3ZRMA

Identification of 2-(4-pyridyl)thienopyridinones as gsk-3beta inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
344
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Identification of 2-(4-Pyridyl)Thienopyridinones as Gsk-3Beta Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 344
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zrmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zrmA01
1SYKA 4FV0A 4IB0A 3CD3A 5CSVA 1NW1A 3IW7A 4L6QA 1Q8YA 2WTJA 3QRKA 4QYFA 3ZDIA 2R3MA 3DZQA 1OKWA 1REJA 1FGIA 5I9UA 3TKUA 4CFNA 2I40A 2HW7A 5IA2A 5FLFA 2BHHA 5JZJA 3EQGA 1XHAA 3UIXA 4C38A 1ZYLA 3MW1A 4YZDA 4A07A 2J0KA 3ZU7A 3BWJA 4NL0A 4YJRA 3H0ZA 4D0WA 3LFSA 4RRVA 2J0JA 4TNBA 5CI7A 3U4WA 4B7TA 3KQ7A 4E26A 2C47A 2Z7QA 5KCVA 1A9UA 3LIJA 4O86A 2QVSE 5IUHA 3KC3A 4FV8A 4IX6A 3REPA 3VS2A 5AR8A 3EIDA 2X6DA 2OLCA 4WHZA 5F1ZA 4BCFA 3ZS5A 1QMZA 2CGXA 1K9AA 5DI1A 3MH3A 1MQ4A 4X0MA 1U5RA 4R3CA 1R1WA 4N57A 4F9AA 3D7ZA 1NY3A 3P86A 4AF3A 4CFMA 4YP8A 5KZ0A 5HVYA 2YAKA 3ZLXA 4FV5A 5DH3A 4EYMA 4A4OA 5CLPA 5ANIA 5JKGA 5M08A 3LJ2A 3DLZA 4I1ZA 4N6ZA 3DBEA 4Z7HA 2PZ5A 3PJ1A 1UKIA 1DAYA 2BRNA 4XLVA 3VF8A 3R63A 5DA3A 4R7HA 5EW3A 4CMUA 1PXOA 4DFZE 2FUMA 4IM3A 4OTRA 3AG9A 2YIRA 3R8UA 4GT3A 4BBEA 2XIRA 3IONA 3UNZA 1KUTA 1GZNA 3EN9A 5CAPA 1FMOE 3VHKA 4C4HA 5IF1A 2J7TA 5HBJA 5LWNA 4RX9A 2QOCA 3CPCA 4PMMA 4YU2A 3PFQA 4LV5A 5CTPA 2PVNA 4FEXA 4A4XA 3MYGA 4W4WA 1Q97A 3SVVA 3LQ8A 3QRTA 4FV2A 4RJ7A 4ARKA 3U87A 4I21A 4DEBA 2E9NA 1RJBA 3R7VA 1YWNA 2J90A 3TCPA 4FSRA 3TNHA 5HQ0A 3MFTA 3ZRLA 3ZRKA 3QTIA 3ZHPC 4J8MA 3BRBA 3IOKA 2C5OA 4BHZA 1PMUA 1B38A 3CLYA 4AN9A 3VF9A 3LJ1A 4HCVA 5E8UA 3ZSHA 2DS1A 3F3WA 3FHRA 5F95A 4B8LA 3CIKA 4WOVA 3AMBA 3O7LD 2Z02A 4DGOA 4CT1A 1BL6A 3IW4A 1MRVA 5HCYA 3HMMA 4ZTLA 3HV4A 3RK5A 5CVFA 3UPZA 3JUHA 2PMIA 2UW4A 4LRJA 2G01A 4AAAA 1BI7A 2ZB1A 3IDPA 2OG8A 2B9JA 2Y4PA 5HIDA 5FDXA 3ROCA 4BDDA 3SAYA 3DGKA 3NAXA 5A6OA 3G2FA 4DINA 1XH9A 2OH0E 2YCFA 3D5WA 4BY9E 3P78A 4E1ZA 3NVKI 3IGOA 3ZYAA 4F9CA 1ERKA 5AP3A 4WA9A 5ETCA 4G5PA 3BGPA 5I3RA 3HV3A 4LL0A 3ALNA 4ZSEA 3R8VA 1GY3A 4I6QA 1Q8UA 3OCGA 4U45A 4Y73A 5KBRA 3FXXA 3ALOA 2A27A 4R6VA 5CS6A 3PWYA 1L3RE 4RVMA 5FP6A 3NUUA 3NPCA 3BGZA 3EFLA 1DS5A 3TNWA 3NW5A 2XKDA 3NNXA 4PX6A 1GZKA 3O17A 3RHKA 2PVFA 5GJFA 4L8MA 3U51A 4B9DA 3WI6A 4DFXE 5GZ8A 1IRKA 2XIZA 3KRLA 4YZMA 1AGWA 4QMWA 3TACA 3SDJA 1Y6AA 1NXKA 3LPBA 4PDSA 4OT6A 4PDOA 3RHXA 4OTIA 2X7OA 5HTIA 1WVYA 3HX4A 4AUAA 2B9FA 2OXYA 4AFEA 2Z60A 2ZV2A 3EN5A 5DR6A 3ENMA 4O0YA 5C8KA 4QD6A 5IQGA 3ORXA 2P2IA 4P2KA 1MRYA 4DG2E 2IO6A 5HTCA 2YJRA 4PUZA 2C3JA 3LXNA 5K0XA 5FBOA 3TNPC 4EH6A 3DZOA 3BGQA 3LM5A 2YDKA 3VS6A 5AJQA 2RKUA 5H2UA 3MN3A 4EH9A 4X3JA 1KE6A 1M52A 4PPAA 4ANBA 3TZ9A 2XJ0A 4FIEA 3DCVA 3BBTB 4NM3A 4X2KA 3S95A 5JQ8A 2WQOA 3AC3A 3GFEA 3ET7A 5KMKA 3Q6UA 2R3OA 3NLBA 4RIXB 5EYCA 2UW3A 3E62A 4JBPA 3UVPA 4CTBA 1W7HA 3SXSA 3N9XA 1KOAA 1YDSE 2UZEA 3P9JA 3ENHA 4BICA 4RG0A 3AC1A 2C5NA 3JY9A 4FTAA 4IANA 4TTHB 3DB8A 3R8PA 4EZ3A 3LM0A 4R8QA 3FLSA 4IDVA 3LKMA 5TO8A 2H96A 2QURA 2W1ZA 3IW8A 4G17A 4NCTA 1TQPA 4KRCA 3SRVB 4EHEA 1P2AA 4IE9A 4NW5A 3UTOA 3PY3A 2YM4A 3BZ3A 4J99A 4ZSGA 5AP5A 3H0YA 3G33A 1OIRA 3H4JA 3VULA 2IG7A 4MF1A 3EQPA 3W33A 3ZUVA 5A4EA 3UYSA 4EUTA 4E20A 3QXPA 3GU7A 2BRGA 4J8NA 3CKWA 3OEFX 2PVRA 4K6ZA 4YTCA 5IEXA 4CFXA 2ITPA 5EYKA 4BVUA 1K2PA 4DLJA 3ZO4A 3LMIA 4GVJA 3SA0A 4APPA 2CLXA 1IEPA 3KREA 4WT6A 1KE7A 4YSMA 5IQBA 4G3EA 4W8DA 5KMJA 4RIYB 4F64A 3M42A 5BX0A 1ZWSA 4BGGA 1OZ1A 5JN2A 2EWAA 5C8NA 3QFVA 4XS2A 4DH8A 2ETKA 2G2HA 2C3KA 1I44A 3Q04A 2YLEA 4MHAA 3WZUA 2YDJA 3R1SA 2OZAB 3L9MA 4C4IA 4AGUA 3VS1A 4EOOA 1ZXEA 3C1XA 3U8WA 3BQCA 4W9XA 2X2MA 4F0FA 3PLAE 3RK7A 5M4UA 4RA4A 3CQUA 5HLWA 3MTLA 2JBPA 4FUXA 5AIKA 3FL5A 3LXLA 2EXMA 3OCTA 4QP8A 3R6XA 4MK0A 4OBQA 4U9AA 5FG8A 1TKIA 2HY81 2WQEA 4Y5QA 4AOJA 5LQFA 1GOLA 3EZRA 3NIZA 4HGSA 5D11A 4F65A 3D5UA 4Z3VA 4K8AA 3HMNA 1HOWA 3F5GA 5AP0A 4XG2A 3WZJA 4M14A 3P4KA 4NFNA 4PP7A 5L2TA 2BPMA 3EL8A 3CBLA 3Q9ZA 5EYDA 4O7SA 3ORPA 3TNQB 3CQEA 3RPRA 4D4YA 3KFAA 3AD6A 4KD1A 4TWPA 2W1GA 3MPAA 2R4BA 3LMHA 4KWPA 2IW6A 3DFAA 4WG3A 2Q0BA 5CT7A 1KSWA 3HNGA 3PIXA 5E8VA 5IA0A 2KULA 2YWVA 3C50A 1JKKA 3AXWA 4XBRA 4EKKA 1H01A 1Z57A 3PPKA 4CKIA 4F9WA 1V0BA 2O8YA 1PHKA 4CYIA 4FIHA 3R22A 4FV3A 4RZVA 4EOMA 4Y95A 3ROYA 5AP6A 3NNVA 3UJGA 3RZFA 1ZYDA 5HG5A 3DKCA 4HNIA 2NP8A 3FY0A 4UZHA 4XG8A 5C01A 2UZUE 3DY7A 5GHVA 3UDBA 2B54A 4O6LA 4AT4A 4Y72A 4GVAA 2JIVA 3FYJX 4FTQA 4RLLA 5L2QA 5K4IA 3V5WA 4KSPA 4MH7A 3ZCLA 3BCEA 4UN0C 1BX6A 4IB3A 5K5XA 2GDOA 1W84A 2BDWA 4J53A 4DTBA 3THBA 4H05A 4RVLA 4QMTA 2C6OA 2CDZA 3FEGA 2ZYBA 3KKVA 4D1XA 2GQSA 4O7RA 3Q52A 4YTHA 5JFWA 5E8SA 4C61A 3BWFA 2H8HA 3DBCA 3C4CA 4GG5A 3P08A 3TTJA 2JIUA 5K9IA 3W2OA 2A0CX 4A4LA 3R00A 5DVRA 5BVFA 3PXKA 4FKGA 3I4BA 2RFDA 1YDTE 2JAVA 3KRWA 4ZJIA 3VS7A 4D1SA 4F6UA 3BV3A 5AUTA 4AN2A 5AR4A 3EH9A 3HRFA 2ONLA 4YHTA 3FL4A 2BKKA 1R78A 1VYWA 4JG6A 4FIGA 5HKMA 5BYYA 3PVUA 3WBLA 1WBNA 3LCKA 2GS2A 5LVNA 4MXCA 4P4CA 4Q2AA 2XK7A 4LUEA 3M11A 4IJPA 2XNNA 4HOKA 3W16A 2QOBA 3FC2A 