3ZRMA

Identification of 2-(4-pyridyl)thienopyridinones as gsk-3beta inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
344
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Identification of 2-(4-Pyridyl)Thienopyridinones as Gsk-3Beta Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 103
structure length 344
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zrmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zrmA01
4PPAA 1YHVA 3VUMA 2ZV8A 4KWPA 4NM3A 3AG9A 3FZPA 4CTCA 4EOLA 4JL9A 5AP0A 4FKIA 2A2AA 4L43A 5CF4A 3GNIB 2CGUA 4V04A 3SW7A 3MJ2A 4S34A 4A9SA 4GKIA 1OVEA 4ANLA 1DAWA 2XEZA 3P7BA 4YHJA 1Q5KA 2BALA 2HELA 5AIRA 1GY3A 3QRKA 3V5TA 4F70A 4FF8A 3R1YA 2J51A 2WO6A 3OOGA 2IZSA 3KXXA 4J8NA 4ACMA 2X39A 5AA9A 3MPAA 3HNGA 4HYHA 4BDCA 3DKGA 4LG4A 4FSYA 3PXFA 4M12A 1O6KA 3PVGA 3NZ0A 3TV4A 4L8MA 5EH0A 3WF5A 3EN7A 2Z2WA 3G90X 4L3PA 5C1QB 4BCJA 4F9AA 4I24A 3ZUTA 4TL0A 5M4UA 2C30A 2VTMA 4FKRA 5AX3A 4KIKB 2IW6A 2OICA 4JBPA 5BNJA 3BRBA 3ORIA 4BCFA 5IH5A 1XR1A 3ATTA 3BYVA 2FVDA 4XRJA 5KBQA 4RG0A 2CCIA 2X7OA 4TYEA 2QO2A 2VWXA 4G6NA 4C38A 3FMEA 1URCA 5L6OA 3O2MA 5EI6A 2P55A 3EYHA 4MTAA 5IEVA 2RG6A 3O8TA 5M51A 5HBHA 5HU9A 5GIPE 2G1TA 1PKGA 3ITZA 3IECA 4EOPA 4M13A 3EZVA 1Y91A 3UIUA 4AT3A 4FV4A 4NIFB 4BHNA 4GT3A 3NUSA 3TM0A 4AFEA 4I41A 3Q2JA 3DBDA 2I0VA 3KCKA 2YIQA 3BELA 4FSMA 4G3DA 4MXYA 3ZUUA 3OMVA 2BAQA 3NAYA 1RDQE 2G9XA 3V04A 3ORKA 5IKWA 3OUNB 4EC9A 1SM2A 1GZNA 4EKLA 3UVRA 1WBTA 4Z7HA 4X2NA 3A8XA 4BRXA 4RIYA 3G2FA 2W5AA 4QMMA 4RJ8A 3UOKA 3NSZA 4A4XA 4ZSJA 3R7UA 4L7FA 5IF1A 2Z7QA 4OAUC 2JLDA 4BBMA 4BWKA 1M7NA 4NCTC 3OTVA 4ZLYA 4G34A 4FZFB 3UNKA 1KV2A 2IW8A 2R3MA 3C0GA 3A8WA 4PMMA 1M7QA 4TRLA 5AUVA 5HG5A 2BZKB 4X2FA 4UMTA 2OJGA 3LZBA 5J95A 3QX2A 5EDQA 5I9WA 4A9UA 4EH6A 4OAVB 3F3WA 3VIDA 4AAAA 2VTRA 3K54A 3QKKA 2QO7A 3R7IA 2GTMA 5AP1A 2RGPA 4BCQA 5K4JA 4O2PA 4FTJA 5AV0A 4B4LA 4CFXA 3ZMMA 2VO3A 2ZM3A 3ORNA 4EH9A 5L2IA 4TWCA 3UZTA 4QMZA 3DV3A 4S33A 5CWZA 2XIZA 4RIWB 3ID6C 3RZBA 4HVDA 2W1FA 5LXMA 4E6CA 3AC5A 3BGZA 1SVHA 3KL8A 4EH7A 2C69A 2P2HA 4O38A 4ZSAA 2QI8A 3ZZWA 4CFFA 2WMTA 3KQ7A 3GGFA 5H3QA 4FYOA 1YDRE 3NMUF 3G33A 1TVOA 4GYIA 3AC2A 2E2BA 3M1SA 1UNLA 2J2IB 3E8EA 5FWKK 5KMJA 4G3FA 2RFNA 5D9HA 5L3AA 2XEYA 2X6DA 4I4EA 2PE1A 3B2TA 3RK7A 4FSQA 5HE3A 4BL1A 4ID7A 3BQCA 5CAPA 3DK6A 4USFA 3PJ1A 3JY0A 3MTFA 4QP1A 4QMTA 3TXOA 1PMVA 2BKZA 2OJIA 3NUPA 3NUYA 3SAYA 4BKZA 4ACHA 5BUJA 2EB3A 2OXDA 3QTSA 4KA3A 5EHLA 5CAOA 3LXLA 5K0XA 4QTCA 3HYHA 4R77A 3P78A 3IKAA 1H07A 4BVUA 1DAYA 2W0JA 1TQIA 3SV0A 5KMOA 4XG2A 3NRMA 2BFYA 4FSRA 2DUVA 4J95A 1ZYJA 5AA8A 4YLLA 5CT7A 3FWQA 3TCPA 4GJ3A 3NNWA 4IM2A 3N4UA 1NY3A 4D4YA 3M11A 3BE9A 5IUGA 5CU4A 3QCSA 4IW0A 5JFXA 1ZARA 4GT5A 3TT0A 3QXPA 3E8DA 4MQ1A 5ETFA 4F9BA 3AT4A 4JI9A 2EXEA 2R64A 4L00A 2JFLA 5FGKA 1XQZA 3Q32A 5BMMA 5CNOA 3ZM4A 4CFUA 4HW7A 4I4FA 2HWOA 4EZ5A 3C4ZA 3C0IA 3DAKA 3G0EA 1YDTE 3TZ9A 1OECA 3C0HA 2A1AB 3P4KA 5EW9A 5AUYA 3PE2A 4O82A 4WG5A 4E4LA 2OW3A 1UU9A 4IZ5A 3JVRA 4AF3A 3S1HA 4XOZA 2I1MA 3EHAA 3FMNA 4ZTLA 4Z7GA 3EFJA 3EQPA 3I6WA 3U55A 2PZIA 2EWAA 2V0DA 3S95A 4M0ZA 2PVHA 3SQQA 4BN1A 5DNRA 5IG1A 5LVOA 3UDBA 5AP4A 4QP8A 5IH4A 4A06A 2UW9A 3Q6UA 3FLQA 3TUCA 4BY9E 1PXOA 3F5PA 3I0OA 4L6QA 2LAVA 3SC1A 4B9DA 3NUNA 1FMKA 4UALA 2C1AA 3L8SA 3PE1A 4XG9A 4ZY6A 1ZMUA 4WSYA 4NW6A 4O83A 4EUUA 2QR8A 5K4IA 4ANQA 4K2RA 5DHJA 4BWPA 5AUTA 1BYGA 2VO7A 2NP8A 2CNVA 3O23A 3AMBA 5D7VA 5FG8A 2C5OA 3C4XA 2GS2A 4LMUA 3D7TB 2C1BA 1UV5A 1OKZA 2G01A 1VJYA 1H08A 4HYUA 3UP7A 5C8NA 4IX5A 2YLFA 2X81A 3OW3A 4RIXB 5AP7A 2DWBA 4RC3A 3VBXA 4YSMA 3LQ5A 4F1TA 2YEXA 2VTIA 4OR5A 1MUOA 3RHXA 2WIPA 1J7IA 1H28A 2QOIA 2E9UA 2OZAB 4PDYA 4S30A 3ACJA 4UMQA 2XB7A 4NKSA 1YI6A 3WARA 2ITPA 4G17A 4U80A 1PXKA 2EXMA 4PL5A 4AOJA 4IM0A 3GT8A 4AWIA 4QMOA 3MSSA 3C13A 3MVMA 3PSCA 3S2PA 3ODYX 5CVHA 3ZFYA 4DA5A 3DGKA 3HMPA 2WMWA 2A27A 3OOMA 3UC4A 4N0SA 1OKVA 3IDPA 3EL8A 4I5CA 4FTAA 3LJ2A 3BIZA 4EWHA 3QQJA 3W8LA 5EQPA 3MFTA 1FVTA 2B1PA 3RBWA 4EQCA 3MIYA 4ZJVA 2JAVA 2B9FA 3CCNA 3GCUA 3PVBA 2ZB1A 4PX6A 4ZZMA 4FTRA 4ZK5A 3TIYA 4B0GA 4X3FC 3MYGA 5HICA 5L2QA 1KUTA 4K6ZA 5M08A 4FT7A 5AFVA 2ZV7A 3NW5A 2NRYA 4LOQA 2C6KA 3B2WA 4OTRA 5FBOA 3QRUA 5JT2A 3VNTA 4ZY4A 2AYPA 4YNOA 3R8MA 5BVDA 3R04A 3TKHA 4O0UA 3VVHA 5E1SA 2VTAA 4CT1A 5L2SA 4GYGA 4BIEA 1L8TA 2PU8A 4U9AA 1XH6A 4O0XA 1W98A 2YIXA 3OD6X 4FKSA 4FTUA 4UWBA 5E8VA 4C61A 4GT4A 2QOKA 2G2IA 4B8MA 2HZ4A 5T6KA 3R8LA 2VN9A 3DJ5A 4IAKA 3FZRA 4TYHB 5ANIA 4O7RA 4ZOGA 3S00A 3OY1A 4WA9A 4BIBA 4BDFA 4LYNA 3F88A 5HVYA 3BU6A 3RPSA 3HZTA 3IDCA 4QYYA 3QTZA 5DOSA 5FEQA 2VWUA 3P5KA 4F0FA 4FTKA 4R7IA 3TIZA 5BVFA 3QHRA 2BROA 3I5ZA 4EOJA 4R7HA 1CKIA 4FTOA 1UWJA 1HOWA 3ALOA 3NLBA 4YC8A 3QQKA 3F2NA 2BRGA 3F7ZA 4E73A 3UQFA 5B2KA 5TF9A 1WCCA 1YOMA 4NW5A 3ZEPA 5IA0A 3GOPA 3UPZA 4WT6A 4ZSLA 5IEYA 1Y8GA 2X7FA 2ONLC 2J5EA 3HDMA 2IWIA 4C8BA 5F20A 3P7AA 3F2RA 2C6OA 2FSMX 2O2UA 4FK6A 4RC2A 5AV4A 3G9LX 3SHEA 4ZS0A 4C37A 4DFNA 3KREA 2UW3A 2WTKC 4PY1A 1IEPA 4ARKA 3LIJA 3O50A 4CZTA 5E8UA 3VS3A 5CI6A 4R7BA 1Q8TA 3AC4A 5IMXA 2HK5A 2R9SA 