3VUTA

Crystal structures of non-phosphorylated map2k4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
247
structure length
203
Chain Sequence
QKQLLMDLDVVMRSSDCPYIVQFCMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 4
publication title Crystal and solution structures disclose a putative transient state of mitogen-activated protein kinase kinase 4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 203
sequence length 247
chains with identical sequence B
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vutA02
4N70A 3MFRA 4A9TA 4FIJA 2XIRA 3PPZA 1APME 3EQFA 3QX2A 2R3OA 2FO0A 4O0UA 3V51A 4I5HA 2C0IA 5EI8A 3PXRA 3LM5A 3KCFA 1PW2A 2J0LA 1PYEA 4NW5A 4OT6A 2WQEA 3H9RA 4H39A 4MQ2A 3RK9A 5HLWA 1H4LA 3A7IA 2XA4A 4FTCA 1FVTA 2YM7A 4FSNA 4JDKA 3F6XA 4FG8A 5EKOA 4EHGA 1OPJA 2B4SB 1OL7A 5LARA 4EZ3A 1P14A 3PY1A 4RWIA 4B9DA 2FH9A 4O6LA 3ODZX 3PIYA 4XG7A 3I0QA 5IA4A 3ULIA 3EFJA 1Q5KA 4LRJA 2OSCA 4M97A 4PDPA 4EOQA 4QD6A 5EFQA 3G5DA 5BVWA 1H00A 4TN6A 3SOAA 3R7VA 1I44A 3EJ1A 2RIOA 3VUHA 3ZRLA 2VZ6A 2JFLA 2YHVA 5HTCA 3UODA 2NRYA 3AD5A 2RG5A 4MEDA 4X2JA 3PJ2A 1H1QA 3LCTA 2W9FB 3DZQA 4U7ZA 5CSVA 3BWFA 3RCDA 5AV0A 1Q8UA 4D0XA 4EWHA 4XLVA 4PF4A 3NAYA 3BELA 5ETFA 5KHWA 4GEOA 4YUQA 4V0GA 1GAGA 4XG6A 4YP8A 1O6KA 3PSDA 4RX5A 5FP6A 3LW0A 4FSTA 3S00A 2JKOA 2WQNA 3FSKA 3R1YA 4ZSEA 3MW1A 3VS3A 5LVMA 5M56A 4BZOA 3U9NA 3F88A 4I22A 5CAPA 3PPJA 4YNOA 3OXIA 3R6XA 3KULA 3FZRA 2IW8A 5BVOA 3SA0A 1YWVA 3QTUA 4P5ZA 4GK3A 4DC2A 3RZBA 2J5FA 3EQRA 1U59A 3GFWA 2UZUE 2OJGA 3NX8A 5E8WA 2GHGA 3MIAA 4LMNA 3AT4A 4U40A 4GG5A 2R3PA 2VTIA 4N6ZA 5CZIA 4EOKA 2X8EA 3LXKA 2YIXA 4G6LA 4BGHA 3WF8A 4MX9A 4C57A 4E4LA 3SLSA 4B4LA 3D9VA 3O23A 3DCVA 5ANIA 4C4GA 4EZ5A 3Q04A 3R8VA 3F5GA 4XV2A 4AN9A 1QL6A 4GFOA 5J7HA 3D7TA 5CNNA 4WBOA 3TV4A 4USDA 5K4IA 2QHMA 3LQ5A 3GC9A 2YCSA 1GZKA 3EB0A 5ANOA 3RAWA 2R3HA 2C5OA 1G5SA 3CIKA 5CT0A 4JI9A 4Q9ZA 4ZY4A 4ACCA 3RGFA 4FIHA 3H9OA 3SX9A 5CEIA 3U6IA 3RPVA 5HVYA 3OEZA 5B7VA 3P7CA 5DH3A 2XKDA 4RQKA 3O7LD 1BL6A 4PQNA 3QCXA 3R01A 3BQCA 5EI2A 4AT3A 2VX3A 3NDMA 5F1ZA 4DFNA 4DEIA 3DBCA 3QQUA 2BALA 4HVIA 4UX9A 5BUJA 2UZOA 2G15A 1YI6A 5KUPA 3EKNA 3NNXA 2BKZA 4F99A 1YOMA 4ENYA 3A4OX 3EH9A 3DBDA 5H8EA 4BTKA 3BYUA 5TKDA 4F1OA 4IVBA 1Q24A 2QODA 3F61A 4CT1A 3HMOA 3CD8A 4B0GA 1FMKA 4C3FA 1OIRA 1ATPE 3T3UA 1ZLTA 2RFDA 3EHAA 3NS9A 3V6RA 1Y8GA 2G2HA 2ETMA 3ZM4A 4BTJA 2XNNA 4BI2A 3KA0A 3VJOA 3RNIA 3BRBA 3BE2A 4RLLA 3KXHA 2EXCX 2J90A 2YERA 4H58A 4FYNA 4XV9A 3RNYA 5J1VA 5ETAA 4JXFA 2OI4X 2H9VA 3R7GA 2AC5A 4AG8A 3PJCA 3PG1A 3AGLA 3LHJA 4IHPA 3ZLXA 3L8SA 3RZFA 4ZZOA 4FSMA 4OTFA 5GNKA 3BPRA 4FTRA 5HE2A 3C0HA 5JK3A 3CQWA 4TYIA 1DI9A 3CKXA 3JY0A 3F3VA 4IE9A 4Y83A 3MVJA 4MF1A 3Q9YA 3I6WA 4R1VA 2UZDA 2GTNA 3FWQA 3OVVA 3OXZA 3FMMA 4TXCA 2XYUA 3UO5A 2IW6A 1BUHA 3KVWA 2VU3A 3MH1A 2R3LA 3GCQA 3PRFA 1XH4A 3PXZA 3OY3A 3Q9WA 4W9XA 2XIZA 4GJ3A 2NO3A 4XBUA 1XH8A 1Y6BA 3TZ7A 1PXLA 3WF6A 1Q41A 4ZTQA 4QP1A 5FEEA 5K5XA 3KGAA 1YRPA 4O0YA 2JFMA 5E8XA 3RK7A 4WG3A 4M68A 5ICPA 3D14A 5DN3A 3TV6A 2OO8X 4BBMA 3QD3A 4JQ7A 3OC1A 5F94A 2GTMA 3HP2A 4UZDA 3CGOA 4YR8A 4JBOA 1GY3A 3W2SA 3BYVA 4WUAA 3VS4A 4HCUA 4ANQA 4QYYA 1IEPA 3KXGA 3C4WA 2GNLA 1FVRA 4HVSA 4C2VA 3R2BA 1P5EA 5AUYA 1JKKA 2RGPA 3DU8A 4GJ2A 5IEXA 2GHMA 3DB8A 3Q53A 4LUEA 4M12A 3DDPA 3ZDIA 3G9NA 3BLRA 5T68A 4FKLA 2I0EA 4A9RA 3TJCA 3O50A 3FL4A 5F9EA 1F0QA 4KBKA 4MAOA 4WUNA 4S31A 4D28A 2B9JA 3FZTA 2YCQA 3QKMA 3AC5A 4JG7A 5L8KA 5EI6A 2FVDA 2W1HA 3AD4A 3DTWA 4BWKA 2CLQA 3QRJA 4ZAUA 2QLUA 4KKEA 2OU7A 3I7BA 2UZBA 3EN6A 4C7TA 4ONAA 1UKIA 4UEUA 4CFWA 2R3QA 3G6HA 2CN5A 4BFMA 3NUYA 3JUHA 1OIUA 3T9TA 4EZ7A 5KKRC 3OTUA 4OT5A 2B54A 4I0TA 3E3PA 4RJ4A 2FB8A 5BVFA 3IDPA 2Q0BA 3NYXA 5BYYA 4I92A 3VHKA 4UYNA 4E4XA 1YDTE 4WSQA 3IGGA 3UBDA 4V01A 2PHKA 4AF3A 4BCNA 1H0WA 2X2LA 3H0ZA 3FLYA 4GT3A 4YJNA 3CE3A 4BDHA 2QOIA 4GCJA 5AUTA 3EL7A 2FUMA 3W16A 3CCNA 3JYAA 4M0ZA 1O6LA 2Y4IC 1XH7A 3B8QA 4QP6A 3UE4A 4CD0A 1QPCA 5D9HA 3V5WA 4FNXA 1OUKA 3B8RA 2IVSA 4CZTA 4W8EA 4I5CA 1O6YA 4HVHA 4WHZA 1NVQA 1YKRA 4Z55A 4FTOA 3K54A 4DEGA 4ANSA 3C9WA 3HRCA 3CTJA 3KVXA 3KRRA 1FOTA 4RWLA 5EYMA 4A4OA 5JSMA 4BZDA 5A6NA 1S9IA 4QMOA 3LJ1A 5CU3A 5DT0A 3QU0A 4BN1A 4HJOA 2XNGA 3NAXA 4YC6A 5IEVA 2F7XE 3GU8A 2C47A 4FKVA 1PF8A 1SVGA 4D2PA 4U9AA 4JAJA 2QNJA 1FVVA 1V1KA 2WTIA 1Q97A 3I81A 4F0FA 3I1AA 3MA3A 3UDBA 5F20A 4ANNA 4RPVA 3IW7A 4XG3A 5CLPA 4II5A 4TY1A 2VTAA 3RHXA 2VV9A 3N9XA 4MYGA 3VBQA 5DR9A 3S3IA 4DEAA 2YAKA 4MNEB 1URCA 2EUFB 1H07A 4UXLA 3THBA 3V5TA 1VYZA 2BZJA 3EQIA 3KB7A 3P7AA 3TWJA 3UYSA 3VS6A 2UV2A 3W33A 5DFPA 4MKCA 3V01A 4FKRA 2WU6A 2XJ2A 3ZO2A 4FBXA 1YXXA 3VC4A 4BCKA 4BIDA 1LPUA 5JMSA 2FSOX 4OTQA 3RHKA 3NUUA 3ORPA 2XEZA 4I24A 5T6KA 3ROCA 3IKAA 3KEXA 3FAAA 3R71A 3MH3A 5AADA 5CWZA 2YM6A 1W84A 1J3HA 3ZFMA 2OKRA 4MD8E 2AC3A 4TRLA 4DFLA 5G1XA 3QQLA 3V8SA 3DY7A 5C01A 2R5TA 3G90X 1J1CA 3MVLA 4FT5A 4R5YA 1MQBA 1OIYA 4FV9A 3VRZA 3U87A 3EZRA 5JRSA 3MN3A 3NW6A 4M69A 2VTSA 5IG1A 4G17A 3KCKA 2X2KA 5HVJA 4DBNA 4O0RA 3ZEPA 4QP9A 5J1WA 4RGJA 1PMVA 3AC1A 3C4FA 3HUBA 3PRIA 4YTHA 3LVPA 5HG9A 