4JDIA 5LMBA 1JVPP 5CVHA 3F61A 3UG1A 2VN9A 3SV0A 2C0TA 3OXZA 3ZC5A 2W5AA 1XQZA 3GP0A 1Q61A 3LCDA 5AIRA 1E1VA 1WAKA 4AXAA 4ZAUA 4DHFA 5IEYA 1PF8A 4MXOA 3LQ3A 4OTQA 4NM5A 2YIQA 2OZOA 4R3PA 4H3PA 2J0IA 3R1QA 4M0YA 3WILA 4FEWA 3GC9A 4A9RA 5KMIA 1OL6A 5HICA 2WD1A 5EM7A 4L43A 2OWBA 2VO6A 4G6LA 4RFZA 5T3QA 2GMXA 3HLLA 4G9RA 5JFSA 2W1FA 4TZRA 2HOGA 2XBAA 4YLLA 5BUEA 4DFUA 3AT4A 3EN6A 3VBTA 5JRSA 1ZYSA 2ZV7A 2QD9A 2QHNA 2QLQA 4BIEA 3QTZA 4NYEA 3PIYA 1IAJA 1YWRA 2OIDA 5EM8A 5H8BA 3R7IA 4K77A 4DEIA 2BRMA 4DEEA 1CTPE 2UZLA 3I5NA 1YXUA 4FT0A 4H3BA 5CANA 1GJOA 5J79A 4JBVA 2B4SB 3V04A 2PZYA 3G6GA 3G6HA 4IX5A 2HYYA 4LRMA 4CCUA 3KMUA 5BVNA 3QQFA 3GCQA 3C0HA 3GGFA 3HMIA 2UVXA 2YIXA 1UVRA 2VTAA 5L6PA 2E9VA 2BRBA 2OJFE 4U3ZA 1OGUA 3V5QA 3FUPA 1VJYA 2RF9A 3KXXA 3MPTA 5ANEA 5HO6A 3UIUA 4C4GA 1YOMA 4G3FA 2AC3A 4IHPA 4RZWA 4ZS4A 1YXVA 1OKVA 2XM8A 1UU8A 2GPHA 4QMSA 1OL7A 5E90A 4A9UA 2X8IA 4M67A 4ANSA 2C6MA 2C3IB 3UMXA 3ZH8A 4CFVA 4EC8A 5FRIA 3D15A 4IC7A 3C4WA 4G3CA 2BAJA 4JNWA 3C13A 1HCKA 5HE2A 2WTIA 5CY3A 4E4LA 4B99A 4Q5HA 3RWPA 3GOKA 5E1EA 3O51A 3MPMA 4H1MA 2VD5A 2BIKB 3GU5A 2W05A 3IG7A 1WBVA 3JR1A 4I3ZA 3I1AA 4BCPA 2H9VA 4QNYA 3TZMA 4L52A 5AM7A 4AZVA 2W5BA 4NFMA 4XV1A 4YNEA 4M15A 2VWBA 5I0BA 4UMTA 3QZFA 4FTUA 2J0LA 4F7LA 3TUBA 4G6NA 4H36A 4JG8A 1Q3DA 3R28A 4QMNA 2BVAA 2BTRA 3AC8A 4MQ2A 4CMOA 4I5CA 1CKPA 1BLXA 1M7NA 2HZIA 4DGLC 4F70A 1U46A 3A7FA 3DAKA 4O1OA 4FODA 4E4MA 3QTUA 1GIJA 3KXZA 4QOXA 3EYGA 4FMQA 1WBPA 4ACDA 2R3KA 4EUUA 2VNWA 4TYHA 4RX8A 1Q99A 4I20A 3PXFA 2PE0A 5KE0A 4FKRA 3HECA 3I79A 1JQHA 3KGAA 2QOIA 3IQ7A 2XK3A 2JDTA 5C4LA 4DGMA 4HYHA 4ENYA 1S9JA 1Q8TA 3NSZA 4IB5A 4RFMA 3UIBA 4BTFA 4CQGA 3E8DA 1NA7A 1JSUA 2W4JA 2QNJA 4JVGA 4RJ5A 4IWPA 2CPKE 5DPVA 5CEIA 2R3PA 5FD2A 4B6LA 3ZSIA 4UZDA 2WIHA 4FE2A 4NH1A 2YZLA 2Z7SA 4H39A 4KA3A 1OPLA 2GQGA 5AUZA 5ANGA 4FV9A 3QQJA 2EXCX 2UW7A 3ZTXA 5HLNA 2JKMA 3NYXA 4LOPA 3QL8A 3COIA 3PPZA 2BAKA 4ZSAA 3FMEA 4FEQA 3ETAA 3ZO3A 4FKQA 3VVHA 5L2SA 4E8AA 1QPEA 3GU6A 4FG7A 1U4DA 2IVUA 1STCE 5EDQA 3CE3A 4KSQA 3ATTA 4F7SA 3DU8A 4DAWA 4O2PA 3QTSA 3R04A 4KIKA 3R02A 4O7WA 4BGHA 4LQMA 5LVLA 3R9DA 4FGRA 1Y6BA 2R7IA 4MYGA 4AA0A 4BCQA 3F2AA 5B2KA 4FTKA 2BALA 3IECA 4AACA 4BDHA 1V0OA 4Y5HA 1OUKA 4OTHA 4FTRA 2RG5A 5AV2A 4HYIA 4CZUA 4TWOA 3BLHA 3FQEA 3DV3A 3BKBA 4ZJVA 1OPKA 1XWSA 3S00A 4V0GB 4KIPA 4MD8E 4APCA 5FWKK 4D28A 1YQJA 5DEYA 2W9ZB 2ZOQA 3HUCA 1REKA 3OCSA 3WYXA 3MVJA 2YABA 3POZA 4QQJA 3P7BA 5CF8A 2NNWB 4IWDA 3C5IA 2YLFA 4DFLA 2XH5A 4FSMA 4DEHA 5ETFA 3FLZA 4ACCA 4CCBA 4BCNA 4XV9A 4LG4A 2GNJA 2R3JA 3WE4A 4BWXA 3ZLYA 4DN5A 3QGWA 1PXKA 4JQ8A 2IVSA 3CQWA 2R5TA 3GCSA 3UVQA 2XKEA 5LVOA 1LPUA 3TT0A 4KINA 3N4VA 3QZIA 2E9PA 3PVBA 2OIQA 3OXIA 3F3UA 4YBKA 5EG3A 4YGAA 2YIWA 2JKKA 4FL1A 2O2UA 3O71A 4XG7A 4MNEB 2XNBA 5IMXA 2V22A 5DGZA 5BVOA 4I4FA 2IJMA 2XK6A 3GU8A 4MWIA 4GKIA 3BEGA 3W1FA 5IQEA 4EK8A 2PMNX 3EN7A 4FOCA 2W1IA 3DKGA 3RAHA 3RALA 5AAGA 3NS9A 3P0MA 1YVJA 3MH2A 4G34A 5BVEA 4PL5A 3VUGA 4EQMA 2EB2A 2J6MA 3EQIA 2DQ7X 3OF0A 4XBUA 5L8LA 5FDPA 4NCTC 4QMOA 4CD0A 5JGBA 5AADA 1XH7A 3BEAA 4AZSA 1YXSA 3GC8A 1M2PA 5LOHA 5KHXA 3CS9A 4I5MA 4FTNA 4I41A 3VUIA 1OECA 3COKA 1F3MC 3OBJA 4EHZA 1YWVA 3OOMA 3ZLSA 4FKOA 4GT4A 3ZFMA 1S9IA 2YIYA 4DH5A 3UC3A 2XF0A 3COHA 1WBOA 4GKHA 4NIFA 1Y8GA 2C6LA 2PVMA 4BR3A 2XYNA 5GZ9A 1P5EA 3GBZA 4FIIA 4IWQA 1J1BA 3W8QA 4UYNA 4NM0A 4J97A 4GJ3A 3TKIA 4U44A 3IW5A 3HL7A 2VUWA 1Y8YA 5DN3A 1CMKE 4QP7A 2XVDA 4QYYA 5D12A 5AR2A 4HW7A 5BQ0A 3RI1A 3QAME 2P2HA 1PXNA 3W18A 1UNLA 5ANOA 5D10A 3HVCA 4K9YA 1PXLA 1YHSA 4UMUA 3UZPA 3ZBFA 4IAKA 3KN5A 4CNHA 4ZSLA 4ZZNA 4WNOA 1PXMA 4P5QA 3O23A 2YDIA 1YRPA 2BR1A 3R1NA 2Y0AA 4FL2A 4XH6A 4M7IA 3Q4UA 3QRIA 4BZDA 3IOPA 5HG9A 4P90A 3GNIB 4FKPA 3H10A 2ERKA 4RC4A 3TXOA 1H4LA 3PZEA 4D9UA 1W8CA 4FTLA 3BYSA 3QRJA 4TWNA 3MA3A 4L3PA 4F9BA 3F6XA 4FZ6A 4EOPA 4HZSA 2V0DA 3PE2A 3LFNA 4FYNA 1M2QA 3FWQA 4FKWA 4XYFA 3VRZA 3ZXZA 4E4NA 1W98A 3WF7A 3D7TA 2ZVAA 3MIYA 2CMWA 4GH2A 4WIHA 4ANLA 4C57A 2XCKA 3C4XA 3RKBA 3TZ7A 2P33A 2VO0A 3BU5A 5CNNA 1H1WA 5DOSA 3C4EA 4U0IA 2JITA 4FT7A 4EBWA 4TYEA 4RWKA 5FGKA 3ID6C 3O8PA 4BFMA 3ANQA 3CEKA 4PPBA 5DIAA 3GENA 3OW3A 4S2ZA 5HTBA 5FBNC 1JSVA 5FXRA 4RC2A 4TYJA 5KKRC 2WMRA 4D4SA 4I0TA 5CX9A 4D2RA 4AE6A 4O0SA 5HD7A 3RP9A 1BUHA 4GUEA 5IA5A 4IAYA 3D5XA 3MWUA 4D2WA 2GTMA 3FLQA 4DA5A 3W2CA 1XBAA 2C6TA 4RIWA 4FV6A 4WUAA 2XKFA 3I6UA 3OS3A 4FSYA 4AP7A 1FBNA 5EQYA 2W9FB 2R3RA 3Q32A 4YLJA 4A9TA 4AFJA 3N4TA 4EWQA 4W4YA 4BCJA 4L00A 2WMWA 1Q24A 4HYSA 4RSSA 4CT2A 4BIDA 2CN8A 3NYVA 4AZWA 1IG1A 4C3FA 2JD5A 4GIIA 3GEQA 1H8FA 1CKIA 1XH4A 3LQ5A 4GV1A 5DNRA 5KMMA 4AQCA 3PE1A 3DS6A 2R64A 2XM9A 3FLYA 4L45A 4C36A 4EZ5A 2OSCA 2C6EA 3GU4A 4RC3A 5CQUA 5LMKA 2VGOA 3LCSA 3QYWA 5HU9A 2X2KA 3CCNA 2ZV8A 3GUBA 1Q8ZA 3VBVA 2GNHA 4IVBA 3ZC6A 1WCCA 2CKPA 3NUXA 5FTOA 1VYZA 3N4UA 3SD0A 4ZLYA 5D1JA 1U5QA 2J4ZA 5KMLA 4AG8A 4EJ7A 1ZLTA 4HPUE 2C6DA 2JFMA 5BPYA 2O0UA 4JS8A 5A4LA 1H07A 2VGPA 3CPBA 2ERZE 3KY2A 3PDTA 5IQCA 5EI6A 4F0IA 3U9CA 4IBMA 4DCAA 3BHYA 3O7LB 5EHLA 3VBYA 3NRMA 4IZAA 4FOBA 4DEAA 