2QONA

Human epha3 kinase and juxtamembrane region, y596f:y602f:y742a triple mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
281
Chain Sequence
TFVTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGAVHRDLAARNILINSNLVCKVSDFGLSRIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAPSNLLLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 281
sequence length 311
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qonA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qonA01
3JY9A 4RBLA 4QO9A 4U42A 4WRSA 3KC3A 5DA3A 4C3RA 4UX9A 4J7BA 5GJDA 1W7HA 2FA2A 3Q4TA 4BTMA 3GFEA 4WT6A 4YBJA 3R9HA 2WMUA 2PZ5A 3BQCA 4IXPA 4G3CA 2ZOQA 3V5QA 4FI1A 3LFFA 2B7AA 3E8NA 4U80A 4B8MA 4TYIA 2WMWA 1KE9A 4M97A 3VUMA 3UQGA 4AGCA 2PVYA 4QMSA 1PF8A 3EN7A 4OTDA 1AD5A 3DZOA 4L7FA 4L8MA 2Y4IB 3TNPC 4GYGA 1J7IA 2X7OA 3MPMA 4HGSA 1P5EA 3KRRA 4AAAA 4E73A 3U6JA 1RJBA 1SVEA 1IRKA 3EJ1A 1T46A 3CQWA 4LMNA 2Q83A 4JIAA 1YHSA 4LV5A 3GENA 4V0GA 3DS6A 4KSPA 4BIEA 4C59A 3CTJA 3M1SA 1FBNA 2UV2A 5KE0A 3VBVA 4FE2A 5HCZA 3OC1A 1J7LA 4YJVA 5CNOA 4L52A 2ITTA 3EQFA 2UZVA 3IGGA 4EZ7A 4C3FA 1OECA 3GBZA 2JLDA 4IAFA 4FVPA 4QMTA 2QHMA 4HCTA 3DOGA 1JKKA 2X4FA 3CPCA 5A4QA 2A1AB 3PJ3A 5CANA 3S1HA 4AW2A 4JXFA 4W4XA 5CT0A 5IQCA 3H0YA 2VTOA 4WBBB 5K4JA 2G9XA 1JWHA 2B52A 5CYIA 5KKRB 1ZOEA 3C13A 3OCGA 4RMZA 3W33A 3QTIA 4LFIA 2R3RA 4CV8A 5CWZA 3HP5A 4NM7A 3UYTA 3NYOA 3F5GA 3MDYA 3RGFA 4AP7A 3G90X 2VO3A 2ZDUA 2CLXA 5AFVA 5IUGA 1OKVA 3FMHA 5AR4A 3QTXA 4FSUA 3R22A 4P5QA 3V51A 4C02A 2CNVA 3KN5A 3MJ1A 1WBTA 3PJ1A 5EHOA 4MKCA 3T3UA 3O7LD 3VQUA 4DBNA 4ORKA 1OPKA 4QPMA 3JVRA 3UIUA 3GCUA 4F0FA 4JJRA 3N51A 5LVMA 5J9LA 3A8WA 3OWLA 3VRZA 2PE2A 4YBKA 4QMOA 5CT7A 5M57A 2C5XA 3FHIA 5CF4A 1PHKA 4O1OA 4O0YA 2LAVA 4UXQA 5M56A 3DLZA 5LARA 2VUWA 1YVJA 4EH5A 4JG7A 3MSSA 3S2PA 1STCE 3LCKA 5CVHA 5EYMA 2WQEA 2VX3A 4FL1A 4P90A 3ZO1A 2YAAA 2FB8A 3N9XA 4I5PA 5F94A 5B2KA 5C26A 3W8QA 3IDCA 2XRUA 5DEWA 4ASXA 4E5BA 1TVOA 4MK0A 3FLQA 3V8SA 5CLPA 2C6TA 3FJQE 3NUPA 4QP4A 2WOTA 3PJCA 2PMOX 4M0YA 1J3HA 2YM5A 4FTRA 3LLAA 5FUTA 5LVOA 3BEAA 2WTIA 3OCBA 4L44A 4YTHA 2BTSA 1WZYA 2QR7A 4FKJA 4QMYA 4C2VA 3KF7A 4R3RA 5JFSA 2CN5A 3UG1A 3BLRA 4ZJVA 2GFSA 2XNOA 3NX8A 4MHAA 4F63A 5E8YA 2PMLX 5A3XA 1ZAOA 3SD0A 2BHHA 4RJ5A 2R64A 1GIHA 2XEYA 4IJPA 4PL3A 4QQTA 3K2LA 1Q99A 4G6LA 4IVBA 4BC6A 1LP4A 5ICPA 2XIRA 3QTUA 4IVCA 1SYKA 4M0ZA 5BVEA 4FL2A 3D7TA 4O2ZA 2B4SB 3COIA 3FDNA 1URCA 3R30A 4X7QA 2QU6A 4DG2E 4PWNA 3R01A 5CSWA 4EEVA 2BUJA 2YIYA 3IS5A 5AV3A 2SRCA 3W2OA 3SW4A 3DKGA 5FEEA 5BVKA 4IB5A 4U41A 3DQXA 4K77A 2ZAZA 4TPTA 5HIDA 4EHEA 3OWPA 3TACA 4OR5A 4J99A 2XKFA 3LAUA 4FT3A 2W05A 2W5BA 3IDPA 3PZHA 4P7EA 3OXZA 3ORXA 1JPAA 2W1IA 3EL7A 4RFZA 4CKJA 1EH4A 4MYGA 2CGWA 4XOYA 3HV3A 5J95A 3W2RA 3HL7A 3DK3A 4M13A 1BYGA 1OL6A 2XK4A 3UNKA 5K4IA 4AU8A 3NNWA 5DRDA 1ZY4A 3F61A 3T9IA 4F9WA 2OG8A 3POOA 4K6ZA 4AT3A 5E8ZA 4DHFA 2QHNA 5I9XA 5J7HA 1ZOGA 5IUIA 4C0TA 2QKRA 3UGCA 2YZLA 5KMMA 2R3LA 1XQZA 4Y73A 4X6RA 2ZB1A 2C69A 4O0SA 3EN5A 3FAAA 1U5QA 3ZXZA 2OICA 2ZVAA 3I4BA 4WUNA 4RVLA 4KBAA 5EDPA 5C8NA 3LMGA 4RIXA 3D0EA 5E4HA 2BFYA 2VWUA 3TV7A 2ZDTA 4TYHA 4DF3A 4YZCA 4ITJA 2C30A 3V6RA 1IASA 3VW8A 2PUIA 5BVFA 3OBJA 4C61A 2R7IA 3BLHA 5AUXA 5H9BA 5BUJA 2BFXA 3FI3A 3R1QA 5HG7A 3TKIA 4I5CA 4IC8A 2B0QA 4D0XA 4FG7A 1YXUA 5C4LA 2W99B 2UW5A 1G3NA 5J7BA 4L43A 3COHA 3EMGA 4RA4A 3C0IA 4MH7A 2ZV7A 3FZ1A 3L1SA 5M51A 4NCTA 3R2YA 4FT7A 4BDJA 5BVDA 3UPZA 2UW0A 5FTOA 5CXHA 4NZWB 2WQBA 4BCIA 3DJ6A 2XIYA 1NW1A 4F1OA 5KMNA 5KZIA 5FGKA 3RM6A 2J51A 4QMUA 4PDYA 1P14A 4IFCA 3HYHA 4OT6A 3COMA 4N6ZA 2REIA 4BIDA 3SDJA 3AOXA 4O83A 5EFQA 5I9WA 2PUNA 3MN3A 4TWOA 3PVBA 5A6NA 1T45A 3F9NA 4RC3A 3D83A 4C4IA 4PMPA 5HHWA 1W84A 3LMHA 5LCJA 3U4UA 2PVRA 3CKWA 4M84A 5E8SA 5AR3A 2NRUA 2NRYA 2WQOA 3DKFA 4KIKB 4XG8A 3FI4A 2R3FA 3QGWA 2R3OA 4UMUA 4M12A 2ETRA 2WTWA 3ZBFA 4J53A 4BHNA 5EKOA 5CAPA 3BU5A 2Y4PA 3PE2A 5BNJA 2WO6A 2WFYA 3JS2A 4J95A 4L68A 4UWBA 3P08A 3QAME 4IAYA 2YJSA 3F3UA 3ZLXA 3ZLWA 1JVPP 2GFCA 4MVFA 4A7CA 4ANOA 4JDJA 3CS9A 3EQPA 2XF0A 2Y8OA 5FP6A 2CDZA 2OI4X 1OPJA 2P3GX 3FL4A 3VC4A 3WYYA 4B99A 2YM8A 4FKUA 2G1TA 3MBLA 4L00A 3FPQA 3R7EA 3WE8A 4CCUA 3BPRA 3LQ5A 5TOZA 3UQFA 1OVEA 5DT4A 2IPXA 4LUDA 5JRSA 1R0EA 2XKDA 4AGUA 3DT1A 3OUNB 5G6VA 3FMDA 5CSHA 2E9OA 1GJOA 2W7XA 3OUKA 5CF8A 3G15A 4O0XA 2PL0A 3UPXA 5FM2A 5CALA 3EFLA 4WIHA 2OGVA 1M2QA 3HEGA 4ZSGA 4YSMA 4EH3A 4G9CA 3U55A 3HV4A 3DNDA 3UMXA 5AUYA 3KK9A 5EM8A 3R7UA 1ZZ2A 4R7IA 5JFWA 4FEUA 3NNUA 2WMXA 2C3LA 5HO7A 1UU3A 2OJJA 2VWWA 4GS6A 4DFXE 2F57A 1RE8A 1S9IA 1H1WA 2C1BA 4FIEA 3DCVA 3D4QA 4JG8A 3NCZA 5EM6A 4AWIA 1Q5KA 3EFWA 1U4DA 3Q4UA 3REPA 3UJGA 4J97A 2XM8A 2WEIA 4BVUA 1WBSA 2H6DA 4V01A 2WTJA 5D7VA 4EONA 4OGRA 4AA4A 4FSZA 2ITPA 3CJGA 3WF5A 4XLIA 4QMNA 2VAGA 4DEEA 4WG5A 5DT3A 2OJFE 5CZHA 2I0VA 3H9RA 1MQBA 2OFVA 3GCPA 5AUTA 3QD3A 5CTPA 4CG8A 4FVQA 2A19B 3W18A 4CFUA 4GU9A 3UVQA 4MXOA 4C4GA 3E64A 3TJDA 3EQBA 3P23A 5DPVA 3OT3A 4X2JA 2W5HA 2GNLA 2JDRA 3VBQA 4OTWA 3ZRLA 4G5JA 2YA9A 1WBWA 4HVIA 5GINE 2UZEA 2ZMCA 4TRLA 3B2TA 1M52A 3GU4A 3RJCA 4BI1A 