4GVJA 2O5KA 2E9PA 3HV6A 1GNGA 5A6OA 5M44A 4DINA 3B2WA 3QGYA 4IADA 5HE3A 3NUSA 2FSMX 3HUCA 2HY0A 4K2RA 1YWNA 2H8HA 3OF0A 4E6QA 4MXOA 4BICA 3SXSA 3P9JA 3LZBA 4FNWA 2P4IA 4YO6A 3BEAA 5E8YA 4YHJA 1JAMA 4L53A 4B7TA 5I9ZA 2JIUA 4ASEA 3F82A 4WNKA 4ERWA 4W4VA 1WBTA 2VGPA 4Q2AA 5D10A 4FZFB 2BMCA 3HDNA 5LXMA 5C9CA 1M7NA 2GCDA 5LVOA 4FV3A 4QTAA 2PMIA 3OUKA 5FXQA 1GZ8A 4FOBA 1M17A 3C4EA 2QU6A 3HMNA 2W1IA 3BQRA 4MK0A 4ASXA 3HLLA 4V05A 4TWCA 2BFYA 3FZ1A 4NFMA 3AT2A 3DJ5A 5AR8A 4I4FA 4IWQA 4EK8A 3FI3A 3OOGA 3AC4A 2B52A 3MV5A 3U4UA 4F9BA 4EK3A 2J0MB 4X6QC 4I21A 3VBTA 3F5PA 3P0MA 4CMOA 3E64A 4YJUA 5AV2A 4J1RA 4QP3A 4D0WA 2HIWA 4YPSA 4RVKA 2QKRA 4PL4A 5EOBA 3VS5A 5BVKA 3WYYA 4C62A 3UJGA 1Q3DA 3QTRA 4IAIA 3V3VA 4PNKA 3VHEA 1M14A 2UZEA 4EWQA 1U46A 1VJYA 3SRVB 4R7IA 3KXXA 3ZZWA 3LFFA 1OL1A 3PG3A 4YJSA 3W8QA 2P2HA 5AR5A 3MPAA 3UIMA 5J8IA 3TNWA 3FI2A 2YZAA 2ZMDA 3BWJA 5DEYA 4IAZA 2CSNA 2PMNX 5C8KA 3KXMA 3JS2A 4LGDA 3A7JA 2E9OA 3T9IA 5CASA 1ZY4A 5D7VA 4KD1A 3GOKA 4LL0A 3VRYA 3W10A 4IX3A 2IZSA 2X8DA 4C02A 4L46A 2WMRA 3RPYA 5G6VA 3LFCA 1XJDA 3LM0A 2YA9A 3VBVA 2ITQA 2YACA 3MY5A 3RAHA 4G16A 3GU6A 3BU3A 2YIWA 3DKCA 4ASZA 2Y4PA 3KXZA 5BYZA 3FMJA 2HZ0A 4RSSA 4EOSA 2X7FA 4UXQA 5DR6A 2J9MA 2YIRA 5AP7A 4BWPA 4ENXA 3ANQA 3FUPA 5K3YA 4L7SA 5HCXA 3PPKA 4ZSGA 3WZDA 2J5EA 4KBAA 1W0XC 2UZLA 5T3QA 1MP8A 3BYOA 3MB6A 2IVVA 3QALE 2XBAA 3RM7A 3RPOA 4D2RA 3BBWA 4E4NA 2BAQA 2QKWB 3TV7A 4UWBA 3D5UA 4IX5A 4RFMA 4Y46A 3UO6A 3DJ7A 5KMNA 1BX6A 3QTSA 2W0JA 1JSVA 3EFKA 4FT0A 4H3PA 2OXXA 4TNDA 3ZTXA 2X6DA 2HCKA 3FKLA 3DFAA 4BDIA 5DPVA 3LJ2A 3EQCA 2UW4A 5CSXA 3RPSA 4AW5A 4BHZA 2V7OA 5HNBA 5KZ0A 3AC3A 3HV3A 3NNWA 5IEYA 3ZHPC 2R3FA 4AT4A 2R2PA 1UU9A 5KKRB 4FODA 3FC2A 4J95A 5GZ8A 4ACMA 4RIOA 2OK1A 3Q9XA 2NP8A 4M15A 3ELJA 3QTZA 4O0SA 1BKXA 3LJ0A 4O21A 5IZFA 2HK5A 4QYFA 3I6UA 3TIYA 4BCPA 2PMLX 4Y73A 1OIQA 2NRUA 2BHHA 5J87A 3VF8A 4QMQA 4E26A 4PDSA 4ZTSA 4QTDA 3Q52A 3WILA 2OFUA 5HE1A 3BLQA 2YEXA 4GT5A 5HU9A 2BILB 2WMXA 2Y4IB 4FSWA 4X3FA 2HAKA 3CC6A 3SQQA 4O0XA 5AP2A 3D4QA 2ZB1A 5FDXA 3RMFA 3ZO3A 3E8CA 2BTSA 2OF2A 3AMAA 4AA4A 4TYHB 4MD9E 3MTFA 4AN3A 1MUOA 1JNKA 2XBJA 1OB3A 4Q5HA 4U79A 3QZHA 1M2QA 4XUFA 2VTPA 4FMQA 5HORA 4AOTA 2W99B 3IGOA 4TL0A 3ZMMA 1DAYA 4YBJA 5DWRA 2WAJA 3F3ZA 4J98A 4EONA 2VO7A 4JDJA 2PVYA 2JKKA 4FK3A 4F7LA 5CF4A 4MBIA 4L52A 4WNMA 2VTQA 1AGWA 5CF8A 1BLXA 2C6OA 2HOGA 2JEDA 3QLFA 4I93A 4JR3A 4M14A 4MCVA 5IA0A 2XNBA 2WOUA 1STCE 3ZS5A 4ANOA 1XH9A 4BDBA 3W2PA 3JVRA 3WOWA 2OIDA 4FZ7A 4G34A 4X3JA 4QMLA 2ETKA 1ZOEA 5HO7A 5HE0A 3GUBA 4I20A 4DEBA 5FP5A 3IW4A 5AR7A 4PMSA 5BMSA 3PY0A 2PVFA 2C6DA 2JKQA 4AGCA 4C4JA 5JFWA 5KX8A 1WBNA 2V7AA 3V8TA 4XG2A 2GMXA 2P33A 2XF0A 1GIIA 4WIHA 5HIBA 4BDDA 3OS3A 4QP2A 5M55A 2F4JA 4YJPA 5EKNA 4M7IA 4FV0A 4L7FA 3CLYA 4AZEA 4C4FA 5HX6A 3QRKA 2IO6A 4EC9A 4FF8A 1JKSA 3S95A 3PP0A 4Y72A 3QX4A 4ZY6A 5TF9A 2YDIA 4K18A 4BHNA 5FLFA 3MYGA 2C6TA 5AP3A 4KIPA 4F63A 4GFGA 4EJNA 5J5SA 2GNIA 4ACDA 3WF7A 4TYJA 3TZ8A 2QU5A 2OZAB 5J9ZA 2WTWA 3ET7A 2JAMA 2G2IA 5IA2A 1EH4A 4IWDA 3SAYA 2A19B 3PLSA 1UU7A 4TTHB 4ALUA 2HELA 4CNHA 4JIKA 3R7YA 4D2WA 4LQMA 2O63A 2ZV9A 4RLKA 3R8ZA 4E73A 3NR9A 1WFCA 5HNIX 2A27A 3IONA 3NCZA 4FZ6A 1NXKA 5CEQA 4E4MA 4CKRA 4D2VA 3B2TA 3WF9A 1PMEA 4AZVA 3AC8A 1H1PA 1H08A 5B2KA 4ZTMA 1WBVA 4TZRA 3A8WA 3EOCA 3DTCA 5BMMA 1AQ1A 1MRYA 4QMMA 5GZ9A 3WARA 4QTEA 1W98A 3CGFA 2XIKA 2Z7LA 3GCUA 3BGZA 3L8XA 4FSYA 3VN9A 4BF2A 1CM8A 4FZDB 2F2UA 5CI6A 2OW3A 2PL0A 2PE1A 5J95A 4M13A 4KIKA 1RQQA 4KAOA 4F0GA 5BQ0A 3BKBA 1PMUA 4QP7A 4FTKA 5L2SA 5JZNA 2JIIA 2A0CX 3F5XA 3R1SA 3QTIA 4GVAA 4BCJA 5ANGA 3E92A 4BYJA 1Q8YA 3R73A 2JIVA 4EH9A 3GC0A 4BDGA 4PY1A 4FTUA 4GV1A 4JG8A 4ZTHA 1WBPA 4FTAA 2BAKA 1Z57A 4FL1A 4IXPA 3A61A 3ODYX 1FGIA 3VS7A 2I0YA 4U41A 4JX3A 2OJJA 4WOVA 3I5NA 2I1MA 4NM5A 4L44A 3FC1X 3EYHA 3D94A 4I6BA 4NT4A 5HOAA 5I4NA 2JC6A 2XK4A 2YAAA 4NJDA 5KZIA 3UVQA 2CGVA 4U44A 2C6EA 5E8UA 1IA8A 2OJIA 2Y8OA 3TTIA 4K9YA 3DK7A 4E1ZA 4EH6A 5HLNA 1JQHA 2ITPA 2A2AA 3KF7A 5L2QA 3VUIA 4I4EA 4FTNA 4U81A 3LFNA 3O71A 3Q4TA 3CEKA 1PY5A 3DZOA 2XK8A 2I0VA 4JRVA 5FWKK 2C5XA 4BCMA 4DTKA 4MXXA 2DS1A 2OICA 3UQGA 3ZZEA 3JPVA 2IN6A 3C5UA 5H8BA 2WEIA 4A4XA 2A1AB 4CFMA 3ZLSA 1V0PA 5KMOA 3PXYA 4GW8A 3E8DA 3U8WA 2VTMA 2VNYA 3FLSA 3W32A 4YSJA 2C6MA 3UP7A 4M66A 4F7JA 1UNLA 4RT7A 5AMNA 2O2UA 4OTRA 2WMVA 3ROYA 4D4RA 3QCSA 5E8ZA 3DLSA 3DK6A 3E5AA 4OBQA 3ZRKA 4HYHA 3CD3A 4G31A 4ZTRA 4ZSLA 4DGLC 4AS0A 4F9AA 5CYIA 4RA5A 3EN9A 1UV5A 3QLGA 4O2ZA 3GB2A 2C0TA 4PP7A 3DPKA 5DLSA 1YHVA 4EK5A 3UO4A 3ZUTA 4UMQA 5AP1A 3WZJA 3QZFA 5ANJA 4D9UA 4TNBA 4YSMA 2BFXA 4FTLA 3VNTA 1RDQE 4ALWA 1OKYA 4XLIA 2ZOQA 1P4FA 4MVFA 3SXFA 1H26A 3CPBA 3ZDUA 4CFUA 5EOLA 1H01A 4KS7A 3PA5A 4UWCA 4XP3A 1XR1A 2BIKB 2XK9A 3HX4A 4L8MA 3TUCA 2WIPA 3NIEA 5CEMA 3SV0A 4K0YA 3OW3A 3R7EA 4NIFA 4BTFA 2J6MA 2X2MA 4C0TA 3DAJA 4YJQA 5EW3A 2OWBA 2WELA 2O8YA 2VN9A 3E62A 3E88A 2VWVA 3QRUA 4D4VA 3ZONA 5EM8A 4GG7A 4FICA 2WTJA 5FM2A 3BHVA 4HNFA 4AXAA 4QPMA 5CQWA 4F6UA 3PWYA 3R9DA 5I0BA 2OXDA 4G5PA 4AGDA 4CKJA 3EN7A 4O1PA 4C38A 3CTQA 2FSLX 4AZWA 3FMKA 3PYYA 3S0OA 