2XK9A 4JAJA 5IKWA 1X8BA 5J5TA 1RDQE 2W1HA 3C0GA 3M1SA 2PUIA 4QPAA 2XS0A 4JQ7A 3A7JA 4ACMA 3RZBA 2BUJA 4CG8A 3G0FA 1ZOEA 4E6QA 2BRHA 4XOYA 2XNGA 3BYUA 3HDMA 2ZMDA 3JVSA 2REIA 3EB0A 4K2RA 3I7CA 3QA8A 5D7VA 4ASXA 4YPSA 5HHWA 1O9UA 3FI3A 2HELA 2OO8X 5JH6A 5B2MA 2YAAA 1ZAOA 2PE2A 1ZMVA 1FVVA 4O96A 3R9RA 4EEVA 1PKDA 2XNEA 3G9LX 4BCHA 4X3FA 3DJ6A 3FMHA 4GK2A 1G8SA 4IAFA 2GNGA 3QQHA 1PW2A 4EONA 5GJDA 5CEKA 4Q5EA 1OB3A 1ND4A 3AGLA 5IPJA 2ACXA 2F2UA 4GT5A 4ITIA 4X7QA 5AP4A 5HX8A 3UIMA 5M06A 4HVGA 2C30A 4XRLA 4YO6A 3Q5ZA 3LFFA 2WKMA 4PTEA 4RQVA 4QP9A 5ETIA 5LARA 5IQFA 3QQUA 4CZYB 5J1VA 4AZFA 3VUMA 2XP2A 2CGWA 3FMJA 4L46A 3ZSGA 5DMZA 2CNUA 4FTOA 3QU0A 5GNKA 3TKHA 5FXQA 3CXWA 3ZO2A 2WTKC 2CNQA 3A7GA 4TXCA 4FT5A 3RBWA 4EOQA 4CRSA 4EH8A 4IEBA 3HUBA 3N51A 2HWOA 4QTCA 4USDA 4OR5A 3HV7A 4YJUA 3E63A 1AQ1A 2WTCA 3PJ8A 4LFIA 4O38A 3HZTA 3VW6A 3W10A 4AW1A 5EM5A 3KCFA 2Q83A 2R3FA 4GSBA 2J51A 3FMKA 3QCSA 2HZNA 4GK4A 3R2BA 5JMSA 4RT7A 3GFWA 3QKKA 4I24A 4ZTSA 3R21A 5HNBA 2RGPA 2QOQA 4QTDA 5A46A 4KS8A 2NRYA 3Q60A 2PSQA 3FI2A 4M13A 5F4NA 5FEDA 1GAGA 1Q41A 3LE6A 4FI1A 1ZZLA 3MJ2A 4KKEA 4XV3A 5TOZA 3VHEA 4CG9A 2GCDA 3VBWA 5AEPA 2P55A 1TQMA 4KRDA 4WRGA 2J9MA 2F4JA 2XIYA 4FC0A 4MXXA 4ZTHA 4D5KA 5L2WA 3CKXA 1G3NA 4I4EA 1H1RA 3ZFXA 4BCKA 3LAUA 4RQKA 2WZJA 1WVWA 4DGGA 4QTAA 4JJRA 2E9UA 4LM5A 2C1AA 2CGUA 3GC0A 5JZNA 4AU8A 5AP7A 5M55A 4IADA 4OTWA 4WBOA 2X8EA 2V55A 3PXRA 4FG8A 5AR7A 4DYMA 2P4IA 4I0SA 2PVKA 2VTOA 3D2KA 4YNOA 4EWHA 5AV1A 3GT8A 3VO3A 3V3VA 3LVPA 3VS0A 2WMQA 2BZJA 1O6YA 3FI4A 2FSOX 4YC6A 3F2NA 3IGGA 4GEOA 4BN1A 5LXMA 2VTQA 3R9NA 2W1EA 3HDNA 2XMYA 3FHIA 3FXWA 2VX0A 3Q53A 1Y57A 2WQMA 3L8VA 4QMLA 4YO4A 4D2PA 4O1PA 5CU2A 3AQVA 5HOAA 1H00A 1OVEA 4PMTA 4LGDA 4RFYA 4NTTA 3UO6A 4O7LA 4DGNA 4FT9A 4E5WA 3B2TA 4NJDA 4JRNA 4JXFA 5FTGA 1IA8A 4TNDA 5B0XA 4M69B 4A7CA 3FMNA 4EOJA 4UB7A 1FGKA 2YACA 5HIBA 2R3NA 5DR2A 2BKZA 2J5FA 3LZBA 4U5JA 3HAMA 3PA5A 4I22A 3GB2A 4FNZA 4FSQA 2WOTA 3UMWA 2LGCA 2XJ2A 3EQRA 3T8OA 2HY0A 2X4FA 4OTPA 4RVKA 4U6RA 4EH4A 5DYJA 4FT3A 1LUFA 3DT1A 3PJ3A 5AR3A 2G2FA 4O0UA 5KZIA 3NYNA 2HENA 3LMGA 4UYAA 5IISA 4JLCA 5HGIA 2C69A 4B0GA 2WTVA 4AA4A 4A9YA 1GIHA 3MB7A 4PV0A 3U6JA 5BVDA 4R1VA 2ITYA 4O7TA 2RL5A 2SRCA 2WPAA 4O7YA 3HV5A 1YI4A 5JRQA 3V8TA 2X9EA 2OJJA 3QA0A 2UZTA 3FC1X 3F66A 4C33A 2WTKB 1H28A 3VIDA 1W83A 4PP9A 4RJ3A 3L8SA 2QOOA 5BMMA 4AGCA 4KABA 4RX7A 3VJNA 5AAEA 4CGAA 3LFEA 4HNFA 2Z2WA 5HE3A 1YI3A 5FUTA 3SOCA 3PJCA 5CAOA 4QMPA 4IC8A 1GZ8A 3ZZWA 2F7XE 2BMCA 4FVQA 4TYIA 4F09A 4YJPA 4GFOA 2QONA 4QP1A 5HX6A 2GNIA 5E8XA 3E93A 3KK9A 3RAWA 1PJKA 3RGFA 5K0KA 3A2CA 5EH0A 3SHEA 5IH6A 4G1WA 4QT1A 3NUYA 3MJ1A 1TQIA 2EVAA 3UP2A 2ZAZA 5IDNA 1H24A 2ITWA 4YJNA 5HLPA 3ZEPA 3ORIA 1WZYA 2VRXA 4FV4A 4FG9A 3NUNA 5BMSA 5KMNA 4CFFA 1JSTA 2WB8A 5HU3A 1LP4A 3KB7A 3OWJA 4O0WA 4BCIA 4QP2A 2JFLA 3R30A 1T46A 4FKVA 3QALE 3U4UA 5AP1A 1Q8WA 3H9OA 5HCZA 4O91A 2CGVA 2PUUA 3S4QA 5DFPA 4FSTA 5HBEA 1IASA 4ZLZA 5LVMA 1J7IA 2X7FA 1Z5MA 4NEUA 3EL7A 4JG7A 3LFDA 4ALWA 5G1XA 3TNIA 3AOXA 2C0IA 3CGOA 4JBOA 4F08A 4F1MA 4HVSA 2WMSA 3E8EA 4CFUA 4RPVA 4N4SA 2WEVA 1XH6A 4YTFA 3I81A 5M44A 3SW7A 4MTAA 3WF5A 3F9NA 4NTSA 3UPXA 1YXTA 4GU9A 4D2SA 4ALUA 3PY1A 3DK3A 4BL1A 4CZTA 3FKLA 4V04A 5E1SA 2VWYA 3OTUA 2JAMA 4TWCA 4E73A 3L8XA 2ITQA 4UMPA 1V0PA 3TIYA 3BHHA 2PPQA 2XNOA 3FZSA 1H1QA 4U97A 3WIKA 1QPJA 2GS6A 5DRBA 2IZUA 4PWNA 3R83A 4QMVA 4MCVA 4GL9A 4ZY4A 4I6HA 2EU9A 1H0VA 4EORA 5HZNA 4PTCA 4J71A 2XA4A 1UWHA 3NCGA 4OTDA 4QMUA 2X8DA 4NUSA 4F7NA 3TN8A 3QCQA 1PY5A 2Y9QA 2J50A 2J5EA 2UZDA 4B8MA 4EBVA 5C27A 4FIFA 2B9HA 3OROA 4EOLA 4FA2A 2YM8A 4CV9A 1PYXA 2FSTX 2A2AA 2QU6A 2XB7A 1J3HA 3O50A 4ZJJA 2CKOA 3V5TA 3KL8A 4C3PA 4P7EA 2YN8A 3D0EA 1Q4LA 4ZLOA 3AC5A 1OIUA 5IUGA 4H58A 2QQ7A 2I0HA 1ATPE 5IMEA 4NKAA 2WQNA 3H3CA 3KXMA 4E5BA 5JFVA 3E7VA 3NVMB 5GIPE 3FZRA 3KMWA 5E7RA 3QX4A 3NZ0A 2BDFA 2WIPA 2ZDUA 2GHGA 3FMDA 5BUIA 2ITTA 3I0OA 3Q6WA 3V51A 4G31A 3L9LA 4QMZA 2G9XA 2WMTA 4PRJA 3SW4A 3NYOA 1WVXA 1MQBA 1ZMWA 1KOBA 1Z9XA 2B7AA 4LUDA 3UQGA 5M57A 2KTYA 2XNMA 4DEGA 3S0OA 3TWJA 4W4VA 2YCSA 3IO7A 3PP1A 4BTKA 2OF2A 1GIIA 1XBBA 4RGJA 3VAPA 3KULB 3VBQA 4FNWA 2QKRA 4ITJA 5K4JA 4J7BA 4QPMA 3RTPA 4FTMA 5L2IA 4ONAA 1ZYCA 3BE9A 1H25A 4JR3A 3NW7A 2ETMA 3MIAA 4FV7A 4AA5A 4O84A 4DE4A 5C4KA 5I5ZA 3HMPA 3PSCA 4QMYA 1NVRA 1WFCA 3PG1A 5L8JA 4R78A 3UQCA 3RCJA 4J98A 2HW6A 2YFXA 2GTNA 3KEXA 4RIXA 4DG3E 5HVKA 4O22A 3FZPA 4EK6A 4J52A 4L68A 4PMSA 3TM0A 3FZ1A 4A06A 4W8EA 3IPHA 2CSNA 3ZUUA 4BI0A 2CJMA 4LOOA 4FV1A 4AX8A 2IVVA 3PTGA 5BVKA 3SRVA 4QQCA 3NMUF 3MESA 4KKGA 4E6AA 3JS2A 2H34A 2R3HA 4XP3A 3PSBA 2HZ4A 3H9FA 2JLDA 2W1DA 3CJGA 3FLWA 3UC4A 1IR3A 1XKKA 2I0YA 1MUOA 3LCTA 5LJJA 4ZS0A 3FV8A 3GQLA 3VS3A 5FM2A 4IVAA 3SXRA 2JKQA 4XUFA 4BKJA 3SKCA 5IG1A 3OW4A 4O7NA 4F63A 4USFA 3WF9A 4GFMA 3E3PA 4WNKA 2XRWA 5AFVA 3PVWA 1KE9A 4WSQA 2Y7JA 3NUSA 1ZZ2A 1Q3WA 4N6YA 5EW8A 5M09A 4C8BA 4RIYA 3ZLWA 4MBIA 2XZSA 2BFXA 4FSUA 3ORMA 4FKSA 4JAIA 2PZRA 4PDPA 5C9CA 3RNIA 2OICA 3OY1A 4LI5A 3W2PA 4RMZA 4CFWA 3HAVA 2OZAA 3RM7A 3HMOA 3TZ8A 5FXSA 4W4XA 