5HBHA 3B2WA 3I1AA 3OXIA 4DG3E 2QOLA 4O27B 3E8CA 4FA2A 5IG1A 4D2WA 4F09A 2C0IA 2WELA 4O7SA 5IU2A 2FO0A 3LJ1A 5JQ8A 4M67A 2JAMA 2ETKA 3L8SA 4BWPA 5EKNA 3EKKA 4KS8A 5BX0A 2QG5A 5KX8A 4IADA 5GJFA 3O7LB 2FSOX 4E5WA 4UYNA 3RZFA 4R3CA 5C4KA 1VYWA 4U3YA 3F3VA 3P79A 3RHXA 3HECA 4BCFA 1ND4A 4BICA 4EK3A 3KVXA 3ZDIA 5K5XA 3BU6A 3MPAA 1OGUA 4FV3A 3UVPA 4GIIA 4WHZA 4ERWA 4YO4A 5IMEA 3LCSA 4MX9A 2GHMA 4RZWA 5ANOA 2XK6A 2P4IA 4ZSJA 3LFCA 5ETFA 1S9JA 3K5VA 5A46A 5BUIA 1PXPA 4WKQA 4I6BA 3FV8A 5AA9A 4EOSA 2YCSA 3SC1A 4A06A 5D10A 2W1EA 3GUBA 1FQ1B 4DBXA 4BKJA 1YHWA 3AD4A 3G0FA 2VD5A 4ANMA 2VX1A 2HELA 4FZFB 3LPBA 3RAKA 1PMNA 3QQUA 4C36A 4D9UA 3LXLA 2BAJA 1Q8WA 2YIQA 4FTOA 4QMWA 5FM3A 2YM3A 5H8EA 2BIKB 1QCFA 4X2FA 4ZIMA 4I0TA 4DEBA 4ZLZA 4I4EA 1TKIA 2BHEA 3FYKX 2I40A 3D94A 4BZOA 4AE6A 2ZYBA 4YGAA 3OROA 2EU9A 2C6LA 2Z8CA 2C5VA 2JIUA 4GH2A 3TXOA 2VTNA 2CNQA 3TKHA 1YI4A 3ORLA 3P1AA 3FQSA 3QD2B 3SLSA 4ZEGA 2OXDA 3CQEA 3NEWA 4FKSA 1I09A 1OPLA 4QPSA 5TKDA 4IAAA 2QCSA 2UW3A 3O51A 4S31A 1IR3A 5ANEA 4NEUA 3QTWA 5LVPA 5D11A 4O86A 3VO3A 4BB4A 3DAJA 4E3CA 3ET7A 3UIXA 4I0RA 5HD4A 3KULB 2ACXA 2GU8A 3EKNA 4NFNA 4FSNA 3ROYA 3P9JA 3UDBA 4QYYA 1ZYDA 3CGOA 2UW4A 4WRGA 4K18A 4ZTMA 4K9YA 3B8QA 4RPVA 5HO8A 4EOOA 3IW6A 1H08A 5ETIA 3QYWA 3ENHA 1F3MC 1RQQA 3FXXA 5BQ0A 5IUHA 5ETCA 4XG6A 3WF6A 4HVSA 3QRTA 4AZEA 5DLSA 3EOCA 3LLTA 4FYOA 3Q9WA 3TNHA 4CZYB 3V01A 1SNUA 3DQWA 4MWIA 3MFRA 4I23A 4AG8A 5HU9A 5IDNA 5L6PA 3SAYA 3N4TA 5AP0A 4K2RA 4NW5A 4TTHB 4O7RA 4RJ7A 5HICA 3NAXA 4JNWA 5HNIX 3ZEWA 4WNOA 5FQDC 4NUSA 4OTFA 2J90A 5CU6A 3PXQA 2ZM1A 4FOCA 5HIBA 4O0UA 3UTOA 3SXFA 3TNIA 2FSLX 3P78A 3QTQA 5AP2A 3PLAE 2RGPA 5L4QA 3G6HA 5ETAA 4S32A 3FLWA 2WTDA 5EDRA 3W55A 3UZTA 5IDPA 3NUAA 3E93A 2QURA 3OMVA 3T9TA 3GCSA 4G3EA 3TV6A 4CV9A 5M44A 4GJ2A 3C4XA 2XB7A 4A4XA 4E6QA 2PWLA 1NVRA 4I5HA 3WZKA 2BKKA 4EWQA 3HA6A 5BVWA 5FRIA 3ZEPA 5DG5A 4DFZE 3F2RA 4TKSA 1XH7A 4EHGA 2VTLA 4IAZA 2VWVA 2CKOA 2P55A 5M4IA 4FIIA 5HCXA 4P5ZA 2JDVA 4RGJA 2PTKA 5I9ZA 3SA0A 3R7OA 5IA4A 1UKIA 3CE3A 3DA6A 3VJOA 1YDRE 3D2IA 3LFEA 4BKZA 4XG4A 2WTVA 4EOIA 1OKYA 2J5EA 5BYZA 5FDPA 2GNHA 1PRYA 4KIKA 4DT8A 4USFA 4QYGA 4BCMA 3CCNA 4BN1A 4FL3A 3LIJA 5EW8A 5AIKA 1E9HA 3MWUA 4BDHA 4AX8A 4K11A 4XV2A 3W2CA 3ZXTA 1JSTA 2R7BA 2YCFA 3U6IA 3AMYA 3QFVA 4EL9A 4U8ZA 1NVSA 5HZNA 3A4PA 3WZUA 3IG7A 4GJ3A 2GSFA 3KVWA 3LCTA 5AR2A 3RVGA 3QKLA 4XBRA 3TUDA 3PG1A 1V0BA 4E4XA 4F0IA 5H3QA 3KFAA 4OTRA 5FBNC 2FGIA 3OXTA 4AW0A 3EYGA 2XVDA 5D12A 3GC9A 3WBLA 3MB6A 5CXZA 4GVAA 3QTRA 4HVDA 3E62A 2ZV8A 2IVTA 3D5XA 4RWKA 3TIYA 3VS0A 2OJGA 3F3ZA 4R6VA 3W8LA 3ZSGA 5GIPE 2ITOA 4N6YA 1FVVA 3D7TB 4XRJA 4W8DA 1LR4A 1XBCA 4L67A 1HCKA 1IA8A 5CU3A 2C6DA 5EW9A 4NSTA 2JKMA 2QONA 2XJ2A 4FTUA 5JEBA 4NK9A 4EZ5A 3QRJA 3GQLA 5CSXA 3PFQA 3RCDA 4M3QA 3PSDA 4YR8A 3DV3A 3G5DA 5B0XA 4BDBA 3EFJA 3AT2A 4ONAA 2QO7A 4LYNA 3EH9A 4QTEA 3FXZA 4A07A 3RK9A 5H2UA 5ANJA 3AG9A 3GT8A 3ANRA 4APCA 2XK3A 4FSMA 4Y85A 5HE2A 3K3JA 3ORKA 4S33A 3CEKA 4EOLA 1VEBA 3NMUF 4K1BA 1BI7A 1GZOA 3CP9A 4RX9A 4QP9A 1H8FA 4LL5A 4ZP5A 4UMRA 3GP0A 5AP3A 4L9IA 4WUAA 1FGIA 2YISA 3QC9A 5IKWA 1FPUA 5CEIA 3QYZA 5I5ZA 5K5NA 4DTBA 1MRYA 3UO6A 3M42A 4Q5HA 2DYLA 4M68A 2UZTA 1OUYA 1H1PA 4U79A 5IISA 3KRXA 5IEVA 4JVGA 3KXHA 4C3PA 2GS6A 2Z2WA 3O2MA 4IFGA 2QO2A 4XUFA 1Q41A 5C27A 4BL1A 4CYJA 4DFUA 3GVUA 3EQIA 4JLCA 4A4OA 4NW6A 2Z02A 4MD9E 4JDKA 1U46A 2R9SA 4U5JA 4YJPA 3FZOA 4GT5A 3FLNC 4EOQA 3O8PA 2VWIA 3PY1A 3MIYA 4IAIA 3ZUVA 2R0IA 3OW3A 3TNWA 3WOWA 4A9TA 4L3PA 4WOVA 3TZMA 1FVRA 2GTNA 4LMUA 4XG3A 5EW3A 2F2UA 4ZY5A 5E8WA 5BYLA 4G1WA 2PYWA 4BI2A 2CLQA 4OLIA 5CEPA 4KA3A 3QKKA 5JGAA 5JH6A 3QZGA 1YDTE 4HVGA 5CEMA 2GNJA 4TNDA 3SX9A 3V6SA 4C38A 4D1ZA 3F2NA 4F7NA 4YTFA 4H05A 3F5XA 5HE3A 4I41A 5C01A 4ACHA 1H07A 4QMXA 4D9TA 1MRUA 4XHKB 4BDAA 1GZ8A 4WBOA 4CGAA 2W1CA 3PWYA 4DTKA 4HCUA 5L2TA 2CGVA 4CT1A 3ODYX 3MW1A 4A9RA 2QU5A 4NFMA 4Y95A 3Q4ZA 2VTQA 3PPJA 3QF9A 1A9UA 1OKWA 2WTKB 3BYMA 4AZVA 1TQIA 5IQIA 4XP0A 3SG9A 2CKPA 4O7VA 3ID6C 2ZM3A 3FYJX 2XNPA 3WYXA 2C5NA 4X2GA 3BWFA 3T8OA 3VUIA 2P2HA 4D2RA 3WIKA 2GQRA 5M07A 4IHPA 4UMTA 2WU7A 2QNJA 3ROCA 4KBCA 2BPMA 4EBVA 5CAOA 3WZJA 5IQGA 1WCCA 2E9UA 4EBWA 3R28A 2GPHA 3C5IA 2WU6A 4YLJA 5HEZA 5D1JA 3F88A 3AQVA 4BYJA 4PTGA 4OTPA 1NXKA 3OFMA 4EC8A 3CD8A 3ETAA 4XG9A 3QKMA 3RK5A 2Y9QA 2BRMA 5DBXA 3HMOA 3KRJA 1Y8YA 3GB2A 3HRBA 3Q60A 4GFOA 5CS6A 5HVJA 3UC3A 5JGBA 4LG4A 1H0WA 3NRMA 5FP5A 2YJRA 1FMOE 3H0ZA 3NLBA 1KV2A 5AAEA 4NU1A 2GDOA 3HDMA 1BLXA 3R04A 4PUZA 3SXRA 4AW5A 3A7FA 4EKKA 5AIRA 2RFDA 4YJUA 1REKA 3KULA 4QP2A 3MESA 1UNHA 1TQMA 3IO7A 5CQUA 4I6FA 3VUKA 4DH5A 4NM0A 5A4EA 4F70A 4Z7GA 1VZOA 4BIBA 3G6GA 4F1TA 5T6KA 5CF5A 2H96A 2YAKA 2X6EA 3QQLA 3ZO3A 4KABA 3OVVA 3VS7A 3BYOA 1Q3WA 1PYXA 3A4OX 2PZRA 3FY0A 5L2QA 3GQIA 2J2IB 5J9ZA 4PMSA 3HAMA 3AC1A 1QPEA 1WBOA 2VNWA 4LV8A 4C35A 2HK5A 2RFNA 4IDTA 4PQNA 4IB3A 4NM3A 4PTCA 4FEWA 4GK4A 1NA7A 2YWPA 3GC8A 1GY3A 2OF4A 1HOWA 2R3NA 3ULZA 3VS3A 1ZYCA 3I5NA 5J5SA 1W0XC 3P4KA 1WVYA 3D2KA 5T3QA 3SOAA 3N4UA 1J91A 1V0OA 2BZKB 2OZAA 1Y8GA 4GG5A 1H00A 3ZUUA 2BAQA 2HENA 3HRFA 4OBQA 