBEA 3TNIA 2B55A 3KMMA 1FINA 2WOUA 4FKIA 4FEQA 2Y8OA 4A4LA 3C4ZA 2JBPA 4HYSA 1BYGA 4F7NA 3FY0A 2HY0A 3OCSA 5DIAA 4ZY4A 3OUKA 5CAUA 2WMRA 3Q04A 4N0SA 3CE3A 2I40A 2F57A 3FLZA 3BLHA 4IAIA 4U44A 3C51A 4ZSGA 2J0MB 1UV5A 2BFXA 2W99B 5CTPA 3R7EA 2C6LA 4HCUA 3PG3A 3ZSGA 4O4FA 3R02A 3QUDA 1REKA 4ZY5A 3JPVA 4G6NA 3ENMA 1KE6A 1H1WA 4OTRA 3BGPA 4LRJA 1W84A 3QRIA 3JS2A 2OO8X 2R3LA 3P7AA 4C4GA 1H25A 2PE1A 4J95A 5JGAA 3D94A 2AUHA 3BGZA 3G33A 4I92A 3SA0A 2YM4A 4UWCA 4BI2A 2VTNA 4KKEA 4HZSA 5AV1A 3VO3A 2GS7A 4G2FA 3ODYX 4EK6A 2VX1A 3II5A 4EOKA 1VEBA 3R7VA 2VTMA 3R2BA 1AD5A 3RAWA 3QD3A 3WYXA 5AV3A 3L8SA 3MA6A 4FC0A 4GU6A 3D7TA 2R9SA 3U87A 4ITJA 4JRNA 2F2UA 2ZVAA 3I60A 4O1OA 2BROA 4R7IA 4ZSLA 2IVTA 5J95A 4TYHB 4PDOA 4XBRA 3PSDA 4P7EA 5E8XA 3THBA 3KKVA 3UPZA 5C27A 4QMYA 3BYOA 4JDHA 4XX9A 2HCKA 3REPA 3QZIA 5C1QB 3R0TA 3LW0A 4C57A 4JG7A 4BYJA 2R3JA 4IAKA 3VHKA 4ARKA 4I23A 5A6NA 2WQEA 1H1RA 1YWRA 1W7HA 3DLSA 3MJ1A 2YCRA 4LYNA 5CEPA 1R0PA 2QOOA 3UGCA 4I5HA 4QTBA 2EB3A 2ZYBA 3UQGA 4JIKA 4BCGA 2QQ7A 2WQMA 3G0EA 4JBQA 3PJ1A 5DOSA 4D4RA 4XV1A 5GNKA 1H1SA 3ROYA 3FYKX 5DT0A 3RVGA 3MPTA 5EM7A 2IO6A 3KXGA 3UMWA 5L6OA 4BC6A 3FYJX 5DE2A 2C5VA 2VO7A 4DH8A 4FZ6A 4I5PA 3D7ZA 3L9MA 3KRWA 3VW8A 4AUAA 3R8ZA 4BZNA 4PPBA 3L9LA 4WT6A 4EK8A 2PVYA 2H34A 3QQJA 1XH4A 2GSFA 2W4JA 4AQCA 3MDYA 2XBJA 4XV9A 5TE0A 2W4KA 4IADA 3SAYA 5AX3A 1OGUA 3G5DA 3UP7A 1YDTE 3QC9A 4DBNA 3K2LA 3QQHA 5L2SA 3O51A 3DPKA 4BDFA 3OXZA 4TT7A 5AM7A 1TKIA 2UV2A 3ZUTA 2GCDA 3R1QA 4D0WA 4BTJA 3AC8A 4ZLZA 4X3FC 1R0EA 2GHLA 3L9NA 5CAPA 2EXEA 5A4LA 4ZTQA 4TN6A 4TYGA 2C5NA 1XJDA 3RAKA 5HESA 3GCQA 4YP8A 2Y4IB 2Y6MA 3W18A 3KRLA 5L6WL 2V62A 5IPJA 3E93A 2QOHA 3HEGA 3OHTA 1MRYA 5I3OA 2PWLA 3D0EA 3B2TA 4O0YA 4AN3A 3A7JA 4G5PA 5ETIA 4FSNA 3Q6UA 4RX9A 3DKFA 3F7WA 1OUKA 4L43A 3KK9A 1YI3A 3RWQA 4H39A 4DLIA 4YHJA 1V0OA 3R30A 3BHYA 2EB2A 5H8BA 3DOGA 3ZRLA 2X4ZA 3BQRA 4C37A 5IA0A 1DAYA 5K4IA 1BMKA 5H9BA 3UVQA 4AOTA 3FBVA 2Z7QA 3FLWA 1YHVA 1CKJA 4JDIA 2PMOX 2VNWA 4L8MA 3VBTA 1JKLA 4J8NA 1H0WA 3VRYA 2W06A 3MSSA 4DEAA 