3G90X 4I5PA 3PLSA 4NU1A 3AC2A 3KXHA 2ZDTA 4BCOA 1QCFA 5IQHA 4LRKA 4G5JA 3NAYA 2XIXA 3OP5A 4BYIA 2ZMCA 2Y6MA 4XRJA 2Y8OA 3BLRA 3D83A 5AV0A 5J1WA 3R7UA 3W2SA 5AUUA 4JDHA 5A14A 5I9VA 5A6NA 5HG7A 3OUNB 2OFVA 2XJ1A 3F5UA 3TV6A 4Z16A 4ZY5A 5IA1A 1PYEA 4E93A 3NIEA 3NCZA 4O81A 5TE0A 3HYHA 3OCBA 3MFUA 4AOTA 4CMTA 2YM6A 3UE4A 5EHYA 4AW2A 5HE1A 4U79A 3MI9A 5AUVA 3ZBXA 4C02A 3AMAA 3QLGA 3TL8A 3BLQA 3UO5A 1YOJA 3R2YA 5ACKA 4XMOA 3QD0A 4ZY6A 4AZTA 1OMWA 1XO2B 4XNEA 5DT4A 4JX3A 5TT7A 3WZKA 2PVLA 3BE2A 2VWUA 4WSYA 2R2PA 3NEWA 4L44A 5E8TA 3SX9A 2XBJA 3ACJA 5J87A 4BI1A 1OIQA 4O7VA 3S1HA 1NVQA 1M2RA 1O6LA 2X6EA 3PIZA 2B1PA 5CNOA 5A9UA 1UU3A 2ITZA 3I5ZA 4FTJA 1U54B 3UOJA 4AT3A 3FE3A 4BDCA 4BCMA 5L4QA 3U6IA 2X39A 4DBXA 3VUHA 3Q9YA 3D9VA 3DAJA 5GJGA 2PU8A 4N70A 1DI9A 2R0UA 4AWIA 3BQRA 3DK7A 2FO0A 4BGQA 3ZXTA 5J9ZA 3JYAA 5HIEA 4HPTE 5DRDA 1OKZA 3UBDA 4C2VA 3BV2A 4IW0A 3RM6A 1HCLA 1WBTA 3EOCA 3AGMA 4BI2A 5HO8A 2YJSA 5CAVA 2PL0A 3QGYA 2FA2A 4FK3A 2XK4A 5EKNA 3OWLA 3RINA 1YOLA 2YITA 2ZM4A 3EN4A 3I6WA 3II5A 4JQEA 4YZNA 5I9ZA 2OW3A 4UEUA 4EK5A 2HCKA 5EW9A 4K33A 4NW6A 3G0EA 4YHJA 3CGFA 2JIIA 2QLUA 1XJDA 3BX5A 5J95A 5I9XA 4U81A 4WG4A 4BB4A 2Z8CA 3LFCA 1RQQA 4CXAA 3VQUA 3DXNA 3SXFA 4X2GA 3OOGA 4BKZA 3MH1A 3UOLA 3QC4A 5BUJA 5CXZA 4BDIA 2XK8A 2OU7A 5CF5A 3ZM4A 2XUUA 4FIJA 4YJQA 3EQFA 5HCXA 4BHNA 2ZV9A 4D0XA 3KA0A 3VN9A 4X21A 4EH3A 3IDCA 3PVGA 4O2ZA 5KO1A 1IA9A 2YCRA 2PE1A 4WO5A 4QQ5A 5F20A 2WMVA 3DXPA 4KBCA 1FPUA 3WYYA 3DAEA 2WELA 4R7IA 3OG7A 3QZHA 2PTKA 3RK9A 3ODYX 3MY1A 3HRCA 3DJ7A 2QOFA 3U9NA 1YHVA 4D2TA 3E3BX 5TKDA 2GS7A 5AA8A 5CZHA 5D9HA 4HVDA 3LW0A 4QQTA 5HE0A 4AN3A 1G8AA 4X2JA 4ASDA 3QBNA 3TDVA 3R7EA 2DYLA 5FTQA 1MRUA 3V6RA 4S33A 1UU9A 3UZTA 2YZAA 5AM6A 4BIBA 3P7AA 2JDOA 5M51A 2HWPA 3QX2A 4KS7A 4J96A 1KE5A 2XNPA 2VTMA 4R1YA 3OXTA 3C4FA 3WZEA 1YI6A 4PY1A 4GW8A 1G5SA 4IACA 2VWVA 3BU3A 1OUYA 4F1OA 4EOIA 4BTJA 2BAQA 3OTVA 3F5PA 4IJ9A 4O0RA 2YA9A 2BFYA 4IX4A 4G3DA 5ANKA 4D4VA 4FZAB 3RAKA 4L53A 2HXLA 2OJGA 4FUYA 3F88A 4YTIA 3UOKA 2F7EE 4IXPA 4F0GA 2PZIA 4YJOA 3IW6A 2WXVA 3NUPA 4EKLA 1PMNA 3FAAA 5M4FA 1FQ1B 2QHMA 4K0YA 4OTGA 4FSNA 2OBJA 3LXPA 1P4OA 3OUKA 3EZVA 3QTRA 5L6OA 3FXZA 4O0XA 5M07A 3Q2JA 4OUCA 4ZSJA 3SGCA 4EK3A 2VTJA 2I1MA 3C0IA 2XIKA 5IZFA 2CCIA 3BHUA 3BI6A 2BHEA 2CKQA 2VTNA 5H3QA 4FVRA 2JEDA 3MSSA 4I92A 2WQBA 4QP3A 3M2WA 5BYZA 3RPOA 3MV5A 3GC7A 2CN5A 1JKTA 2WU6A 5CF6A 3QQLA 2V5QA 3QCXA 2WU7A 4FEUA 4C62A 5BYLA 4BDAA 2VO3A 4C58A 3UNKA 5GIOE 2VAGA 4U80A 1YW2A 5CENA 5CEOA 4O27B 4X6RA 2WMBA 4GYIA 4X2FA 3OWPA 2CHLA 3EKKA 3Q4TA 3PSDA 3SOAA 3MBLA 5E8WA 1PXIA 4M8TA 3VWAA 3RWQA 2WOUA 1OL2A 4F9YA 3PA4A 3EQCA 2PWLA 4NT4A 4Y8DA 1QPCA 2A4LA 4XOZA 2R3QA 4PL3A 3ZZEA 3NUAA 5DT0A 5HI2A 4QMQA 4R5YA 2XKCA 3D5VA 4MXAA 3MFSA 3QKMA 4ZZOA 1IAHA 3RPYA 3IK3A 3WOWA 2HZ0A 2QO9A 5AV4A 3ERKA 2W7XA 2R7BA 3QQKA 4J1RA 5D41A 3FSKA 4FKLA 4G2FA 3FYKX 2W17A 5AMNA 3AC4A 4F6SA 3TDWA 1R39A 3E88A 3P7CA 3W2QA 5A4TA 2OIBA 2R9SA 4AOIA 4CEGA 5HORA 1OL5A 3K3JA 4CSVA 3R7GA 4G9CA 2CNVA 1H27A 2RFEA 1JBPE 3PWDA 2W4OA 3F3TA 3PXYA 4FR4A 4YJSA 2VV9A 4ZP5A 4F1TA 3F2RA 4XHKB 4ZTRA 4KAOA 3A7IA 2PHKA 3V8SA 4XLIA 4TW9A 5G6VA 2PVJA 3ORNA 1OBDA 2QG7A 5A4CA 1TVOA 3WARA 4YZBA 3H30A 4YR8A 4AE9A 1R0EA 5HO7A 2ZM3A 2VWIA 2E9OA 3E8NA 2WGJA 2IVTA 5T68A 3COMA 1JWHA 4EZ7A 3EJ1A 5K5NA 3L9PA 4JRVA 4O0VA 1CSNA 4M0ZA 3O2MA 4FEVA 4K1BA 2G15A 3A60A 3OZ6A 4I6FA 4C4JA 2FVDA 4NK9A 3B8RA 1OL1A 3RVGA 3GCUA 3NDMA 3A61A 3DTWA 2C6KA 2YERA 2ZM1A 4N0SA 4U7ZA 3HA8A 3FPMA 4L7FA 2XRUA 4EHVA 2XCHA 3FLNC 1E9HA 2WO6A 4USEA 2QO7A 2ONLC 1M7QA 4EI4A 1UKHA 3V5PA 5C1QB 4KUJA 4RJ4A 2DUVA 4M12A 4GMYA 4BBMA 5M4CA 1OIYA 5HNIX 3B8QA 3OHTA 5AA9A 1ZMUA 1PXPA 2AC5A 2R3LA 4CLIA 4U8ZA 4KKHA 3UQFA 3JY0A 3DQXA 5CQWA 5C8MA 4V0GA 3DBQA 3V8WA 3CR0A 2PMOX 4RWIA 4XEYA 4TYGA 2QKWB 5ANDA 5BVWA 3HRBA 3F82A 4J95A 4C35A 5EOLA 4I6BA 3R7YA 3T3UA 3POOA 1P14A 1FINA 3CTJA 5KX8A 4MQ1A 4D5HA 3ULIA 3TI1A 3D2IA 3L9NA 2PZPA 5DG5A 1ZOGA 3IKAA 2X2LA 4ASZA 3DDPA 3CTQA 3DKFA 1DI8A 1DAWA 2HXQA 2XEZA 3PRFA 4LL5A 3SG8A 2RG6A 3GCPA 1E1XA 3ORKA 3KRXA 3EFWA 3C5UA 1OI9A 5HEZA 2NPQA 4MAOA 1JLUE 3FQHA 2UZWE 5E4HA 4JBQA 4MNEA 4TPTA 3AT2A 3ACKA 4FGBA 2I7QA 1B39A 3ZONA 4DFNA 1GNGA 2EUFB 2YWPA 2VWZA 4ZMEA 4DTAA 1L8TA 2W5HA 1OKYA 4O82A 4I93A 3EKNA 2C5VA 3OY3A 2X7GA 4NM7A 4UV0A 5CU4A 4E3CA 2IN6A 4C4FA 3EQDA 5EI2A 1FOTA 4C59A 4EOSA 2FB8A 3FKOA 4FICA 4BF2A 4DC2A 1XBCA 4KIQA 5D7AA 3LFBA 1F5QA 2P0CA 4WD5A 1LEWA 1M17A 3QQGA 2EB3A 4IQ6A 2QCSA 4YBJA 5KKRB 4BKYA 3G9NA 3UZRA 3R9HA 4BBFA 3F69A 3ODZX 4D9TA 5IQAA 4R7BA 4I23A 4V05A 4NZWB 5AX3A 4EYJA 4ANMA 2IW8A 4YUQA 4DH1A 3VUTA 4D4RA 2RFNA 5A54A 2BZIB 3MDYA 1CM8A 3QCYA 3HV6A 3JPVA 3OVVA 3PYYA 5B7VA 3O0GA 3ORLA 3BIZA 4MD9E 4CVAA 3RMFA 2VTPA 4BDGA 1APME 3W32A 1PRYA 4WNMA 3F3ZA 3HA6A 4PL4A 3TV7A 4MD7E 4QO9A 2GU8A 3K5UA 2YEXA 2C6IA 3DK6A 4YLKA 2X9FA 5JSMA 4WBBB 1SNUA 2F7ZE 4YSJA 3LLAA 2ZB0A 4IZ5A 4UWYA 2LAVA 3BBWA 3FMMA 4U43A 5CYIA 4GJ2A 5E92A 4K18A 4NWMA 4FX3A 5M4IA 3E92A 4L3LA 2UZNA 2RFSA 2UZOA 1JKLA 4ZOGA 5J7HA 4DG0E 4JT3A 4PNKA 3FY2A 