3CKXA 5CAUA 3OXZA 3QC4A 1OIQA 3CS9A 4TY1A 5CEQA 2NNWB 3PXRA 4PMPA 3IDBA 4KBKA 5LWNA 4J71A 2NRUA 1IAJA 3THBA 3R0TA 2WOTA 2JKMA 3PVUA 3P9JA 4FIJA 4RWLA 3NVKI 1Z57A 3ZSIA 4OW8A 3Q53A 5CNNA 4UX9A 5IQGA 2UZVA 3TKUA 4MXZA 5DMZA 2QO9A 4YTCA 1FGIA 2QOLA 2PMNX 2Y4PA 4C3RA 1WBNA 4DGOA 3FSKA 2PWLA 3Q4CA 3VUKA 2V7OA 5K5XA 4D0XA 4FKLA 4HJOA 3QLGA 3QTQA 4EYJA 3SD0A 3BLRA 4CEGA 3BHYA 3AQVA 4J98A 4DFLA 5A4LA 4BCPA 3QD4A 5IQEA 3QTUA 4CV8A 4K0YA 3FQEA 5JSMA 2RFSA 2W1HA 4M68A 1QPCA 2UZLA 4OTIA 3U51A 4AG8A 4CD0A 3MWUA 3HVCA 3WYXA 4G3GA 5CXHA 5CXZA 3FMMA 2J50A 2DQ7X 5ANEA 1JOWB 5ACBC 3FLWA 3CXWA 4XBUA 5JZNA 4NL0A 4M69B 5M55A 4KABA 3KB7A 1ZXEA 2C5YA 3EN4A 1ZAOA 4IVCA 4JAJA 4S32A 4W9WA 2WMQA 5L8KA 3BGQA 3A62A 4ZLZA 4BZNA 2XJ0A 3UGCA 4Z55A 1GIJA 3QA8A 4XG6A 3SVVA 4C36A 3SXSA 2JBOA 1OKYA 4LM5A 3QQFA 5FXQA 1Q4LA 5T3QA 5K9IA 4M7IA 5H2UA 4DCAA 5EOLA 1DS5A 2WOUA 1BMKA 4XRLA 2ZMDA 3FAAA 4IJPA 4YC3A 3QGYA 2QD9A 3L9LA 1UU3A 4CG8A 1ZY5A 4QQCA 5M44A 2XIXA 5AV2A 5FTQA 2P0CA 4HNIA 3WYYA 1J3HA 3DAJA 3VUDA 4FT0A 4XG4A 3UJGA 3PVWA 2C47A 2OFUA 3H9FA 4MK0A 1JWHA 2UW4A 3VUIA 3QGWA 4O7LA 5FDXA 3BWJA 3IW8A 4EC8A 3R28A 2ERKA 2VTOA 4RX8A 1URWA 4EZ3A 1NW1A 2GQRA 4KKEA 3KC3A 2AUHA 4RVTA 3NPCA 3W33A 3ZLSA 4IJ9A 4HZRA 3GC0A 4O84A 3AXWA 4H3PA 3TKIA 2X2KA 4U44A 4DYMA 4Z16A 2WTDA 4FI1A 2W1CA 2JGZA 4JG6A 4AE9A 3V5QA 4QMVA 1HCLA 4FEWA 3P23A 4L7SA 2RG5A 5DYJA 1V0PA 4J1RA 2AC5A 5AV1A 1OITA 3PG3A 4FE2A 1IA8A 5LVNA 4AW5A 3GC7A 5JN2A 1YXXA 4CRLA 4U81A 1KE9A 1W0XC 3F3VA 3VF8A 4UWYA 3OWLA 2J9MA 4J99A 4NH1A 4RX9A 4D1XA 1TKIA 4V01A 3Q2MA 4EHEA 5KCVA 3EKNA 4GV1A 3MESA 2X7GA 3FY0A 3GCVA 2XNOA 3NNXA 4DEEA 2XKFA 3G6HA 4I6HA 3OWPA 2OGVA 2GHLA 1H01A 3EWHA 4CFWA 2QODA 3CEKA 1UNGA 3HMMA 4O22A 1PF8A 4GK3A 4PDPA 5DR9A 1M52A 3D5WA 2F4JA 4CFNA 1CKPA 3FZ1A 1FVVA 4UMUA 2OK1A 2XS0A 3R8UA 1E1XA 4RT7A 2CKQA 4HGEA 3W55A 4C4HA 4JX3A 3V6RA 3KXHA 2VTHA 4DH7A 3QHWA 2OXXA 3BHHA 4LL0A 3TI1A 3BEGA 3BE2A 4FEXA 5CSPA 1XBAA 2RKUA 3NX8A 4O0WA 1FOTA 3OCTA 3MGYA 4PTGA 4CG9A 3C51A 3SOCA 3FY2A 2QCSA 1WMKA 4MXCA 4RQVA 3ZHPC 4N57A 4K9YA 5JQ8A 2HXLA 2CPKE 3FQHA 5CU3A 3IW7A 1CDKA 1HCKA 3HRBA 3UOLA 3ANRA 4CTBA 5HLWA 4U7ZA 5CTPA 3EQHA 4Q2AA 3ZEWA 3SDJA 4F1MA 4E20A 5JEBA 2R3JA 3EL7A 3LCOA 4UZHA 5CU6A 4GU9A 5HNGA 3VC4A 4LGGA 4PV0A 4XG7A 5E8XA 4BCOA 1T45A 3ZONA 3OW4A 3PIZA 1I44A 3K2LA 5HTCA 4GL9A 4FK3A 4O0VA 1E1VA 3KRRA 5CENA 5EOBA 2ERZE 3CJFA 2OF4A 4X6RA 5DRBA 5AV3A 4PP7A 4U3YA 3L8XA 3MVHA 4P2KA 2VO6A 2PMIA 3RPYA 5A14A 4GU6A 4KINA 4FKVA 3CY2A 3TL8A 3W8QA 3QTIA 3QRIA 4E4XA 3FDNA 3T9IA 4FIHA 4FNYA 2J5FA 2YDIA 5IA3A 3LFDA 5DT3A 3FSFA 5CT0A 5LMBA 3RM6A 3BYSA 3QRJA 3G0FA 4GKHA 3IW5A 3VS5A 3HDNA 1JQHA 3A7FA 3ZBFA 5LVLA 3FMKA 2PSQA 4IFGA 3S3IA 4Z3VA 4C4FA 3GEQA 2JDVA 3LQ3A 2QU5A 2UVZA 3PLAE 3DY7A 4PP9A 5GJGA 3OCSA 5E8ZA 3PTGA 3RPVA 4ZTNA 3QUDA 4CMUA 1F3MC 4HCVA 5HVKA 2PL0A 2XKDA 3LLAA 4UV0A 2W4KA 4Z9LA 4HGTA 5GIOE 3BHTA 5F95A 2W17A 3N51A 4G6OA 3F2AA 4NSTA 3V5WA 5LQFA 4DF3A 3R9DA 4YO4A 3UODA 2F9GA 5IQHA 4O7SA 3LJ1A 5C03A 4MBIA 2IVTA 4I6BA 3ORZA 4ZEGA 3UC3A 2Z02A 4XUFA 4AGUA 1OM1A 3HL7A 2O63A 3KXMA 4NKAA 1QL6A 4C4EA 4CMOA 4QMQA 3P08A 3CIKA 4FZAB 3KRXA 5H8BA 4MHAA 3FPMA 3PY0A 4QMLA 3U4WA 2PUIA 3FJQE 4GVAA 4UEUA 3MH3A 4J96A 4ZJJA 2Y4IC 5AR4A 3W16A 2J6MA 4LOPA 4L3LA 3A7JA 4YBKA 5DR6A 3HV5A 5HE1A 2B52A 3WF8A 2OZOA 2BRHA 5AEPA 5IU2A 4A4OA 4ITHA 3VBYA 5AAEA 5BQ0A 3COMA 4OGRA 2CMWA 2FH9A 4UXLA 1WAKA 4KBAA 1PXPA 1ERKA 5BVEA 4O86A 5HKMA 5HCYA 3AGLA 4U5JA 2C3LA 2V22A 4KRDA 3OT8A 5IH6A 4BZOA 5BUEA 1AQ1A 2XRWA 5B2LA 1SMHA 2C68A 2R3IA 3EH9A 2C6EA 3BHVA 3IQ7A 3HP5A 3W10A 3MH0A 5AP5A 1SNUA 1SVEA 1YWNA 3TTJA 2H9VA 1TQPA 3RAWA 4EH2A 4CLJA 3CLYA 4RBLA 2VWWA 2EUFB 5IA2A 2BMCA 4TYJA 2W06A 3DDPA 3UPXA 2PYWA 3QKMA 1WBPA 5L8JA 1J7UA 2YCQA 3PP1A 3BV2A 4H05A 1B38A 3F9NA 4BCGA 3Q9YA 3FKOA 3OFMA 2WU6A 3EQRA 4ZAUA 4JDHA 3ERKA 4BDDA 5AM7A 5IUHA 2W5BA 2ITUA 3FHIA 3GCSA 3ZO2A 1IASA 4ASEA 1JKTA 5CF5A 3R8VA 5JFWA 3MH2A 4O7ZA 5TT7A 3R9HA 4DH8A 4ENXA 5J9YA 2XBJA 4AZTA 5I3OA 3VRZA 2J0IA 3EQFA 4R5YA 4O0SA 5D11A 1RQQA 3EN6A 4K18A 4TT7A 5EM7A 5HQ0A 2WHBA 3QX4A 4CMTA 4F1OA 5J87A 2HY81 3CTHA 4MXOA 4FKPA 2WIHA 2OFVA 4D4VA 5CASA 4J97A 2UVXA 2BAJA 3ACKA 5JFVA 4A9YA 1YKRA 4NU1A 2JFMA 2BIKB 5H8GA 2IW9A 1JBPE 3G5DA 3L8PA 2QNJA 4FNWA 3ZTXA 4NM5A 4JIKA 4DG2E 3A60A 1OL7A 4RIWA 3MA3A 4ANMA 5LVMA 5EW3A 4MWHA 3LLTA 4I5PA 4BI2A 1Q24A 4HVIA 3HEGA 5CVGA 4WUNA 4BGQA 3OS3A 2CNQA 5TE0A 3ZLYA 5CX9A 3ZO1A 3COKA 3UZPA 4A7CA 3B8RA 4UZDA 1W83A 4FIFA 4GK2A 5C01A 2R0UA 3CTJA 4O1PA 1UU8A 2O0UA 4ANOA 3BBTB 1H1PA 5AUWA 1MQ4A 1O6LA 2XK4A 2XJ2A 3D5UA 2PVKA 3QUPA 4LOOA 4QYFA 1ZYLA 3I7BA 1WBWA 3C5UA 3IS5A 4HNFA 4EEVA 3C4WA 5AP6A 3WZEA 3LCDA 5M4FA 4DGGA 4QQTA 4IAIA 3DU8A 5ANGA 3ORPA 5DGZA 3NGAA 5EDPA 3MVJA 4FKOA 2WMXA 5EW8A 5CEPA 1J1BA 5CEOA 4RVLA 3E5AA 3WIGA 4OT6A 4FV8A 2BRNA 2EU9A 2R2PA 1VYWA 3LXNA 2BR1A 3VHKA 5JK3A 5E8WA 1GZOA 4UMPA 4DH3A 3ORMA 2JIUA 4GJ2A 2XNPA 3JPVA 4RX5A 3UTOA 2HENA 5EI8A 3UOHA 2W1ZA 1H27A 5JGAA 3DTCA 5ETAA 5ANDA 3P86A 5I3RA 4OBOA 1DM2A 3R7VA 4KRCA 4BZDA 2ZOQA 3CR0A 4YU2A 