3KXMA 3LXKA 2G15A 5K9IA 5F1ZA 3IG7A 3PXFA 4A4XA 5CSPA 5HVKA 3UIXA 2PZPA 3HZTA 3HRCA 3ORTA 1IG1A 5CANA 3EL8A 4FKUA 3WE8A 2JFMA 4BWKA 5DEYA 4M12A 4FTOA 4QQ5A 4U40A 5DRBA 4D4SA 4F09A 2A4LA 1OMWA 3DB6A 2BALA 3DFAA 5IA5A 4EQCA 2XKCA 5EHOA 2WHBA 3VUKA 4IH8A 2OGVA 4XYFA 2HXQA 5AM6A 3CQEA 4CYJA 2X8EA 4FI1A 2CCIA 3DFCB 3SC1A 2Y6OA 3I6UA 1TQPA 1CM8A 3C5UA 3WIGA 2VWVA 1W2DA 5E8YA 4EONA 1R3CA 2AYPA 4NJDA 3MVJA 4QMZA 4D2WA 2J0LA 3QLFA 4E3CA 3U6JA 4KS7A 3O8PA 2X0GA 4R8QA 4X2KA 4X6RA 4U42A 4AZTA 4EWQA 1Q41A 5EYCA 1PXLA 4H58A 4U5JA 4O96A 1Y6BA 2BDFA 4Y5QA 5F20A 5BVWA 4AWIA 4BZOA 4CFVA 5C26A 4WNPA 4TZRA 5F9EA 5TKDA 3GCPA 3AC5A 5HCYA 2YFXA 4FOCA 4BBMA 4HGEA 2Q0NA 3Q4UA 3K3JA 1ZZ2A 3OWLA 5JFWA 4AACA 3CQUA 3QCQA 3QZHA 4L00A 2PZ5A 3SRVA 4EHEA 4QYYA 3DZOA 3FHRA 2J0IA 4MNFA 2RL5A 2JFLA 2BVAA 4OGRA 4Q2AA 3NYOA 3F3TA 3OROA 4FG8A 1PXPA 4EKLA 3IGOA 2J4ZA 1W83A 3FE3A 3AXWA 4M3QA 4U9AA 2GDOA 3EQPA 5ETCA 3FPQA 2OIBA 3NAXA 3QWKA 2GS6A 4L3PA 4MWIA 2JIVA 4NTSA 4UBAA 2XYUA 4PTEA 4YO4A 1OUYA 4LOOA 3GBZA 3R8UA 4ACHA 4NM0A 3L8PA 5CS6A 1VZOA 3QWJA 3WARA 3QGYA 5CNOA 3TCPA 1JAMA 2FH9A 5EOLA 1H24A 5KMLA 3TZ7A 4FR4A 3QYZA 3LFQA 3PJ2A 3LCKA 4NEUA 4P2KA 3GU6A 3ZC6A 4ZEGA 5L8JA 3ZLSA 4CQEA 2UW4A 3TZ8A 5IEXA 4BTKA 3PJ3A 3LQ5A 5FP5A 4TPTA 4U0IA 2VD5A 2XKFA 2OXDA 3CP9A 3A4PA 4WUNA 3PY1A 5KHWA 3SX9A 3EFWA 4LMUA 3M42A 4NM7A 3F88A 3OCTA 4CFXA 3QD4A 3CXWA 4ITHA 1PMUA 4K18A 3R00A 5CSXA 3GP0A 5HI2A 2X2KA 4W4WA 3SXRA 3VNTA 3PSCA 4A9SA 4BKYA 4BIDA 4L45A 4C0TA 4MXZA 5CSHA 4E6DA 1JBPE 2WQOA 2ZV9A 4BZDA 2VN9A 3NW5A 3PUPA 1IEPA 3DDPA 3P08A 2ITNA 2V7OA 2GQGA 3IW6A 4G9CA 4O0WA 3JY0A 4FSUA 4F7JA 2VGPA 3QKLA 2PTKA 4BHZA 5HX6A 3ACKA 3HKOA 5JRQA 2DWBA 2IWIA 3NNVA 5A54A 5KMMA 2CHLA 3MH3A 4OTIA 2YIQA 5KUPA 2CCHA 2JDSA 5AUTA 3H30A 3EFLA 2UZOA 3LHJA 4A7CA 4FIHA 2YHVA 2XK9A 3GFEA 4QPMA 1Q24A 2Z7LA 3GC9A 2GTNA 4IB0A 3DB8A 3PZHA 4G5JA 4JOAA 4CD0A 3OTVA 4FV3A 4BTFA 4TY1A 3P78A 3UG2A 3V8TA 4QTEA 4CMOA 5HX8A 4Y83A 3LM5A 4YHTA 4ERWA 5CSVA 3ORPA 3TG1A 5HU9A 4CFFA 4HVGA 1XR1A 3AT2A 5KKRB 3FDNA 3HV3A 