1KE6A 4F9YA 3BV3A 2VTJA 2W4OA 3DDQA 4FNWA 4Z3VA 5J79A 4QMQA 1U54B 5LMKA 2ERKA 3CR0A 3TTIA 2JKKA 2B1PA 2NPQA 2PPQA 4NKSA 4X21A 4JDIA 3GU8A 4YTCA 3WARA 3HV6A 3UP7A 3O96A 4C8BA 3KF4A 2OIBA 5J9YA 3ZU7A 3MVHA 2VTMA 3IDBA 4MQ2A 3ZZWA 3CQUA 3B8RA 1XJDA 5LVNA 3FEGA 5DMZA 4R5YA 2UW9A 5IA5A 3OW4A 1H27A 4FNXA 4QP7A 1O6YA 4FV8A 4MD8E 3L8XA 4X2NA 4KIOA 2OF2A 3TCPA 4BBMA 4G5PA 5A14A 3DXPA 4BZNA 4ANBA 3O50A 3SKCA 4KRDA 4Y72A 3DAKA 3TNQB 2OO8X 3JPVA 2IW8A 4YZBA 4FZ7A 5CU2A 4DGNA 3O0GA 3P5KA 4DITA 4Q5EA 5EYDA 3NWWA 2OH0E 3I5ZA 4PP9A 4EUTA 1DI9A 1KOBA 4BDDA 3QQGA 3ZRMA 4Y46A 2HYYA 1WBNA 3VS6A 2YFXA 3TDVA 4AFJA 4IB1A 4U3ZA 3EN6A 2G15A 2GMXA 3RPVA 5D7AA 4F7SA 4EH8A 3CY2A 4FTIA 4ZY4A 4AE9A 3F82A 5GZAA 1YOJA 4H3QA 4AOIA 5M08A 4U9AA 1M17A 2VWYA 5E8XA 4FKRA 5AAGA 5F20A 3WF8A 4E1ZA 1R3CA 1F0QA 4L01A 4FV1A 4EHVA 2YERA 5C9CA 3PJ2A 3VNTA 4NL0A 1YWVA 2JAVA 4M7IA 5DVRA 4FIHA 3LFBA 2I6LA 3RMFA 5TT7A 4YJRA 3O71A 3OEFX 5DOSA 3QZHA 3VS4A 3W1FA 4AA0A 1UU7A 4L46A 4MWHA 1ERKA 4IZ7A 3SXSA 4C37A 3ATSA 4HZRA 1MP8A 2C6MA 3FZTA 1RDQE 3PRIA 3R02A 4IEBA 4TXCA 4D4RA 2B53A 3BU3A 3EZVA 4BGGA 2ZV2A 3LXKA 5J1WA 3HDNA 5EOBA 4JAJA 1JKSA 3VUHA 4NKAA 2XNNA 3PXKA 4YMJA 2O2UA 4WG4A 5BUEA 4DTAA 3MVMA 4PL4A 2GS7A 4UZDA 4QOXA 1BL7A 3R7IA 2XMYA 5K0XA 5C03A 3U51A 3AC8A 4QTBA 4FSWA 4CNHA 1WVXA 1HCLA 4DYMA 1AGWA 4GW8A 2CNUA 3HUCA 1QMZA 3R7GA 3RPRA 2RKUA 1URWA 2OK1A 3KY2A 4IM0A 4K0YA 4AGDA 5KMLA 5LWMA 4KUJA 3HLLA 5AUUA 2X6DA 3W16A 4B8LA 2OU7A 1U5RA 5L2IA 5I0BA 4RWLA 4G9RA 4TWPA 2QI8A 4EK4A 1SVHA 3OP5A 3ZDUA 2VU3A 3G33A 3LFNA 4JR3A 4JX7A 4MTAA 4UBAA 2R3JA 3TWJA 3LFSA 1QPDA 4RWJA 3AMAA 3QLFA 3ZC6A 3F66A 3NR9A 4G6NA 3R8PA 4CKRA 5DWRA 5AA8A 4I6HA 3OTUA 4O0TA 4HPTE 5E1SA 1PXKA 2PVKA 4TL0A 3RKBA 3FMNA 2J7TA 4IX3A 5KZ0A 2UZOA 4FT5A 1VYZA 3QX2A 4N0SA 4NTSA 5HGIA 2OFUA 3ULIA 1OBDA 2UZDA 3NCGA 4HW7A 4QPAA 3TJCA 3ZC5A 3FZRA 4CLJA 4GFGA 5BMSA 5M55A 4ZTRA 2ONLC 1CM8A 2OIQA 3QQJA 4FV7A 4DE4A 3ZMMA 3C4WA 2FVDA 3DLSA 4X3FC 3QHWA 3SVVA 4QMVA 3CY3A 4V05A 5JMSA 2QQ7A 3DTWA 4B4LA 1YKRA 4UZHA 5DIAA 5LVLA 4IACA 3PE1A 4IM3A 4YP8A 4ASDA 1B39A 3CIKA 3EQRA 3O17A 2IVUA 5IQAA 4C58A 4NIFA 1UNGA 2WMTA 3KL8A 5HTCA 3QWJA 2C6IA 2ITWA 4EZ3A 4R8QA 2WB8A 5AWMA 3R9DA 3ZOSA 2W1DA 1ZMUA 3E8DA 4MAOA 5M06A 4HNIA 4CMOA 1YXSA 1PMUA 2X39A 3DKOA 4O1PA 4DLJA 4BRXA 1J7UA 5KMJA 3CTQA 4RX7A 2XRWA 4HJOA 4W9XA 1ZRZA 3GC0A 2W96B 4RIWB 4WNKA 1NVQA 4X6QC 4DH7A 2YDIA 1REJA 2GNFA 4CRLA 4QYHA 3R71A 3ZTXA 4XMOA 4ZJIA 3DBCA 4FSYA 1H01A 1H1RA 2QR8A 1ZYJA 2IZTA 5F4NA 4FKOA 2EXMA 1SM2A 2H8HA 4RA5A 5GNKA 3TZ8A 4F7JA 3QQHA 5AM7A 4JIKA 5C8KA 1ZXEA 2PVJA 2WMSA 2QLUA 3ACJA 3ALOA 4ZTNA 4E6DA 4ZLOA 5AJQA 4O91A 2WD1A 3LM5A 3UNJA 1A48A 4RLLA 3V04A 3CSVA 3FI2A 1OUKA 4USDA 1W82A 2QKWB 3PA5A 5BVNA 1K2PA 5IQHA 4O21A 4DFYA 3FZSA 3A8XA 2VTPA 3S0OA 3BYVA 3NNVA 3ZFYA 1M7QA 3SW7A 3ZH8A 2PMIA 2VTRA 3L9LA 1Q8UA 3Q9XA 4AZWA 2YWVA 3PYYA 3QRKA 4KD1A 3NUNA 3EQGA 3Q3BA 4ZSAA 1CKPA 4L45A 4E4NA 2I0EA 1YXTA 3F7ZA 3OCSA 4LGGA 1OIRA 4Z55A 1H26A 4S2ZA 1ZWSA 3AD6A 4PP7A 4ZSLA 4FV9A 4F1MA 4D58A 5KBQA 4AGWA 4JDHA 5H8GA 1Q8TA 4BR3A 4A9UA 4S30A 3R9NA 4J96A 2F7EE 2O0UA 3L8PA 1G8SA 5LCKA 4MXZA 4YSJA 5HTBA 2X1NA 4QP1A 3VBTA 2QO9A 5B2LA 4ZMFA 4UWYA 4XCUA 1YXVA 1XBBA 4TN6A 4ALVA 4Z7HA 2GNIA 3FLZA 2GNGA 5A9UA 4PDSA 4LRJA 3PP1A 2HZ4A 4M66A 5DGZA 5AP4A 4FG8A 4H3BA 4D2SA 4YNEA 1Q97A 3TUCA 3QX4A 5CAQA 4YPDA 4FK3A 5HESA 3VJNA 2BRHA 4EJ7A 2VNYA 2VTAA 3DK7A 2PZYA 5HI2A 4GK3A 2BMCA 3BIZA 4ITHA 4CLIA 1IAHA 1Y57A 3KA0A 5HE0A 5DR2A 1X8BA 3QGYA 3UMWA 4ENYA 1PXJA 4UB7A 1PXIA 2W4KA 2X2KA 5CU0A 2V55A 2NO3A 4HNFA 5HG9A 2XYUA 3I6UA 1U54A 4FKQA 2J5FA 5FXSA 2J0MB 1H4LA 4HPUE 4ZXTA 5EDQA 5FG8A 3R73A 3VS5A 2QOFA 3N4VA 5TF9A 4YZ9A 2B9JA 5M53A 3Q2JA 2OBJA 2WIPA 3BHHA 3KQ7A 2F49A 1KE7A 5HIEA 2O3PA 2R5TA 4FR4A 4GV1A 4G3GA 4W4WA 2ITYA 4C4FA 2GQGA 4DCEA 3KXXA 2XZSA 3R83A 2W1ZA 3RPSA 4BDFA 2YN8A 4FODA 4XP2A 4D28A 4E4LA 1PY5A 3C4CA 1KSWA 4YJOA 3RALA 5AR5A 5HLNA 2WNTA 4MNFA 3MV5A 5KCVA 3R9RA 1MRVA 3UE4A 3VF8A 4CRSA 5L6OA 3WIGA 4W4YA 3A60A 4GKHA 4DGMA 4X2KA 3C4ZA 3NVMB 3BLQA 2B9HA 4M8TA 2J0JA 3WF7A 4RC4A 3TZ9A 1Q24A 4RVMA 3RK7A 3FLYA 1CSNA 4JBVA 4F9CA 2EUFB 3L8VA 2IZRA 4R5SA 3K3IA 5AP1A 3S4QA 4Q9ZA 4XP3A 4ZZNA 2HXQA 4AW1A 4BFMA 3I7BA 1IG1A 3Q9ZA 3UOLA 5HG8A 3ZONA 4FIFA 2RL5A 3MGYA 4LI5A 3BHUA 3VBYA 5DN3A 3EN4A 2W9ZB 2R4BA 4ZZMA 4BDKA 3R8ZA 5M4FA 4QYFA 2JDSA 3LCDA 3TIZA 4B0GA 5HU3A 3NYVA 2QOCA 2JBOA 4G2FA 4AN9A 4CCBA 4ACCA 3MH3A 3ITZA 4LGDA 3UO4A 3HZTA 3VF9A 1M7NA 2RIOA 2GQSA 4XRLA 2C3JA 4ID7A 4IVDA 2QOHA 4OBPA 4NTTA 3R21A 2HWOA 4BDEA 2YDKA 2ITVA 1GNGA 2VO0A 2R0UA 4IM2A 3UZPA 4JQ7A 2X7GA 2VWXA 4EH4A 2X9EA 4RQVA 2BROA 4KBKA 5F9EA 2C4GA 5ITAA 3LFQA 1VJYA 4I5MA 4WG3A 3V5TA 3LXPA 3MH1A 2VO7A 2R2PA 3FC1X 3TG1A 4AN2A 2W1HA 3F69A 3MIAA 4PMTA 3IOKA 4APPA 4QTDA 3BRBA 2F2CB 1ATPE 4RFMA 3HVCA 3OF0A 4E93A 3PXRA 5HBJA 5IA1A 5ACBC 3QALE 3FKOA 4FKGA 4I1ZA 1XKKA 5E91A 4GVJA 2C1AA 3Q04A 1SNXA 2HWPA 3OY1A 4WNMA 2CGUA 4WSQA 3VS1A 4ZS4A 3PIXA 4TNBA 3RNYA 4KINA 3GU7A 4BCGA 3U54A 4CFFA 2XBAA 3ANQA 5IA3A 4FF8A 3DBFA 3FE3A 2YM4A 1L3RE 3KU2A 4QP3A 