1ZYJA 2QVSE 3EZVA 3KMUA 4L3JA 2R4BA 2XRUA 3C50A 2BRBA 2OF4A 1KV1A 4NTTA 1XBCA 5E1EA 5FGKA 2WO6A 3F7WA 2HZIA 4FEQA 4O0TA 5GZAA 3NRMA 3VJNA 1JKLA 2PVMA 4E5AX 4X2GA 3DDQA 3UOLA 4YJOA 5CQUA 4OTDA 4IB5A 3TNHA 1PXJA 3TTJA 5BVEA 3GT8A 4DG2E 4YU2A 2PVLA 5IA3A 2GQGA 4TKSA 5AUXA 5C03A 3ORMA 3P23A 4PPAA 4F4PA 5AUVA 4XEYA 2VX1A 4CZYB 5M4FA 3FXWA 4D5HA 3SD0A 3IW8A 4ZS0A 4RJ7A 3LPBA 4U45A 5L8JA 5A46A 3FHIA 4FT9A 5C8MA 4EK4A 2B9HA 4ZK5A 5FG8A 1YHSA 1SM2A 2QOHA 3QKLA 4N0SA 4J52A 3AT3A 4CLJA 1OGUA 3ORKA 2C0OA 4Q9SA 3R9OA 2ONLC 1OPLA 3T3VA 2Y7JA 3VVHA 3BHHA 4L3PA 4EI4A 5HVKA 4E6DA 5L8LA 3VUMA 4ZJJA 4QMNA 3MH0A 3I7CA 2HZ4A 3VW8A 3WIKA 3WI6A 4FG9A 5AUWA 4G5JA 4B6LA 2X6EA 4UY9A 4M0YA 4G6OA 4AQCA 2PTKA 4NTSA 4EC8A 4FGBA 4PV0A 2YWPA 4IB3A 4FL2A 4D4YA 3QUPA 4I5PA 4EEVA 5A4CA 3HL7A 1PYXA 2QO9A 2PZIA 1XBBA 4WA9A 3D5VA 4DITA 2QCSA 1YVJA 2VWZA 3G0FA 5EDQA 3FQSA 1UA2A 4P4CA 5EG3A 4BBFA 3FQEA 4DYMA 3ORXA 1YI3A 4FG7A 3FZOA 4OTIA 1U4DA 2BAJA 4A7CA 4FTIA 4ZLOA 4DAWA 3A99A 3OUNB 4ANMA 4ASDA 4B99A 5LWMA 4HYSA 2C1BA 3SW7A 3UQFA 3ALNA 4GYGA 2VAGA 5IH4A 4J53A 4RJ6A 5E92A 1OKZA 3TIZA 2E2BA 4RRVA 1ZRZA 2G1TA 3OG7A 1GJOA 1XHAA 4Y85A 3QQJA 4XJ0A 3Q32A 4OBPA 4E6CA 1Q99A 4ITIA 4QQCA 5ETCA 2YN8A 1K2PA 3Q3BA 3KMWA 4GUBA 5HLPA 5L2TA 4LL5A 2WGJA 5HCZA 5CEPA 3OBJA 3GQIA 3KQ7A 3DQXA 4PL5A 1P4OA 3CQUA 4NKAA 4LOOA 3QFVA 2RFEA 3OMVA 3PXKA 4ANBA 3KULB 2EWAA 5KBRA 3TZMA 1TQPA 4NJ3A 4USFA 2QG5A 5CAQA 5L6OA 5IDNA 5HU3A 5HEZA 4FV6A 4IB1A 4IZ7A 3OWLA 4Y95A 2CKEA 4ITHA 4W8DA 4AZTA 3UMXA 4XG4A 5FTOA 3K5VA 2UZTA 4ZSAA 3QXOA 2JDTA 3MBLA 4NFNA 4IMYA 2REIA 2B53A 1YDSE 4L00A 4F9WA 2PMOX 3ZLYA 3OW4A 1CSNA 3FMHA 4IB0A 4RJ3A 3F66A 2PVNA 2R3RA 5HGIA 3MPTA 4L42A 3R22A 4X6RA 4XH6A 3Q5ZA 3UP2A 1A06A 4WG5A 3RK5A 4GK2A 3FL5A 3HV7A 5AAEA 2BZIB 2WMSA 4BDFA 4EOJA 3FDNA 4FIIA 4XOYA 4BI1A 4RX9A 1KE5A 2GS2A 2XS0A 4QMPA 4YZCA 5CF6A 1ZXEA 4UZHA 1I09A 2XYNA 1M2PA 3IOPA 5DRDA 3E87A 5F95A 2O65A 3NW7A 4AA0A 4W4XA 4P2KA 3ZOSA 4L9IA 3ZRMA 2C5NA 3FY0A 4C34A 5HX8A 1Y57A 4CZUA 2EU9A 1X8BA 5JH6A 3ZSHA 2W5AA 5AP4A 1YW2A 5B2MA 2OG8A 3TN8A 3I0OA 1VZOA 2RFNA 4IVDA 1H27A 4O6EA 4U6RA 4ZIMA 1UU3A 1ZYLA 2W17A 3OCSA 4AFJA 4EYMA 5HZNA 4GK4A 1QCFA 3BYMA 1OECA 3QC9A 4WRGA 4LV5A 4BL1A 4RWJA 2JITA 1PKDA 3EQHA 3PJ1A 2GDOA 2QLQA 3IECA 3R1NA 4MNFA 3F3TA 4DEHA 3BEGA 4J7BA 5AP6A 1NA7A 4H1MA 1OITA 3LIJA 3PUPA 4QQJA 1ZAOA 4AFEA 2WQBA 3F5UA 4F08A 5I5ZA 4BCHA 4UMRA 3CR0A 2J4ZA 3I79A 4AP7A 4BI0A 5K5NA 1M2RA 5LMKC 3LAUA 3PJ3A 4BCOA 3MA6A 2PZYA 4BYIA 4HVDA 1PHKA 3DAEA 4EHZA 1QPEA 4EKLA 3VUKA 4GYIA 3A8XA 3MJ1A 5CXHA 1WVWA 5D7AA 4EYJA 3O0GA 4F0IA 5JFSA 4L68A 1JOWB 3ZXTA 3VAPA 3QQKA 2BRNA 1W83A 4CVAA 3GEQA 2QOFA 4I23A 1SVEA 4MWHA 4HVGA 3E8NA 4C4IA 4X2NA 4V04A 4C8BA 4FUYA 2X39A 3GQLA 2BRHA 4BB4A 1IRKA 2W4JA 1WBSA 3L9PA 4YLLA 4QMVA 4DN5A 1OM1A 4PPBA 4XOZA 3SXRA 4KRDA 2XIYA 1FINA 5TOZA 4WSYA 4I1ZA 4R7HA 3L9MA 2PE0A 2RF9A 3F3UA 4W9WA 2QOBA 1GOLA 3QL8A 3FLZA 2IVUA 4G3FA 2ITXA 2ZYBA 4YLKA 4BRXA 2JBOA 3VBXA 4XV3A 3R9HA 3LXLA 3A60A 4DGNA 1OUYA 4BZNA 4YZBA 1K3AA 2OBJA 2X0GA 1ERKA 3A7FA 2DUVA 2QOQA 4HGLA 3IS5A 2Y9QA 1UNGA 3LE6A 5BVNA 3R8PA 3QRIA 2R3GA 3BV2A 4UBAA 3F7ZA 5ETIA 4OTHA 1REJA 4JQ8A 1OVEA 5IA5A 3ZC6A 5HO8A 4S33A 4DEEA 2QURA 2WQMA 2UZVA 3CJFA 3DK3A 2R0IA 2ERZE 3PSBA 3QHRA 5JN2A 3FXXA 4KRCA 5AV1A 3V6SA 1VYWA 5IUGA 3VUGA 2UW8A 5JQ5A 4YTIA 2XCHA 3R21A 4RFYA 5KNJA 1WVXA 4I0SA 2HW6A 2F7EE 4FL3A 1SNXA 4F9CA 3C0IA 4D1ZA 4MXCA 3A62A 1XO2B 4IIRA 2ZVAA 4HGSA 4CRSA 1P2AA 2JDOA 4DG3E 3C4XA 2ERKA 4HZSA 2E9NA 2XNPA 4HCVA 4XYFA 3HEGA 3MH2A 4RIXB 3RI1A 1Q4LA 3OWKA 3UPXA 3Q4UA 5CXZA 2BRMA 4EQMA 5ACBC 2QOCA 3LCOA 5BUIA 2CCHA 2VTTA 4OR5A 3ZCLA 2EB3A 3CKWA 3M1SA 2R9SA 2VTHA 3GGFA 1Y6AA 4Y5QA 2B9FA 4BCGA 4WD5A 3OWJA 3DKFA 4RIYA 1KE9A 4K33A 3ZXZA 3R2YA 5I9YA 5CSPA 4WKQA 2G01A 3MSSA 2XM9A 3ORIA 4BDAA 3P4KA 2XKEA 1CMKE 3KRJA 2ZV2A 3LQ8A 1RW8A 2ETRA 2F9GA 2BHEA 4C36A 4G1WA 1KOAA 2PUUA 2WMWA 4BWXA 2GPHA 3POZA 3E93A 3QA8A 4UMPA 4EOPA 4LV8A 1GZNA 3D5WA 4YZMA 5DT3A 2BVAA 2SRCA 5CAUA 1YXSA 2BZHB 1XH6A 5JT2A 4K77A 4N6YA 2W1ZA 3SKCA 4YHFA 1JLUE 2PWLA 2OJ9A 4PWNA 4AA5A 4TYHA 3WYXA 2IJMA 2OH0E 5LVLA 2C30A 4KSPA 2XJ1A 3HZTA 4QYHA 4UV0A 3H10A 3R63A 4BKYA 1O9UA 1ZMUA 3LMGA 1XKKA 4U5JA 4Z7GA 3AGMA 4QMTA 4RIWB 3DNDA 4R5SA 5DRBA 4F7SA 4JAIA 4BCFA 5HIDA 1KE7A 2XNOA 4GS6A 2VNWA 3PE2A 4IACA 2WTDA 3K2LA 3A7GA 3DGKA 3Q60A 4YZNA 5CEKA 4O91A 3GP0A 3H0YA 4A4LA 4C37A 2XIXA 4F65A 4D4SA 3S2PA 3Q9ZA 2GFCA 4FR4A 5KMKA 2J51A 5IMXA 1DI8A 4D1SA 4EBVA 5HTIA 4GIHA 3PFQA 1B38A 1DM2A 3JXWA 5FXSA 3NW5A 2XNMA 3NNVA 3PE1A 4TYGA 4BC6A 2JLDA 1HOWA 2VTJA 5DI1A 2UW0A 3IQ7A 2UUEA 4LRMA 2YJSA 4U80A 4DG0E 3NLBA 2QD9A 4KA3A 3LCKA 2VTNA 5E8TA 2E9UA 3KRXA 1MRVA 4XNEA 3HYHA 1F5QA 4HNIA 5B0XA 1YQJA 3KXNA 3HRBA 4I6HA 2UW5A 2HY81 3IOKA 4CTBA 1GZOA 3RAIA 5JKGA 3QD4A 3TACA 5CAVA 1SNUA 5E90A 1V0BA 5CALA 5LVNA 2JDSA 3QUDA 3AD6A 5K9IA 3VQHA 5DR2A 4JJRA 5IH5A 4M69B 3P86A 5DNRA 4JG6A 4ITJA 4XG9A 4A9YA 4NH1A 3QA0A 5FBOA 4C2WA 1H1SA 3LCDA 2BROA 4O27B 5IISA 3DLZA 1ZMVA 3LFQA 4G3GA 2WMAA 5AUUA 4FKTA 2VWUA 4D55A 4IC7A 4FOCA 2JKMA 