2ETKA 3QD2B 4FL3A 4G9RA 3VUGA 2P3GX 4CNHA 4C2WA 2XNBA 3KMMA 3TV6A 3FI8A 4HYSA 5G6VA 3WIKA 4AE6A 4ALUA 3TNIA 1WBVA 4F7NA 3NWWA 3UQCA 4H39A 3R6XA 4GIIA 2BZIB 2XKEA 4X0MA 5HO7A 3FLYA 4RRVA 3DKCA 3HA6A 3F3TA 4AGWA 2P2IA 4BCHA 4F9YA 2XF0A 3R7GA 3NUUA 4Y95A 1NA7A 2VGPA 5FEEA 5KMIA 3R7OA 2E9OA 3WE4A 4F0GA 5DIAA 1BI8A 4FEVA 3S4QA 4DFBA 4JX7A 4ITIA 5I9XA 3BPRA 4NTTA 3VS2A 2C3JA 4G1WA 2YITA 3FL5A 2C5VA 4TNDA 5D1JA 5AIKA 3V5JA 4D4RA 3PPKA 4ZY5A 5B2MA 3IOPA 2AC3A 1PXNA 4J8MA 4Y85A 3I81A 4PQNA 3ZLXA 5KMKA 3LHJA 4YJRA 4W8EA 1S9IA 2Y0AA 3D7TA 4BFMA 4BYJA 5AWMA 4MNEA 5HG7A 4C4JA 3ZXTA 2X0GA 4GG7A 2ITZA 3DFAA 3FMJA 4PDOA 4MF0A 5CF8A 5JRSA 1BI7A 4RFYA 4RIXA 3VS7A 2E9PA 3T3UA 2C6TA 4FR4A 4M0YA 5DLSA 1W8CA 2RFDA 3NW7A 1UNHA 3LXPA 3UNJA 1Z9XA 4AT5A 2UZUE 3LMHA 2Z7RA 4D9UA 3I0QA 5M56A 3MPTA 2BCJA 2Y4IB 3DFCB 1Q8WA 5CSXA 4IADA 4FTIA 1WBSA 2I0HA 3GC9A 2C4GA 4OBPA 5FD2A 4QRCA 2OI4X 2YAAA 2XNMA 2XUUA 2OJJA 4NUSA 5EQYA 1P2AA 2SRCA 1ND4A 2J4ZA 5CVFA 4JNWA 4BI0A 4DTKA 4BTMA 2QQ7A 4X6QC 4ZJIA 3POZA 3R2BA 4YZBA 1KV1A 2HW6A 2WMRA 2JC6A 4WBBB 2BDJA 3PY1A 3R1SA 5EM6A 4BICA 1J7LA 4KS7A 5F4NA 5L2TA 4DTBA 4FZ7A 4JR7A 5HI2A 5GZAA 3CP9A 2VX1A 5FQDC 2OWBA 2H6DA 3DXPA 2XRUA 1RJBA 1MRYA 4FBXA 3NNUA 3TJDA 3ZSGA 4YZCA 4YLKA 1Y6BA 2WFYA 1JNKA 3KN5A 4R8QA 2Y8OA 3G9NA 3L9PA 3S0OA 3O8UA 3MFUA 4C34A 1DI8A 1PW2A 2FUMA 4JIAA 4LUEA 4IAFA 2VWVA 3BHUA 4GUBA 4HOKA 3UNZA 2X8IA 3HMIA 4AFJA 1U5QA 4BDGA 4O91A 1QMZA 4WKQA 4FTLA 4ZMEA 1REKA 3OY3A 3QL8A 3DJ7A 3FLZA 4M97A 4IM3A 4P5ZA 5I9UA 3G51A 4CFVA 3MFRA 3AC3A 3FZSA 4FKUA 4PDSA 4U79A 3RCJA 4DFZE 3H9OA 4D55A 3LJ0A 4XP2A 5EYMA 4KIQA 4PWNA 3TN8A 4QYHA 1PY5A 4PL4A 3UIXA 3KXGA 1SYKA 2Z7SA 5ANOA 3ZFMA 3CGFA 4M84A 2HXQA 1H24A 4U41A 5M4CA 3NS9A 5IQIA 4EH5A 4NCTA 3WBLA 2JBPA 4CQEA 3FL4A 4ASXA 4ZZNA 5CAQA 3PUPA 3V3VA 4B8LA 3Q9ZA 3T3VA 2OIBA 3DJ6A 1H1SA 2WMUA 3NEWA 1L3RE 2Y9QA 5HX8A 3RM7A 2WKMA 3QZGA 1REJA 2V5QA 2YCSA 1K9AA 3RCDA 3FHRA 3NW6A 4O81A 4B7TA 1MRVA 3KXZA 4MWIA 4N70A 3QZIA 2YFXA 3DDQA 3GQIA 4G16A 4RA5A 4DINA 5HZNA 3VBWA 2R3HA 5EYKA 4IZAA 2IZTA 4K33A 5J1VA 4FG9A 3L9MA 4BTKA 5J9LA 2JEDA 3UE4A 4CRSA 2XCHA 5CI7A 4F64A 3DK3A 4XH6A 3E3PA 2B54A 1JKSA 3PZHA 1YOJA 1V0OA 5JH6A 1STCE 2WEVA 4OTDA 4Y73A 4DC2A 3LFBA 5HG8A 3Q60A 4CQGA 3U6HA 2Y7JA 4QPAA 3GC8A 5IA1A 1XHAA 4C3PA 4JQEA 3ZOSA 4V0GA 2FSTX 5CSHA 3C4CA 3Q5IA 4TN6A 5DWRA 5BVWA 2XA4A 2CN8A 5EFQA 4IEBA 4DGNA 5EYCA 3V6SA 5HU3A 2BDWA 5CANA 3ULZA 2HCKA 4FSZA 3EFLA 1ZLTA 4U42A 5E8YA 3ENHA 3O71A 2XK3A 3VO3A 4IVDA 2BFXA 4XCUA 2GNFA 4OTFA 5C27A 2R3RA 5J1WA 2WD1A 3EOCA 3BX5A 4OUCA 5EDRA 4XMOA 2GHMA 2H34A 4BCKA 4L9IA 4CXAA 3HUBA 4WG4A 3UMXA 4PPBA 3CKWA 4WIHA 2O3PA 2YDKA 3MBLA 4FTCA 4RX7A 2YIWA 3ZYAA 2UZNA 3OWKA 2C5NA 2XCKA 1XH9A 2OH0E 4XLVA 4EL9A 1NT2A 3PJ8A 3C5IA 5DBXA 2XK6A 4D58A 3KF4A 3FYKX 3ODZX 2XK7A 3ZO3A 4AX8A 1JSUA 1ZRZA 3EB0A 4O6EA 2I7QA 4KD1A 4GG5A 3LCKA 4EBWA 4LMNA 5I9YA 2QURA 1G8AA 4M69A 5JZJA 2V62A 2HZNA 4F6UA 2IO6A 4YNEA 5E8SA 3FPQA 1ZMVA 3D4QA 3MH1A 4BKJA 2WB8A 5FXRA 3QKLA 5IA4A 2PZPA 1Q62A 4FSNA 1CKJA 4LV5A 3KF7A 3HV7A 3RJCA 3PSDA 4E6DA 4TNBA 4XV2A 1OB3A 3RAIA 5BVNA 3NYVA 2V7AA 4CKRA 4F99A 4FOCA 4DFYA 2BRMA 3L8VA 5I5ZA 4YBJA 2VTJA 3DXNA 4KSPA 3R7YA 5LJJA 3DPKA 4RZVA 2ETMA 3F5GA 5KZIA 4FMQA 4IB5A 2XYNA 5HO6A 4F4PA 3GP0A 4AW1A 2YM4A 3O7LB 3UIMA 3Q52A 4NJDA 5HTBA 4AZEA 2F57A 4ONAA 4IH8A 3SRVA 4F0IA 5F9EA 4GVJA 4AW2A 4YC6A 1A48A 3GVUA 3PXZA 4BTJA 4FNZA 4AS0A 5AX9A 4ACGA 4U45A 2WAJA 5JQ5A 2H96A 3M2WA 4BCIA 2GQSA 3WF7A 3MY1A 4I93A 4NYEA 4MXXA 4AN9A 5KMNA 3KMUA 1SVGA 1U54B 5M4IA 4IAZA 2GU8A 2EXCX 4QPMA 5DA3A 3VF9A 4DEDA 4EBVA 4L3JA 3QUEA 3AD4A 5KE0A 5KHWA 2UZWE 3LFCA 4HCTA 2FB8A 4KS8A 3FC1X 2FSLX 3HP2A 1WVXA 3KULB 4RVMA 4TTHB 2ACXA 3PA3A 5IUIA 3TDVA 3OEFX 3UYTA 4YO6A 4RJ4A 1ZOEA 4RJ6A 4RFMA 5HEZA 4YZDA 2PVJA 1ZY4A 2ITNA 4FIEA 4M3QA 3SKCA 3LM0A 4WRGA 5CLPA 2QOOA 3ZH8A 2XBAA 4IAAA 4LL5A 4PUZA 5KZ0A 1Q8ZA 5T68A 5ANJA 3IW6A 2YZLA 2HAKA 1R0EA 4FTNA 2XP2A 3K5UA 4BDJA 1F5QA 5FEDA 4X3FA 2BDFA 2ITQA 2QHMA 3TJCA 4Y5QA 2W96B 1ZWSA 3LOKA 3D2IA 4QO9A 3TNPC 4EQMA 1WBOA 1JPAA 4MAOA 4EUTA 5AAGA 3IOKA 4YPSA 3RMFA 5DE2A 4TPTA 2F2CB 4FZ6A 5TOZA 3ZLWA 3JVSA 4EJ7A 2UW7A 3GCPA 2ETRA 4G31A 5GHVA 2W4OA 2PMOX 4NEUA 4IHPA 3R9OA 4UBAA 4TKSA 3ZCLA 4KAOA 3U9NA 2W1EA 1XJDA 4DGMA 4JLCA 3VBVA 2XIYA 3BBWA 3OZ6A 3KY2A 4E6QA 1H8FA 1UKHA 3Q5ZA 3VJNA 4D1SA 3UBDA 5AR3A 2JIIA 5FP6A 4FV0A 3VWAA 2GTNA 1PHKA 2G15A 2CGVA 5A4EA 2QKRA 4I3ZA 4BR3A 1G5SA 3K3IA 3K5VA 4EOIA 4OLIA 4XG8A 3Q4TA 1U4DA 2JDSA 3HGKA 4ZMFA 3SA0A 3LQ8A 1OUYA 1H1RA 3HX4A 3GUBA 3W1FA 4I6QA 4K11A 1UA2A 4YGAA 4CCBA 4E5WA 4EJNA 2WQNA 3D5VA 4BDBA 3A61A 4QP2A 2O8YA 4BIDA 2PPQA 2BAKA 3ZUVA 1W84A 3ZZEA 4FTTA 3D94A 5A6OA 2ONLA 3LCSA 4TYIA 3WE8A 4NZWB 2ZDUA 2UW0A 4M66A 3LMIA 1RW8A 5I4NA 3VULA 4LRJA 1LUFA 3OTUA 3QTWA 4G5JA 1OIYA 4AN3A 4CSVA 3PY3A 4FVQA 5E91A 3KU2A 3QQGA 3T8OA 4AGDA 2BPMA 1OL5A 3CJGA 3DZQA 4GW8A 3H4JA 4HZSA 1I09A 3NIEA 2HWPA 3ZU7A 4YLJA 4JBOA 1YDSE 5ETIA 1PKDA 4S2ZA 1XKKA 4CYJA 1ZOHA 2BIYA 4O0YA 5H8EA 4DEBA 3UOJA 3GI3A 4W4YA 5KMLA 2ITOA 1CTPE 3A99A 