5HCYA 5IH5A 3WZDA 3BI6A 2VWBA 4G16A 3R8VA 2BIYA 4BDIA 4U43A 4MD7E 4KKHA 2BCJA 4J1RA 3F2AA 3TV4A 3BBTB 4EOJA 3NZ0A 4GT3A 3ZHPC 4XV9A 5EM7A 4KKEA 3GOKA 2J9MA 4XV3A 4H58A 4EYMA 3AGMA 2V0DA 4ZLYA 4NYEA 3EWHA 3ZO4A 2R3HA 3U9CA 1YHVA 3P0MA 1YOLA 4S34A 1ZOHA 5HLPA 4DA5A 5KHWA 2PY3A 3QRIA 4H39A 4I0SA 3E7OA 3HRCA 1Q62A 4W8EA 1OKZA 2PVNA 4FGRA 1H1SA 4ASZA 4N57A 2OZAB 3HA8A 1IA9A 5BPYA 3C0GA 4FYNA 5CX9A 3PXYA 1WAKA 2C6OA 2YIWA 3VUTA 2PVFA 2Q0NA 2UUEA 3OHTA 4JRNA 5CEOA 4ENXA 3KCKA 4O6EA 5G1XA 3EIDA 4F65A 5HVKA 2O65A 4FV5A 2YITA 3DAEA 4D5HA 5F1ZA 3OG7A 4EH7A 2R3KA 3L9MA 5AV1A 3JVSA 5C1QB 2OWBA 3IW4A 3BX5A 3LOKA 2O64A 3MFUA 4AFEA 3EQHA 4C62A 3AC4A 3QRUA 2X8DA 4JQEA 1KWPA 2Y6MA 1UU8A 3DNEA 5TR6A 3RPOA 4ZY6A 3TEIA 4FUXA 3I60A 4ZTSA 3D15A 4FTCA 3CD3A 2IZSA 2W4JA 3AD5A 4ANLA 4JRVA 4IBMA 3FKLA 3NW7A 2PU8A 4C4JA 3GU6A 4RIWA 1OZ1A 1JKLA 3ZLSA 1ZYLA 1ZZLA 4JT3A 5HLWA 3NIEA 3P7AA 4OAUC 3HUBA 2VX0A 3D5WA 4P4CA 5I9VA 3KMUA 2PVHA 3A99A 1J1BA 3FSKA 2IVVA 4TZRA 5BYYA 4ASEA 1OM1A 2XNGA 3IECA 4R7HA 3E5AA 4YHJA 4DCAA 4AQCA 1Q8YA 3GGFA 2OZOA 5A4TA 4TY1A 1NY3A 4LUEA 4O7WA 5E8TA 5KBRA 4IANA 2XBJA 4I94A 5L8KA 5J1VA 2XNEA 3U9NA 2YABA 3V8TA 5KNJA 4BGQA 2ZB0A 5J8IA 4LL0A 4FKWA 4LOPA 4XJ0A 2CJMA 5AP5A 5HQ0A 2XM9A 2B54A 4O6LA 4GT4A 2A4LA 3FMKA 4LRMA 3DFCB 3VUDA 3QZIA 2ZMDA 5AR8A 1TQPA 3FPMA 3P7CA 2Q0BA 3GCQA 4RFYA 2BZIB 3EYHA 3E92A 3DU8A 1Z57A 4GIHA 5TO8A 2UZLA 2CCHA 5KO1A 4EORA 1PXMA 2HOGA 3PRFA 4C33A 3KXZA 3AC5A 4G3DA 2QOQA 4IB0A 5HORA 3TDWA 3ZO2A 5E90A 2PMNX 2V62A 3OTVA 4U0IA 3DGKA 3C1XA 4WO5A 5CNNA 5JQ5A 2CN8A 1Y91A 3D7ZA 3G9NA 4PRJA 5HX6A 3QCYA 5JRQA 2IWIA 4RVTA 3LXNA 4AUAA 2Y6OA 3Q5ZA 4IWDA 2OJ9A 4L7SA 4CQEA 3RNIA 4FOBA 2OKRA 2PHKA 2W1GA 1WBPA 4Z9LA 4BTJA 2PK9A 5JZJA 5KMIA 3A7JA 3LMIA 4UY9A 5CSVA 1PXLA 2GHGA 2QC6A 4U44A 4NM5A 5HBEA 2V5QA 4XNEA 3PVGA 4BWKA 4E6AA 3IGOA 4G17A 1OBGA 4CXAA 5LQFA 2GCDA 5IZFA 3PA3A 2O8YA 4BF2A 5JFVA 4FKTA 3MH2A 3SOCA 3RAHA 3LM0A 4DG0E 3RTPA 3ZSHA 2JFMA 2W9FB 5FD2A 2IO6A 3FZPA 1P4FA 4E20A 3UOJA 4OW8A 4O7NA 2PE1A 1MUOA 4FMQA 4CFMA 5GHVA 5CVFA 4NT4A 2X0GA 4QMZA 2XS0A 4J52A 1P4OA 5I4NA 3V8WA 5JN2A 3C51A 3ODZX 3ORZA 2PVMA 3MVLA 2PUPA 2JITA 5DHJA 5IEXA 2VGPA 3FBVA 4UV0A 4NCTC 1XWSA 4GL9A 3TUBA 3QZFA 5FWKK 2B9IA 1KE5A 1YWRA 3LQ8A 5AV0A 3DBQA 3LVPA 4AA5A 5LXMA 3U6HA 4EC9A 2V7AA 3A7IA 2BKZA 3QWKA 2XH5A 4R78A 4QQCA 5EYKA 4BZDA 4MF0A 4KIQA 4PL5A 1OB3A 4HGEA 3RHKA 3ZLYA 4C4HA 4NIFB 4XX9A 3IONA 4IX4A 1Q4LA 3FMMA 4MXXA 3W10A 1J1CA 3AMBA 4ANNA 3ZS5A 4PPAA 1DS5A 3PWDA 4V04A 2WAJA 3ACKA 3FQHA 3U87A 5EI2A 4YNOA 3EFKA 1K9AA 5IQFA 3DZQA 3R0TA 5F95A 1O6KA 1JLUE 3QXPA 3VQHA 4FKVA 3OOMA 4FTKA 2JDTA 1WFCA 3ALNA 4QP8A 3C4FA 3R6XA 2KTYA 4GUEA 2ITXA 2J0LA 4X3JA 3HKOA 4Y8DA 1UVRA 3A7GA 4YJQA 5AMNA 3HMMA 3SGCA 2X8IA 3LW0A 3DPKA 4FSRA 4JR7A 4L53A 2XJ0A 4GG7A 1YQJA 3AT4A 3BELA 4EOMA 4ACDA 2HZ0A 3LFDA 1XBAA 3A61A 3GFWA 3QCXA 4FNZA 3C4EA 3W2SA 2BZHB 2Y4IC 5LWNA 5DT0A 5FXRA 3PTGA 4CZTA 4LRKA 1SMHA 1SVGA 2I0YA 5DRBA 3ZM4A 4BGHA 4MXYA 2YLFA 2JIVA 4ALUA 2UW6A 2NP8A 2AUHA 2QD9A 2WMBA 3VHKA 5CSPA 2X8EA 4OTHA 2YDJA 2C0TA 5EG3A 3ZRKA 3LFAA 3GEQA 3NVKI 2C0OA 4HVHA 3RWPA 4OBOA 4H1MA 3QCSA 1PMVA 3A7HA 3C9WA 2UZWE 3PA4A 1H0VA 4O7YA 4FVRA 3DB6A 2P2IA 4TWNA 4U45A 2ERZE 5AV4A 3PVWA 2C3KA 2QODA 2HY81 2UW8A 3CC6A 3TT0A 4D1SA 3MS9A 3Q52A 5L6WL 2WMVA 1YWNA 2XKCA 1JOWB 4BDGA 2XEZA 1PMEA 4U81A 5KKRC 5KUPA 4FZDB 3Q9YA 2R3QA 4UMQA 4UWCA 3JR1A 3CPBA 2GS2A 1GZNA 2YCRA 4H3PA 1ZMWA 3E87A 4RJ3A 4IQ6A 5AAFA 3V5PA 3NDMA 3M2WA 4BKYA 3OWKA 2HY0A 4AZFA 4DEHA 3H10A 3MB7A 5D9HA 4BCKA 1YW2A 4FV6A 4OTQA 3PVUA 4MBIA 4GYIA 5HNGA 3D14A 4ZJJA 3EHAA 3VS2A 4KS7A 3AGLA 3CGFA 2E9NA 4B9DA 2ESMA 1PKDA 2PUUA 1OITA 4OTGA 5CEQA 3LHJA 4FEVA 3GC7A 1JSVA 3NYXA 3DFAA 2ITUA 2GTMA 1I44A 2WIHA 4ZOGA 4BBFA 4FV0A 2H9VA 2YHVA 4QD6A 5ANDA 3HX4A 4RLKA 3NW5A 3AC3A 3E7VA 4H36A 4D2VA 5LOHA 5CENA 3PXFA 4FTMA 1OI9A 4YZNA 4FTAA 3P86A 5FXQA 2J4ZA 4TT7A 1Q8ZA 2HCKA 4P2KA 4F9BA 3G2FA 2Z7LA 4PDOA 4FTQA 3DK6A 3F5PA 4IX6A 4W9WA 1W8CA 2GHLA 2W06A 3H9OA 3LE6A 4O96A 3ELJA 5AP7A 1DM2A 3PPKA 3VBXA 3MFTA 2PSQA 4ERKA 2O63A 2YLEA 4Y5HA 3ZUTA 2DWBA 2H34A 4C57A 4FEQA 2YCQA 4II5A 2IVSA 2X81A 4IJ9A 4EQCA 2I1MA 2Z60A 2VTSA 2CKEA 2I7QA 1XH9A 3OEZA 1UU9A 4G34A 2P33A 3BZ3A 4JX3A 4KB8A 5E7RA 3VBWA 5DYJA 2ITNA 4BBEA 4AT5A 5EI6A 2XK8A 4ZZOA 3BGPA 3TN8A 3ERKA 3KGAA 2BZJA 3F7WA 3E3PA 4F6WA 4L3LA 2P0CA 4QNAA 1XHAA 5I3RA 2XCHA 1JKTA 3WZEA 3BE2A 4DFBA 3PJ8A 2QOOA 3S00A 2JKOA 3OCTA 1GZKA 4IMYA 4CG9A 3Q4CA 3E3BX 4L42A 2XIZA 4NH1A 1R1WA 1XH6A 4PY1A 4C2WA 4MXAA 3UODA 3NNXA 4FTJA 1OMWA 4Y83A 2R3PA 4YTIA 3UBDA 3PXZA 4CEGA 4EI4A 3UYSA 3UO5A 2JGZA 3SHEA 4QTAA 1CMKE 1CTPE 1ZYSA 3KMMA 4RG0A 4B6LA 4TWCA 5HO6A 3DTCA 3W2QA 4YLLA 4BCHA 4N4SA 3DDPA 3I0OA 2WTCA 1MQ4A 1YOMA 3KRLA 4QT1A 4RC2A 4XG7A 3K54A 1W83A 3O23A 3RZBA 4M69B 3NUXA 4WSYA 4ZAUA 5KMOA 2CKQA 3F3TA 4BDCA 5AUWA 3AT3A 4D5KA 4BWXA 3PLSA 2WMQA 5IF1A 4O0VA 2Y0AA 2WMRA 1GIJA 2PVLA 2AC5A 2WQNA 3QC4A 3MFSA 4KWPA 5DH3A 4N70A 4O38A 5FTQA 3R8MA 4AT4A 4DGOA 4F7LA 5I9YA 4JG6A 4D2TA 2FH9A 5A4CA 3LJ0A 3IPHA 4AOTA 2C68A 2I0HA 4I3ZA 