3HP2A 4MXZA 3VNTA 4BZOA 2IZSA 4DT9A 3QUPA 5KMOA 4JDJA 4Y83A 2PVYA 5EM6A 1SNXA 1UA2A 1BKXA 2FYSA 4TL0A 2O64A 5TF9A 1R0PA 4XG6A 3ZM9A 3Q4CA 4YZ9A 1Y91A 3DJ5A 3TJDA 1VZOA 5JFXA 3HP5A 3VC4A 4R77A 3T3VA 4KBKA 5DHJA 5FP5A 2R0IA 2VTLA 5CU0A 2W1CA 3MH0A 4R3RA 3QUEA 5M56A 3OT8A 4IM0A 4YURA 4FBXA 4Z55A 4XV2A 3ELJA 4LGGA 5HESA 2VTIA 3P79A 4I5HA 4IAIA 4BWKA 3FI8A 3P5KA 3Q9WA 3OFMA 2QR8A 3HEGA 4Q9SA 4RIOA 3VJOA 4F4PA 2WFYA 5IEVA 2OH4A 2F57A 5CVGA 1KWPA 3CY3A 3UG2A 3MTFA 2ITOA 5HG8A 1PMVA 3WE8A 4DBNA 4FSWA 5H8GA 4WRSA 3BYMA 4MNFA 4RWLA 3QTWA 3KCKA 4YJVA 2FSLX 2V62A 4E5AX 4BDEA 4ENXA 5F9EA 3AD4A 3MGYA 2PYWA 3NR9A 4TN6A 3ZRMA 3LHJA 3BHTA 4C7TA 1RE8A 5A3XA 1UV5A 4ANOA 2XEYA 3D94A 3PA3A 4RJ6A 4IFCA 3Q2MA 2A1AB 1R3CA 4L42A 2JDVA 4UX9A 4M66A 4RJ8A 2VTHA 3KN6A 5EKOA 5AWMA 3CTHA 4S34A 3ZEWA 4EH2A 3OT3A 3LLTA 3Q96A 1BL7A 3RPVA 4CQEA 2OXDA 3LOKA 2OK1A 3DB6A 3KU2A 4EL9A 2B52A 4II5A 4O21A 2EXEA 3C9WA 4ANNA 2BIYA 3LXKA 2QODA 2VWXA 5AUYA 4EOKA 2C5YA 5IH4A 4JDKA 5EQEA 4C37A 4MXYA 4DLIA 4JX7A 4KNBA 4L7SA 4UMQA 4BDFA 4EH7A 3V01A 5C03A 3DNEA 4FKJA 2UW5A 1BYGA 3R8MA 3DQWA 3I7BA 4BTMA 3UO4A 1WBSA 4I0RA 4PF4A 3KF7A 2CCHA 2QR7A 3T9TA 4Q9ZA 5CAQA 2P3GX 3S3IA 2C5XA 5IQIA 4Y46A 4IDTA 3UYTA 4DT8A 4AGWA 2C68A 2UVZA 4OT5A 5AAFA 4JOAA 3G5DA 4G3GA 4OW8A 3BYVA 3WIGA 5IQDA 1URWA 3NGAA 2H6DA 1M14A 2JBOA 2R3IA 5ETAA 5FM3A 2WMXA 1T45A 5IH5A 2PULA 3LJ0A 3G15A 4HJOA 4AS0A 3DNDA 4ZXTA 3MVLA 5IA4A 3LFQA 3VW8A 3W55A 3WF6A 4CTCA 5HD4A 4MX9A 4U3YA 3RCDA 2X4ZA 5ACBC 3MVMA 3BYOA 2NRUA 4D58A 1I09A 2YCQA 1J7LA 3LFAA 4DH7A 4TRLA 3R7OA 4ITHA 1NT2A 3Q4ZA 4FK6A 3TG1A 2GNLA 3FJQE 3OEZA 4TYHB 2YM3A 5AP2A 3VUDA 5DR9A 2JDSA 1JKSA 5L6WL 3OC1A 4ACGA 3O96A 3QRUA 4QRCA 5ANJA 1CDKA 5CSXA 4QNAA 1OITA 5I3OA 4WKQA 3QWJA 4QYHA 1NVSA 5LVPA 3MY0A 2QI8A 1PXJA 2UW6A 1J7UA 5L8KA 3BELA 5H8EA 2RSVA 2R3GA 4MF0A 1LEZA 4E6CA 2QU5A 1QL6A 3TJCA 5FEEA 4CLJA 5CU3A 5HBHA 4EQCA 3U6HA 4A9SA 1VEBA 3RJCA 2IZRA 4NSTA 4PQNA 4FTTA 2VU3A 4WNPA 2OXXA 4XX9A 4DEDA 5I9WA 5DEWA 1YHWA 4LMUA 5E8YA 3VS4A 3GXLA 4DTKA 4E4XA 4MEDA 3IDBA 2V7OA 3E87A 4FTCA 4LYNA 3PG3A 4HGEA 4QPSA 4CYJA 1EH4A 2A19B 3HGKA 4KIOA 5EQPA 5J7BA 3ZUTA 4KB8A 3R8LA 3BU6A 2X1NA 2WNTA 3FZOA 4GG7A 4GUBA 4KIKB 4TT7A 5EI8A 3T9IA 3WF8A 3PP0A 2FSMX 3V6SA 2O65A 3JVRA 2GHMA 2E2BA 2VTTA 2VWWA 4H1JA 2OKRA 3EHAA 4PTGA 3EYHA 5CEPA 3V5JA 5KNJA 2PK9A 3P1AA 5LCJA 2DWBA 4S30A 2QOHA 4IWOA 1Q62A 4X6QC 4GS6A 3UNJA 2WMAA 3ZDUA 3BPRA 2JGZA 2Y6OA 3KVWA 4DH3A 2IW9A 1ZYJA 3VBXA 2F9GA 3GVUA 3VRYA 5KUPA 3G51A 3TIZA 2BCJA 4CKJA 3TUDA 3DA6A 4G16A 4OBPA 4RBLA 2UVYA 2Z7RA 3UVRA 1CKJA 1P4FA 2Y4IC 3I60A 4JIAA 3F3VA 5C26A 1B6CB 4XG4A 4HVHA 2VX3A 4M69A 3QZGA 4JIKA 4X2NA 4ZZMA 5LMAA 4AW0A 2OFUA 3DPKA 3L1SA 3EWHA 1JOWB 3OWKA 2UZBA 3DBDA 4LV8A 3TEIA 4E7WA 5LWMA 3R1YA 3DXQA 3FPQA 4L3JA 4GU6A 3E64A 1FVRA 3CP9A 3KVXA 1J91A 4YJTA 1VR2A 3KF4A 4C34A 2O5KA 2CKEA 3A7HA 5J9YA 4BYJA 4Z7GA 3EFKA 2VZ6A 3SQQA 5LMKC 4C3RA 3ZOSA 4UWCA 4LGHA 4ZTMA 4QYGA 1SVHA 1SMHA 4R5SA 2AUHA 3CSVA 4LOQA 3S2PA 2O3PA 3K54A 3ULZA 4UXLA 3RPSA 4C4EA 3QTXA 4YC8A 4GRBA 3NWWA 2UZVA 3GOPA 5J8IA 5JK3A 4RLKA 3PY0A 5HNGA 3AD5A 4HCTA 3MS9A 2F2CB 4E6DA 5JGDA 4FSZA 2BILB 2WAJA 3O8UA 4AZEA 3SG9A 4NIFB 4ZTNA 2I6LA 1J1CA 3FDNA 3QWKA 4Y85A 1OPJA 4OTFA 2VO7A 4TY1A 5EOBA 3NNUA 3UGCA 2W4KA 4LMNA 2JDRA 3QYZA 4CKRA 3ORZA 4EHGA 2I0EA 5T6KA 2W0JA 1YDRE 2FGIA 4EQUA 1ZOHA 4ZIMA 1MP8A 5EDRA 2YHVA 3ZO1A 4ACHA 4MWHA 4YC3A 4YMJA 3QTQA 4IIRA 1UWJA 3KXGA 3ANRA 3QD4A 4ZTQA 4PPCA 4HCUA 1UNGA 3VUKA 4BCGA 1A48A 4IB1A 4QP4A 3C7QA 3DOGA 1PKGA 3PXQA 4M68A 3R73A 1FMKA 5IUIA 4ORKA 2GHLA 4X3FC 5GZAA 2GFSA 3PJ2A 1H1SA 5CZIA 2VNYA 3W2RA 4AW5A 3EFJA 3W8LA 3BHVA 2YM5A 5DBXA 4QYEA 3R71A 4GYGA 4MBJA 2QOLA 1JPAA 4JR7A 2VX1A 3R01A 2HK5A 2ESMA 2Z7LA 4RVTA 5CU6A 1ZY4A 5J5SA 4ZK5A 3KRRA 3Q5IA 4JI9A 4KBAA 5CEMA 4PNIA 3CD8A 4EJNA 2BROA 3D7TB 1Q5KA 3KRJA 3Q3BA 2W96B 3UP7A 4S31A 5B2LA 2BZKB 2X81A 1PMEA 3A8XA 1DM2A 2RIOA 2UW8A 3F5XA 3A8WA 1ZRZA 5KBQA 3QHRA 5AUXA 1AD5A 2B55A 2YM7A 4UALA 5E91A 3CY2A 2VTSA 3B2WA 3ZFYA 2JC6A 2OJ9A 3L8PA 5DT3A 2V7AA 2PUPA 4OLIA 4O6EA 5GINE 3TV4A 3QUDA 4UY9A 4XJ0A 1SZMA 4FTIA 4BZNA 2B53A 1H1PA 4FVPA 5EHOA 3TUCA 2WMUA 4EC9A 4GFGA 1OM1A 4FYOA 4M84A 4PDYA 2Y4IB 4W9WA 1BMKA 2JKOA 4IFGA 4WG5A 3WZDA 3FSFA 3E7OA 4RIWB 3A4PA 4OAUC 2WTDA 5CXHA 3C51A 3VQHA 4OGRA 4ANQA 4XP0A 4I94A 2ITXA 2UUEA 5EFQA 2F49A 4ALVA 3K2LA 5FEQA 3D4QA 5BNJA 1SVEA 3A62A 3JXWA 2AYPA 5EDPA 4BWPA 4RX5A 3E5AA 4CV8A 4ERKA 3R9OA 4IH8A 3QD2B 2B9IA 4RWJA 5KHWA 4IM2A 3K5VA 3OBGA 3QC9A 4FNXA 4XG3A 3VS5A 3MY5A 2QG5A 1UU7A 3EQHA 4FKIA 5IU2A 3Q9XA 3PXZA 1RW8A 2WHBA 3NNWA 1ZY5A 3C4ZA 4FL3A 4FZ7A 5F94A 4DFBA 3DTCA 4ASEA 5I9YA 3U54A 4K11A 1JNKA 2IWIA 4YPDA 4PMPA 4WUNA 3ORTA 5ICPA 1QPDA 4DFYA 4FZDB 2NO3A 1W0XC 1V1KA 3QD3A 2OF4A 2UW9A 1URCA 5IA3A 3DFCB 4BC6A 3MB6A 2X0GA 1WBWA 3KULA 4HZRA 5EYMA 4F6WA 5IDPA 4DCEA 5M53A 3RNYA 3ITZA 1FVTA 2J0MB 3F7ZA 2BZHB 2C1BA 3KK8A 3PUPA 4M97A 4TKSA 4U40A 5CEQA 5A4QA 2OJIA 4GCJA 2I0VA 2GSFA 4GIHA 2IPXA 3R0TA 3QF9A 2XYUA 4MKCA 5CAUA 5CWZA 4IAAA 4D2VA 3TTIA 3MFRA 2YISA 