5I9XA 3DJ6A 3V5JA 4XMOA 3FZSA 2PZPA 1JKTA 2WD1A 4GUEA 3IDBA 2IWIA 1W8CA 2C5YA 4QT1A 4IH8A 3MIYA 4GT4A 4AAAA 4WNOA 2VO3A 3NCGA 2RKUA 1E1VA 4KBCA 2XK7A 2OGVA 4JBPA 1Q62A 3GC8A 1E1XA 1H25A 4NM3A 5J7BA 2UVZA 3HMIA 2BDFA 2V0DA 1CKPA 1YXVA 2B55A 5H3QA 4H36A 4NCTC 4FVQA 3TXOA 5J5TA 3MB7A 1TQIA 4FTQA 4XS2A 4ZTNA 3OBGA 1XBAA 2G2FA 4OTWA 2CGWA 5L4QA 2H96A 4MQ1A 4HW7A 3P78A 3GNIB 4NWMA 4ACHA 3ZFYA 4KKGA 3R83A 3FLWA 3UG1A 5DA3A 3HNGA 3NYOA 4TYEA 5EYCA 4DFYA 3VQUA 4EH7A 5L6PA 3COIA 5EW8A 4WRSA 4YTFA 5AV4A 3R8UA 3UNKA 4FTJA 5ITAA 3NWWA 2YCFA 2Z60A 5L2WA 1KWPA 2DWBA 2ZAZA 4PRJA 3QD0A 2VRXA 4FKOA 5HO6A 4F70A 3EQBA 3QCQA 3UNJA 3G0EA 3AMYA 2B7AA 4ZXTA 1PXIA 1M52A 3ORLA 3QTXA 4WBBB 4NU1A 4IM3A 3PY3A 3R9NA 3V5QA 3GBZA 2XKCA 2HENA 2J50A 5C26A 4CV8A 3KRLA 1W7HA 5DVRA 5CTPA 1IR3A 3D15A 4LI5A 4YBKA 4BDCA 5HHWA 3DT1A 3K5UA 3OZ6A 4O1OA 4CLIA 4FV8A 4JLCA 3UZTA 2X1NA 3FLQA 3P7BA 1Y91A 4PTGA 4X21A 3UOKA 2W1FA 3RP9A 3M2WA 3ZH8A 3O17A 5D12A 2Z8CA 5H8GA 2YABA 4LMUA 3UNZA 4OTGA 4FUXA 3BU5A 3ZBXA 3ZEWA 3FPMA 4DHFA 2ZJWA 2X9FA 3GCPA 3VBWA 2XVDA 2X4FA 2XKFA 3NGAA 3IW6A 1REKA 3DNEA 3HDMA 4U3ZA 4B8MA 4EH4A 4OW8A 5H2UA 1J91A 3I4BA 5FM3A 1TQMA 5BNJA 1FPUA 1SVHA 2UZWE 3OCBA 3F3WA 3C4CA 3F2AA 2PE2A 3BCEA 4GU6A 4XG8A 2ZV7A 2XM8A 3FQHA 2XMYA 5EH0A 4CSVA 1QMZA 5HBJA 3LFDA 4YGAA 4APPA 3QTWA 3OTVA 1PXNA 4EOOA 1BMKA 4A06A 2WMUA 2UVXA 5A4EA 4DH1A 2R3MA 3I60A 3QBNA 4J8MA 3PWDA 5CT7A 4YPDA 2V22A 3A4PA 4CCUA 5KCVA 2GNHA 3KRWA 3FKOA 3QYZA 4FT7A 4UMTA 4XRLA 5EM5A 2CGUA 4YHTA 3HA6A 3PA4A 3GENA 4MBLA 3FSFA 1SMHA 4G9CA 4DFZE 3UIBA 4FIGA 4YC8A 2ITUA 4EHVA 1AD5A 2VX0A 5DEWA 3BHTA 2PZRA 4FTTA 2YM8A 4MXAA 3JVSA 5TR6A 5L2IA 1CKIA 3UVPA 4EORA 1JBPE 2I0HA 4CFXA 4FT3A 1F3MC 4ERKA 2BRGA 1OMWA 5CU0A 2VUWA 3CQEA 4R3RA 3EYGA 3HRFA 5K0XA 5DIAA 1JSTA 5BX0A 3DV3A 2WTKB 4RC3A 4MH7A 1YXUA 5HD4A 4IM0A 4M84A 4B8LA 5AIRA 3MI9A 3NEWA 3MDYA 5AM7A 2P0CA 3RM6A 3GOPA 4CFNA 4X3FB 3C7QA 1MRUA 3NNUA 3U6JA 3Q2MA 1QPJA 2QR7A 2C69A 4FSQA 5HICA 2YM5A 4I3ZA 3AG9A 4S34A 2PK9A 4ZLYA 1KOBA 5LQFA 3FYJX 5IMEA 3CS9A 1UVRA 4JDHA 1LEWA 4DH5A 3PXFA 2E9VA 5AP0A 1PXKA 4LRKA 4MWIA 1WMKA 4MD7E 5HBEA 3WZUA 3L8PA 2BR1A 1LR4A 1YWRA 3KY2A 3NSZA 4Z16A 4QQTA 5BPYA 2X81A 4PX6A 5M57A 3P5KA 3HVCA 3PZEA 5CS6A 4IM2A 2GFSA 1HCLA 2GS7A 1KSWA 4IEBA 4KABA 4R3PA 4LYNA 4FV5A 1ZYCA 3RBWA 2X4ZA 5CANA 4CKIA 2WU7A 3PTGA 4QMYA 2VWBA 3DQWA 4G3EA 2V62A 3OOMA 5E91A 5HNGA 2J7TA 3AXWA 3SC1A 4C59A 4LGHA 3ORTA 5JGAA 1GIHA 4CEGA 2CMWA 2RG6A 1Q8TA 4FKSA 4G9RA 3GI3A 3D2IA 3TJDA 4EKKA 3KN6A 2R3KA 4NSTA 4BDEA 3HA8A 3V8WA 4YLJA 3WIGA 2IZUA 3V04A 5CAOA 4CTCA 3KF4A 4NEUA 3RVGA 1UWJA 2R3JA 2ITNA 2QO2A 3PVUA 3LXPA 5KMMA 3V5PA 4PMTA 5BVDA 2ZDTA 4Z9LA 1K9AA 1DS5A 4HYIA 5HESA 2ZM1A 4DH7A 4K6ZA 1BI8A 4ZZMA 3VS2A 3NYVA 3ZO4A 4UALA 5HTBA 2PVKA 2WIHA 3N51A 4Y5HA 1GIJA 5AR2A 1Q8ZA 3R28A 5EHOA 1KE8A 2QO7A 4JL9A 2Q0NA 1NY3A 3RKBA 3U4WA 3UOHA 4ZZNA 1ZYDA 4PDOA 4CQGA 4G3DA 4IJ9A 3UG2A 4FV7A 3QD2B 1SYKA 5LMAA 3P79A 2A4LA 4RG0A 5FQDC 4QYEA 3WE8A 3UC4A 2R7IA 2YFXA 3IDCA 3BYSA 1H1RA 1SZMA 2I6LA 4IZYA 4TWPA 5A4QA 5IUHA 2J0IA 2UW7A 5CZHA 5AAFA 4CT2A 2Z7SA 5JGDA 3VWAA 2YIYA 3UMWA 2XH5A 3QF9A 5HKMA 4TWNA 1WCCA 1R0EA 3IK3A 3DAKA 3MY0A 2OIBA 5HCYA 1S9JA 3CY2A 4FNYA 3F2NA 5DE2A 3RALA 3W8LA 4BDKA 1YDRE 4CXAA 5HI2A 1U54B 3O8TA 4G3CA 2LGCA 4FSZA 1ZYSA 4FKJA 3CTHA 3AMBA 3BGQA 3Q5IA 3EN5A 3RAKA 3WE4A 4HPTE 4BTMA 2WHBA 3EQDA 4GRBA 4ZSJA 4KIKB 2CHLA 4AGWA 4C58A 1WBOA 1XH5A 2G9XA 3QWJA 4EH8A 4QMXA 5EK7A 1H24A 2VTRA 4YZ9A 4DGGA 2XCKA 3FMLA 1RJBA 5K0KA 4ACGA 5HG8A 4HZRA 2KULA 4FNZA 1LEZA 4CYJA 3U6HA 2LAVA 4HGTA 5TT7A 2JGZA 5TO8A 1Q8WA 3MFTA 1OKWA 3IW5A 3D2KA 3NYNA 3QZIA 4I41A 4UWYA 4Q5EA 4RC4A 1J1BA 4EL9A 3II5A 4IAFA 3UPZA 3COKA 3FMEA 3LCSA 4O38A 5L6WL 2CPKE 4DGOA 2OH4A 3IG7A 4OGRA 4HPUE 3DBQA 5FEDA 4QNAA 3ZYAA 5IF1A 2YDJA 4BVUA 3VBYA 3DKOA 2F57A 2V5QA 2CLXA 1PXPA 4AE9A 4RFZA 4C4EA 4EK6A 3VUDA 4NZWB 2HWPA 2X7OA 3CJGA 2FA2A 4S30A 2GNFA 3EKKA 1NVSA 1R0PA 2PZ5A 2XZSA 3HMMA 5M4IA 4DFXE 4CCBA 3MS9A 2RFSA 2W1CA 4OUCA 5KHXA 4CRLA 3A7HA 3OT8A 3PZHA 4ZP5A 4BIEA 3U9CA 3HV4A 4F9YA 3HP5A 1OL2A 4F1TA 3WBLA 2KTYA 2VTOA 2WB8A 4HCTA 3D83A 3Q6WA 4LG4A 4XBRA 3TL8A 4CFFA 4D2SA 2XK3A 3ACKA 5EM7A 4DH8A 4MXYA 4UN0C 4KIQA 4C3PA 1V0OA 4RQVA 5DOSA 5AP5A 4E93A 5J79A 1R1WA 2YJRA 3Q6UA 5EM6A 4OTPA 2JD5A 4E7WA 2DQ7X 5JGBA 4OBOA 2GS6A 2XB7A 3DBFA 3EN4A 2W7XA 3MY1A 5AUZA 2FSTX 5CX9A 3NUNA 4O0VA 2W5HA 4PMMA 5AJQA 4BGQA 5C1QB 3QC4A 3TNPC 5I9WA 1BL7A 5CVGA 3F69A 4EOLA 5I9UA 4RVTA 4V0GB 4IX6A 2ACXA 3OHTA 4FV1A 4KS8A 4D58A 4MNEA 3HV5A 4AX8A 1H0VA 3RPRA 3TKUA 1U5QA 2BIYA 4FKPA 3TNQB 5D1JA 5F4NA 3AQVA 4EUUA 2O64A 3W1FA 4U3YA 2BTRA 4PL3A 4JBQA 2YM4A 4OAVB 4K11A 2W96B 4U97A 2CDZA 4NIFB 3ETAA 4WNPA 2C6KA 2QQ7A 3UIXA 2PVRA 4OAUC 2XRWA 4X7QA 2EVAA 4U0IA 3E3BX 4H3BA 3UC3A 1CKJA 4U43A 1Q3WA 5FD2A 3K3IA 2R0UA 2CN8A 2YIQA 3KKVA 4HGEA 4NK9A 4RC2A 2C3JA 3FPQA 4AE6A 2JDRA 3C4ZA 2Z2WA 4NM7A 4BCIA 4QMWA 4L3LA 4X2FA 4XV1A 4ZY5A 2CJMA 4R3CA 3D7TB 3BGPA 4QOXA 4AU8A 3Q4ZA 4UYAA 4FVPA 5B2LA 1PMNA 5LJJA 4R1YA 3EL8A 4J97A 3QWKA 4EQCA 4FKWA 1QPDA 3LFBA 