4AOJA 4RJ8A 3GI3A 4QQ5A 3BEGA 4PPBA 3EQCA 3KB7A 2JFLA 3ZZEA 2HZNA 4F4PA 5FBOA 4YJTA 1LPUA 4USEA 4HOKA 3WI6A 3UNZA 4GU6A 4YZDA 4PNKA 2C6EA 3QL8A 1M2PA 2JD5A 5CEKA 1OIUA 5CU4A 3RCJA 3FHRA 3G9LX 5DR6A 4K8AA 5L2SA 4MNEB 1JQHA 4NWMA 3WILA 2WGJA 3ZYAA 4PMMA 2Z7RA 4RX8A 1R0PA 3V5WA 3GCVA 5AADA 5M4CA 4YO6A 5CASA 2RFSA 2BILB 3L9NA 4DEIA 5J5TA 3MTLA 3ZCLA 4R77A 4D55A 2ZJWA 3CXWA 5HOAA 2G01A 4F64A 2XKEA 2C3IB 4EWHA 4O0WA 4LGHA 5IQBA 2QOBA 3IW8A 1XO2B 5EK7A 4I6QA 5DNRA 3DKCA 1YI3A 3FKNA 4UYAA 4X0MA 3II5A 2XP2A 4E7WA 3CBLA 1L8TA 1UNLA 3RAIA 3VVHA 3HV7A 1KOAA 3CKXA 4DH3A 3QA0A 1B6CB 2XUUA 5AX9A 4UMPA 5A54A 5DR9A 4RJ6A 4JAIA 2O5KA 4Q9SA 3UP2A 3BHTA 2FYSA 3PY3A 4AZTA 4DAWA 4RT7A 4W4VA 3ATTA 3L9PA 3LCOA 4BHZA 4GUBA 5HX8A 3EZRA 4O7ZA 3SRVA 4XS2A 3BYUA 4O0RA 2J6MA 5IPJA 4X3FB 1GOLA 3QUEA 3GXLA 5FEDA 3VAPA 5IH6A 4DEDA 1RW8A 4FTLA 5IQEA 2R3GA 4HZSA 2HXLA 2AYPA 1LUFA 1AQ1A 2HW7A 3K5UA 3VUGA 5JSMA 2RFEA 5ACKA 4RIOA 1H28A 4IZ5A 3PZEA 4CTBA 1W98A 3QBNA 4AF3A 4O7LA 1B38A 1BI8A 1YI6A 2CMWA 4R1VA 4R1YA 4CFVA 4CZUA 4J98A 5CY3A 5DEYA 3NGAA 5C8MA 4AS0A 3NIZA 4FIJA 4I21A 4FZAB 2CSNA 3FMEA 3U8WA 3KXGA 1UA2A 4QMLA 4TYJA 2UZUE 5HTIA 3QD4A 2X2LA 4GFMA 3RINA 4MBJA 1P2AA 5AR7A 5JT2A 3KCFA 4RX5A 1BMKA 4QNYA 3OBGA 4AZSA 3I81A 4R3PA 4DGLC 3HV5A 4DEAA 4JS8A 3QHRA 4EUUA 2YIXA 3CTHA 5HKMA 1OL2A 1H1QA 3JUHA 3PP0A 5B7VA 4ITIA 2VTTA 3BKBA 5L8JA 3ENMA 4E5AX 2UVZA 2UVXA 3AXWA 3DBDA 4KAOA 1QL6A 4FT9A 3TL8A 2YM7A 5GJGA 3QTZA 1GAGA 2XK7A 4LOOA 3G51A 2EVAA 1DAWA 5HD7A 3SG8A 3KXMA 1E1XA 5H8BA 2X9FA 2VZ6A 2WHBA 5DI1A 1XH8A 5IA2A 4E4MA 3VULA 3KKVA 3MVJA 3QUPA 3H30A 4I93A 4ALWA 4EQMA 4HCVA 2FSMX 1WBVA 2C5OA 5DE2A 2DUVA 4Z16A 1R78A 2WMAA 4CTCA 1ZLTA 4ZK5A 4UN0C 2PE0A 4PX6A 4C4EA 2E2BA 5IEYA 5FDXA 2J0KA 3GOPA 2JEDA 3BQRA 3DXQA 4D4YA 3ZFXA 3R8UA 5EOLA 5IMXA 2C5YA 4I22A 3TTJA 4GRBA 3NPCA 3GU5A 3V5LA 3W32A 4DFLA 4QRCA 1PJKA 1VR2A 5ANIA 4O81A 4JOAA 3FUPA 2PZPA 2IW6A 3THBA 4CFNA 4I4FA 2IW9A 4IE9A 4K33A 4BCOA 3BHYA 4L3JA 1M2RA 4EK8A 4KRCA 3Q6UA 4KIPA 3NUSA 2XIXA 4FBXA 4Q2AA 4OT5A 4BYIA 5AEPA 4BCNA 5EQPA 3UG2A 3C0HA 3UVRA 1XH5A 1Z5MA 2XA4A 2BR1A 4IDVA 4IWPA 3PSCA 3BE9A 3VIDA 2XNMA 3D9VA 4XEYA 4FZ6A 4CT2A 4EK5A 2KULA 2C47A 4TW9A 2WXVA 4XH6A 2XK9A 3FLSA 5E8VA 4KNBA 2B55A 4EH6A 4JL9A 3HMIA 4NJDA 3QCQA 4WNPA 1Z9XA 1WVWA 4ZS0A 1ZMVA 4EH9A 4YURA 4OUCA 3ORMA 1PXOA 1XH4A 3F5UA 1OIQA 2XJ1A 4DINA 2LGCA 4DLIA 3PSBA 4L6QA 2CHLA 3HAVA 2R3IA 3O8UA 5AUZA 3UIMA 2FUMA 3PY0A 3WF9A 4AN3A 3KXNA 4NJ3A 5CAVA 5CQWA 4M15A 4XG2A 3NS9A 4F99A 5BVOA 5GZ8A 4FSTA 3EN9A 3D5UA 4B7TA 3MA3A 4YUQA 1PKGA 3MTFA 4QMPA 3E63A 4U7ZA 3H9FA 4I20A 3BWJA 4LM5A 4PDPA 2RF9A 4RRVA 5AM6A 2X2MA 1JSUA 4RIYB 3UOHA 4E6CA 2Z7QA 4JBQA 1OL1A 3RWQA 3U4WA 3A2CA 1BKXA 3OOGA 4A4LA 4U97A 5FEQA 2RG6A 1H25A 3FY2A 4FTNA 4F6SA 4E8AA 3BYSA 2BDJA 4O22A 3FC2A 2OIDA 4IAKA 3R8LA 4RJ4A 2XNBA 3HMNA 3COKA 5EHLA 4BCJA 3BV2A 1YRPA 2XIKA 1LEWA 4UXLA 2B9FA 4HYHA 5I9UA 3R7VA 3RBWA 3OY3A 4IZYA 3C5UA 3HP2A 1UKHA 3KRWA 3NYNA 3AC2A 3D5VA 3MPTA 4BCQA 3KREA 4IWQA 4PF4A 3SQQA 4D2PA 5IH4A 1CDKA 4GKIA 2YIRA 4A9SA 4J8MA 4FUYA 2JKQA 4YLKA 1FINA 2Y7JA 4KSQA 2WZJA 3RP9A 5EQYA 2QVSE 4M69A 4CD0A 3ORPA 4YZMA 3FL5A 3HNGA 3CLYA 5FTGA 4QMMA 2G2FA 2WEVA 4M14A 4WD5A 5HG5A 3OZ6A 3QLGA 4GSBA 5KHXA 2BAKA 2E9VA 2WOUA 4U40A 2CCIA 3MJ2A 4ACGA 4PPCA 1IAJA 4RZVA 3MYGA 4PTEA 4FNYA 2EXCX 4HYIA 1OIYA 3C7QA 3FSFA 3Q32A 4D4SA 5JFXA 3Q53A 5CZIA 1U59A 3BGQA 4FK6A 3ZFMA 1QPCA 4G3FA 3OWJA 5AUVA 3R9OA 2OSCA 3MY5A 4DGGA 5FLFA 5D41A 5L2WA 1PXNA 4XV1A 5EHYA 5CI6A 3R7YA 5HNBA 3DXNA 3GNIB 3H4JA 1FVTA 5JKGA 4PV0A 4FKPA 2X7FA 3IQ7A 3PUPA 3FI8A 2Z7SA 3Q96A 3EB0A 1BX6A 4IZAA 1JAMA 3H3CA 3IK3A 4XYFA 4O84A 2VN9A 3FWQA 3G0EA 3JYAA 4JI9A 4V0GB 1PYEA 4ANSA 1WMKA 5K0KA 1SZMA 1G8AA 2VO6A 3RAWA 4IH8A 4ZMEA 3TI1A 2VTHA 3BGZA 4MNEA 3KMWA 2C6KA 3T3VA 2W17A 4JQ8A 1DI8A 4F9AA 2ITQA 3DBEA 1FGKA 3IOPA 4YHTA 2FSTX 1PW2A 1UV5A 3P7BA 4JBOA 4ZTLA 4FV4A 2VTIA 5BMMA 3VN9A 2NNWB 4C7TA 2XCKA 1APME 3EL8A 5KMKA 3WE4A 5AP6A 2EXEA 2W5AA 3UOKA 3QQKA 3FQEA 1G5SA 5E9EA 2QLQA 3R1NA 2BDFA 3DY7A 3E88A 3MY0A 5LMKC 4YC6A 2WPAA 5JGDA 3TM0A 4MQ1A 3RI1A 4A9YA 3F3WA 2BTRA 2RG5A 4CQGA 4JBPA 4C34A 4IW0A 5CAUA 4O7TA 2BRNA 3LQ3A 2BRBA 3NW6A 3UQCA 4BTKA 2IZUA 4E26A 4F08A 2QOKA 4HYSA 3S95A 4CFXA 5LMBA 5A6OA 3R00A 1CKJA 2EB2A 4DN5A 2F7ZE 1K3AA 3PPZA 4MF1A 4EJNA 2HIWA 3NAYA 4QQJA 2HAKA 2VWZA 3MI9A 5T68A 4J8NA 2A0CX 5JZNA 2ONLA 5EQEA 3R1SA 4U6RA 2G2IA 5EM5A 4DH1A 2OW3A 4BCPA 4HGTA 4QTCA 2J0IA 4X3FA 2IJMA 3RPYA 2ITZA 5IA0A 3Q5IA 3MA6A 3OD6X 5EYCA 4EH2A 2XYNA 1V1KA 4LQMA 2W1FA 4AXAA 3FXWA 4F6UA 1M14A 3QTSA 4G6OA 4KKGA 1JBPE 2YACA 4FT0A 4FICA 4OTIA 5E1EA 2VGOA 4FKLA 4IWOA 4RQKA 2JIIA 3POZA 3QD0A 3RM7A 3DJ5A 5B2MA 5ANGA 3I6WA 3LKMA 2IN6A 2W0JA 4EK6A 2BVAA 3JXWA 4IX5A 2V22A 3BHVA 3I79A 2X4ZA 4TYGA 2UVYA 3NUYA 4H1JA 3QA8A 4MCVA 4UEUA 2WKMA 3V5JA 4DEGA 2YZAA 2JC6A 3PG3A 3JY0A 2UZBA 2PULA 2ETMA 5J87A 3C50A 1IEPA 3ZSIA 1GIIA 5L3AA 5HVYA 1BL6A 2HZIA 4DH8A 1NT2A 4CKIA 3HGKA 4EOKA 4CVAA 3UZRA 1FOTA 2EWAA 4YU2A 4XLVA 2DS1A 4O82A 4BY9E 4EHZA 4YJSA 5EH0A 5GZ9A 4GK2A 4R7BA 1ZY5A 4DFNA 