1UNHA 4FZFB 2PY3A 1XR1A 2VTRA 4IMYA 4X3FB 3A99A 5CSWA 4L67A 4UMRA 5JQ5A 5DE2A 4F7JA 3FZTA 1H08A 5DWRA 1XH5A 2O63A 5HVJA 3DLSA 4ZMFA 5FQDC 4IVDA 4HGTA 2ZJWA 4IX3A 4HYUA 3EQBA 3D14A 4MVFA 4RA5A 4U41A 3PPJA 4XG9A 4O0TA 4EK4A 3FBVA 3DDQA 3AT3A 2PMLX 2WTWA 4FNYA 2J2IB 4QMMA 4ZEGA 5CSHA 4ID7A 2C4GA 3HKOA 3UODA 4BDBA 4Z9LA 4AGDA 5CASA 1W82A 2UW0A 5JGAA 4C0TA 3UOHA 3MVHA 3FKNA 5E9EA 4L9IA 3QKLA 4P5ZA 3SLSA 2GNFA 1BI8A 1A06A 3AMYA 4QP6A 1H26A 4AT5A 2W99B 1SM2A 1K3AA 2QC6A 4BDJA 1KE8A 1O6KA 4QTEA 5CSPA 1YKRA 4UBAA 3H9RA 5ITAA 3MA6A 2WEIA 3I0QA 4IZYA 4UWBA 4XP2A 4QMXA 4ERWA 4EH5A 4IVCA 3SC1A 2ETRA 2ITVA 4FF8A 4CRLA 5TR6A 1H0WA 5AX9A 4HVIA 1YXXA 3PZHA 3K3IA 3KMMA 5CI6A 4O7ZA 3A4OX 3CC6A 4B4LA 4OAVB 4S32A 5CF4A 5I4NA 2ITUA 2BTSA 2OGVA 4MBLA 2GQRA 4YZCA 2OI4X 2FH9A 3F7WA 4UXQA 5JT2A 4IAZA 3FMLA 1KV2A 3QXOA 4V01A 2PUNA 5CALA 1KV1A 2G2IA 4JL9A 3QLFA 3LCOA 4FKTA 3ATSA 4IZ7A 4G6OA 3U55A 2W06A 3V5LA 2UV2A 3R8ZA 2GFCA 4F99A 4D55A 4OBOA 5L3AA 5AUWA 5LCKA 5JEBA 4BDKA 3GQIA 5J9LA 3QHWA 4L01A 4XCUA 1XH8A 3CJFA 4FKUA 3GI3A 4D1ZA 4BRXA 3GCVA 5K3YA 3ZMMA 3E8CA 3NX8A 2C0OA 5CT0A 2CLQA 4YHFA 1F0QA 3OD6X 5AR5A 4NJ3A 1LR4A 2BDJA 4M3QA 1GZOA 1U59A 2C3LA 2ITNA 4H3QA 4HGLA 4NKSA 2PVHA 3EMGA 4QTBA 4GK3A 1WMKA 3P23A 4O83A 1ZARA 5AV3A 1OBGA 4DF3A 3FQSA 5H9BA 1JAMA 4C2WA 5E8ZA 2HIWA 4U42A 3PRIA 3DBFA 1U54A 3NW6A 2Q0NA 3KXNA 3O8TA 5DLSA 3IS5A 2B0QA 2QOKA 2HAKA 4DITA 1SVGA 2G1TA 2QO2A 3OMVA 2IZTA 3RAIA 3DKOA 5EK7A
chains in the Genus database with same CATH superfamily
1SYKA 4FV0A 4IB0A 3CD3A 5CSVA 1NW1A 3IW7A 4I6LA 4L6QA 1Q8YA 2WTJA 3QRKA 4QYFA 3ZDIA 2R3MA 3DZQA 1OKWA 1REJA 1FGIA 5I9UA 3TKUA 4CFNA 2I40A 2HW7A 5IA2A 4MUQA 5FLFA 2BHHA 5JZJA 3EQGA 1XHAA 3UIXA 4C38A 1ZYLA 3MW1A 4YZDA 4A07A 2J0KA 3ZU7A 3BWJA 4NL0A 4YJRA 3H0ZA 4D0WA 3LFSA 4RRVA 2J0JA 4TNBA 5CI7A 3U4WA 4B7TA 3KQ7A 4E26A 2C47A 2Z7QA 5KCVA 1A9UA 3LIJA 4O86A 2QVSE 5IUHA 3KC3A 4FV8A 4IX6A 3REPA 3VS2A 5AR8A 3EIDA 2X6DA 2OLCA 4WHZA 5F1ZA 4BCFA 3ZS5A 1QMZA 2CGXA 1K9AA 5DI1A 3MH3A 1MQ4A 4X0MA 1U5RA 4R3CA 1R1WA 4N57A 4F9AA 3D7ZA 1NY3A 3P86A 4AF3A 4CFMA 4YP8A 5KZ0A 5HVYA 2YAKA 3P5JC 3ZLXA 4FV5A 5DH3A 4EYMA 4AQKA 4A4OA 5CLPA 5ANIA 5JKGA 5M08A 3LJ2A 3DLZA 4I1ZA 4N6ZA 3DBEA 4Z7HA 2PZ5A 3PJ1A 1UKIA 1DAYA 2BRNA 4XLVA 3VF8A 3R63A 5DA3A 4R7HA 5EW3A 4CMUA 1PXOA 4DFZE 2FUMA 4IM3A 4OTRA 3AG9A 2YIRA 3R8UA 4GT3A 4BBEA 2XARA 2IEWA 2XIRA 3IONA 3UNZA 1KUTA 1GZNA 3EN9A 5CAPA 1FMOE 3VHKA 4C4HA 5IF1A 2J7TA 5HBJA 5LWNA 3O5AA 4RX9A 2QOCA 3CPCA 4PMMA 4YU2A 3PFQA 4LV5A 5CTPA 2PVNA 4FEXA 4A4XA 3MYGA 4W4WA 1Q97A 3SVVA 3LQ8A 3QRTA 4FV2A 4RJ7A 4ARKA 3U87A 4I21A 4DEBA 2E9NA 1RJBA 3R7VA 1YWNA 2J90A 3TCPA 4FSRA 3TNHA 5HQ0A 3MFTA 3ZRLA 3ZRKA 3QTIA 3ZHPC 4J8MA 3BRBA 3IOKA 2C5OA 4BHZA 1PMUA 1B38A 3CLYA 4AN9A 3VF9A 3LJ1A 4HCVA 5E8UA 3ZSHA 2DS1A 3F3WA 3FHRA 5F95A 4B8LA 3CIKA 4WOVA 3AMBA 3O7LD 2Z02A 4DGOA 4CT1A 1BL6A 3IW4A 1MRVA 5HCYA 3HMMA 4ZTLA 3HV4A 3RK5A 5CVFA 3UPZA 3JUHA 2PMIA 2UW4A 4LRJA 2G01A 4AAAA 1BI7A 2ZB1A 3IDPA 2OG8A 2B9JA 2Y4PA 5HIDA 1TFFA 5FDXA 3ROCA 4BDDA 3SAYA 3DGKA 3NAXA 5A6OA 3G2FA 4DINA 1XH9A 2OH0E 2YCFA 3D5WA 4BY9E 3P78A 4E1ZA 3NVKI 3IGOA 3ZYAA 4F9CA 1ERKA 5AP3A 4WA9A 5ETCA 4G5PA 3BGPA 5I3RA 3HV3A 4LL0A 3ALNA 4ZSEA 3R8VA 1GY3A 4I6QA 1Q8UA 3OCGA 4U45A 4Y73A 5KBRA 3FXXA 3ALOA 2A27A 4R6VA 5CS6A 3PWYA 1L3RE 4RVMA 5FP6A 3NUUA 3NPCA 3BGZA 3EFLA 1DS5A 3TNWA 3NW5A 4O4CA 2XKDA 3NNXA 4PX6A 1GZKA 3O17A 3RHKA 2PVFA 5GJFA 4L8MA 3U51A 4B9DA 3WI6A 4DFXE 5GZ8A 1IRKA 2XIZA 3KRLA 4YZMA 1AGWA 4QMWA 3TACA 3SDJA 1Y6AA 3W0RA 1NXKA 3LPBA 4PDSA 4OT6A 4PDOA 3RHXA 4OTIA 2X7OA 5HTIA 1WVYA 3HX4A 4AUAA 2B9FA 2OXYA 4AFEA 2Z60A 2ZV2A 3EN5A 5DR6A 3ENMA 4O0YA 5C8KA 4QD6A 5IQGA 3ORXA 2P2IA 4P2KA 1MRYA 4DG2E 2IO6A 5HTCA 2YJRA 4PUZA 2C3JA 3LXNA 5K0XA 5FBOA 3TNPC 4EH6A 3DZOA 3BGQA 3LM5A 2YDKA 3VS6A 5AJQA 2RKUA 5H2UA 3MN3A 4EH9A 4X3JA 1KE6A 1M52A 4PPAA 4ANBA 3TZ9A 2XJ0A 4FIEA 3DCVA 3BBTB 4NM3A 4X2KA 3S95A 5JQ8A 2WQOA 3AC3A 3GFEA 3ET7A 5KMKA 3Q6UA 2R3OA 3NLBA 4RIXB 5EYCA 2UW3A 3E62A 4JBPA 3UVPA 4CTBA 1W7HA 3SXSA 3N9XA 1KOAA 1YDSE 2UZEA 3P9JA 3ENHA 4BICA 4RG0A 3AC1A 2C5NA 3JY9A 4FTAA 4IANA 4TTHB 3DB8A 3R8PA 4EZ3A 3LM0A 4R8QA 3FLSA 4IDVA 3LKMA 5TO8A 2H96A 2QURA 2W1ZA 3IW8A 4G17A 4NCTA 1TQPA 4KRCA 3SRVB 4EHEA 1P2AA 4IE9A 4NW5A 3UTOA 3PY3A 2YM4A 3BZ3A 4J99A 4ZSGA 5AP5A 3H0YA 3G33A 1OIRA 3H4JA 2ZFYA 3VULA 2IG7A 4MF1A 3EQPA 3W33A 3ZUVA 5A4EA 3UYSA 4EUTA 4E20A 3QXPA 3GU7A 2BRGA 4J8NA 3CKWA 3OEFX 2PVRA 4K6ZA 4YTCA 5IEXA 4CFXA 2ITPA 5EYKA 4BVUA 1K2PA 4DLJA 3ZO4A 3LMIA 4GVJA 3SA0A 4APPA 2CLXA 1IEPA 3KREA 4WT6A 1KE7A 4YSMA 5IQBA 4G3EA 4W8DA 5KMJA 4RIYB 4F64A 3M42A 5BX0A 1ZWSA 4BGGA 1OZ1A 5JN2A 2EWAA 5C8NA 3QFVA 4XS2A 4DH8A 2ETKA 2G2HA 2C3KA 1I44A 3Q04A 2YLEA 4MHAA 3WZUA 2YDJA 3R1SA 2OZAB 3L9MA 4C4IA 4AGUA 3VS1A 4EOOA 1ZXEA 3C1XA 3U8WA 3BQCA 4W9XA 2X2MA 4F0FA 3PLAE 3RK7A 5M4UA 4RA4A 3CQUA 5HLWA 3MTLA 2JBPA 4FUXA 5AIKA 3FL5A 3LXLA 2EXMA 3OCTA 4QP8A 3R6XA 4MK0A 4OBQA 4U9AA 5FG8A 1TKIA 2HY81 2WQEA 4Y5QA 4AOJA 5LQFA 1GOLA 3EZRA 3NIZA 4HGSA 5D11A 4F65A 3D5UA 4Z3VA 