4IWOA 4MXAA 2B9JA 3E7VA 3R30A 5EG3A 3I5NA 5BVOA 2OO8X 4D0WA 3W2QA 2BILB 3EZRA 4YSJA 5J9ZA 4X21A 3TZ7A 3KGAA 4EH3A 5BX0A 4ASDA 4EK6A 4DE4A 3MDYA 4FG8A 1YXVA 4L42A 3PP0A 3I7CA 4QP3A 4FT9A 4WBOA 1VYZA 3FV8A 5CY3A 3II5A 4A9RA 3DBQA 4YTIA 3DT1A 1S9JA 2C6DA 4WNKA 5CU2A 2UZDA 3W32A 5J7HA 3RWQA 2IJMA 2XK8A 3N9XA 4KKGA 2PK9A 3WZKA 4HVSA 4RVKA 2WQBA 4CZUA 3ET7A 3O96A 3DZOA 1FINA 1H26A 5BYZA 4UYAA 5DG5A 5KKRC 4AUAA 1G3NA 4AZFA 1XH5A 4XX9A 1YWRA 5K5NA 2VTSA 4CYIA 2VO0A 3EFWA 4O21A 5IQFA 2YIYA 2OIDA 2WMVA 2C6IA 2VU3A 4QMPA 5ITAA 2GNJA 2PY3A 3ORXA 2R3FA 2YIRA 2YCFA 3QXOA 4UY9A 2VRXA 1OBDA 3WF6A 3RINA 2CKEA 3LFFA 3Q3BA 2J0KA 1YRPA 3EN5A 3MFSA 4FTQA 4ALWA 3HECA 3G6GA 1OPKA 3PA4A 4Y5HA 5D7AA 3L9NA 4D2SA 4O7YA 4DT8A 2PVNA 2GMXA 4MF1A 1O6YA 2ITYA 3BLQA 5M07A 2X2MA 4IWPA 1P5EA 3W2PA 4EHGA 5CEKA 2ZM1A 1P14A 4BC6A 4QTDA 4OTHA 3ORLA 5IQCA 4RIOA 3E92A 3D2KA 3DCVA 1BL7A 1OZ1A 4EQUA 4GRBA 3CPCA 3SXRA 5FUTA 3QFVA 1OPLA 2HIWA 2YJSA 3VBTA 4GH2A 4XOYA 4EK8A 4AGCA 5BPYA 4AA4A 5HLNA 3ENMA 5TKDA 2HW7A 4QMXA 4YJTA 5A4TA 3BGPA 2J0JA 4YJQA 4O27B 2IZUA 4I0TA 3NDMA 4IB3A 2P4IA 1Q8UA 4FV9A 5F1ZA 3DLZA 3O51A 4ENYA 4ZSEA 5DR2A 4D2VA 5L8LA 3GB2A 3R8PA 3OUKA 2YM3A 3LFAA 1MRUA 4F09A 3A2CA 3F6XA 4A4LA 2ESMA 5HIBA 4Y8DA 4QYGA 2CLXA 4YTHA 4WUAA 3ZSHA 4DITA 4O6LA 4TXCA 4O2ZA 4QQ5A 4BBFA 5I0BA 5HLPA 3OG7A 4FX3A 1WVYA 3VHEA 1PYXA 3EQIA 3VJOA 5IPJA 4XV3A 2BVAA 2BZJA 4W9XA 3TV7A 2IPXA 4JRVA 2YN8A 3SXFA 4BGGA 2ZM4A 4UYNA 4D1ZA 5CQWA 3VQHA 2VD5A 4CKIA 4R1VA 3FKLA 4QMSA 3LFNA 4RC4A 3R8ZA 1OL6A 3DKOA 3KN6A 2F7XE 4II5A 4W8DA 4JJRA 3HA8A 3Q96A 4FV1A 4J53A 4QPSA 5KNJA 3D15A 3MB7A 1UVRA 2HYYA 3RPOA 1YWVA 5AP2A 3O0GA 4U0IA 2R3OA 3HV3A 3F82A 4Q9ZA 5AJQA 3DKFA 4DEGA 3QAME 4CGAA 2CDZA 4FV7A 2B7AA 1SNXA 1OIUA 3K3JA 2VX3A 2I6LA 3BLHA 3P79A 4R5SA 4ZTQA 2XVDA 2R7IA 3CQWA 4W4WA 3WOWA 1R78A 4TYGA 4AP7A 3EQDA 3UP2A 4E6AA 5ACKA 4APPA 3W2RA 5A3XA 4XV1A 4Y72A 4UXQA 3UMWA 3P1AA 4KIKA 4FV5A 5BMSA 2RFEA 2W9FB 1LR4A 4USDA 4I22A 3D5XA 3FXXA 4FSUA 4PPCA 4CFMA 3DTWA 2CKOA 4MEDA 3R1NA 1BL6A 1LEZA 4YR8A 2OSCA 1MP8A 3EYGA 3LMGA 1E9HA 3HAMA 2A0CX 3KRLA 2A19B 3RI1A 5LMKC 5F94A 1XH4A 3QCQA 3V8TA 3HUCA 4C33A 3NR9A 5A4QA 3C7QA 4KIOA 4L53A 4NJ3A 4JG7A 5HTIA 3EQCA 4DCEA 5D10A 3MA6A 4PNIA 3H9RA 4D9TA 4IX3A 4NIFA 2FYSA 5EM5A 1KSWA 3PZEA 2PVLA 1OMWA 4RQKA 4AW0A 4ERWA 4QTAA 2R4BA 3PDTA 1YVJA 3PXKA 4MCVA 3AC1A 4XBRA 4DBNA 5GZ8A 2IZRA 1DI9A 4KSQA 4MBJA 3HKOA 4U43A 1ZOGA 1YXUA 5C8MA 4JBVA 3FE3A 1M2PA 2UZOA 3QYWA 1JKLA 2REIA 1F0QA 2J7TA 1BUHA 2C3KA 4I92A 5DT4A 3H3CA 3GU7A 3NIZA 3PWYA 2XYUA 3QRTA 3WZUA 3AD5A 3CPBA 5EHYA 2PUUA 1A06A 3I1AA 2FA2A 2OG8A 2PE0A 5DVRA 3SX9A 1GIIA 3A4OX 2QONA 4E4NA 4KB8A 4FOBA 4OTWA 4Y83A 3O7LD 1Z5MA 3PWDA 3OHTA 3W2OA 4MKCA 3ROCA 2YM7A 1YI3A 4R6VA 5E4HA 4WO5A 2CNUA 3E63A 1YQJA 4E93A 2ITVA 4TWNA 4FL1A 4F7LA 3RWPA 4WOVA 2OBJA 2RSVA 1ZZ2A 2W5HA 4EOSA 2QC6A 3NCZA 5FM3A 3QF9A 3E7OA 1J1CA 4CV9A 2B0QA 4IC7A 2WTJA 1KWPA 1R1WA 2B9HA 4AZWA 5DFPA 3CQUA 3VRYA 1PMUA 2PHKA 5EHOA 4B6LA 5J7BA 3LW0A 4QT1A 4EK3A 1BLXA 3SLSA 4BDEA 4C58A 3FMLA 5JFSA 5JKGA 5K0KA 4C0TA 3ULIA 2YA9A 1OI9A 1OIRA 1IG1A 3DB8A 4L46A 5D41A 4YJUA 3A4PA 3SG8A 3Q6WA 4RJ3A 3E64A 2VWZA 2GHGA 4FSTA 4DN5A 4EI4A 3GENA 4U8ZA 3QQHA 5CYIA 4FKTA 3KXNA 4AU8A 3R21A 2ITXA 3QWJA 3T9TA 4GUEA 3BU5A 3QQUA 4EHZA 4BCMA 3OBJA 5LCJA 4IVBA 3CY3A 4O7NA 5KBRA 2XJ1A 3AMAA 5GNKA 4FODA 5L2WA 5I9ZA 2BRBA 3A7IA 2GQGA 2QLUA 3U4UA 4XYFA 3UG1A 3NYOA 4UN0C 1MQBA 4H1JA 1H0WA 3ZC6A 5FXSA 2XIRA 2W4JA 3L1SA 4A9TA 4RMZA 3OF0A 4TW9A 2QOBA 5KKRB 1XBCA 4F08A 3O17A 3QU0A 2C6MA 3DQXA 3IGGA 4FEQA 4FT5A 4I94A 4XJ0A 5B0XA 5CALA 4ANBA 3PJ3A 2CSNA 1ZYCA 4DBXA 3Q04A 4I20A 2WZJA 3JXWA 4J7BA 3HRFA 2YWPA 4G9CA 3MTLA 3BZ3A 3CD8A 3E8NA 4IX4A 4JDJA 5A9UA 5HO8A 5HIEA 4KUJA 3RTPA 1T46A 2DYLA 5HCZA 1OKWA 2Z60A 2WTWA 3M42A 2WEIA 1OUKA 4WG3A 2R7BA 3FZOA 1ZZLA 4YPDA 5CEIA 3U8WA 4AZVA 4W4XA 4AXAA 2JIVA 2Q0BA 3UVPA 3PRFA 1AGWA 1LPUA 1VEBA 4JT3A 5BVKA 5LMKA 4OT5A 4KIPA 1JVPP 4GFOA 4EHVA 1BKXA 2C0TA 1U59A 3PFQA 5E1EA 4FVPA 2F7ZE 3C9WA 2WQOA 3GU4A 5EKNA 4W4VA 1AD5A 2QVSE 2PUPA 4BCNA 4TWPA 2F2UA 4N4SA 1KOAA 2FGIA 4CCUA 1OBGA 3DNDA 1H25A 4JQ7A 5DPVA 5E90A 3KRWA 4JS8A 3RALA 4NM0A 3OBGA 2O5KA 4EOKA 3TUDA 1Q61A 2WNTA 2X6EA 3O8PA 5EQEA 2I0EA 2CN5A 3ZBXA 4NT4A 4P90A 2BUJA 3JYAA 1U46A 3Q9XA 4IDVA 3TWJA 2RF9A 3ZDIA 4CVAA 4FICA 4APCA 4JG8A 1K2PA 2XK9A 5KHXA 4E1ZA 4GCJA 3R02A 2PMLX 2BHHA 5A46A 2R3KA 3PA5A 3KVXA 3AC8A 4MH7A 3E62A 2IVUA 4H3BA 4FV3A 4ANSA 5EM8A 4XP3A 5D12A 3TNWA 3SOAA 4C35A 3GCQA 5C26A 2GS7A 2ZMCA 3NAXA 2RIOA 3ELJA 3JY9A 3R00A 4I5MA 4MNFA 5HESA 3FKNA 4IFCA 5AR2A 2FSOX 3TEIA 3VW8A 4UMRA 4FIGA 4YTFA 5JMSA 2ZB0A 4PMTA 2CGWA 3VS6A 4O1OA 4L44A 3QD3A 2OZAA 3V5LA 2B4SB 4WNOA 4IWDA 4HPUE 2VV9A 2Y6MA 3EJ1A 4N6ZA 2W1GA 4BF2A 4LGDA 4EYMA 5BYYA 2WTVA 5HIDA 2HOGA 2UW5A 1H0VA 3R1QA 3MVLA 4FEUA 3D7ZA 3OWJA 4S31A 2ZV2A 3RK5A 2QG5A 3FQSA 4FKQA 2WTIA 4DAWA 3JR1A 3F69A 5AR8A 4RPVA 4UB7A 3ZRLA 5HGIA 3ZM9A 3DB6A 3HMNA 2BHEA 2OKRA 4QQJA 3N4TA 3C1XA 1WZYA 3RVGA 3R73A 2WPAA 1VR2A 1V1KA 4H36A 5EK7A 4LRMA 2CGXA 3IGOA 