3MPMA 4GU9A 3OP5A 5KE0A 3O2MA 3ZUUA 3BLHA 5I3OA 5D11A 2VWIA 4RJ8A 1L3RE 4M8TA 4Y8DA 4RVLA 5A4TA 3BHUA 3KMMA 5K4JA 2R3IA 4QMZA 4AGUA 4BIBA 3FMDA 3NUXA 3DBEA 5EYKA 4DGMA 2VO0A 3VS1A 4YNEA 4ID7A 2GNJA 3CPCA 4NUSA 1B39A 1CTPE 1WZYA 4RA4A 4CMTA 4ZJVA 4AWIA 4RIXA 4O96A 2W06A 1U5RA 3UIUA 3QZGA 5M53A 4O0WA 2R3NA 4FKIA 2C3IB 2WTCA 2ZM4A 2OZOA 3ALOA 4DLJA 2ZM3A 3VUTA 3KU2A 3P08A 4FI1A 5ANKA 5JRQA 3QCYA 2YLFA 5A14A 3TEIA 5KMJA 2ZMCA 4TWOA 5AWMA 2F7ZE 1TVOA 1PXMA 5BUEA 3ACJA 3POOA 1W82A 4WO5A 2XUUA 3QRTA 4QP4A 5AV3A 5AX3A 4LUDA 3PIXA 2OXYA 4TT7A 3O96A 5CI7A 5ANDA 4R8QA 4AZSA 4J8NA 2ONLA 2P55A 2W4KA 2WQOA 3W18A 4EHEA 5E7RA 4EUTA 1ZZLA 2Y6MA 1XWSA 4IVCA 4GL9A 4RZWA 2YDKA 4L43A 5HD7A 1OZ1A 3TCPA 4IFGA 2BZKB 2J0KA 2J2IB 2VGOA 3D5XA 3KFAA 4HYUA 4IWPA 4JX7A 4QNYA 1YXTA 4QTBA 5TE0A 2PSQA 2VD5A 3NIZA 4MHAA 2QHNA 3LFEA 3H30A 2EB2A 4F09A 2BDJA 4JOAA 2EXEA 5H9BA 3C51A 4D1XA 2VO6A 3REPA 5IA1A 3OXTA 3E7OA 4AT5A 2NPQA 3SRVA 4AOJA 4IFCA 4IC8A 2HW7A 4A07A 4RIWA 5LMBA 2VWXA 3FLNC 3KK9A 3OD6X 3UGCA 3COMA 5CF5A 5ANEA 4UMUA 2FGIA 1YI4A 4U42A 3VO3A 4C4HA 4M67A 4QRCA 3R1QA 1T45A 4YC3A 4XX9A 4ZLZA 4YURA 3CP9A 1FQ1B 3TUDA 4X0MA 4AW1A 4IX4A 3RCJA 4EOMA 4XP2A 3MTLA 2WFYA 4E3CA 5L3AA 5KO1A 5JFVA 1YOLA 3EFWA 4I94A 2V55A 3VS0A 3BI6A 3H3CA 4YZDA 3DA6A 3GXLA 3NUPA 4GSBA 4F64A 2PVHA 3L9NA 3COHA 3QKKA 5JZJA 4AW0A 3BIZA 4EOIA 1XQZA 5I9VA 4QP8A 3GFEA 4W4WA 2BPMA 2J0JA 5FRIA 4WT6A 3BE9A 4ZJIA 4XHKB 2BDWA 5DMZA 2WNTA 4IW0A 4PPCA 1WAKA 5D41A 1ZZ2A 3V5LA 5LWNA 4IAAA 4M3QA 1T46A 2WMTA 5GJDA 2R7BA 3FY2A 3GCVA 3GU7A 3O8UA 4LM5A 3C13A 1YOJA 4C35A 3ZO1A 4PUZA 2ITOA 2JBPA 4FZAB 1R39A 5E1SA 1LUFA 4D5KA 1TKIA 3ULZA 4FKUA 4FKQA 3FE3A 5LOHA 3O51A 4MTAA 4DH3A 2EXMA 5M4CA 4PTCA 5DBXA 1CDKA 3G2FA 2BCJA 2UW3A 3SDJA 3PSCA 3EMGA 2ZB0A 4PNIA 4RVMA 4AOIA 2WTKC 5GJGA 4FX3A 3R7OA 3PVBA 2Y0AA 3E7VA 4ARKA 1UWHA 2QC6A 4QMSA 4BKZA 4E8AA 1IASA 2YM3A 3L9LA 2DYLA 3HKOA 4X3FC 3RWPA 3W2OA 4E20A 3RINA 5A4LA 2QONA 5FTQA 4QPSA 2C1AA 3R30A 4NW6A 3ERKA 3I5ZA 4FYOA 3G9LX 2Y6OA 2WTVA 3VW6A 4CYIA 3H4JA 3ZBFA 4C3RA 3CY3A 5AM6A 4ANLA 4BDJA 5IH6A 3ORNA 3BZ3A 3UZPA 4O22A 5FXRA 2XK6A 3OWPA 1IG1A 4J99A 4OLIA 3G51A 3UTOA 2UZNA 4I0RA 2Z7QA 2C68A 3L1SA 5IDPA 5M4UA 3BBTB 3KL8A 2W05A 3TKIA 4P7EA 4USEA 4QPAA 3SVVA 1DAWA 3O8PA 3UQCA 2JDVA 5CENA 5LMKA 2R64A 1ZARA 3GC7A 2ITTA 3PXQA 3RTPA 2WZJA 1R3CA 4KINA 3UOJA 3P1AA 2B1PA 4FV2A 4F1MA 2RL5A 4J71A 4C33A 4YMJA 3W2CA 5LCKA 5HG7A 2ITWA 1ZMWA 3FXZA 4I6QA 3KC3A 4F6SA 2C3KA 4KSQA 3ZUVA 3HECA 4U8ZA 2X8IA 3IPHA 4EH2A 5IU2A 3KK8A 5IKWA 1UNHA 3E63A 2X9EA 4A9SA 2XNEA 4LOPA 1WBWA 2W1DA 4JBVA 4QTCA 3O7LB 3S4QA 3VULA 5FEQA 3DOGA 2GU8A 1JVPP 5E8VA 1ZOGA 4KKHA 3H9FA 4H1JA 1H8FA 4R6VA 3OROA 4QO9A 3BX5A 4BGGA 5LVPA 2WOTA 4GFMA 2P2IA 1H1WA 2QR8A 3DXNA 3EWHA 4IANA 3MWUA 4APCA 3NPCA 4FKGA 4P5QA 4YTCA 3QYWA 2BUJA 2C6IA 5JFXA 3CBLA 3MFUA 3FHRA 3TT0A 2IZRA 1ZY5A 3OCTA 2W1EA 3W55A 4RX8A 4N4SA 2X7GA 1OL6A 4XCUA 4IZ5A 4FVRA 1HCKA 2ZDUA 2WKMA 3QQGA 3Q96A 2OZAA 2IVTA 5GHVA 5EDPA 4Z3VA 5M51A 2GSFA 4F7NA 4MBJA 4IDVA 4PTEA 1UKHA 3ZFXA 3R8LA 1JSUA 2WPAA 3LOKA 5EHYA 3DKGA 2C6LA 4BKJA 4JQEA 3R02A 4IZAA 4PMPA 5A54A 3ITZA 2HXLA 3LLTA 5A9UA 1UU8A 5J9YA 3DFCB 3G33A 3QAME 1URWA 2ESMA 2W1GA 3TI1A 4IVAA 4IWOA 5EHLA 3HMPA 3M42A 3WZEA 1Z5MA 2GHLA 3D7ZA 4JS8A 4IJPA 3C0GA 3FBVA 4IBMA 5ACKA 5CU2A 3EIDA 1JWHA 3R7IA 5EYDA 5AIKA 2IW9A 1M7QA 5CVFA 5IUIA 2QOKA 4RIYB 4ZEGA 3MFSA 5FDPA 3R7UA 3W2RA 4KIOA 5AEPA 2GNGA 4IDTA 3E8EA 4LOQA 1ZWSA 4RJ5A 4RZVA 3TZ9A 3EQPA 3FZPA 2H34A 1A9UA 3EQGA 4EBWA 4G2FA 1MQ4A 2OIQA 4IQ6A 1PKGA 5DGZA 4CV9A 3RWQA 2P3GX 5C8NA 3TUBA 4YJTA 5AAGA 3U51A 5CU6A 5AA8A 5KMLA 3OT3A 2XEYA 4JIAA 5KBQA 2O3PA 5JQ8A 4HOKA 4FK6A 5CVHA 4XP0A 4W4YA 4XRJA 1VEBA 1BYGA 1OKVA 4DCEA 4S32A 3AC2A 2ZV8A 2PY3A 2AYPA 3IO7A 2HXQA 3M11A 5DT4A 4QQ5A 3SW4A 4AN2A 3Q4CA 3QQFA 2WMQA 4BCQA 4CQEA 5IPJA 4JDIA 2F2CB 4LGGA 1OPKA 4P90A 3JY9A 5KMIA 1RE8A 1ZOHA 3G6GA 2PVJA 2W9ZB 3OY1A 2WMBA 3SOCA 3TNIA 4L45A 2XP2A 3GU4A 5GJFA 2UW6A 3FKNA 2ITVA 3R04A 2OJFE 4FIFA 4FC0A 5HG5A 4GMYA 2XJ0A 2CCIA 2F49A 4IAYA 3HGKA 4UB7A 3DS6A 3PIZA 4O2PA 4L01A 3GCSA 3FV8A 1FGKA 4H3QA 4JNWA 4QMUA 3ZSIA 3CXWA 4C61A 4RBLA 3VF9A 3FYKX 4JR7A 3W2QA 3FMNA 5DG5A 2VTLA 4FSUA 5CNOA 5E8SA 4LFIA 5C27A 4YJVA 3MVMA 2WXVA 1JPAA 4FIEA 3BV3A 4QYGA 4X2KA 4ZOGA 4RX7A 3ZC5A 3S1HA 4F6WA 4CFVA 4NKSA 3ENMA 2RSVA 5AR3A 5CSWA 4PP9A 3FI4A 3R8MA 3FJQE 2O0UA 1Q61A 2YITA 5DHJA 3LFAA 3TG1A 5CSHA 3SHEA 3R00A 2QOOA 1VR2A 2H6DA 3QXPA 2B9IA 5A3XA 2C5VA 3K3JA 4FSRA 2W4OA 3OCGA 4I5MA 5CEOA 2JAVA 3T8OA 4MF0A 3PP1A 1OL5A 3ZSGA 1Y8YA 4FV4A 4DLIA 4E5BA 2WEVA 3KN5A 2C4GA 2ITZA 4ALVA 5I3RA 4A9UA 3AOXA 3QHWA 4WG4A 4AZFA 2HZNA 4K8AA 4YO4A 2QOLA 3OEFX 3DB6A 3ANRA 5AA9A 1E9HA 3A2CA 3MVHA 4J96A 2UVYA 3LFSA 2HWOA 1G3NA 1LP4A 2ITYA 4IAKA 3PVWA 4L6QA 4TPTA 5CU4A 3F9NA 1H28A 3QQHA 3QUEA 4RWKA 1PJKA 3EFLA 2C3LA 2VWYA 2OFVA 3BHYA 4YJRA 5AX9A 4JRNA 4EH3A 4Z7HA 2I40A 3L8VA 2QI8A 3PJ8A 2YLEA 3WZKA 4JVGA 1OI9A 4E5WA 5HQ0A 4AUAA 4KWPA 5AR4A 3QTQA 3ENHA 2IZTA 4CMUA 4S2ZA 4D2TA 3VIDA 1KE6A 4I6FA 3MGYA 1U54A 2HYYA 4TW9A 4NM0A 2FYSA 4MXZA 4BBEA 5HBHA 1KV2A 3ZLWA 2W5BA 1PXOA 2YCRA 3R0TA 4D9TA 3BU6A 3UVRA 3GVUA 4JT3A 4GH2A 1FMOE 2UW9A 2Z7RA 3GU5A 4KNBA 3UYTA 4DEDA 3PA3A 4EH5A 4NCTA 4ZTLA 4GIIA 3TKHA 1BI7A 1WVYA 2CGXA 1YHWA 5JEBA 5CY3A 3NZ0A 5HIEA 3LXNA 4EQUA 5LCJA 3RJCA 2AUHA 4AW2A 3ZU7A 4AACA 4FTMA 4K1BA 4G6NA 2VWWA 4L67A 3WF5A 1Z9XA 3QGWA 1NVRA 5J9LA 4KB8A 5FBNC 5EDRA 4E6AA 4FA2A 3OFMA 3PVGA 3MJ2A 1B6CB 5EW9A 3ORZA 2YISA 4RMZA 1R78A 3D0EA 3C1XA