4K8AA 3HMNA 1HOWA 3F5GA 5AP0A 4XG2A 3WZJA 4M14A 3P4KA 4NFNA 4PP7A 5L2TA 2BPMA 3EL8A 3CBLA 3Q9ZA 5EYDA 4O7SA 3ORPA 3TNQB 3CQEA 3RPRA 4D4YA 3KFAA 3AD6A 4KD1A 4TWPA 2W1GA 3MPAA 2R4BA 3LMHA 4KWPA 2IW6A 3DFAA 4WG3A 2Q0BA 5CT7A 1KSWA 3HNGA 3PIXA 5E8VA 5IA0A 2KULA 2YWVA 3C50A 1JKKA 3AXWA 4XBRA 4EKKA 1H01A 1Z57A 3PPKA 4CKIA 4F9WA 1V0BA 2O8YA 1PHKA 4CYIA 4FIHA 3R22A 4FV3A 4RZVA 4EOMA 4Y95A 3ROYA 5AP6A 3NNVA 3UJGA 3RZFA 1ZYDA 5HG5A 3DKCA 4HNIA 2NP8A 3FY0A 4UZHA 4XG8A 5C01A 2UZUE 3DY7A 5GHVA 3UDBA 2B54A 4O6LA 4AT4A 4Y72A 4GVAA 3NFFB 2JIVA 3FYJX 4FTQA 4RLLA 5L2QA 5K4IA 3V5WA 4KSPA 4MH7A 3ZCLA 3BCEA 4UN0C 1BX6A 4IB3A 5K5XA 2GDOA 1W84A 2BDWA 2XAOA 4J53A 4DTBA 3THBA 4H05A 4RVLA 4QMTA 2C6OA 2CDZA 3FEGA 2ZYBA 3KKVA 4D1XA 1G8JA 2GQSA 4O7RA 3Q52A 4YTHA 5JFWA 5E8SA 4C61A 3BWFA 2H8HA 3DBCA 3C4CA 4GG5A 3P08A 3TTJA 2JIUA 5K9IA 3W2OA 2A0CX 4A4LA 3R00A 5DVRA 5BVFA 2X0PA 3PXKA 4FKGA 3I4BA 2RFDA 1YDTE 2JAVA 3KRWA 4ZJIA 3VS7A 4D1SA 4F6UA 3BV3A 5AUTA 4AN2A 5AR4A 3EH9A 3HRFA 2ONLA 4YHTA 3FL4A 2BKKA 1R78A 1VYWA 4JG6A 4FIGA 5HKMA 5BYYA 3PVUA 3WBLA 1WBNA 3LCKA 2GS2A 5LVNA 4MXCA 4P4CA 4Q2AA 2XK7A 4LUEA 3M11A 4IJPA 2XNNA 4AXFA 4HOKA 3W16A 2QOBA 3FC2A 4JDIA 5LMBA 1JVPP 5CVHA 3F61A 3UG1A 2VN9A 3SV0A 2C0TA 3OXZA 3ZC5A 2W5AA 1XQZA 3GP0A 1Q61A 3LCDA 5AIRA 1E1VA 1WAKA 4AXAA 4ZAUA 4DHFA 5IEYA 1PF8A 4MXOA 3LQ3A 3PFYA 4OTQA 4NM5A 2YIQA 2OZOA 4R3PA 4H3PA 2J0IA 3R1QA 4M0YA 3WILA 4FEWA 3GC9A 4A9RA 5KMIA 1OL6A 5HICA 2WD1A 5EM7A 4L43A 2OWBA 2VO6A 4G6LA 4RFZA 5T3QA 2GMXA 3HLLA 4G9RA 5JFSA 2W1FA 4TZRA 2HOGA 2XBAA 4YLLA 5BUEA 4DFUA 3AT4A 3EN6A 3VBTA 5JRSA 1ZYSA 2ZV7A 2QD9A 2QHNA 2QLQA 4BIEA 3QTZA 4NYEA 3PIYA 1IAJA 1YWRA 2OIDA 5EM8A 5H8BA 3R7IA 4K77A 4DEIA 2BRMA 4DEEA 1CTPE 2UZLA 3I5NA 1YXUA 4FT0A 4H3BA 5CANA 1GJOA 5J79A 4JBVA 2B4SB 3V04A 2PZYA 3G6GA 3G6HA 4IX5A 2HYYA 4LRMA 4CCUA 3KMUA 5BVNA 3QQFA 3GCQA 3C0HA 3GGFA 3HMIA 2UVXA 2YIXA 1UVRA 2VTAA 5L6PA 2E9VA 2BRBA 2OJFE 4U3ZA 1OGUA 3V5QA 3FUPA 1VJYA 2RF9A 3KXXA 3MPTA 5ANEA 5HO6A 3UIUA 4C4GA 1YOMA 4G3FA 2AC3A 4IHPA 4RZWA 4BJJA 4ZS4A 1YXVA 1OKVA 2XM8A 1UU8A 2GPHA 4QMSA 1OL7A 5E90A 4A9UA 2X8IA 4M67A 4ANSA 2C6MA 2C3IB 3UMXA 3ZH8A 4CFVA 4EC8A 5FRIA 3D15A 4IC7A 3C4WA 4G3CA 2BAJA 4JNWA 3C13A 1HCKA 5HE2A 2WTIA 5CY3A 4E4LA 4B99A 4Q5HA 3RWPA 3GOKA 5E1EA 3O51A 3MPMA 4H1MA 2VD5A 2BIKB 3GU5A 2W05A 3IG7A 1WBVA 3JR1A 4I3ZA 3I1AA 4BCPA 2H9VA 4QNYA 3TZMA 4L52A 5AM7A 4AZVA 2W5BA 4NFMA 4XV1A 4YNEA 4M15A 2VWBA 5I0BA 4UMTA 3QZFA 4FTUA 2J0LA 4F7LA 3TUBA 4G6NA 4H36A 1W2DA 4JG8A 1Q3DA 3R28A 4QMNA 2BVAA 2BTRA 3AC8A 4MQ2A 3AKKA 4CMOA 4I5CA 1CKPA 1BLXA 1M7NA 2HZIA 4DGLC 4F70A 1U46A 3A7FA 3DAKA 4O1OA 4FODA 4E4MA 3QTUA 1GIJA 3KXZA 4QOXA 4AXCA 3EYGA 4FMQA 1WBPA 4ACDA 2R3KA 4EUUA 2VNWA 4TYHA 4RX8A 1Q99A 4I20A 3PXFA 2PE0A 5KE0A 4FKRA 3HECA 3I79A 1JQHA 3KGAA 2QOIA 3IQ7A 2XK3A 2JDTA 5C4LA 4AXDA 4DGMA 4HYHA 4ENYA 1S9JA 1Q8TA 3NSZA 4IB5A 4RFMA 3UIBA 4BTFA 4CQGA 3BL9A 3E8DA 1NA7A 1JSUA 2W4JA 2QNJA 4JVGA 4RJ5A 4DDGA 4IWPA 2CPKE 4O4DA 5DPVA 5CEIA 2R3PA 5FD2A 4B6LA 3ZSIA 4UZDA 2WIHA 4FE2A 4NH1A 2YZLA 2Z7SA 4H39A 4KA3A 1OPLA 2GQGA 5AUZA 5ANGA 4FV9A 3QQJA 2EXCX 2UW7A 3ZTXA 5HLNA 2JKMA 3NYXA 4LOPA 3QL8A 3COIA 3PPZA 2BAKA 4ZSAA 3FMEA 4FEQA 3ETAA 3ZO3A 4FKQA 3VVHA 5L2SA 4E8AA 1QPEA 3GU6A 4FG7A 1U4DA 2IVUA 1STCE 5EDQA 3CE3A 4KSQA 3ATTA 4F7SA 3DU8A 4DAWA 4O2PA 3QTSA 3R04A 4KIKA 3R02A 4O7WA 4BGHA 4LQMA 5LVLA 3R9DA 4FGRA 1Y6BA 2R7IA 4MYGA 4AA0A 4BCQA 3F2AA 5B2KA 4FTKA 2BALA 3IECA 4AACA 4BDHA 1V0OA 4Y5HA 1OUKA 4OTHA 4FTRA 2RG5A 5AV2A 4DHIB 4HYIA 4CZUA 4TWOA 3BLHA 3FQEA 3DV3A 3BKBA 4ZJVA 1OPKA 1XWSA 3S00A 4V0GB 4KIPA 4MD8E 4APCA 5FWKK 4D28A 1YQJA 5DEYA 2W9ZB 2ZOQA 3HUCA 1REKA 3OCSA 3WYXA 3MVJA 2YABA 3POZA 4QQJA 3P7BA 5CF8A 2NNWB 4IWDA 3C5IA 2YLFA 4DFLA 2XH5A 4FSMA 4DEHA 5ETFA 3FLZA 4ACCA 4CCBA 4BCNA 4XV9A 4LG4A 2GNJA 2R3JA 3WE4A 4BWXA 3ZLYA 4DN5A 3QGWA 1PXKA 4JQ8A 2IVSA 3CQWA 2R5TA 3GCSA 3UVQA 2XKEA 5LVOA 1LPUA 3TT0A 4KINA 3N4VA 3QZIA 2E9PA 3PVBA 2OIQA 3OXIA 3F3UA 4YBKA 5EG3A 4YGAA 2YIWA 2JKKA 4FL1A 2O2UA 3O71A 4XG7A 4MNEB 2XNBA 5IMXA 2V22A 5DGZA 5BVOA 4I4FA 2IJMA 2XK6A 3GU8A 4MWIA 4GKIA 3BEGA 3W1FA 5IQEA 4EK8A 2PMNX 3EN7A 4FOCA 2W1IA 3DKGA 3RAHA 3RALA 5AAGA 3NS9A 3P0MA 1YVJA 3MH2A 4G34A 5BVEA 4PL5A 3VUGA 4EQMA 2EB2A 2J6MA 3EQIA 2DQ7X 3OF0A 4XBUA 5L8LA 5FDPA 4NCTC 4QMOA 4CD0A 5JGBA 5AADA 1XH7A 3BEAA 4AZSA 1YXSA 3GC8A 1M2PA 5LOHA 5KHXA 3CS9A 4I5MA 4FTNA 4I41A 3VUIA 1OECA 3COKA 1F3MC 3OBJA 4EHZA 1YWVA 3OOMA 3ZLSA 4FKOA 4GT4A 3ZFMA 1S9IA 2YIYA 4DH5A 3UC3A 2XF0A 4LV7A 3COHA 1WBOA 4GKHA 4NIFA 1Y8GA 2C6LA 2PVMA 4BR3A 2XYNA 5GZ9A 1P5EA 3GBZA 4FIIA 4IWQA 1J1BA 3W8QA 4UYNA 4NM0A 4J97A 4GJ3A 3TKIA 4U44A 3IW5A 3HL7A 2VUWA 1Y8YA 5DN3A 1CMKE 4QP7A 2XVDA 4QYYA 5D12A 5AR2A 4HW7A 5BQ0A 3RI1A 3QAME 2P2HA 1PXNA 3W18A 1UNLA 5ANOA 5D10A 3HVCA 4K9YA 1PXLA 1YHSA 4UMUA 3UZPA 3ZBFA 4IAKA 3KN5A 4CNHA 4ZSLA 4ZZNA 4WNOA 1PXMA 4P5QA 3O23A 2YDIA 1YRPA 2BR1A 3R1NA 2Y0AA 4FL2A 4XH6A 4M7IA 3Q4UA 3QRIA 4BZDA 3IOPA 5HG9A 4P90A 3GNIB 4FKPA 3H10A 2ERKA 4RC4A 3TXOA 1H4LA 3PZEA 4D9UA 1W8CA 4FTLA 