4FG9A 1QPJA 3PDTA 4YJNA 2IG7A 4FGBA 1CKIA 1YXXA 4DC2A 5EI8A 2V7OA 4ZTHA 4EOPA 4I92A 1OL7A 3QQFA 4G31A 3VW6A 1OL5A 4IC7A 1BUHA 1YDSE 4PNIA 5LMAA 2JBPA 5L8LA 1Y6BA 5K3YA 3TKUA 2HW6A 3MH0A 4FX3A 3TZ7A 4D0WA 1KUTA 4ARKA 5E8UA 5M09A 4XBUA 3R1YA 3PIZA 2ZV9A 1Q3DA 4CMUA 4CFWA 4ANQA 4IVAA 1LEZA 3DB8A 3E8EA 5AV2A 5M4UA 3IW5A 5E92A 2OXYA 1O9UA 2J50A 4Y5QA 5CVGA 2F7XE 3NSZA 5LJJA 2OJIA 4J71A 4FIGA 4TYEA 5AX3A 3FMJA 4FSQA 4I24A 4MEDA 2OXXA 4QP6A 4CSVA 2G2HA 3I7CA 3ORIA 4XOZA 2A27A 4BI0A 1DAYA 3NUUA 4HGLA 4OAVB 3MY1A 4ACMA 4F0GA 3F6XA 3HMPA 3A62A 4GEOA 2AC3A 2OH4A 2YM6A 4MBLA 4UALA 4YC8A 4YHFA 4FEXA 1UWJA 3W2PA 2UZNA 1A06A 2QOIA 1FMKA 2VV9A 3V3VA 4O2PA 3LJ2A 3KN6A 3Q2MA 2RSVA 4GCJA 3ZBXA 3I0QA 1F5QA 1JNKA 3DJ7A 3LZBA 3VWAA 4CYIA 4DT9A 4EQUA 3Q6WA 4FC0A 2R3MA 4EKLA 2QG7A 2DQ7X 2E9PA 4RIXB 4HYUA 2ZM4A 2YEXA 4BTFA 3ZM9A 4RWIA 5ANKA 3VRYA 3ORNA 5CF6A 4TYHB 4GMYA 2F9GA 2WQMA 3QUDA 4WA9A 4FKIA 3UC4A 4AACA 2VRXA 4RSSA 1KV1A 1V0PA 5IQDA 1O6LA 4FTTA 2JDOA 1H24A 3QU0A 5JK3A 3IW7A 3VHEA 2OLCA 4RIYA 5GIOE 2UW7A 2EB3A 2CPKE 3R63A 3KEXA 3CJFA 4RVKA 2WTKC 3IKAA 5HE1A 3SV0A 1Y6AA 4ZSEA 4YPSA 5I3OA 4CMTA 2A2AA 2CGXA 3SRVB 4EYJA 4MXCA 1Q61A 3OT8A 2BDWA 4D4VA 1UWHA 4QYEA 1XR1A 5TE0A 3PIYA 4IIRA 2BALA 1KE8A 5DFPA 2BRGA 3OS3A 2PZIA 3O8TA 1ZARA 5CI7A 2F4JA 4FV2A 4YC3A 4D1XA 4LOQA 3S3IA 4ZTQA 5K9IA 3FMLA 1R39A 5A4LA 3ORTA 3UIBA 3KK8A 3QXOA 1E1VA 3EQDA 3BBWA 3R2BA 3M11A 3BCEA
chains in the Genus database with same CATH superfamily
3JY9A 4RBLA 4QO9A 4U42A 4WRSA 3KC3A 3UDSA 5DA3A 4C3RA 4UX9A 4J7BA 5GJDA 1W7HA 2FA2A 3Q4TA 4BTMA 3GFEA 4WT6A 4YBJA 3R9HA 2WMUA 2PZ5A 3BQCA 4IXPA 4G3CA 2ZOQA 3V5QA 4FI1A 3LFFA 2B7AA 3E8NA 4U80A 4B8MA 4TYIA 2WMWA 1KE9A 4M97A 3VUMA 3UQGA 4AGCA 2PVYA 4QMSA 1PF8A 3EN7A 4OTDA 1AD5A 3DZOA 4L7FA 4L8MA 2Y4IB 3TNPC 4GYGA 1J7IA 2X7OA 3MPMA 4HGSA 1P5EA 3KRRA 4AAAA 4E73A 3U6JA 1RJBA 1SVEA 1IRKA 3EJ1A 1T46A 3CQWA 4LMNA 2Q83A 4JIAA 1YHSA 4LV5A 3GENA 4V0GA 3DS6A 4KSPA 4BIEA 4C59A 3CTJA 3M1SA 1FBNA 2UV2A 5KE0A 3VBVA 4FE2A 5HCZA 3OC1A 1J7LA 4YJVA 5CNOA 4L52A 2ITTA 3EQFA 2UZVA 3IGGA 4EZ7A 4C3FA 1OECA 3GBZA 2JLDA 4IAFA 4FVPA 4QMTA 2QHMA 4HCTA 3DOGA 1JKKA 2X4FA 3CPCA 5A4QA 2A1AB 3PJ3A 5CANA 3S1HA 4AW2A 4JXFA 4W4XA 5CT0A 5IQCA 3H0YA 2VTOA 4WBBB 5K4JA 2G9XA 1JWHA 2B52A 5CYIA 5KKRB 1ZOEA 3C13A 3OCGA 4RMZA 3W33A 3W0QA 3QTIA 4LFIA 2R3RA 4CV8A 5CWZA 3HP5A 4NM7A 3UYTA 3NYOA 3F5GA 3MDYA 3RGFA 4AP7A 3G90X 2VO3A 2ZDUA 2CLXA 5AFVA 5IUGA 1OKVA 3FMHA 5AR4A 3QTXA 4FSUA 3R22A 4P5QA 3V51A 4C02A 2CNVA 3KN5A 3MJ1A 1WBTA 3PJ1A 5EHOA 4MKCA 3T3UA 3O7LD 3VQUA 4DBNA 4ORKA 1OPKA 4QPMA 3JVRA 3UIUA 3GCUA 4F0FA 4JJRA 3N51A 5LVMA 5J9LA 3A8WA 3OWLA 3VRZA 2PE2A 4YBKA 4QMOA 5CT7A 5M57A 2NYAA 2C5XA 3FHIA 5CF4A 1W2DA 1PHKA 3BL7A 4O1OA 4O0YA 2LAVA 4UXQA 5M56A 3DLZA 5LARA 2VUWA 1YVJA 4EH5A 4JG7A 3MSSA 3S2PA 1STCE 3LCKA 5CVHA 5EYMA 2WQEA 2VX3A 4FL1A 4P90A 3ZO1A 2YAAA 2FB8A 3N9XA 4I5PA 5F94A 5B2KA 5C26A 3W8QA 3IDCA 2XRUA 5DEWA 4ASXA 4E5BA 3TMOA 1TVOA 4MK0A 3FLQA 3V8SA 5CLPA 2C6TA 3FJQE 3NUPA 4QP4A 2WOTA 3PJCA 2PMOX 4M0YA 1J3HA 2YM5A 4FTRA 3LLAA 5FUTA 5LVOA 3BEAA 2WTIA 3OCBA 4L44A 4YTHA 2BTSA 1WZYA 2QR7A 4FKJA 4QMYA 4C2VA 3KF7A 4R3RA 5JFSA 2CN5A 3UG1A 3BLRA 4ZJVA 2GFSA 2XNOA 3NX8A 4MHAA 4F63A 5E8YA 2PMLX 5A3XA 1ZAOA 3SD0A 2BHHA 4RJ5A 2R64A 1GIHA 2XEYA 4IJPA 4PL3A 4QQTA 3K2LA 1Q99A 4G6LA 4IVBA 4BC6A 1LP4A 5ICPA 2XIRA 3QTUA 4IVCA 3UDZA 1SYKA 4M0ZA 4DDIA 5BVEA 4FL2A 3D7TA 4O2ZA 2B4SB 3COIA 3FDNA 1URCA 3R30A 4X7QA 2QU6A 4DG2E 4PWNA 3R01A 5CSWA 4EEVA 2BUJA 2YIYA 3IS5A 5AV3A 2SRCA 3W2OA 3SW4A 3DKGA 5FEEA 5BVKA 4IB5A 4U41A 3DQXA 4K77A 2ZAZA 4TPTA 5HIDA 4EHEA 1ST4A 3OWPA 3TACA 4OR5A 4J99A 2XKFA 3LAUA 4FT3A 2W05A 2W5BA 3IDPA 3PZHA 4P7EA 3OXZA 3ORXA 1JPAA 2W1IA 3EL7A 4RFZA 4CKJA 1EH4A 4MYGA 2CGWA 4XOYA 3HV3A 5J95A 3W2RA 3HL7A 3DK3A 4M13A 1BYGA 1OL6A 2XK4A 3UNKA 5K4IA 4AU8A 3NNWA 5DRDA 1ZY4A 3F61A 3T9IA 4F9WA 2OG8A 3POOA 4K6ZA 4AT3A 5E8ZA 4DHFA 2QHNA 5I9XA 5J7HA 1ZOGA 5IUIA 4C0TA 2QKRA 3UGCA 2YZLA 5KMMA 2R3LA 1XQZA 4Y73A 4X6RA 2ZB1A 2C69A 4O0SA 3EN5A 3FAAA 1U5QA 3ZXZA 2OICA 2ZVAA 3I4BA 4WUNA 4RVLA 4KBAA 5EDPA 5C8NA 3LMGA 4RIXA 3D0EA 5E4HA 2BFYA 2VWUA 3TV7A 2ZDTA 4TYHA 4DF3A 4YZCA 4ITJA 2C30A 3V6RA 1IASA 3VW8A 2PUIA 5BVFA 3OBJA 4C61A 2R7IA 3BLHA 5AUXA 5H9BA 5BUJA 2BFXA 3FI3A 3R1QA 3BL9A 5HG7A 3TKIA 4I5CA 4IC8A 2B0QA 4D0XA 4FG7A 1YXUA 5C4LA 2W99B 2UW5A 1G3NA 5J7BA 4L43A 3COHA 3EMGA 4RA4A 3C0IA 4MH7A 2ZV7A 3FZ1A 3L1SA 5M51A 4NCTA 3R2YA 4FT7A 4BDJA 5BVDA 3UPZA 2UW0A 5FTOA 5CXHA 4NZWB 2WQBA 4BCIA 3DJ6A 2XIYA 1NW1A 4F1OA 5KMNA 5KZIA 5FGKA 3RM6A 2J51A 4QMUA 4PDYA 1P14A 4IFCA 3HYHA 4OT6A 3COMA 4N6ZA 2REIA 4BIDA 3SDJA 3AOXA 4O83A 5EFQA 5I9WA 2PUNA 3MN3A 4TWOA 3PVBA 5A6NA 4FJVA 1T45A 3F9NA 4RC3A 3D83A 4C4IA 4PMPA 5HHWA 1W84A 3LMHA 5LCJA 3U4UA 2PVRA 2XALA 3CKWA 4M84A 1OGYA 5E8SA 5AR3A 2NRUA 2NRYA 2WQOA 3DKFA 4KIKB 4XG8A 3FI4A 2R3FA 3QGWA 2R3OA 4UMUA 4M12A 2ETRA 2WTWA 3ZBFA 4J53A 4BHNA 5EKOA 5CAPA 3BU5A 2Y4PA 3PE2A 5BNJA 2WO6A 2WFYA 3JS2A 4J95A 4L68A 4UWBA 3P08A 3QAME 4IAYA 2YJSA 3F3UA 3ZLXA 3ZLWA 1JVPP 2GFCA 4MVFA 