chains in the Genus database with same CATH superfamily
4N70A 3MFRA 4A9TA 4FIJA 2XIRA 3PPZA 1APME 3EQFA 3QX2A 2R3OA 2FO0A 4O0UA 3V51A 4I5HA 2C0IA 5EI8A 3PXRA 3LM5A 3KCFA 1PW2A 2J0LA 1PYEA 4NW5A 4OT6A 2WQEA 3H9RA 4H39A 4MQ2A 3RK9A 5HLWA 1H4LA 3A7IA 2XA4A 4FTCA 1FVTA 2YM7A 4FSNA 4JDKA 3F6XA 4FG8A 5EKOA 4EHGA 1OPJA 2B4SB 1OL7A 5LARA 4EZ3A 1P14A 3PY1A 4RWIA 4B9DA 2FH9A 4O6LA 3ODZX 3PIYA 4XG7A 3I0QA 5IA4A 3ULIA 3EFJA 1Q5KA 4LRJA 2OSCA 4M97A 4PDPA 4EOQA 4QD6A 5EFQA 3G5DA 5BVWA 1H00A 4TN6A 3SOAA 3R7VA 1I44A 3EJ1A 2RIOA 3VUHA 2IEWA 2VZ6A 3ZRLA 2JFLA 2YHVA 5HTCA 3UODA 2NRYA 3AD5A 2RG5A 4MEDA 4X2JA 3PJ2A 1H1QA 3LCTA 2W9FB 3DZQA 4U7ZA 5CSVA 3BWFA 3RCDA 5AV0A 1Q8UA 4D0XA 4EWHA 4XLVA 4PF4A 3NAYA 3BELA 5ETFA 5KHWA 2IF8A 4GEOA 4YUQA 4V0GA 1GAGA 4XG6A 4YP8A 1O6KA 3PSDA 4RX5A 5FP6A 3LW0A 4FSTA 3S00A 2JKOA 2WQNA 3FSKA 3R1YA 4ZSEA 3MW1A 3VS3A 5LVMA 5M56A 4BZOA 3U9NA 3F88A 4I22A 5CAPA 3PPJA 4YNOA 3OXIA 3R6XA 3KULA 3FZRA 2IW8A 5BVOA 3SA0A 1YWVA 3QTUA 4P5ZA 4GK3A 4DC2A 3RZBA 2J5FA 3EQRA 1U59A 3GFWA 2UZUE 2OJGA 3NX8A 5E8WA 2GHGA 3MIAA 4LMNA 3AT4A 4U40A 4GG5A 2R3PA 2VTIA 4N6ZA 5CZIA 4EOKA 2X8EA 3LXKA 2YIXA 4G6LA 4O4FA 3WF8A 4MX9A 4BGHA 4C57A 4E4LA 3SLSA 4B4LA 3D9VA 3O23A 3DCVA 5ANIA 4C4GA 4EZ5A 3Q04A 3R8VA 3F5GA 4XV2A 4AN9A 1QL6A 4GFOA 5J7HA 3D7TA 5CNNA 4WBOA 3TV4A 4USDA 5K4IA 2QHMA 3LQ5A 3GC9A 2YCSA 1GZKA 3EB0A 5ANOA 3RAWA 2R3HA 2C5OA 1G5SA 3CIKA 5CT0A 4JI9A 4Q9ZA 4ZY4A 4ACCA 3RGFA 4FIHA 3H9OA 3SX9A 5CEIA 3U6IA 3RPVA 5HVYA 3OEZA 5B7VA 3P7CA 5DH3A 2XKDA 4RQKA 3O7LD 1BL6A 4PQNA 3QCXA 3R01A 3BQCA 5EI2A 4AT3A 2VX3A 3NDMA 5F1ZA 4DFNA 4DEIA 3DBCA 3QQUA 2BALA 4HVIA 4UX9A 5BUJA 2UZOA 2G15A 1YI6A 5KUPA 3EKNA 3NNXA 2BKZA 4F99A 1YOMA 4ENYA 3A4OX 3EH9A 3DBDA 5H8EA 4BTKA 3BYUA 5TKDA 4F1OA 4IVBA 1Q24A 2QODA 3F61A 4CT1A 3HMOA 3CD8A 4B0GA 1FMKA 4C3FA 1OIRA 1ATPE 3T3UA 1ZLTA 2RFDA 3EHAA 3NS9A 3V6RA 1Y8GA 2G2HA 2ETMA 3ZM4A 4BTJA 2XNNA 4BI2A 3KA0A 3VJOA 3RNIA 3BRBA 3BE2A 4RLLA 3KXHA 2EXCX 2J90A 2YERA 4H58A 4FYNA 4XV9A 3RNYA 5J1VA 5ETAA 4JXFA 2OI4X 2H9VA 3R7GA 2AC5A 4AG8A 3PJCA 3PG1A 3AGLA 3LHJA 4IHPA 3ZLXA 3L8SA 3RZFA 4ZZOA 4FSMA 4OTFA 5GNKA 3BPRA 4FTRA 5HE2A 3C0HA 5JK3A 3CQWA 4TYIA 1DI9A 3CKXA 3JY0A 3F3VA 4IE9A 4Y83A 3MVJA 4MF1A 3Q9YA 3I6WA 4R1VA 2UZDA 2GTNA 3FWQA 3OVVA 3OXZA 3FMMA 4TXCA 2XYUA 3UO5A 2IW6A 1BUHA 3KVWA 2VU3A 3MH1A 2R3LA 3GCQA 3PRFA 1XH4A 3PXZA 3OY3A 3Q9WA 4W9XA 2XIZA 4GJ3A 2NO3A 4XBUA 1XH8A 1Y6BA 3TZ7A 1PXLA 3WF6A 1Q41A 4ZTQA 4QP1A 5FEEA 5K5XA 3KGAA 1YRPA 4O0YA 2JFMA 5E8XA 3RK7A 4WG3A 4M68A 5ICPA 3D14A 5DN3A 3TV6A 2OO8X 4BBMA 3QD3A 4JQ7A 3OC1A 5F94A 2GTMA 3HP2A 4UZDA 3CGOA 4YR8A 4JBOA 1GY3A 3W2SA 3BYVA 4WUAA 3VS4A 4HCUA 4ANQA 4QYYA 1IEPA 3KXGA 3C4WA 2GNLA 1FVRA 4HVSA 4C2VA 3R2BA 1P5EA 5AUYA 1JKKA 2RGPA 3DU8A 4GJ2A 5IEXA 2GHMA 3DB8A 3Q53A 4LUEA 4M12A 3DDPA 3ZDIA 3G9NA 3BLRA 5T68A 4FKLA 2I0EA 4A9RA 3TJCA 3O50A 3FL4A 5F9EA 1F0QA 4KBKA 4MAOA 4WUNA 4S31A 4D28A 2B9JA 3FZTA 2YCQA 3QKMA 3AC5A 4JG7A 5L8KA 5EI6A 2FVDA 2W1HA 3AD4A 3DTWA 4BWKA 2CLQA 3QRJA 4ZAUA 2QLUA 4KKEA 2OU7A 3I7BA 2UZBA 3EN6A 4C7TA 4ONAA 1UKIA 4UEUA 4CFWA 2R3QA 3G6HA 2CN5A 4BFMA 3NUYA 3JUHA 1OIUA 3T9TA 4EZ7A 5KKRC 3OTUA 4OT5A 2B54A 4I0TA 3E3PA 4RJ4A 2FB8A 5BVFA 3IDPA 2Q0BA 3NYXA 5BYYA 4I92A 3VHKA 4UYNA 4E4XA 1YDTE 4WSQA 3IGGA 3UBDA 4V01A 2PHKA 4AF3A 4BCNA 1H0WA 2X2LA 3H0ZA 3FLYA 4GT3A 4YJNA 3CE3A 4BDHA 2QOIA 4GCJA 5AUTA 3EL7A 2FUMA 3W16A 3CCNA 3JYAA 4M0ZA 1O6LA 2Y4IC 1XH7A 3B8QA 4QP6A 3UE4A 4CD0A 1QPCA 5D9HA 3V5WA 4FNXA 1OUKA 3B8RA 2IVSA 4CZTA 4W8EA 4I5CA 1O6YA 4HVHA 4WHZA 1NVQA 1YKRA 4Z55A 4FTOA 3K54A 4DEGA 4ANSA 3C9WA 3HRCA 3CTJA 3KVXA 3KRRA 1FOTA 4RWLA 5EYMA 4A4OA 5JSMA 4BZDA 5A6NA 1S9IA 4QMOA 3LJ1A 5CU3A 5DT0A 3QU0A 4BN1A 4HJOA 2XNGA 3NAXA 4YC6A 5IEVA 2F7XE 3GU8A 2C47A 4FKVA 1PF8A 1SVGA 4D2PA 4U9AA 4JAJA 2QNJA 1FVVA 1V1KA 2WTIA 1Q97A 3I81A 4F0FA 3I1AA 3MA3A 3UDBA 5F20A 4ANNA 4RPVA 3IW7A 4XG3A 5CLPA 4II5A 4TY1A 2VTAA 3RHXA 2VV9A 4O4DA 3N9XA 4MYGA 3VBQA 5DR9A 3S3IA 4DEAA 2YAKA 4MNEB 1URCA 2EUFB 1H07A 4UXLA 3THBA 3V5TA 1VYZA 2BZJA 3EQIA 3KB7A 3P7AA 3TWJA 3UYSA 3VS6A 2UV2A 3W33A 5DFPA 4MKCA 3V01A 4FKRA 2WU6A 2XJ2A 3ZO2A 4FBXA 1YXXA 3VC4A 4BCKA 4BIDA 1LPUA 5JMSA 2FSOX 4OTQA 3RHKA 3NUUA 3ORPA 2XEZA 4I24A 5T6KA 3ROCA 3IKAA 3KEXA 3FAAA 3R71A 3MH3A 5AADA 5CWZA 2YM6A 1W84A 1J3HA 3ZFMA 2OKRA 4MD8E 2AC3A 4TRLA 4DFLA 5G1XA 3QQLA 3V8SA 3DY7A 5C01A 2R5TA 3G90X 1J1CA 3MVLA 4FT5A 4R5YA 1MQBA 1OIYA 4FV9A 3VRZA 3U87A 3EZRA 5JRSA 3MN3A 3NW6A 4M69A 2VTSA 5IG1A 4G17A 3KCKA 2X2KA 5HVJA 4DBNA 4O0RA 3ZEPA 4QP9A 5J1WA 4RGJA 1PMVA 3AC1A 3C4FA 3HUBA 3PRIA 4YTHA 3LVPA 5HG9A 4GVJA 2O5KA 2E9PA 3HV6A 1GNGA 