3BYSA 3QRJA 4TWNA 3MA3A 4L3PA 4F9BA 3F6XA 4FZ6A 4EOPA 4HZSA 2V0DA 4FJVA 3PE2A 3LFNA 4FYNA 1M2QA 3FWQA 4FKWA 4XYFA 3VRZA 3ZXZA 4E4NA 1W98A 3WF7A 3D7TA 2ZVAA 3MIYA 2CMWA 4GH2A 4WIHA 4DDIA 4ANLA 4C57A 3PUFC 2XCKA 3C4XA 3RKBA 3TZ7A 2P33A 2VO0A 3BU5A 5CNNA 1H1WA 5DOSA 3C4EA 4U0IA 2JITA 4FT7A 4EBWA 4TYEA 4RWKA 5FGKA 3ID6C 3O8PA 4BFMA 3ANQA 3CEKA 4PPBA 5DIAA 3GENA 3OW3A 4S2ZA 5HTBA 5FBNC 1JSVA 5FXRA 4RC2A 4TYJA 5KKRC 2WMRA 4D4SA 4I0TA 5CX9A 4D2RA 4AE6A 4O0SA 5HD7A 3RP9A 1BUHA 4GUEA 5IA5A 4IAYA 3D5XA 3MWUA 4D2WA 2GTMA 3FLQA 4DA5A 3W2CA 1XBAA 2C6TA 4RIWA 4FV6A 4WUAA 2XKFA 3I6UA 3OS3A 4FSYA 4AP7A 1FBNA 5EQYA 2W9FB 2R3RA 3Q32A 4YLJA 4A9TA 4AFJA 3N4TA 4EWQA 4W4YA 4BCJA 4L00A 2WMWA 1Q24A 4HYSA 4RSSA 4CT2A 4BIDA 2CN8A 3NYVA 4AZWA 1IG1A 4C3FA 2JD5A 4GIIA 3GEQA 1H8FA 1CKIA 1XH4A 3LQ5A 4GV1A 5DNRA 5KMMA 4AQCA 3PE1A 3DS6A 2R64A 2XM9A 3FLYA 4L45A 4C36A 4EZ5A 2OSCA 2C6EA 3GU4A 4RC3A 5CQUA 5LMKA 2VGOA 3LCSA 3QYWA 5HU9A 2XALA 2X2KA 3CCNA 2ZV8A 3GUBA 1G8KA 1Q8ZA 3VBVA 2GNHA 4IVBA 3ZC6A 1WCCA 2CKPA 3NUXA 5FTOA 1VYZA 3N4UA 3SD0A 4ZLYA 5D1JA 1U5QA 2J4ZA 5KMLA 4AG8A 4EJ7A 1ZLTA 4HPUE 2C6DA 2JFMA 5BPYA 2O0UA 4JS8A 5A4LA 1H07A 2VGPA 3CPBA 2ERZE 3KY2A 3PDTA 5IQCA 5EI6A 4F0IA 3U9CA 4IBMA 4DCAA 3BHYA 3O7LB 5EHLA 3VBYA 3NRMA 4IZAA 4FOBA 4DEAA 2XK9A 4JAJA 5IKWA 1X8BA 5J5TA 1RDQE 2W1HA 3C0GA 3M1SA 2PUIA 4QPAA 2XS0A 4JQ7A 3A7JA 4ACMA 3RZBA 2BUJA 4CG8A 3G0FA 1ZOEA 4E6QA 2BRHA 4XOYA 2XNGA 3BYUA 3HDMA 2ZMDA 3JVSA 2REIA 3EB0A 4K2RA 3I7CA 3QA8A 5D7VA 4ASXA 4YPSA 5HHWA 1O9UA 3FI3A 2HELA 2OO8X 5JH6A 5B2MA 2YAAA 1ZAOA 2PE2A 1ZMVA 1FVVA 4O96A 3R9RA 4EEVA 1PKDA 2XNEA 3G9LX 4BCHA 4X3FA 3DJ6A 3FMHA 4GK2A 1G8SA 4IAFA 2GNGA 3QQHA 1PW2A 4EONA 5GJDA 5CEKA 4Q5EA 1OB3A 1ND4A 3AGLA 5IPJA 2ACXA 2F2UA 4GT5A 4ITIA 4X7QA 5AP4A 5HX8A 3UIMA 5M06A 4HVGA 2C30A 4XRLA 4YO6A 3Q5ZA 3LFFA 2WKMA 4PTEA 4RQVA 4QP9A 5ETIA 5LARA 5IQFA 3QQUA 4CZYB 5J1VA 4AZFA 3VUMA 2XP2A 2CGWA 3FMJA 4L46A 3ZSGA 5DMZA 2CNUA 4FTOA 3QU0A 5GNKA 3TKHA 5FXQA 4QDVA 3CXWA 3ZO2A 2WTKC 2CNQA 3A7GA 4TXCA 4FT5A 3RBWA 4EOQA 4CRSA 4EH8A 4IEBA 3HUBA 3N51A 2HWOA 4QTCA 4USDA 4OR5A 3HV7A 4YJUA 3E63A 1AQ1A 2WTCA 3PJ8A 4LFIA 4O38A 3HZTA 3VW6A 3W10A 4AW1A 5EM5A 3KCFA 2Q83A 2R3FA 4GSBA 2J51A 3FMKA 3QCSA 2HZNA 4GK4A 3R2BA 5JMSA 4RT7A 3GFWA 3QKKA 4I24A 4ZTSA 3R21A 5HNBA 2RGPA 2QOQA 4QTDA 5A46A 4KS8A 2NRYA 3Q60A 2PSQA 3FI2A 4M13A 5F4NA 5FEDA 1GAGA 1Q41A 3LE6A 4FI1A 1ZZLA 3MJ2A 4KKEA 4XV3A 5TOZA 3VHEA 4CG9A 2GCDA 3VBWA 5AEPA 2P55A 1TQMA 4KRDA 4WRGA 2J9MA 2F4JA 2XIYA 4FC0A 4MXXA 4ZTHA 4D5KA 5L2WA 3CKXA 1G3NA 4I4EA 1H1RA 3ZFXA 4BCKA 3LAUA 4RQKA 2WZJA 1WVWA 4DGGA 4QTAA 4JJRA 2E9UA 4LM5A 2C1AA 2CGUA 3GC0A 5JZNA 4AU8A 5AP7A 5M55A 4IADA 4OTWA 4WBOA 2X8EA 2V55A 3PXRA 4FG8A 5AR7A 4DYMA 2P4IA 4I0SA 2PVKA 2VTOA 3D2KA 4YNOA 4EWHA 5AV1A 3GT8A 3VO3A 3V3VA 3LVPA 3VS0A 2WMQA 2BZJA 1O6YA 3FI4A 2FSOX 4YC6A 3F2NA 3IGGA 4GEOA 4BN1A 5LXMA 2VTQA 3R9NA 2W1EA 3HDNA 2XMYA 3FHIA 3FXWA 2VX0A 3Q53A 1Y57A 2WQMA 3L8VA 4QMLA 4YO4A 4D2PA 4O1PA 5CU2A 3AQVA 2IF8A 5HOAA 1H00A 1OVEA 4PMTA 4LGDA 4RFYA 4NTTA 3UO6A 4O7LA 4DGNA 4FT9A 4E5WA 1VLRA 3B2TA 4NJDA 4JRNA 4JXFA 5FTGA 1IA8A 4TNDA 5B0XA 4M69B 4A7CA 3FMNA 4EOJA 4UB7A 1FGKA 2YACA 5HIBA 2R3NA 5DR2A 2BKZA 2J5FA 3LZBA 4U5JA 3HAMA 3PA5A 4I22A 3GB2A 4FNZA 4FSQA 2WOTA 3UMWA 2LGCA 2XJ2A 3EQRA 3T8OA 2X0QA 2HY0A 2X4FA 4OTPA 4RVKA 4U6RA 4EH4A 5DYJA 4FT3A 1LUFA 3DT1A 3PJ3A 5AR3A 2G2FA 4O0UA 5KZIA 3NYNA 2HENA 3LMGA 4UYAA 5IISA 4JLCA 5HGIA 2C69A 4B0GA 2WTVA 4AA4A 4A9YA 1GIHA 3MB7A 4PV0A 3U6JA 5BVDA 4R1VA 2ITYA 4O7TA 2RL5A 2SRCA 2WPAA 4O7YA 3HV5A 1YI4A 5JRQA 3KIOC 3V8TA 2X9EA 2OJJA 3QA0A 3BLAA 2UZTA 3FC1X 3F66A 4C33A 2WTKB 1H28A 3VIDA 1W83A 4PP9A 4RJ3A 3L8SA 2QOOA 5BMMA 4AGCA 4KABA 4RX7A 3VJNA 5AAEA 4CGAA 3LFEA 4HNFA 2Z2WA 5HE3A 1YI3A 5FUTA 3SOCA 3PJCA 5CAOA 4QMPA 4IC8A 1GZ8A 3ZZWA 2F7XE 2BMCA 4FVQA 4TYIA 4F09A 4YJPA 4GFOA 2QONA 4QP1A 5HX6A 2GNIA 5E8XA 3E93A 3KK9A 3RAWA 1PJKA 3RGFA 5K0KA 3A2CA 5EH0A 3SHEA 5IH6A 4G1WA 4QT1A 3NUYA 3MJ1A 1TQIA 2EVAA 3UP2A 2ZAZA 5IDNA 1H24A 2ITWA 4YJNA 2X0OA 5HLPA 3ZEPA 3ORIA 1WZYA 2VRXA 4FV4A 4FG9A 3NUNA 5BMSA 5KMNA 4CFFA 1JSTA 2WB8A 5HU3A 1LP4A 3KB7A 3OWJA 4O0WA 4BCIA 4QP2A 2JFLA 3R30A 1T46A 4FKVA 3QALE 3U4UA 5AP1A 1Q8WA 3H9OA 3W0NA 5HCZA 4O91A 3W0OA 2CGVA 2PUUA 3S4QA 5DFPA 4FSTA 5HBEA 1IASA 4ZLZA 5LVMA 1J7IA 2X7FA 1Z5MA 4NEUA 3EL7A 4JG7A 3LFDA 4ALWA 5G1XA 3TNIA 3AOXA 2C0IA 3CGOA 4JBOA 4F08A 4F1MA 4HVSA 2WMSA 3E8EA 4CFUA 4RPVA 4N4SA 2WEVA 1XH6A 4YTFA 3I81A 5M44A 3SW7A 4MTAA 3WF5A 3F9NA 4NTSA 3UPXA 1YXTA 4GU9A 4D2SA 4ALUA 3PY1A 3DK3A 4BL1A 4CZTA 3FKLA 4V04A 5E1SA 2VWYA 3OTUA 2JAMA 4TWCA 4E73A 3L8XA 2ITQA 4UMPA 1V0PA 3TIYA 3BHHA 2PPQA 2XNOA 3FZSA 1H1QA 4U97A 3WIKA 1QPJA 2GS6A 5DRBA 2IZUA 4PWNA 3R83A 4QMVA 4MCVA 4GL9A 4ZY4A 4I6HA 2EU9A 1H0VA 4EORA 5HZNA 4PTCA 4J71A 2XA4A 1UWHA 3NCGA 4OTDA 4QMUA 2X8DA 4NUSA 4F7NA 3TN8A 3QCQA 1PY5A 2Y9QA 2J50A 2J5EA 2UZDA 4B8MA 4EBVA 5C27A 4FIFA 2B9HA 3OROA 4EOLA 4FA2A 2YM8A 4CV9A 1PYXA 2FSTX 2A2AA 2QU6A 2XB7A 1J3HA 3O50A 4ZJJA 2CKOA 3V5TA 3KL8A 4C3PA 4P7EA 2YN8A