4ANNA 4BDBA 4EH8A 3KU2A 4EQMA 5CEOA 2G9XA 4BI0A 4MXAA 4M68A 3IW7A 5EKOA 4XBUA 3LFSA 4I6BA 5B0XA 3FQEA 3PPJA 3AOXA 4E4LA 3VBQA 1M7QA 2A2AA 3HMNA 3R9NA 1ZMUA 1ZRZA 3ULIA 4BDJA 3DKCA 4IFGA 3LXLA 4LL5A 2YM7A 4S30A 3RZFA 2FVDA 2WQBA 4C34A 4EH5A 4L3JA 3ANQA 3CLYA 1GZOA 1RW8A 1K2PA 2R3MA 3NZ0A 3WIKA 4H1MA 2OF4A 3COIA 5K4JA 4CQGA 1JLUE 2YCFA 3O71A 2RFNA 2X2LA 4X2FA 5J79A 2CMWA 5HCZA 2GU8A 4U81A 3ZO4A 1JPAA 5FQDC 3NIEA 3ORIA 3BIZA 4IACA 2P33A 3W33A 3CGFA 1LP4A 3U9CA 3UVRA 1BI8A 3C1XA 1XH5A 4O0TA 3K5VA 5EDRA 5AR4A 2XK3A 4LQMA 1SVEA 4ANBA 1V0PA 2XZSA 3KGAA 2PUUA 4USDA 5KHXA 3POZA 3QAME 5AA9A 3MB6A 4OTQA 3D83A 4PL3A 5CNNA 1OVEA 3L8XA 4XG7A 3SD0A 1E1XA 1ERKA 4F0FA 1MRVA 2C3IB 5C8MA 4ID7A 4BCJA 4MNEA 2X39A 5FM3A 2ITWA 5LCKA 3QKKA 3QBNA 4RFZA 4BFMA 4MD9E 4FZ7A 2E9NA 2IZRA 4I21A 3BYSA 1XQZA 3DBCA 3FZRA 2W1ZA 2XKDA 4BRXA 2YISA 4YO6A 4BGGA 1I09A 5ANEA 4FKWA 4QQCA 2YM5A 3HV6A 4RFMA 2XA4A 3W2OA 2JIIA 4CKJA 3EJ1A 4MTAA 1YOJA 2BFYA 2A27A 2I6LA 3R04A 3HV7A 3MBLA 3PXYA 2B9JA 2BHHA 3E8CA 2RFDA 4O0SA 3V5WA 3R21A 2F7XE 4CZUA 1FMOE 1K9AA 4NT4A 5ANGA 5M4IA 3I79A 1YI4A 3HYHA 4AZVA 3EQGA 4RIXB 3PE1A 4BCOA 3E87A 4L6QA 2HYYA 4BVUA 3QKMA 3FJQE 3JY9A 4O22A 5AV0A 3FLSA 3C13A 3AC4A 2XEZA 4AG8A 5HOAA 3VULA 4FKQA 4HW7A 1YXTA 2R3GA 5A4EA 3GC8A 1E1VA 2ERZE 2QODA 3S2PA 3F7ZA 4BKJA 4MYGA 1YXVA 1WVXA 4QYGA 2OKRA 4AOIA 5AUYA 1YI6A 3OXTA 2ZM1A 3SOAA 4RVTA 3PY0A 2RKUA 4UXQA 4RFYA 4WA9A 4TYIA 3RPVA 3FI3A 5JSMA 3DZQA 5EM8A 2B1PA 2ZV7A 3PXQA 2WKMA 2X0OA 2WGJA 4L42A 5T3QA 1IR3A 4AW2A 5CVGA 1UNGA 2I0EA 4MEDA 4OT6A 4F0IA 4G6OA 2PMLX 3VF8A 3BE9A 3QXOA 3VUTA 3RPOA 2XNNA 5B2MA 2W5AA 4YPDA 1Q97A 3PA5A 4PF4A 4AGUA 5L2QA 3MH0A 2XH5A 5CEIA 4FV6A 4RIYB 1UU9A 3H4JA 4PMTA 4YC6A 3ZZEA 3D5UA 5ACKA 5C8NA 5FEEA 3B8QA 1WBPA 5EFQA 4GT5A 3TZMA 4WKQA 2HZNA 3Q2MA 4Z7GA 5GHVA 5EW3A 1OL1A 4CTCA 5GJFA 4ALWA 3AD5A 4F99A 2QD9A 1P2AA 3IOKA 4UEUA 5A3XA 4CT2A 4M0YA 5JGBA 1KE8A 4FT9A 4ASXA 2ERKA 4FV9A 4BB4A 1ZYSA 4FG7A 4RWJA 3GCSA 1Q3DA 3ZDUA 3DXNA 3DDQA 1YWNA 2O65A 3C4XA 3MN3A 4DH7A 2CGXA 4EOSA 5ETA