5A6OA 5M44A 4DINA 3B2WA 3QGYA 4IADA 5HE3A 3NUSA 2FSMX 3HUCA 2HY0A 4K2RA 1YWNA 2H8HA 3OF0A 4E6QA 4MXOA 4BICA 1W2CA 3P9JA 3SXSA 3LZBA 4FNWA 2P4IA 4YO6A 3BEAA 5E8YA 4YHJA 1JAMA 4L53A 4B7TA 5I9ZA 2JIUA 4ASEA 3F82A 4WNKA 4ERWA 4W4VA 1WBTA 2VGPA 4Q2AA 5D10A 4FZFB 2BMCA 3HDNA 5LXMA 5C9CA 1M7NA 2GCDA 5LVOA 4FV3A 4QTAA 2PMIA 3OUKA 5FXQA 1GZ8A 4FOBA 1M17A 3C4EA 2QU6A 3HMNA 2W1IA 3BQRA 4MK0A 4ASXA 3HLLA 4V05A 4TWCA 2BFYA 3FZ1A 4NFMA 3AT2A 3DJ5A 5AR8A 4I4FA 4IWQA 4EK8A 3FI3A 3OOGA 3AC4A 2B52A 3MV5A 3U4UA 4F9BA 4EK3A 2J0MB 4X6QC 4I21A 3VBTA 3F5PA 3P0MA 4CMOA 3E64A 4YJUA 5AV2A 4J1RA 4QP3A 4D0WA 2HIWA 4YPSA 4RVKA 2QKRA 4PL4A 5EOBA 3VS5A 5BVKA 3WYYA 4C62A 3UJGA 1Q3DA 3QTRA 4IAIA 3V3VA 4PNKA 3VHEA 1M14A 2UZEA 4EWQA 1U46A 1VJYA 3SRVB 4R7IA 3KXXA 3ZZWA 3LFFA 1OL1A 3PG3A 4YJSA 3W8QA 2P2HA 5AR5A 3MPAA 3UIMA 5J8IA 3TNWA 3FI2A 2YZAA 2ZMDA 3BWJA 5DEYA 4IAZA 2CSNA 2PMNX 5C8KA 3KXMA 3JS2A 4LGDA 3A7JA 2E9OA 3T9IA 5CASA 1ZY4A 5D7VA 4KD1A 3GOKA 4LL0A 3VRYA 3W10A 4IX3A 2IZSA 2X8DA 4C02A 4L46A 2WMRA 3RPYA 5G6VA 3LFCA 1XJDA 3LM0A 2YA9A 3VBVA 2ITQA 2YACA 3MY5A 3RAHA 4G16A 3GU6A 3BU3A 2YIWA 3DKCA 4ASZA 2Y4PA 3KXZA 5BYZA 3FMJA 2HZ0A 4RSSA 4EOSA 2X7FA 4UXQA 5DR6A 2J9MA 2YIRA 5AP7A 4BWPA 4ENXA 3ANQA 3FUPA 5K3YA 4L7SA 5HCXA 3PPKA 4ZSGA 3WZDA 2J5EA 4KBAA 1W0XC 2UZLA 5T3QA 1MP8A 3BYOA 3MB6A 2IVVA 3QALE 2XBAA 3RM7A 3RPOA 4D2RA 3BBWA 4E4NA 2BAQA 2QKWB 3TV7A 4UWBA 3D5UA 4IX5A 4RFMA 4Y46A 3UO6A 3DJ7A 5KMNA 1BX6A 3QTSA 2W0JA 1JSVA 3EFKA 4FT0A 4H3PA 2OXXA 4TNDA 3ZTXA 2X6DA 2HCKA 3FKLA 3DFAA 4BDIA 5DPVA 3LJ2A 3EQCA 2UW4A 5CSXA 3RPSA 4AW5A 4BHZA 2V7OA 5HNBA 5KZ0A 3AC3A 3HV3A 3NNWA 5IEYA 3ZHPC 2R3FA 4AT4A 2R2PA 1UU9A 5KKRB 4FODA 3FC2A 4J95A 5GZ8A 4ACMA 4RIOA 2OK1A 3Q9XA 2NP8A 4M15A 3ELJA 3QTZA 4O0SA 1BKXA 3LJ0A 4O21A 5IZFA 2HK5A 4QYFA 3I6UA 3TIYA 4BCPA 2PMLX 4Y73A 1OIQA 2NRUA 2BHHA 5J87A 3VF8A 4QMQA 4E26A 4PDSA 4ZTSA 4QTDA 3Q52A 3WILA 2OFUA 5HE1A 3BLQA 2YEXA 4GT5A 5HU9A 2BILB 2WMXA 2Y4IB 4FSWA 4X3FA 2HAKA 3CC6A 3SQQA 4O0XA 5AP2A 3D4QA 2ZB1A 5FDXA 3RMFA 3ZO3A 3E8CA 1W2FA 2BTSA 2OF2A 3AMAA 4AA4A 4TYHB 4MD9E 3MTFA 4AN3A 1MUOA 1JNKA 2XBJA 1OB3A 4Q5HA 4U79A 3QZHA 1M2QA 4FRFA 4XUFA 2VTPA 4FMQA 5HORA 4AOTA 2W99B 3IGOA 4TL0A 3ZMMA 1DAYA 4YBJA 5DWRA 2WAJA 3F3ZA 4J98A 4EONA 2VO7A 4JDJA 2PVYA 2JKKA 4FK3A 4F7LA 5CF4A 4MBIA 4L52A 4WNMA 2VTQA 1AGWA 5CF8A 1BLXA 2C6OA 2HOGA 2JEDA 3QLFA 4I93A 4JR3A 4M14A 4MCVA 5IA0A 2XNBA 2WOUA 1STCE 3ZS5A 4ANOA 1XH9A 4BDBA 3W2PA 3JVRA 3WOWA 2OIDA 4FZ7A 4G34A 4X3JA 4QMLA 2ETKA 1ZOEA 5HO7A 5HE0A 3GUBA 4I20A 4DEBA 5FP5A 3IW4A 5AR7A 4PMSA 5BMSA 3PY0A 2PVFA 2C6DA 2JKQA 4AGCA 4C4JA 5JFWA 5KX8A 1WBNA 2V7AA 3V8TA 4XG2A 2GMXA 2P33A 2XF0A 1GIIA 4WIHA 5HIBA 4BDDA 3OS3A 4QP2A 5M55A 2F4JA 4YJPA 5EKNA 4M7IA 4FV0A 4L7FA 3CLYA 4AZEA 4C4FA 5HX6A 3QRKA 2IO6A 4EC9A 4FF8A 1JKSA 3S95A 3PP0A 4Y72A 3QX4A 4ZY6A 5TF9A 2YDIA 4K18A 4BHNA 5FLFA 3MYGA 2C6TA 5AP3A 4KIPA 4F63A 4GFGA 4EJNA 5J5SA 2GNIA 4ACDA 3WF7A 4TYJA 3TZ8A 2QU5A 2OZAB 5J9ZA 2WTWA 3ET7A 2JAMA 2G2IA 5IA2A 1EH4A 4IWDA 3SAYA 2A19B 3PLSA 1UU7A 4TTHB 4ALUA 2HELA 4CNHA 4JIKA 3R7YA 4D2WA 4LQMA 2O63A 2ZV9A 4RLKA 3R8ZA 4E73A 3NR9A 1WFCA 5HNIX 2A27A 3IONA 3NCZA 4FZ6A 1NXKA 5CEQA 4E4MA 4CKRA 4D2VA 3B2TA 3WF9A 1PMEA 4AZVA 3AC8A 1H1PA 1H08A 5B2KA 4ZTMA 1WBVA 4TZRA 3A8WA 3EOCA 3DTCA 5BMMA 1AQ1A 1MRYA 4QMMA 5GZ9A 3WARA 4QTEA 1W98A 3CGFA 2XIKA 2Z7LA 3GCUA 3BGZA 3L8XA 4FSYA 3VN9A 4BF2A 1CM8A 4FZDB 2F2UA 5CI6A 2OW3A 2PL0A 2PE1A 5J95A 4M13A 4KIKA 1RQQA 4KAOA 4F0GA 5BQ0A 3BKBA 1PMUA 4QP7A 4FTKA 5L2SA 5JZNA 2JIIA 2A0CX 3F5XA 3R1SA 3QTIA 4GVAA 4BCJA 5ANGA 3E92A 4BYJA 1Q8YA 3R73A 2JIVA 4EH9A 3GC0A 4BDGA 4PY1A 4FTUA 4GV1A 4JG8A 4ZTHA 1WBPA 4FTAA 2BAKA 1Z57A 4FL1A 4IXPA 3A61A 3ODYX 1FGIA 3VS7A 2I0YA 4U41A 4JX3A 2OJJA 4WOVA 3I5NA 2I1MA 4NM5A 4L44A 3FC1X 3EYHA 3D94A 4I6BA 4NT4A 5HOAA 5I4NA 2JC6A 2XK4A 2YAAA 4NJDA 5KZIA 3UVQA 2CGVA 4U44A 2C6EA 5E8UA 1IA8A 2OJIA 2Y8OA 3TTIA 4K9YA 3DK7A 4E1ZA 4EH6A 5HLNA 1JQHA 2ITPA 2A2AA 3KF7A 5L2QA 3VUIA 4I4EA 4FTNA 4U81A 3LFNA 3O71A 3Q4TA 3CEKA 1PY5A 3DZOA 2XK8A 2I0VA 4JRVA 5FWKK 2C5XA 4BCMA 4DTKA 4MXXA 2DS1A 2OICA 3UQGA 3ZZEA 3JPVA 2IN6A 3C5UA 5H8BA 2WEIA 4A4XA 2A1AB 4CFMA 3ZLSA 1V0PA 5KMOA 3PXYA 4GW8A 3E8DA 3U8WA 2VTMA 2VNYA 3FLSA 3W32A 4YSJA 2C6MA 3UP7A 4M66A 4F7JA 1UNLA 4RT7A 5AMNA 2O2UA 4OTRA 2WMVA 3ROYA 4D4RA 3QCSA 5E8ZA 3DLSA 3DK6A 3E5AA 4OBQA 3ZRKA 4HYHA 3CD3A 4G31A 4ZTRA 4ZSLA 4DGLC 4AS0A 4F9AA 5CYIA 4RA5A 3EN9A 1UV5A 3QLGA 4O2ZA 3GB2A 2C0TA 4PP7A 3DPKA 5DLSA 1YHVA 4EK5A 3UO4A 3ZUTA 4UMQA 5AP1A 3WZJA 3QZFA 5ANJA 4D9UA 4TNBA 4YSMA 2BFXA 4FTLA 3VNTA 1RDQE 4ALWA 1OKYA 4XLIA 2ZOQA 1P4FA 4MVFA 3SXFA 1H26A 3CPBA 3ZDUA 4O4BB 4CFUA 5EOLA 1H01A 4KS7A 3PA5A 4UWCA 4XP3A 1XR1A 2BIKB 2XK9A 3HX4A 4L8MA 3TUCA 2WIPA 3NIEA 5CEMA 3SV0A 4K0YA 3OW3A 3R7EA 4NIFA 4BTFA 2J6MA 2X2MA 4C0TA 3DAJA 4YJQA 5EW3A 2OWBA 2WELA 2O8YA 2VN9A 3E62A 3E88A 2VWVA 3QRUA 4D4VA 3ZONA 5EM8A 4GG7A 4FICA 2WTJA 5FM2A 3BHVA 4HNFA 4AXAA 4QPMA 5CQWA 4F6UA 3PWYA 3R9DA 5I0BA 2OXDA 4G5PA 4AGDA 4CKJA 3EN7A 4O1PA 4C38A 3CTQA 2FSLX 4AZWA 3FMKA 3PYYA 3S0OA 