4NFMA 3DBFA 4TWOA 4MVFA 4FVRA 4K77A 3EKKA 2E9VA 1PMNA 4RIYB 2WTCA 3E88A 5HE0A 2NO3A 4YMJA 5GJFA 3H10A 5L6WL 4C59A 4F65A 1XO2B 2R3QA 4FT3A 3KFAA 3OVVA 5HX6A 1PRYA 1OGUA 2QU6A 4RWKA 3NUAA 3EFKA 2LGCA 3ZRKA 2R5TA 1B6CB 3E3BX 3VN9A 4TYHA 3CGOA 5IEXA 4EK5A 5CAVA 3COIA 4F7JA 2P33A 5IQDA 3VS1A 4X7QA 2QOCA 3ZDUA 5AAFA 1GIHA 4FV2A 3TZMA 3AD6A 3IK3A 4YUQA 4EKKA 4E4MA 1H1QA 2ZAZA 3FMHA 1QPJA 5JGDA 3RP9A 3KRJA 4QP7A 3ZXZA 4JVGA 5CZHA 3POOA 5I9VA 4EWQA 3DK7A 4FGRA 2OH4A 4C62A 4E7WA 3FI4A 3ROYA 3PRIA 1NXKA 1K3AA 3GXLA 5FM2A 4O0RA 4YP8A 1ATPE 2JKOA 3GU8A 4GFMA 2CHLA 4K1BA 3BYMA 5CSWA 5DT0A 5CZIA 3FBVA 3QLFA 5E8TA 4GEOA 4D2RA 3F66A 4MNEB 4OBQA 4RSSA 3MB6A 4PMSA 2HZ0A 1PJKA 4XEYA 4JAIA 5BUIA 5LMAA 4DG0E 3HLLA 2F7EE 2VWBA 3HV6A 4EH4A 4BI1A 1GZKA 2Z8CA 4F9CA 3NYNA 3AGMA 4IE9A 4QMNA 1ZMWA 4L67A 5LARA 1NVSA 3LXKA 4QOXA 3TNQB 3DA6A 3VW6A 3QWKA 2PVRA 3MJ1A 4U40A 3MI9A 2C6LA 2WMBA 2VTLA 4D2TA 3BQRA 1YHSA 4AQCA 2X8DA 4USEA 3W2SA 1U54A 2UUEA 2Z7LA 3HMOA 4GFGA 5M09A 2G2HA 3BYUA 5BYLA 3RKBA 3MIAA 1G8SA 3R63A 2QLQA 3I6UA 1KOBA 2PTKA 3LFSA 4YZMA 4KBCA 3KULA 2VX0A 2ZJWA 3NYXA 4X2GA 4DT9A 4Q9SA 5HORA 3CC6A 4JRNA 5DRDA 4L01A 3DLSA 2WELA 2JDOA 4D5HA 5C8KA 3AMYA 2PZYA 4JR3A 3PJCA 3CBLA 3SGCA 3GFWA 5J5SA 4ERKA 2QHNA 2PVYA 2Y6OA 4AT4A 4EORA 3FEGA 3H0ZA 5C9CA 2X9FA 3OP5A 4D5KA 4FGBA 1GJOA 1TQMA 2W9ZB 4U3ZA 3WI6A 1R3CA 4FIIA 2C0IA 3ZO4A 3ATSA 4G3CA 2XM8A 2EVAA 4FKWA 4I5HA 3R7EA 3GFEA 5KMMA 1IA9A 3DQWA 2X8EA 2JDRA 2QOHA 3FZTA 3JS2A 4YJPA 5ICPA 5L4QA 1YHWA 2GDOA 3FI3A 2YZAA 4ALVA 2BKKA 1NVRA 2UVYA 4PL3A 3R2YA 2R3NA 3ETAA 4YURA 2GNIA 5JGBA 5HBEA 2YM6A 4EONA 1YW2A 3OT3A 4LV8A 4BBEA 4GSBA 4BB4A 3EMGA 5IQAA 4HPTE 5J5TA 4DTAA 3VS4A 4RWIA 3H30A 3NNVA 3PXYA 2JKQA 2PVMA 4C7TA 3FUPA 4JXFA 2R0IA 4KNBA 4ZTHA 1M14A 1KE6A 2CCHA 1FBNA 5C4LA 3BV3A 5DN3A 4DEHA 5CF6A 3ZFXA 4RZWA 3QD0A 5AADA 4OTPA 2DS1A 4QMYA 2OF2A 3KA0A 4FYNA 2W1DA 4YJSA 2GNLA 2XKCA 4YJOA 4MQ2A 4AA5A 4R3PA 3P0MA 4QMWA 3ANQA 4V05A 4RLLA 4P4CA 4FNXA 3COHA 3QZHA 4F6SA 2OJFE 5HHWA 4IMYA 5AMNA 3GOKA 5G1XA 4B99A 4DFXE 3FXWA 4BDAA 1W82A 4OTGA 1QPEA 2VAGA 3PIXA 4DLJA 4AOIA 1YXTA 3MY0A 4XV9A 2IVSA 4U97A 5AUUA 1NVQA 2OU7A 4DG3E 3TG1A 4H1MA 3F7WA 4MD9E 1CSNA 2GFCA 3GU6A 1KE7A 1Q99A 4ZLOA 3RAKA 3R83A 3RGFA 1Q3DA 4DH5A 3G15A 2KULA 5IISA 3UYSA 3UIBA 2B9IA 3FC2A 4G2FA 1GNGA 4IVAA 4R3CA 4V0GB 4C4GA 3KVWA 3F3UA 3NCGA 3PPZA 4HCUA 5EYDA 4ASZA 4ZTMA 5HD4A 4LQMA 5LWMA 2IVVA 1W7HA 1XH7A 3Q4ZA 4AACA 4R3RA 2YDJA 4AN2A 2X2LA 4IXPA 2OXYA 2X4ZA 2YWVA 3MW1A 3EN9A 1H00A 4IQ6A 3DBCA 4FUYA 4BDKA 2HZIA 4ZS4A 2NPQA 5KUPA 4D28A 2PUNA 4FUXA 2PULA 4JQ8A 2KTYA 3KCFA 2OLCA 4ZTSA 4PNKA 3LFQA 4FZDB 1Q3WA 4M67A 2QR7A 2I0YA 2WMSA 4O7TA 3A7GA 2WU7A 2C0OA 4FTMA 2ITWA 5FRIA 4L68A 3QYZA 5HOAA 2PVFA 3KK8A 3V8SA 3D14A 5AR5A 5EKOA 5KX8A 3FMDA 1WVWA 2VUWA 3R01A 4IBMA 4JOAA 3P7CA 4RGJA 4DEIA 2R3LA 4E26A 1IAHA 2R3PA 2C5XA 2UW6A 2GCDA 4EZ7A 1KE8A 5HNIX 4QYEA 2OJ9A 3F3ZA 4IX6A 4C2VA 3WZJA 3TNHA 1U5RA 5LVPA 3EQGA 4FV6A 1FGKA 3PG1A 4D2WA 2JD5A 4MD7E 4FG7A 3LFEA 3TUBA 2CKPA 4EOOA 2BTSA 2YHVA 3RK9A 1JSVA 3E8CA 3VBQA 4OTQA 4NWMA 4PTEA 5HG9A 4O7WA 4I23A 1M2RA 2UZBA 3DS6A 4FL2A 4YZNA 4CZYB 5IQBA 4J52A 1R39A 4I6FA 4QP9A 4WD5A 2J0MB 2ZYBA 4QTEA 4U6RA 3UG2A 3TTIA 4R78A 4NK9A 5E7RA 3PSBA 4MD8E 4YHTA 4O96A 5J8IA 4F63A 4O7VA 2YABA 4QTBA 4MX9A 3QC9A 4HYIA 3FYJX 2VTTA 4HGSA 5E92A 3RPRA 2ITTA 3QCYA 2ZV9A 1BX6A 3OROA 4RA4A 3MS9A 5EI2A 1H4LA 4GK4A 4BTFA 3VAPA 5E9EA 4BDHA 4XG3A 4NM7A 4DHFA 5FTOA 3OXIA 4LGHA 2Q0NA 3UQGA 5JRQA 2QOQA 2XH5A 3I60A 1J91A 1Q8YA 2B55A 3DAEA 3R22A 3SRVB 3IONA 3TACA 3REPA 3PLSA 3QCXA 2W7XA 5DI1A 3JUHA 3UO4A 2JDTA 1GAGA 3OCBA 3GBZA 1Y8YA 4FSWA 1H1WA 4KKHA 4N6YA 4ANNA 5IZFA 2I40A 4PRJA 3UO6A 3LE6A 3V5PA 3E93A 5DH3A 4YZ9A 4EK4A 3SG9A 4CT2A 2B53A 3OC1A 3TZ8A 3V51A 4O0TA 3CQEA 4HVHA 4L45A 3PYYA 3VUTA 4XP0A 2XZSA 2R3GA 4ITJA 3ZS5A 4FC0A 4X3JA 4QNYA 4YJNA 3KMWA 3GU5A 5M53A 3Q9WA 3BKBA 2QKWB 3QTRA 2FO0A 3KEXA 2VTQA 3QA0A 5IA5A 2YCRA 4G6LA 3WILA 4AOTA 2E9NA 3DNEA 4XLIA 2YM8A 5FBNC 3DBEA 1UU7A 3GQLA 4IAYA 4NFNA 4WNMA 3AOXA 4ZZOA 2GSFA 5IDNA 2VTPA 4QMUA 1X8BA 3R71A 3BEAA 3FI2A 2F49A 2YM5A 3CE3A 4RJ5A 4RJ7A 1JKKA 2IG7A 1APME 4ZIMA 1CM8A 1UWHA 2PE2A 4X3FB 3QZFA 4M14A 3VUHA 4I0SA 3LAUA 2XM9A 5ETCA 1Y6AA 2GPHA 4IIRA 1P4FA 3HRCA 3ZRMA 4E5AX 2VWYA 3PJ2A 1PXIA 1XBBA 4F6WA 5KO1A 3HV4A 5H9BA 2WMAA 3QTXA 3LKMA 3R9RA 4RLKA 2IN6A 3IG7A 3VQUA 4QP4A 2QG7A 3WZDA 4AZSA 3LPBA 2PZRA 4X2KA 2W99B 5HD7A 3W2CA 4BKYA 4C4IA 3NVMB 3U54A 4E5BA 4PF4A 2GNGA 4YJVA 3OEZA 1YI4A 2X1NA 2UW8A 2GS6A 3OCGA 3QBNA 3IO7A 4HGLA 4IDTA 3V01A 5CU0A 2W1IA 5M06A 4IZ7A 3RNIA 1JSTA 5DEWA 4G5PA 4DH1A 5A54A 5HE2A 3C4FA 3AT3A 2GNHA 3I4BA 3QQLA 4DGLC 3CD3A 4QNAA 4XHKB 2WGJA 3D9VA 3U9CA 5IDPA 4LI5A 3QALE 3BYOA 4H58A 3TDWA 4QP6A 5L6PA 4ACDA 3HAVA 5LOHA 2JAMA 3PXQA 4D4SA 4GIHA 4UWCA 4IACA 1QPDA 4DEAA 2XNNA 4FKGA 3IPHA 4XS2A 5CS6A 3FXZA 2PZ5A 4ZTRA 5J79A 1M17A 4RWJA 1Q41A 4I0RA 1V0BA 1Q97A 1VZOA 4DFUA 3C4EA 5GJDA 4IB1A 5HCXA 4MBLA 5TO8A 4BGHA 5C4KA 5IMEA 5AP3A 1PMEA 2XNEA 1FPUA 2UZTA 4X2JA 2C3IB 3D0EA 4C02A 