4A7CA 4ANOA 4JDJA 3CS9A 3EQPA 2XF0A 2Y8OA 5FP6A 2CDZA 2OI4X 1OPJA 2P3GX 3FL4A 3VC4A 3WYYA 4B99A 2YM8A 4FKUA 2G1TA 3MBLA 4L00A 3FPQA 3R7EA 3WE8A 4CCUA 3BPRA 3LQ5A 5TOZA 3UQFA 1OVEA 5DT4A 2IPXA 4LUDA 5JRSA 1R0EA 2XKDA 1TFFA 4AGUA 3DT1A 3OUNB 5G6VA 3FMDA 5CSHA 2E9OA 1GJOA 2W7XA 3OUKA 5CF8A 3G15A 4O0XA 2PL0A 3UPXA 5FM2A 5CALA 3EFLA 4WIHA 2OGVA 1M2QA 3HEGA 4ZSGA 4YSMA 4EH3A 4G9CA 3U55A 3HV4A 3DNDA 3UMXA 5AUYA 3KK9A 5EM8A 3R7UA 1ZZ2A 4R7IA 5JFWA 4FEUA 3NNUA 2WMXA 2C3LA 5HO7A 1UU3A 2OJJA 2VWWA 4GS6A 4DFXE 2F57A 1RE8A 4O4CA 1S9IA 1H1WA 2C1BA 4FIEA 3DCVA 3D4QA 4JG8A 3NCZA 5EM6A 4AWIA 1Q5KA 3EFWA 4O4BB 1U4DA 3Q4UA 3REPA 3UJGA 4J97A 2XM8A 2WEIA 4BVUA 1WBSA 2H6DA 4V01A 2WTJA 5D7VA 4EONA 4OGRA 4AA4A 4FSZA 2ITPA 3CJGA 3WF5A 4XLIA 4QMNA 2VAGA 4DEEA 4WG5A 5DT3A 2OJFE 5CZHA 2I0VA 3H9RA 1MQBA 2OFVA 3GCPA 5AUTA 3QD3A 5CTPA 4CG8A 4FVQA 2A19B 3W18A 4CFUA 3TYKA 4GU9A 3UVQA 4MXOA 4C4GA 3E64A 3TJDA 3EQBA 3P23A 5DPVA 3OT3A 4X2JA 2W5HA 2GNLA 2JDRA 3VBQA 4OTWA 3ZRLA 4G5JA 2YA9A 1WBWA 4HVIA 5GINE 2UZEA 2ZMCA 4TRLA 3B2TA 1M52A 3GU4A 3RJCA 4BI1A 5HBHA 3B2WA 3I1AA 3OXIA 4DG3E 2QOLA 4O27B 3E8CA 4FA2A 5IG1A 4D2WA 4F09A 2C0IA 2WELA 4O7SA 5IU2A 2FO0A 3LJ1A 5JQ8A 4M67A 2JAMA 2ETKA 3L8SA 4BWPA 5EKNA 3EKKA 4KS8A 5BX0A 2QG5A 5KX8A 4IADA 5GJFA 3O7LB 2FSOX 4E5WA 4UYNA 3RZFA 4R3CA 5C4KA 1VYWA 4U3YA 3F3VA 3P79A 3RHXA 3HECA 4BCFA 1ND4A 4BICA 4EK3A 3KVXA 3ZDIA 5K5XA 3BU6A 3MPAA 1OGUA 4FV3A 3UVPA 4GIIA 4WHZA 4ERWA 4YO4A 5IMEA 3LCSA 4MX9A 2GHMA 4RZWA 5ANOA 2XK6A 2P4IA 4ZSJA 3LFCA 5ETFA 1S9JA 3K5VA 5A46A 5BUIA 1PXPA 4WKQA 4I6BA 3FV8A 5AA9A 4EOSA 2YCSA 3SC1A 4A06A 5D10A 2W1EA 3GUBA 1FQ1B 4DBXA 4BKJA 1YHWA 3AD4A 3G0FA 2VD5A 4ANMA 2VX1A 2HELA 4FZFB 3LPBA 3RAKA 1PMNA 3QQUA 4C36A 4D9UA 3LXLA 2BAJA 1Q8WA 2YIQA 4FTOA 4QMWA 5FM3A 2YM3A 5H8EA 2BIKB 1QCFA 4X2FA 4ZIMA 4I0TA 4DEBA 4ZLZA 4I4EA 1TKIA 2BHEA 3FYKX 2I40A 3D94A 4BZOA 4AE6A 2ZYBA 4YGAA 3OROA 2EU9A 2C6LA 2Z8CA 2C5VA 2JIUA 4GH2A 3TXOA 2VTNA 2CNQA 3TKHA 1YI4A 3ORLA 3P1AA 3FQSA 3QD2B 3SLSA 4ZEGA 2OXDA 3CQEA 3NEWA 4FKSA 1I09A 1OPLA 4QPSA 5TKDA 4IAAA 2QCSA 2UW3A 3O51A 4S31A 1IR3A 5ANEA 4NEUA 3QTWA 5LVPA 5D11A 4O86A 3VO3A 4BB4A 3DAJA 4E3CA 3ET7A 3UIXA 4I0RA 5HD4A 3KULB 2ACXA 2GU8A 3EKNA 4NFNA 4FSNA 3ROYA 3P9JA 3UDBA 4QYYA 1ZYDA 3CGOA 2UW4A 4WRGA 4K18A 4ZTMA 4K9YA 3B8QA 4RPVA 5HO8A 4EOOA 3IW6A 1H08A 5ETIA 3QYWA 3ENHA 1F3MC 1RQQA 3FXXA 5BQ0A 5IUHA 5ETCA 4XG6A 3WF6A 4HVSA 3QRTA 4AZEA 5DLSA 3EOCA 3LLTA 4FYOA 3Q9WA 3TNHA 4CZYB 3V01A 1SNUA 3DQWA 4MWIA 3MFRA 4I23A 4AG8A 5HU9A 5IDNA 5L6PA 3SAYA 3AKLA 3N4TA 5AP0A 4K2RA 2AQXA 4NW5A 4TTHB 4O7RA 4RJ7A 5HICA 3NAXA 4JNWA 5HNIX 3ZEWA 4WNOA 5FQDC 4NUSA 4OTFA 2J90A 5CU6A 3PXQA 2ZM1A 4FOCA 5HIBA 4O0UA 3UTOA 3SXFA 4BJJB 3TNIA 2FSLX 3P78A 3QTQA 5AP2A 3PLAE 2RGPA 5L4QA 3G6HA 5ETAA 4S32A 3FLWA 2WTDA 5EDRA 3W55A 3UZTA 5IDPA 3NUAA 3E93A 2QURA 3OMVA 3T9TA 3GCSA 4G3EA 3TV6A 4CV9A 5M44A 4GJ2A 3C4XA 2XB7A 4A4XA 4E6QA 2PWLA 1NVRA 4I5HA 3WZKA 2BKKA 4EWQA 3HA6A 5BVWA 5FRIA 3ZEPA 5DG5A 4DFZE 3F2RA 4TKSA 1XH7A 4EHGA 2VTLA 4IAZA 2VWVA 2CKOA 2P55A 5M4IA 4FIIA 5HCXA 4P5ZA 2JDVA 4RGJA 2PTKA 5I9ZA 3SA0A 3R7OA 5IA4A 1UKIA 3CE3A 3DA6A 3VJOA 1YDRE 3D2IA 3LFEA 4BKZA 4XG4A 2WTVA 4EOIA 1OKYA 2J5EA 5BYZA 5FDPA 2GNHA 1PRYA 3KIOC 4KIKA 4DT8A 4USFA 4QYGA 4BCMA 3CCNA 4BN1A 4FL3A 3LIJA 5EW8A 5AIKA 1E9HA 3MWUA 4BDHA 4AX8A 4K11A 4XV2A 3W2CA 3ZXTA 1JSTA 2R7BA 2YCFA 3U6IA 3AMYA 3QFVA 4EL9A 4U8ZA 1NVSA 5HZNA 3A4PA 3WZUA 3IG7A 4GJ3A 2GSFA 3KVWA 3LCTA 5AR2A 3RVGA 3QKLA 4XBRA 3TUDA 3PG1A 1V0BA 4E4XA 4F0IA 5H3QA 3KFAA 4OTRA 5FBNC 2FGIA 3OXTA 4AW0A 3EYGA 2XVDA 5D12A 3GC9A 3WBLA 3MB6A 5CXZA 4GVAA 3QTRA 4HVDA 3E62A 2ZV8A 2IVTA 3D5XA 4RWKA 3TIYA 3VS0A 2OJGA 3F3ZA 4R6VA 3W8LA 3ZSGA 5GIPE 2ITOA 4N6YA 1FVVA 3D7TB 4XRJA 4W8DA 1LR4A 1XBCA 4L67A 1HCKA 1IA8A 5CU3A 2C6DA 5EW9A 4NSTA 2JKMA 2QONA 2XJ2A 4FTUA 5JEBA 4NK9A 4EZ5A 3QRJA 3GQLA 5CSXA 3PFQA 3RCDA 4M3QA 3PSDA 4YR8A 3DV3A 3G5DA 5B0XA 4BDBA 3EFJA 3AT2A 4ONAA 2QO7A 4LYNA 3EH9A 4QTEA 3FXZA 4A07A 3RK9A 5H2UA 5ANJA 3AG9A 3GT8A 3ANRA 4APCA 2XK3A 4FSMA 4Y85A 5HE2A 3K3JA 3ORKA 4S33A 3CEKA 4EOLA 1VEBA 3NMUF 4K1BA 1BI7A 1GZOA 3CP9A 4RX9A 4QP9A 1H8FA 1ST0A 4LL5A 4ZP5A 4UMRA 3W0MA 3GP0A 5AP3A 4L9IA 4WUAA 1FGIA 2YISA 3QC9A 5IKWA 1FPUA 5CEIA 3QYZA 5I5ZA 5K5NA 4DTBA 1MRYA 3UO6A 3M42A 4Q5HA 2DYLA 4M68A 2UZTA 1OUYA 1H1PA 4U79A 5IISA 3KRXA 5IEVA 4JVGA 3KXHA 4C3PA 2GS6A 2Z2WA 3O2MA 4IFGA 2QO2A 4XUFA 1Q41A 5C27A 4BL1A 4CYJA 4DFUA 3GVUA 3EQIA 4JLCA 4A4OA 4NW6A 2Z02A 4MD9E 4JDKA 1U46A 2R9SA 4U5JA 4YJPA 3FZOA 4GT5A 3FLNC 4EOQA 3O8PA 2VWIA 3PY1A 3MIYA 4IAIA 3ZUVA 2R0IA 3OW3A 3TNWA 3WOWA 4A9TA 4L3PA 4WOVA 3TZMA 1FVRA 2GTNA 4LMUA 4XG3A 5EW3A 2F2UA 4ZY5A 5E8WA 5BYLA 4G1WA 2PYWA 4BI2A 2CLQA 4OLIA 5CEPA 4KA3A 3QKKA 5JGAA 5JH6A 3W0NA 3QZGA 1YDTE 4HVGA 5CEMA 2GNJA 4TNDA 3SX9A 3V6SA 4C38A 4D1ZA 3F2NA 4F7NA 4YTFA 4H05A 3F5XA 4AXEA 5HE3A 4I41A 5C01A 4ACHA 1H07A 4O4DA 4QMXA 4D9TA 1MRUA 4XHKB 4BDAA 1GZ8A 4WBOA 4CGAA 2W1CA 3PWYA 4DTKA 4HCUA 5L2TA 2CGVA 4CT1A 3ODYX 3MW1A 4A9RA 2QU5A 4NFMA 4Y95A 3Q4ZA 2VTQA 3PPJA 3QF9A 1A9UA 1OKWA 2WTKB 3BYMA 