1ZYJA 2QVSE 3EZVA 3KMUA 4L3JA 2R4BA 2XRUA 3C50A 2BRBA 2OF4A 1KV1A 4NTTA 1XBCA 5E1EA 5FGKA 2WO6A 3F7WA 2HZIA 4FEQA 4O0TA 4O4CA 5GZAA 3NRMA 3VJNA 1JKLA 2PVMA 4E5AX 4X2GA 3DDQA 3UOLA 4YJOA 5CQUA 4OTDA 4IB5A 3TNHA 1PXJA 3TTJA 5BVEA 3GT8A 4DG2E 4YU2A 2PVLA 5IA3A 2GQGA 4TKSA 5AUXA 5C03A 3ORMA 3P23A 4PPAA 4F4PA 5AUVA 4XEYA 2VX1A 4CZYB 5M4FA 3FXWA 4D5HA 3SD0A 3IW8A 4ZS0A 4RJ7A 3LPBA 4U45A 5L8JA 5A46A 3FHIA 4FT9A 5C8MA 4EK4A 2B9HA 4ZK5A 5FG8A 1YHSA 1SM2A 2QOHA 3QKLA 4N0SA 4J52A 3AT3A 4CLJA 1OGUA 3ORKA 2C0OA 4Q9SA 3R9OA 2ONLC 1OPLA 3T3VA 2Y7JA 3VVHA 3BHHA 4L3PA 4EI4A 5HVKA 4E6DA 5L8LA 3VUMA 4ZJJA 4QMNA 3MH0A 3I7CA 2HZ4A 3VW8A 3WIKA 3WI6A 4FG9A 5AUWA 4G5JA 4B6LA 2X6EA 4UY9A 4M0YA 4G6OA 4AQCA 2PTKA 4NTSA 4EC8A 4FGBA 4PV0A 2YWPA 4IB3A 4FL2A 4D4YA 3QUPA 4I5PA 4EEVA 5A4CA 3HL7A 1PYXA 2QO9A 2PZIA 1XBBA 4WA9A 3D5VA 4DITA 2QCSA 1YVJA 2VWZA 3G0FA 5EDQA 3FQSA 1UA2A 4P4CA 5EG3A 4BBFA 3FQEA 4DYMA 3ORXA 1YI3A 4FG7A 3FZOA 4OTIA 1U4DA 2BAJA 4A7CA 4FTIA 4ZLOA 4DAWA 3A99A 3OUNB 4ANMA 4ASDA 4B99A 5LWMA 4HYSA 2C1BA 3SW7A 3UQFA 3ALNA 4GYGA 2VAGA 5IH4A 4J53A 4RJ6A 5E92A 1OKZA 3TIZA 2E2BA 4RRVA 1ZRZA 2G1TA 3OG7A 1GJOA 1XHAA 4Y85A 3QQJA 4XJ0A 3Q32A 4OBPA 4E6CA 1Q99A 4ITIA 4QQCA 5ETCA 2YN8A 1K2PA 3Q3BA 3KMWA 4GUBA 5HLPA 5L2TA 4LL5A 2WGJA 5HCZA 5CEPA 3OBJA 3GQIA 3KQ7A 3DQXA 4PL5A 1P4OA 3CQUA 4NKAA 4LOOA 3QFVA 2RFEA 3OMVA 3PXKA 4ANBA 3KULB 2EWAA 5KBRA 3TZMA 1TQPA 4NJ3A 4USFA 2QG5A 5CAQA 5L6OA 5IDNA 5HU3A 5HEZA 4FV6A 4IB1A 4IZ7A 3OWLA 4Y95A 2CKEA 4ITHA 4W8DA 4AZTA 3UMXA 4XG4A 5FTOA 3K5VA 2UZTA 4ZSAA 3QXOA 2JDTA 3MBLA 4NFNA 4IMYA 2REIA 2B53A 1YDSE 4L00A 4F9WA 2PMOX 3ZLYA 3OW4A 1CSNA 3FMHA 4IB0A 4RJ3A 3F66A 2PVNA 2R3RA 5HGIA 3MPTA 4L42A 3R22A 4X6RA 4XH6A 3Q5ZA 3UP2A 1A06A 4WG5A 3RK5A 4GK2A 3FL5A 3HV7A 5AAEA 2BZIB 2WMSA 4BDFA 4EOJA 3FDNA 4FIIA 4XOYA 4BI1A 4RX9A 1KE5A 2GS2A 2XS0A 4QMPA 4YZCA 5CF6A 1ZXEA 4UZHA 1I09A 2XYNA 1M2PA 3IOPA 5DRDA 3E87A 5F95A 2O65A 3NW7A 4AA0A 4W4XA 4P2KA 3ZOSA 4L9IA 3ZRMA 2C5NA 3FY0A 4C34A 5HX8A 1Y57A 4CZUA 2EU9A 1X8BA 5JH6A 3ZSHA 2W5AA 5AP4A 1YW2A 5B2MA 2OG8A 3TN8A 3I0OA 1VZOA 2RFNA 4IVDA 1H27A 4O6EA 4U6RA 4ZIMA 1UU3A 1ZYLA 2W17A 3OCSA 4AFJA 4EYMA 5HZNA 4GK4A 1QCFA 3BYMA 1OECA 3QC9A 4WRGA 4LV5A 4BL1A 4RWJA 2JITA 1PKDA 3EQHA 3PJ1A 2GDOA 2QLQA 3IECA 3R1NA 4MNFA 3F3TA 4DEHA 3BEGA 4J7BA 5AP6A 1NA7A 4H1MA 1OITA 3LIJA 3PUPA 4QQJA 1ZAOA 4AFEA 2WQBA 3F5UA 4F08A 5I5ZA 4BCHA 4UMRA 3CR0A 2J4ZA 3I79A 4AP7A 4BI0A 5K5NA 1M2RA 5LMKC 3LAUA 3PJ3A 4BCOA 3MA6A 2PZYA 4BYIA 4HVDA 1PHKA 3DAEA 4EHZA 1QPEA 4EKLA 3VUKA 4GYIA 3A8XA 3MJ1A 5CXHA 1WVWA 5D7AA 4EYJA 3O0GA 4F0IA 5JFSA 4L68A 1JOWB 3ZXTA 3VAPA 3QQKA 2BRNA 1W83A 4CVAA 3GEQA 2QOFA 4I23A 1SVEA 4MWHA 4HVGA 3E8NA 4C4IA 4X2NA 4V04A 4C8BA 4FUYA 2X39A 3GQLA 2BRHA 4BB4A 1IRKA 2W4JA 1WBSA 3L9PA 4YLLA 4QMVA 4DN5A 1OM1A 4PPBA 4XOZA 3SXRA 4KRDA 2XIYA 1FINA 5TOZA 4WSYA 4I1ZA 4R7HA 3L9MA 2PE0A 2RF9A 3F3UA 4W9WA 2QOBA 1GOLA 3QL8A 3FLZA 2IVUA 4G3FA 2ITXA 2ZYBA 4YLKA 4BRXA 2JBOA 3VBXA 4XV3A 3R9HA 3LXLA 3A60A 4DGNA 1OUYA 4BZNA 4YZBA 1K3AA 2OBJA 2X0GA 1ERKA 3A7FA 2DUVA 2QOQA 4HGLA 3IS5A 2Y9QA 1UNGA 3LE6A 5BVNA 3R8PA 3QRIA 2R3GA 3BV2A 4UBAA 3F7ZA 5ETIA 4OTHA 1REJA 4JQ8A 1OVEA 5IA5A 3ZC6A 5HO8A 4S33A 4DEEA 2QURA 2WQMA 2UZVA 3CJFA 3DK3A 2R0IA 2ERZE 3PSBA 3QHRA 5JN2A 3FXXA 4KRCA 5AV1A 3V6SA 1VYWA 5IUGA 3VUGA 2UW8A 5JQ5A 4YTIA 2XCHA 3R21A 4RFYA 5KNJA 1WVXA 4I0SA 2HW6A 2F7EE 4FL3A 1SNXA 4F9CA 3C0IA 4D1ZA 4MXCA 3A62A 1XO2B 4IIRA 2ZVAA 4HGSA 4CRSA 1P2AA 2JDOA 4DG3E 3C4XA 2ERKA 4HZSA 2E9NA 2XNPA 4HCVA 4XYFA 3HEGA 3MH2A 4RIXB 3RI1A 1Q4LA 3OWKA 3UPXA 3Q4UA 5CXZA 2BRMA 4EQMA 5ACBC 2QOCA 3LCOA 5BUIA 2CCHA 2VTTA 4OR5A 3ZCLA 2EB3A 3CKWA 3M1SA 2R9SA 2VTHA 3GGFA 1Y6AA 4Y5QA 2B9FA 4BCGA 4WD5A 3OWJA 3DKFA 4RIYA 1KE9A 4K33A 3ZXZA 3R2YA 5I9YA 5CSPA 4WKQA 2G01A 3MSSA 2XM9A 3ORIA 4BDAA 3P4KA 2XKEA 1CMKE 3KRJA 2ZV2A 3LQ8A 1RW8A 2ETRA 2F9GA 2BHEA 4C36A 4G1WA 1KOAA 2PUUA 2WMWA 4BWXA 2GPHA 3POZA 3E93A 3QA8A 4UMPA 4EOPA 4LV8A 1GZNA 3D5WA 4YZMA 5DT3A 2BVAA 2SRCA 5CAUA 1YXSA 2BZHB 1XH6A 5JT2A 4K77A 4N6YA 2W1ZA 3SKCA 4YHFA 1JLUE 2PWLA 2OJ9A 4PWNA 4AA5A 4TYHA 3WYXA 2IJMA 2OH0E 5LVLA 2C30A 4KSPA 2XJ1A 3HZTA 4QYHA 4UV0A 3H10A 3R63A 4BKYA 1O9UA 1ZMUA 3LMGA 1XKKA 4U5JA 4Z7GA 3AGMA 4QMTA 4RIWB 3DNDA 4R5SA 5DRBA 4F7SA 4JAIA 4BCFA 5HIDA 1KE7A 2XNOA 4GS6A 2VNWA 3PE2A 4IACA 2WTDA 3K2LA 3A7GA 3DGKA 3Q60A 4YZNA 5CEKA 4O91A 3GP0A 3H0YA 4A4LA 4C37A 2XIXA 4F65A 4D4SA 3S2PA 3Q9ZA 2GFCA 4FR4A 5KMKA 2J51A 5IMXA 1DI8A 4D1SA 4EBVA 5HTIA 4GIHA 3PFQA 1B38A 1DM2A 3JXWA 5FXSA 3NW5A 2XNMA 3NNVA 3PE1A 4TYGA 4BC6A 2JLDA 1HOWA 2VTJA 5DI1A 2UW0A 3IQ7A 2UUEA 4LRMA 2YJSA 4U80A 4DG0E 3NLBA 2QD9A 4KA3A 3LCKA 2VTNA 5E8TA 2E9UA 3KRXA 1MRVA 4XNEA 3HYHA 1F5QA 4HNIA 5B0XA 1YQJA 3KXNA 3HRBA 4I6HA 2UW5A 2HY81 3IOKA 4CTBA 1GZOA 3RAIA 5JKGA 3QD4A 3TACA 5CAVA 1SNUA 5E90A 1V0BA 5CALA 5LVNA 2JDSA 3QUDA 3AD6A 5K9IA 3VQHA 5DR2A 4JJRA 5IH5A 4M69B 3P86A 5DNRA 4JG6A 4ITJA 4XG9A 4A9YA 4NH1A 3QA0A 5FBOA 4C2WA 1H1SA 3LCDA 2BROA 4O27B 5IISA 3DLZA 1ZMVA 3LFQA 4G3GA 2WMAA 5AUUA 4FKTA 2VWUA 4D55A 4IC7A 4FOCA 2JKMA