5HBJA 3PPJA 2YACA 4BHZA 1JLUE 3U6IA 2VZ6A 1B39A 1RE8A 4Q5HA 1JAMA 4LUDA 1OPJA 3F5UA 4IB0A 4RFZA 3BWFA 4D2PA 2WTKB 3CSVA 2YERA 3MV5A 1PYEA 3C50A 3IW4A 4F7SA 1CMKE 4BYIA 5A6NA 4IWQA 5FP5A 4WHZA 4EOMA 1OL2A 4JDKA 1XH8A 4L52A 3PIYA 3KKVA 1PXJA 5GINE 3W18A 1Y57A 1OL1A 4FA2A 2JKKA 3BU3A 4R1YA 5FLFA 4CKJA 5M57A 1YOLA 1PXMA 2UZEA 3I79A 4YHFA 2WQEA 2YISA 5CSVA 1IRKA 5HVJA 3E87A 2ZVAA 4ACCA 3RZFA 2A4LA 2VNYA 2YLEA 4P7EA 4GMYA 3UVQA 3D83A 4ORKA 4EOQA 2BTRA 2CJMA 4P5QA 3EIDA 1O9UA 2XMYA 4BDIA 3DXQA 2VNWA 2UV2A 4HVGA 5ANKA 4BWXA 3EQBA 4JBQA 1WFCA 2BZHB 2J0LA 3U6JA 2H8HA 5LCKA 5GZ9A 4QD6A 3MPMA 1P4OA 3LCTA 5AUXA 5TR6A 3CTQA 2X4FA 2XNGA 4A07A 4IC8A 1FVRA 4IZYA 4F9WA 3AT2A 3MN3A 4ZXTA 4WRSA 5AR7A 2V55A 3N4VA 5AUZA 2ZDTA 1QCFA 4WSQA 1UKIA 2GFSA 3DOGA 1EH4A 3MY5A 4TZRA 4PTCA 5DEYA 5A4CA 3UZRA 3KK9A 3F61A 4E8AA 3NUXA 2G2FA 4M8TA 3RAHA 3F5XA 4Y46A 2CLQA 2J90A 4IANA 3SW4A 4C57A 2EB2A 4C3FA 4DLIA 2X9EA 4GS6A 4I21A 4K8AA 4WNPA 5CQUA 3U87A 3LM5A 1R0PA 5K3YA 1GOLA 5CEMA 1A9UA 1ZYDA 3ORTA 3VS0A 2QOFA 4CLIA 4EH8A 4LRKA 1KE5A 4JDIA 2HY0A 3RHKA 1ZYSA 1LEWA 3OXTA 2W05A 2WQMA 4LFIA 4XNEA 1LP4A 3FLNC 4I1ZA 4MYGA 4E3CA 2Q83A 3WF9A 1FMOE 2O64A 4Q5EA 5FTGA 2O65A 3UO5A 4ZSGA 5HNBA 4NTSA 5B7VA 1GZ8A 2VTNA 3ALNA 4AA0A 2VGOA 3B8QA 3RNYA 3BCEA 1FQ1B 3A7HA 2RL5A 3FLSA 4ZP5A 1M2QA 2XIKA 1IR3A 2YJRA 1SZMA 2YAKA 4FKJA 4M15A 5AM6A 4H3QA 3V8WA 5FDPA 2OIQA 3R9NA 3BI6A 2VWIA 2WXVA 1PXLA 3ZC5A 2JITA 3Q4UA 1XWSA 1YXSA 3H0YA 3LVPA 4G3EA
chains in the Genus database with same CATH superfamily
4PPAA 1YHVA 3VUMA 2ZV8A 4KWPA 4NM3A 3AG9A 3FZPA 4CTCA 4EOLA 4JL9A 5AP0A 4FKIA 2A2AA 4L43A 5CF4A 3GNIB 2CGUA 4V04A 3SW7A 3MJ2A 4S34A 4A9SA 4GKIA 1OVEA 4ANLA 1DAWA 2XEZA 3P7BA 4YHJA 1Q5KA 2BALA 2HELA 5AIRA 1GY3A 3QRKA 3V5TA 4F70A 4FF8A 3R1YA 2J51A 2WO6A 3OOGA 2IZSA 3KXXA 4J8NA 4ACMA 2X39A 5AA9A 3MPAA 3HNGA 4HYHA 4BDCA 3DKGA 4LG4A 4FSYA 3PXFA 4M12A 1O6KA 3PVGA 3NZ0A 3TV4A 4L8MA 5EH0A 3WF5A 3EN7A 2Z2WA 3G90X 4L3PA 5C1QB 4BCJA 4F9AA 4I24A 3ZUTA 4TL0A 5M4UA 2C30A 2VTMA 4FKRA 5AX3A 4KIKB 2IW6A 2OICA 4JBPA 5BNJA 3BRBA 3ORIA 4BCFA 5IH5A 1XR1A 3ATTA 3BYVA 2FVDA 4XRJA 5KBQA 4RG0A 2CCIA 2X7OA 4TYEA 2QO2A 2VWXA 4G6NA 4C38A 3FMEA 1URCA 5L6OA 3O2MA 5EI6A 2P55A 3EYHA 4MTAA 5IEVA 2RG6A 3O8TA 5M51A 5HBHA 5HU9A 5GIPE 2G1TA 1PKGA 3ITZA 3IECA 4EOPA 4M13A 3EZVA 1Y91A 3UIUA 4AT3A 4FV4A 4NIFB 4BHNA 4GT3A 3NUSA 3TM0A 4AFEA 4I41A 3Q2JA 3DBDA 2I0VA 3KCKA 2YIQA 3BELA 4FSMA 4G3DA 4MXYA 3ZUUA 3OMVA 4AXDA 2BAQA 3NAYA 1RDQE 2G9XA 3V04A 3ORKA 5IKWA 3OUNB 4EC9A 1SM2A 1GZNA 4EKLA 3UVRA 1WBTA 4Z7HA 4X2NA 3A8XA 4BRXA 4RIYA 3G2FA 2W5AA 4QMMA 4RJ8A 3UOKA 3NSZA 4A4XA 4ZSJA 3R7UA 4L7FA 5IF1A 2Z7QA 4OAUC 2JLDA 4BBMA 4BWKA 1M7NA 2XANA 4NCTC 3OTVA 4ZLYA 4G34A 4FZFB 3UNKA 1KV2A 2IW8A 2R3MA 3C0GA 3A8WA 4PMMA 1M7QA 4TRLA 5AUVA 5HG5A 2BZKB 4X2FA 4UMTA 2OJGA 3LZBA 5J95A 3QX2A 5EDQA 5I9WA 4A9UA 4EH6A 4OAVB 3F3WA 3VIDA 4AAAA 2VTRA 3K54A 3QKKA 2QO7A 3R7IA 2GTMA 5AP1A 2RGPA 4BCQA 5K4JA 4O2PA 4FTJA 5AV0A 4B4LA 4CFXA 3ZMMA 2VO3A 2ZM3A 3ORNA 4EH9A 5L2IA 4TWCA 3UZTA 4QMZA 3DV3A 4S33A 5CWZA 2XIZA 4RIWB 3ID6C 3RZBA 4HVDA 2W1FA 5LXMA 4E6CA 3AC5A 3BGZA 1SVHA 3KL8A 4EH7A 2C69A 2P2HA 4O38A 4ZSAA 2QI8A 3ZZWA 4CFFA 2WMTA 3KQ7A 3GGFA 5H3QA 4FYOA 1YDRE 3NMUF 3G33A 1TVOA 4GYIA 3AC2A 2E2BA 3M1SA 1UNLA 2J2IB 3E8EA 5FWKK 5KMJA 4G3FA 2RFNA 5D9HA 5L3AA 2XEYA 2X6DA 4I4EA 2PE1A 3B2TA 3RK7A 4FSQA 5HE3A 4BL1A 4ID7A 3BQCA 5CAPA 3DK6A 4USFA 3PJ1A 3JY0A 3MTFA 4QP1A 4QMTA 3TXOA 1PMVA 2BKZA 2OJIA 3NUPA 3NUYA 3SAYA 4BKZA 4ACHA 5BUJA 2EB3A 2OXDA 3QTSA 4KA3A 5EHLA 5CAOA 3LXLA 5K0XA 4QTCA 3HYHA 4JMQA 4R77A 3P78A 3IKAA 1H07A 4BVUA 1DAYA 2W0JA 1TQIA 3SV0A 5KMOA 4XG2A 3NRMA 2BFYA 4FSRA 2DUVA 4J95A 1ZYJA 5AA8A 4YLLA 5CT7A 3FWQA 3TCPA 4GJ3A 3NNWA 4IM2A 3N4UA 1NY3A 4D4YA 3M11A 3BE9A 5IUGA 5CU4A 3QCSA 4IW0A 5JFXA 1ZARA 4GT5A 3TT0A 3QXPA 3E8DA 4MQ1A 5ETFA 4F9BA 3AT4A 4JI9A 2EXEA 2R64A 4L00A 2JFLA 5FGKA 1XQZA 3Q32A 5BMMA 5CNOA 3ZM4A 4CFUA 4HW7A 4I4FA 2HWOA 4EZ5A 3C4ZA 3C0IA 3DAKA 3G0EA 1YDTE 3TZ9A 1OECA 3C0HA 2A1AB 3P4KA 5EW9A 5AUYA 3PE2A 4O82A 4WG5A 4E4LA 2OW3A 1UU9A 4IZ5A 3JVRA 4AF3A 3S1HA 4XOZA 3AKLA 2I1MA 3EHAA 3FMNA 4ZTLA 4Z7GA 3EFJA 3EQPA 3I6WA 3U55A 2PZIA 2EWAA 2V0DA 3S95A 4M0ZA 2PVHA 3SQQA 4BN1A 5DNRA 5IG1A 5LVOA 3UDBA 5AP4A 4QP8A 5IH4A 4A06A 2UW9A 3Q6UA 3FLQA 3TUCA 4BY9E 1PXOA 3F5PA 3I0OA 4L6QA 2LAVA 3SC1A 4B9DA 3NUNA 1FMKA 4UALA 2C1AA 3L8SA 3PE1A 4XG9A 4ZY6A 1ZMUA 4WSYA 4NW6A 4O83A 2X0QA 4EUUA 3ML1A 2QR8A 5K4IA 4ANQA 4K2RA 5DHJA 4BWPA 5AUTA 1BYGA 2VO7A 2NP8A 2CNVA 3O23A 3AMBA 5D7VA 5FG8A 2C5OA 3C4XA 2GS2A 4LMUA 3D7TB 2C1BA 1UV5A 1OKZA 2G01A 1VJYA 1H08A 4HYUA 3UP7A 5C8NA 4IX5A 2YLFA 2X81A 3OW3A 4RIXB 5AP7A 2DWBA 4RC3A 3VBXA 4YSMA 3LQ5A 4F1TA 2YEXA 2VTIA 4OR5A 1MUOA 3RHXA 2WIPA 1J7IA 1H28A 2QOIA 2E9UA 2OZAB 4PDYA 4S30A 3ACJA 4UMQA 2XB7A 4NKSA 1YI6A 3WARA 2ITPA 4G17A 4U80A 1PXKA 2EXMA 4PL5A 4AOJA 4IM0A 3GT8A 4AWIA 4QMOA 3MSSA 3C13A 3MVMA 3PSCA 3S2PA 3ODYX 5CVHA 3ZFYA 4DA5A 3DGKA 3HMPA 2WMWA 2A27A 3OOMA 3UC4A 4N0SA 1OKVA 3IDPA 3EL8A 4I5CA 4FTAA 3LJ2A 3BIZA 4EWHA 