4AZVA 1TQIA 5IQIA 4XP0A 3SG9A 2CKPA 4O7VA 3ID6C 2ZM3A 3FYJX 2XNPA 3WYXA 4MUQA 2C5NA 4X2GA 3BWFA 3T8OA 3VUIA 2ZFYA 2P2HA 4D2RA 3WIKA 2GQRA 5M07A 4IHPA 4UMTA 2WU7A 2QNJA 3ROCA 4KBCA 2BPMA 4EBVA 5CAOA 3WZJA 5IQGA 1WCCA 2E9UA 4EBWA 3R28A 2GPHA 3C5IA 2WU6A 4YLJA 5HEZA 5D1JA 3F88A 3AQVA 4BYJA 4PTGA 4OTPA 1NXKA 3OFMA 4EC8A 3CD8A 3ETAA 4XG9A 3QKMA 3RK5A 2Y9QA 2BRMA 5DBXA 3HMOA 3KRJA 1Y8YA 3GB2A 3HRBA 3Q60A 4GFOA 1VLRA 5CS6A 5HVJA 3UC3A 5JGBA 2X0PA 4LG4A 1H0WA 3NRMA 5FP5A 2YJRA 1FMOE 3H0ZA 3NLBA 1KV2A 5AAEA 4NU1A 2GDOA 3HDMA 1BLXA 3R04A 4PUZA 3SXRA 4AW5A 3A7FA 4EKKA 5AIRA 2RFDA 4YJUA 1REKA 3KULA 4QP2A 3MESA 1UNHA 1TQMA 3IO7A 5CQUA 4I6FA 3VUKA 4DH5A 4NM0A 5A4EA 4F70A 4Z7GA 1VZOA 4BIBA 3G6GA 4F1TA 5T6KA 5CF5A 2H96A 2YAKA 2X6EA 3QQLA 3ZO3A 4KABA 3OVVA 3VS7A 3BYOA 1Q3WA 1PYXA 3A4OX 2PZRA 3FY0A 5L2QA 3GQIA 2J2IB 5J9ZA 4PMSA 3HAMA 3AC1A 1QPEA 1WBOA 2VNWA 4LV8A 4C35A 2HK5A 2RFNA 4IDTA 4PQNA 4IB3A 4NM3A 4PTCA 4FEWA 4GK4A 1NA7A 2YWPA 3GC8A 1GY3A 2OF4A 1HOWA 2R3NA 3ULZA 4O4EA 1ZYCA 3VS3A 3I5NA 5J5SA 1W0XC 3P4KA 1WVYA 3D2KA 5T3QA 3SOAA 3N4UA 1J91A 1V0OA 2BZKB 2OZAA 1Y8GA 4BJJA 4GG5A 1H00A 3ZUUA 2BAQA 2HENA 3HRFA 4OBQA 1KE6A 4F9YA 3BV3A 2VTJA 2W4OA 3DDQA 4FNWA 4Z3VA 5J79A 4QMQA 1U54B 5LMKA 2ERKA 3CR0A 3TTIA 2JKKA 2B1PA 2NPQA 2PPQA 4NKSA 4X21A 4JDIA 3GU8A 4YTCA 3WARA 3O5AA 3HV6A 3UP7A 3O96A 4C8BA 3KF4A 2OIBA 5J9YA 3ZU7A 3MVHA 2VTMA 3IDBA 4MQ2A 3ZZWA 3CQUA 3B8RA 1XJDA 5LVNA 3FEGA 5DMZA 4R5YA 2UW9A 5IA5A 3OW4A 1H27A 4FNXA 4QP7A 1O6YA 4FV8A 4MD8E 3L8XA 4X2NA 4KIOA 2OF2A 3TCPA 4BBMA 4G5PA 5A14A 3DXPA 4BZNA 4ANBA 3O50A 3SKCA 4KRDA 4Y72A 3DAKA 3TNQB 2OO8X 3JPVA 2IW8A 4YZBA 4FZ7A 5CU2A 4DGNA 3O0GA 3P5KA 4DITA 4Q5EA 5EYDA 3NWWA 3AKJA 2OH0E 3I5ZA 4PP9A 4EUTA 1DI9A 1KOBA 4BDDA 3QQGA 3ZRMA 4Y46A 2HYYA 1WBNA 3VS6A 2YFXA 3TDVA 4AFJA 4IB1A 4U3ZA 3EN6A 2G15A 2GMXA 3RPVA 5D7AA 4F7SA 4EH8A 3CY2A 4FTIA 4ZY4A 3UDTA 4AE9A 3F82A 5GZAA 1YOJA 4H3QA 4AOIA 5M08A 4U9AA 1M17A 2VWYA 5E8XA 4FKRA 5AAGA 5F20A 3WF8A 4E1ZA 1R3CA 1F0QA 4L01A 4FV1A 4EHVA 4I6LA 2YERA 5C9CA 3PJ2A 3VNTA 4NL0A 1YWVA 2JAVA 4M7IA 5DVRA 4FIHA 3LFBA 2I6LA 3RMFA 5TT7A 4YJRA 3O71A 3OEFX 5DOSA 3QZHA 3VS4A 3W1FA 4AA0A 1UU7A 4L46A 4MWHA 1ERKA 4IZ7A 3SXSA 4C37A 3ATSA 4HZRA 1MP8A 2C6MA 3FZTA 1RDQE 3PRIA 3R02A 4IEBA 4TXCA 4D4RA 2B53A 3BU3A 3EZVA 4BGGA 2ZV2A 3LXKA 5J1WA 3HDNA 5EOBA 4JAJA 1JKSA 3VUHA 4NKAA 2XNNA 3PXKA 4YMJA 2O2UA 4WG4A 5BUEA 4DTAA 3MVMA 4PL4A 2GS7A 4UZDA 4QOXA 1BL7A 3R7IA 2XMYA 5K0XA 5C03A 3U51A 3AC8A 4QTBA 4FSWA 4CNHA 1WVXA 1HCLA 4DYMA 1AGWA 4GW8A 2CNUA 3HUCA 1QMZA 3R7GA 3RPRA 2RKUA 1URWA 2OK1A 3KY2A 4IM0A 4K0YA 4AGDA 5KMLA 5LWMA 4KUJA 3HLLA 5AUUA 2X6DA 3W16A 4B8LA 2OU7A 1U5RA 5L2IA 5I0BA 4RWLA 4G9RA 4TWPA 2QI8A 4EK4A 1SVHA 3OP5A 3ZDUA 2VU3A 3G33A 3LFNA 4JR3A 4JX7A 4MTAA 4UBAA 2R3JA 3TWJA 3LFSA 1QPDA 4RWJA 3AMAA 3QLFA 3ZC6A 3F66A 3NR9A 4G6NA 3R8PA 4CKRA 5DWRA 5AA8A 4I6HA 3NFFB 3OTUA 4O0TA 4HPTE 5E1SA 1PXKA 2PVKA 4TL0A 3RKBA 3FMNA 2J7TA 4IX3A 5KZ0A 2UZOA 4FT5A 1VYZA 3QX2A 4N0SA 4NTSA 5HGIA 2OFUA 3ULIA 1OBDA 2UZDA 3NCGA 4HW7A 4QPAA 3TJCA 3ZC5A 3FZRA 4CLJA 4GFGA 5BMSA 5M55A 4ZTRA 2ONLC 1CM8A 5BV3A 2OIQA 3QQJA 4FV7A 4DE4A 3ZMMA 3C4WA 2FVDA 3DLSA 4X3FC 3QHWA 3SVVA 4QMVA 3CY3A 4V05A 5JMSA 2QQ7A 3DTWA 4B4LA 1YKRA 4UZHA 5DIAA 5LVLA 4IACA 3PE1A 4IM3A 4YP8A 4ASDA 1B39A 3CIKA 3EQRA 3O17A 2IVUA 5IQAA 4C58A 4NIFA 3P5JC 1UNGA 2WMTA 3KL8A 5HTCA 3QWJA 2C6IA 2ITWA 4EZ3A 4R8QA 2WB8A 5AWMA 3R9DA 3ZOSA 2W1DA 1ZMUA 3E8DA 4MAOA 5M06A 4HNIA 4CMOA 1YXSA 3NFGB 1PMUA 2X39A 3DKOA 4O1PA 4DLJA 4BRXA 1J7UA 5KMJA 3CTQA 4RX7A 2XRWA 4HJOA 4W9XA 1ZRZA 3GC0A 2W96B 4RIWB 4WNKA 1NVQA 4X6QC 4DH7A 2YDIA 1REJA 2GNFA 4CRLA 4QYHA 3R71A 3ZTXA 4XMOA 4ZJIA 3DBCA 4FSYA 1H01A 1H1RA 2QR8A 1ZYJA 2IZTA 5F4NA 4FKOA 2EXMA 1SM2A 2H8HA 4RA5A 5GNKA 3TZ8A 4F7JA 3QQHA 5AM7A 4JIKA 5C8KA 1ZXEA 2PVJA 2WMSA 2QLUA 3ACJA 3ALOA 4ZTNA 4E6DA 4ZLOA 5AJQA 4O91A 2WD1A 3LM5A 3UNJA 1A48A 4RLLA 3V04A 3CSVA 3FI2A 1OUKA 4USDA 1W82A 2QKWB 3PA5A 5BVNA 1K2PA 5IQHA 4O21A 4DFYA 3FZSA 3A8XA 2VTPA 3S0OA 3BYVA 3NNVA 3ZFYA 1M7QA 3SW7A 3ZH8A 2PMIA 2VTRA 3L9LA 1Q8UA 3Q9XA 4AZWA 2YWVA 3PYYA 3QRKA 4KD1A 3NUNA 3EQGA 3Q3BA 4ZSAA 1CKPA 4L45A 4E4NA 2I0EA 1YXTA 3F7ZA 3OCSA 4LGGA 1OIRA 4Z55A 1H26A 4S2ZA 1ZWSA 3AD6A 4PP7A 4ZSLA 4FV9A 4F1MA 4D58A 5KBQA 4AGWA 4JDHA 5H8GA 1Q8TA 4BR3A 4A9UA 4S30A 3R9NA 4J96A 2F7EE 2O0UA 3L8PA 1G8SA 5LCKA 4MXZA 4YSJA 5HTBA 2X1NA 4QP1A 3VBTA 2QO9A 5B2LA 4ZMFA 4UWYA 4XCUA 1YXVA 1XBBA 4TN6A 4ALVA 4Z7HA 2GNIA 3FLZA 2GNGA 5A9UA 4PDSA 4LRJA 3PP1A 2HZ4A 4M66A 5DGZA 5AP4A 4FG8A 4H3BA 4D2SA 4YNEA 4AAYA 1Q97A 3TUCA 3QX4A 5CAQA 4YPDA 4FK3A 5HESA 3VJNA 2BRHA 4EJ7A 2VNYA 2VTAA 3DK7A 2PZYA 5HI2A 4GK3A 2BMCA 3BIZA 4ITHA 4CLIA 1IAHA 1Y57A 3KA0A 5HE0A 5DR2A 3BLAA 1X8BA 3QGYA 3UMWA 4ENYA 1PXJA 4UB7A 1PXIA 2W4KA 2X2KA 5CU0A 2V55A 2NO3A 4HNFA 5HG9A 2XYUA 3I6UA 1U54A 4FKQA 2J5FA 5FXSA 2J0MB 1H4LA 4HPUE 4ZXTA 5EDQA 5FG8A 3R73A 3VS5A 2QOFA 3N4VA 5TF9A 4YZ9A 2B9JA 5M53A 3Q2JA 2OBJA 2WIPA 3BHHA 3KQ7A 2F49A 1KE7A 5HIEA 2O3PA 2R5TA 4FR4A 4GV1A 4G3GA 4W4WA 2ITYA 4C4FA 2GQGA 4DCEA 2X0QA 3KXXA