3QQJA 3W8LA 5EQPA 3MFTA 1FVTA 2B1PA 3RBWA 4EQCA 3MIYA 4ZJVA 2JAVA 2B9FA 3CCNA 3GCUA 3PVBA 2ZB1A 4PX6A 4ZZMA 4FTRA 4ZK5A 3TIYA 4B0GA 4X3FC 3MYGA 5HICA 5L2QA 1KUTA 4K6ZA 5M08A 2AEGA 1XMLA 4FT7A 5AFVA 4AXEA 2ZV7A 3NW5A 2NRYA 4LOQA 3W0RA 2C6KA 3B2WA 4OTRA 5FBOA 3QRUA 5JT2A 3VNTA 4ZY4A 2AYPA 4YNOA 3R8MA 5BVDA 3R04A 3TKHA 4O0UA 3VVHA 5E1SA 2VTAA 4CT1A 5L2SA 4GYGA 4BIEA 1L8TA 2PU8A 4U9AA 1XH6A 4O0XA 1W98A 2YIXA 3OD6X 4FKSA 4FTUA 4UWBA 5E8VA 4C61A 4GT4A 2QOKA 2G2IA 4B8MA 2HZ4A 5T6KA 3R8LA 2VN9A 3DJ5A 4IAKA 3FZRA 4TYHB 5ANIA 4O7RA 4ZOGA 3S00A 3OY1A 4WA9A 4BIBA 4BDFA 4LYNA 3F88A 5HVYA 3BU6A 3RPSA 3HZTA 3IDCA 4QYYA 3QTZA 5DOSA 5FEQA 2VWUA 3P5KA 4F0FA 4FTKA 4R7IA 3TIZA 5BVFA 3QHRA 2BROA 3I5ZA 4EOJA 4R7HA 1CKIA 4FTOA 1UWJA 1HOWA 3ALOA 3NLBA 4YC8A 3QQKA 3F2NA 2BRGA 3F7ZA 4E73A 3UQFA 5B2KA 2XAMA 5TF9A 1WCCA 1YOMA 4NW5A 3ZEPA 5IA0A 3GOPA 3UPZA 4WT6A 4ZSLA 5IEYA 1Y8GA 2X7FA 2ONLC 2J5EA 3HDMA 2IWIA 4C8BA 5F20A 3P7AA 3F2RA 2C6OA 2FSMX 2O2UA 4FK6A 4RC2A 5AV4A 3G9LX 3SHEA 4ZS0A 4C37A 4DFNA 3KREA 2UW3A 2WTKC 4PY1A 1IEPA 4ARKA 3LIJA 3O50A 4CZTA 5E8UA 3VS3A 5CI6A 4R7BA 1Q8TA 3AC4A 5IMXA 2HK5A 2R9SA 3CKXA 5CAUA 3OXZA 3QC4A 1OIQA 3CS9A 4TY1A 5CEQA 2NNWB 2ZFYA 3PXRA 4PMPA 3IDBA 4KBKA 5LWNA 4J71A 2NRUA 1IAJA 3THBA 3R0TA 2WOTA 2JKMA 3PVUA 3P9JA 4FIJA 4RWLA 3NVKI 1Z57A 3ZSIA 4OW8A 3Q53A 5CNNA 4UX9A 5IQGA 2UZVA 3TKUA 3BLAA 4MXZA 5DMZA 2QO9A 4YTCA 1FGIA 2QOLA 2PMNX 2Y4PA 4C3RA 1WBNA 4DGOA 3FSKA 2PWLA 3Q4CA 3VUKA 2V7OA 5K5XA 4D0XA 4FKLA 4HJOA 3QLGA 3QTQA 4EYJA 3SD0A 3BLRA 4CEGA 3BHYA 3AQVA 4J98A 4DFLA 5A4LA 4BCPA 3QD4A 5IQEA 3QTUA 4CV8A 4K0YA 3FQEA 5JSMA 2RFSA 2W1HA 4M68A 1QPCA 2UZLA 4OTIA 3U51A 4AG8A 4CD0A 3MWUA 3HVCA 3WYXA 4G3GA 5CXHA 5CXZA 3FMMA 2J50A 2DQ7X 5ANEA 1JOWB 5ACBC 4LDTA 3FLWA 3CXWA 4XBUA 5JZNA 4NL0A 4M69B 5M55A 4KABA 3KB7A 1ZXEA 2C5YA 3EN4A 1ZAOA 4IVCA 4JAJA 4S32A 4W9WA 2WMQA 5L8KA 3BGQA 3A62A 4ZLZA 4BZNA 2XJ0A 3UGCA 4Z55A 1GIJA 3QA8A 4XG6A 3AKJA 3SVVA 4C36A 3SXSA 2JBOA 1OKYA 4LM5A 3QQFA 5FXQA 1Q4LA 5T3QA 5K9IA 4M7IA 5H2UA 4DCAA 5EOLA 1DS5A 2WOUA 1BMKA 4XRLA 2ZMDA 3FAAA 4IJPA 4YC3A 3QGYA 2QD9A 3L9LA 1UU3A 4CG8A 1ZY5A 4QQCA 5M44A 2XIXA 5AV2A 5FTQA 2P0CA 4HNIA 3WYYA 1J3HA 3DAJA 3VUDA 1OGYA 4FT0A 4XG4A 3UJGA 3PVWA 2C47A 2OFUA 3H9FA 4MK0A 1JWHA 2UW4A 3VUIA 3QGWA 4O7LA 5FDXA 3BWJA 3IW8A 4EC8A 3R28A 2ERKA 2VTOA 4RX8A 1URWA 4EZ3A 1NW1A 2GQRA 4KKEA 3KC3A 2AUHA 4RVTA 3NPCA 3W33A 3ZLSA 4IJ9A 4HZRA 3GC0A 4O84A 3AXWA 4H3PA 3TKIA 2X2KA 4U44A 4DYMA 4Z16A 2WTDA 4AAYA 4FI1A 2W1CA 2JGZA 4JG6A 4AE9A 3V5QA 4QMVA 1HCLA 4FEWA 3P23A 4L7SA 2RG5A 5DYJA 1V0PA 4J1RA 2AC5A 5AV1A 1OITA 3PG3A 4FE2A 4DHZA 1IA8A 5LVNA 4AW5A 3GC7A 5JN2A 1YXXA 4CRLA 4U81A 1KE9A 1W0XC 3F3VA 3VF8A 4UWYA 3OWLA 2J9MA 4J99A 4NH1A 4RX9A 4D1XA 1TKIA 4V01A 3Q2MA 4EHEA 5KCVA 3EKNA 4GV1A 3MESA 2X7GA 3FY0A 3GCVA 2XNOA 3NNXA 4DEEA 2XKFA 3G6HA 4I6HA 3OWPA 2OGVA 2GHLA 1H01A 3EWHA 4CFWA 2QODA 3CEKA 1UNGA 3HMMA 4O22A 1PF8A 4GK3A 4PDPA 5DR9A 1M52A 3D5WA 2F4JA 4CFNA 1CKPA 3FZ1A 1FVVA 4UMUA 2OK1A 2XS0A 3R8UA 1E1XA 4RT7A 2CKQA 4HGEA 3W55A 4C4HA 4JX3A 3V6RA 3KXHA 2VTHA 4DH7A 3QHWA 2OXXA 3BHHA 4LL0A 3TI1A 3BEGA 3BE2A 4FEXA 1TFFA 5CSPA 1XBAA 2RKUA 3NX8A 4O0WA 1FOTA 3OCTA 3MGYA 4PTGA 3W0QA 3C51A 4CG9A 3SOCA 3FY2A 2QCSA 1WMKA 4MXCA 4RQVA 3ZHPC 4N57A 4K9YA 5JQ8A 2HXLA 2CPKE 3FQHA 5CU3A 3IW7A 1CDKA 1HCKA 3HRBA 3UOLA 3ANRA 4CTBA 5HLWA 4U7ZA 5CTPA 3EQHA 4Q2AA 3ZEWA 3SDJA 4F1MA 4E20A 5JEBA 2R3JA 3EL7A 3LCOA 4UZHA 5CU6A 4GU9A 5HNGA 3VC4A 4LGGA 4PV0A 4XG7A 5E8XA 4BCOA 1T45A 3ZONA 3OW4A 3PIZA 1I44A 3K2LA 5HTCA 4GL9A 3TYKA 4FK3A 4O0VA 1E1VA 3KRRA 5CENA 5EOBA 2ERZE 3CJFA 2OF4A 4X6RA 5DRBA 5AV3A 4PP7A 4U3YA 3L8XA 3MVHA 4P2KA 2VO6A 2PMIA 3RPYA 5A14A 4GU6A 4KINA 4FKVA 3CY2A 3TL8A 3W8QA 3QTIA 3QRIA 4E4XA 3FDNA 3T9IA 4FIHA 4FNYA 2J5FA 2YDIA 5IA3A 3LFDA 5DT3A 3FSFA 5CT0A 5LMBA 4LV7A 3RM6A 3BYSA 3QRJA 3G0FA 4GKHA 3IW5A 3VS5A 3HDNA 4O4CA 1JQHA 3A7FA 3ZBFA 5LVLA 3FMKA 2PSQA 4IFGA 3S3IA 4Z3VA 3W0OA 4C4FA 3GEQA 2JDVA 3LQ3A 2QU5A 2UVZA 3PLAE 3DY7A 4PP9A 5GJGA 3OCSA 5E8ZA 3PTGA 3RPVA 4ZTNA 3QUDA 4CMUA 1F3MC 4HCVA 5HVKA 2PL0A 2XKDA 3LLAA 4UV0A 2W4KA 4Z9LA 4HGTA 5GIOE 3BHTA 5F95A 2W17A 3N51A 4G6OA 3F2AA 4NSTA 3V5WA 5LQFA 4DF3A 4DHIB 3R9DA 4YO4A 3UODA 2F9GA 5IQHA 4O7SA 3LJ1A 5C03A 4MBIA 2IVTA 4I6BA 3ORZA 4ZEGA 3UC3A 2Z02A 4XUFA 4AGUA 1OM1A 3HL7A 2O63A 3KXMA 4NKAA 1QL6A 4C4EA 4CMOA 4QMQA 3P08A 3CIKA 4FZAB 3KRXA 5H8BA 4MHAA 3FPMA 3PY0A 4QMLA 3U4WA 2PUIA 3KIOC 3FJQE 4GVAA 4UEUA 3MH3A 4J96A 4ZJJA 2Y4IC 5AR4A 3W16A 2J6MA 4LOPA 4L3LA 3A7JA 4YBKA 5DR6A 3HV5A 5HE1A 2B52A 3WF8A 2OZOA 2BRHA 5AEPA 5IU2A 4A4OA 4ITHA 3VBYA 5AAEA 5BQ0A 3COMA 4OGRA 2CMWA 2FH9A 4UXLA 1WAKA 4KBAA 1PXPA 1ERKA 5BVEA 4O86A 5HKMA 5HCYA 3AGLA 4U5JA 2C3LA 2V22A 4KRDA 3OT8A 5IH6A 4BZOA 5BUEA 1AQ1A 2XRWA 5B2LA 1SMHA 2C68A 2R3IA 3EH9A 2C6EA 3BHVA 3IQ7A 3HP5A 3W10A 3MH0A 5AP5A 1SNUA 1SVEA 1YWNA 3TTJA 2H9VA 1TQPA 3RAWA 4EH2A 4CLJA 3CLYA 4RBLA 2VWWA 2EUFB 5IA2A 2BMCA 4TYJA 2W06A 3DDPA 3UPXA 2PYWA 3QKMA 1WBPA 5L8JA 1J7UA 2YCQA 3PP1A 3BV2A 4H05A 1B38A 3F9NA 4BCGA 3Q9YA 4FJVA 3FKOA 3OFMA 2WU6A 3EQRA 4ZAUA 4JDHA 3ERKA 4BDDA 5AM7A 5IUHA 2W5BA 2ITUA 3FHIA 3GCSA 3ZO2A 1IASA 4ASEA 1JKTA 5CF5A 3R8VA 5JFWA 3MH2A 4FRFA 4O7ZA 5TT7A 3R9HA 4DH8A 4ENXA 5J9YA 2XBJA 4AZTA 5I3OA 3VRZA 2J0IA 3EQFA 4R5YA 4O0SA 5D11A 1RQQA 3EN6A 4K18A 4TT7A 5EM7A 5HQ0A 2WHBA 3QX4A 4CMTA 4F1OA 5J87A 2HY81 3CTHA 4MXOA 4FKPA 2WIHA 2OFVA 4D4VA 5CASA 4J97A 2UVXA 2BAJA 3ACKA 5JFVA 4A9YA 1YKRA 4NU1A 2JFMA 2BIKB 5H8GA 2IW9A 1JBPE 3G5DA 3L8PA 2QNJA 4FNWA 3ZTXA 4NM5A 4JIKA 4DG2E 3A60A 1OL7A 4RIWA 3MA3A 4ANMA 5LVMA 5EW3A 4MWHA 3LLTA 4I5PA 4BI2A 1Q24A 4HVIA 3HEGA 5CVGA 4WUNA 4BGQA 3OS3A 2CNQA 5TE0A 3ZLYA 5CX9A 3ZO1A 3COKA 3UZPA 4A7CA 3NFFB 3B8RA 4UZDA 1W83A 4FIFA 4GK2A 5C01A 2R0UA 3CTJA 4O1PA 1UU8A 2O0UA 4ANOA 3BBTB 1H1PA 5AUWA 1MQ4A 1O6LA 2XK4A 2XJ2A 3D5UA 2PVKA 3QUPA 4LOOA 4QYFA 1XMMA 1ZYLA 3I7BA 1WBWA 3C5UA 3IS5A 4HNFA 4EEVA 3C4WA 5AP6A 3WZEA 3LCDA 5M4FA 4DGGA 4QQTA 4IAIA 3DU8A 5ANGA 3ORPA 5DGZA 3NGAA 5EDPA 3MVJA 4FKOA 2WMXA 5EW8A 5CEPA 1J1BA 5CEOA 4RVLA 3E5AA 3WIGA 4OT6A 4FV8A 2BRNA 2EU9A 2R2PA 1VYWA 3LXNA 2BR1A 3VHKA 5JK3A 5E8WA 1GZOA 4UMPA 4DH3A 3ORMA 2JIUA 4GJ2A 2XNPA 3JPVA 4RX5A 3UTOA 2HENA 5EI8A 3UOHA 2W1ZA 1H27A 5JGAA 3DTCA 5ETAA 5ANDA 3P86A 5I3RA 4OBOA 1DM2A 3R7VA 4KRCA 4BZDA 2ZOQA 3CR0A 4YU2A 2ETKA 3QD2B 4FL3A 4G9RA 3VUGA 2P3GX 4CNHA 4C2WA 2XNBA 3KMMA 3TV6A 3FI8A 4HYSA 5G6VA 3WIKA 4AE6A 4ALUA 3TNIA 1WBVA 4F7NA 3NWWA 3UQCA 4H39A 3R6XA 4GIIA 2BZIB 2XKEA 4X0MA 5HO7A 3FLYA 4RRVA 3DKCA 3HA6A 3F3TA 4AGWA 2P2IA 4BCHA 4F9YA 2XF0A 3R7GA 3NUUA 4Y95A 1NA7A 2VGPA 5FEEA 5KMIA 3R7OA 2E9OA 3WE4A 4F0GA 5DIAA 1BI8A 4FEVA 3S4QA 4DFBA 4JX7A 3NFGB 4ITIA 5I9XA 3BPRA 4NTTA 3VS2A 2C3JA 4G1WA 2YITA 3FL5A 2C5VA 4TNDA 5D1JA 5AIKA 3V5JA 4D4RA 3PPKA 4ZY5A 5B2MA 2XALA 3IOPA 2AC3A 1PXNA 4J8MA 4Y85A 3I81A 4PQNA 3ZLXA 5KMKA 3LHJA 4YJRA 4W8EA 1S9IA 2Y0AA 3D7TA 4BFMA 4BYJA 5AWMA 4MNEA 5HG7A 4C4JA 3ZXTA 2X0GA 4GG7A 4O4DA 2ITZA 3DFAA 3FMJA 4PDOA 4MF0A 5CF8A 5JRSA 1BI7A 4RFYA 4RIXA 3VS7A 2E9PA 3T3UA 2C6TA 4FR4A 4M0YA 5DLSA 1W8CA 2RFDA 3NW7A 1UNHA 3LXPA 3UNJA 1Z9XA 4AT5A 2UZUE 3LMHA 2Z7RA 4D9UA 3I0QA 5M56A 3MPTA 2BCJA 2Y4IB 3DFCB 1Q8WA 5CSXA 4IADA 4FTIA 1WBSA 2I0HA 3GC9A 2C4GA 4OBPA 5FD2A 4QRCA 2OI4X 2YAAA 2XNMA 2XUUA 2OJJA 4NUSA 5EQYA 1P2AA 2SRCA 1ND4A 2J4ZA 5CVFA 4JNWA 4BI0A 4DTKA 4BTMA 2QQ7A 4X6QC 4ZJIA 3POZA 3R2BA 4YZBA 1KV1A 2HW6A 2WMRA 2JC6A 4WBBB 2BDJA 3PY1A 3R1SA 5EM6A 4BICA 1J7LA 4KS7A 5F4NA 5L2TA 4DTBA 4FZ7A 4JR7A 5HI2A 5GZAA 3CP9A 2VX1A 5FQDC 2OWBA 2H6DA 3DXPA 2XRUA 1RJBA 1MRYA 4FBXA 3NNUA 3TJDA 3ZSGA 4YZCA 3W0MA 4YLKA 1Y6BA 2WFYA 1JNKA 4QDVA 3KN5A 4R8QA 2Y8OA 3G9NA 3L9PA 3S0OA 3O8UA 3MFUA 4C34A 3AKKA 1DI8A 1PW2A 2FUMA 4JIAA 4LUEA 4IAFA 2VWVA 3BHUA 4GUBA 4HOKA 3UNZA 2X8IA 3HMIA 4AFJA 1U5QA 4BDGA 4O91A 1QMZA 4WKQA 4FTLA 4ZMEA 1REKA 3OY3A 3QL8A 3DJ7A 3FLZA 4M97A 4IM3A 4P5ZA 5I9UA 3G51A 4CFVA 3MFRA 3AC3A 3FZSA 4FKUA 4PDSA 4U79A 3RCJA 4DFZE 3H9OA 4D55A 3LJ0A 4XP2A 5EYMA 4KIQA 4PWNA 3TN8A 4QYHA 1PY5A 4PL4A 3UIXA 3KXGA 1SYKA 2Z7SA 5ANOA 3ZFMA 3CGFA 4M84A 2HXQA 1H24A 4U41A 5M4CA 3NS9A 5IQIA 4EH5A 4NCTA 3WBLA 2JBPA 4CQEA 3FL4A 4ASXA 4ZZNA 5CAQA 3PUPA 3V3VA 4B8LA 3Q9ZA 3T3VA 2OIBA 3DJ6A 1H1SA 2WMUA 3NEWA 1L3RE 2Y9QA 5HX8A 3RM7A 2WKMA 3QZGA 1REJA 2V5QA 2YCSA 1K9AA 3RCDA 3FHRA 3NW6A 4O81A 4B7TA 1MRVA 3KXZA 4MWIA 4N70A 3QZIA 2YFXA 3DDQA 3GQIA 4G16A 4RA5A 4DINA 5HZNA 3VBWA 2R3HA 4O4FA 5EYKA 4IZAA 2IZTA 4K33A 5J1VA 4FG9A 3L9MA 4BTKA 5J9LA 2JEDA 3UE4A 4CRSA 2XCHA 5CI7A 4F64A 3DK3A 4XH6A 3E3PA 2B54A 1JKSA 3PZHA 1YOJA 1V0OA 5JH6A 1STCE 2WEVA 4OTDA 4Y73A 4DC2A 3LFBA 5HG8A 3Q60A 4CQGA 3U6HA 2Y7JA 4QPAA 3GC8A 5IA1A 1XHAA 4C3PA 4JQEA 3ZOSA 4V0GA 2FSTX 5CSHA 3C4CA 3Q5IA 4TN6A 5DWRA 5BVWA 2XA4A 2CN8A 5EFQA 4IEBA 4DGNA 5EYCA 3V6SA 5HU3A 2BDWA 5CANA 3ULZA 2HCKA 4FSZA 3EFLA 1ZLTA 4U42A 5E8YA 3ENHA 3O71A 2XK3A 1W2CA 4IVDA 2BFXA 3VO3A 4XCUA 2GNFA 4OTFA 5C27A 2R3RA 5J1WA 2WD1A 3EOCA 3BX5A 4OUCA 1TZDA 4XMOA 2GHMA 2H34A 5EDRA 4L9IA 4BCKA 4CXAA 3HUBA 4WG4A 3UMXA 4PPBA 3CKWA 4WIHA 2O3PA 2YDKA 3MBLA 4FTCA 4RX7A 2YIWA 3ZYAA 2UZNA 3OWKA 2C5NA 2XCKA 1XH9A 2OH0E 4XLVA 4EL9A 1NT2A 3PJ8A 3C5IA 5DBXA 2XK6A 4D58A 3KF4A 3FYKX 3ODZX 2XK7A 3ZO3A 4AX8A 1JSUA 1ZRZA 3EB0A 4O6EA 2I7QA 4KD1A 4GG5A 3LCKA 4EBWA 4LMNA 5I9YA 2QURA 1G8AA 4M69A 5JZJA 2V62A 2HZNA 4F6UA 2IO6A 4YNEA 5E8SA 3FPQA 1ZMVA 3D4QA 3MH1A 4BKJA 2WB8A 5FXRA 3QKLA 5IA4A 2IF8A 2PZPA 1Q62A 4FSNA 1CKJA 4LV5A 4AQKA 3KF7A 3HV7A 3RJCA 3PSDA 4E6DA 4TNBA 4XV2A 1OB3A 3RAIA 5BVNA 3NYVA 2V7AA 4CKRA 4F99A 4FOCA 4DFYA 2BRMA 3L8VA 5I5ZA 4YBJA 2VTJA 3DXNA 4KSPA 3R7YA 5LJJA 3DPKA 4RZVA 2ETMA 3F5GA 5KZIA 4FMQA 4IB5A 2XYNA 5HO6A 4F4PA 3GP0A 4AW1A 2YM4A 3O7LB 3UIMA 3Q52A 4NJDA 5HTBA 4AZEA 2F57A 4ONAA 4IH8A 3SRVA 4F0IA 5F9EA 4GVJA 4AW2A 4YC6A 1A48A 3GVUA 3PXZA 4BTJA 4FNZA 4AS0A 5AX9A 4ACGA 3BL9A 4U45A 2WAJA 5JQ5A 2H96A 3M2WA 4BCIA 2GQSA 3WF7A 3MY1A 4I93A 4NYEA 4MXXA 2XARA 4AN9A 5KMNA 3KMUA 1SVGA 1U54B 5M4IA 4IAZA 2GU8A 2EXCX 4QPMA 5DA3A 3VF9A 4DEDA 4EBVA 4L3JA 3QUEA 3AD4A 5KE0A 5KHWA 2UZWE 3LFCA 4HCTA 2FB8A 4KS8A 3FC1X 2FSLX 3HP2A 1WVXA 3KULB 4RVMA