3ZRMA

Identification of 2-(4-pyridyl)thienopyridinones as gsk-3beta inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
344
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Identification of 2-(4-Pyridyl)Thienopyridinones as Gsk-3Beta Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 103
structure length 344
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zrmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zrmA01
5E8TA 3VULA 1EH4A 3CGOA 3KRRA 3DCVA 3NYNA 4OW8A 4P4CA 2OZAA 4FNXA 5E8ZA 1ZXEA 1GAGA 3TZ7A 3HEGA 5HBHA 3SG8A 2PMNX 5FBOA 3MJ2A 4GFMA 5IA5A 4RWJA 4TT7A 4EORA 3EKKA 4O0UA 5DWRA 4FT3A 4OT5A 3QZIA 4ASXA 3ORIA 4RQKA 3JY9A 5M06A 2JKKA 3VS2A 4PP9A 5IUIA 5K0XA 4P7EA 4GK3A 2C5OA 4DBXA 3PWYA 4BZOA 3A8XA 1JOWB 4BDEA 2ETKA 5JT2A 2V55A 2O0UA 3MH0A 2HZ4A 3OG7A 3R8ZA 4AOJA 2O63A 3V5JA 3R1QA 4QMQA 3NUYA 5HLPA 5HO8A 3VHEA 3V51A 4UMPA 2DS1A 2R64A 4C2WA 4I3ZA 4W4XA 2GNIA 2GHMA 2P3GX 1OKVA 4MK0A 4FL2A 2XNPA 4X6RA 3TG1A 3ZMMA 2RF9A 1OMWA 4FNZA 4KIQA 2OBJA 3F5XA 4G31A 4QD6A 3LMIA 1SM2A 2Z7SA 5AR2A 3BGPA 3GB2A 3RPOA 3FKLA 5FTQA 3ZEPA 3SHEA 4AGUA 3ZRKA 5I3RA 4X2FA 2R3JA 1JAMA 2AC3A 4EI4A 3R04A 4AW1A 1FQ1B 3RAHA 2J6MA 4IM2A 3ORNA 4LYNA 4NJDA 5AA9A 2X7OA 1XH8A 1GIIA 2NNWB 2FSLX 3OCGA 3BRBA 4MF1A 3VUIA 3F69A 4F63A 3UVPA 5HEZA 3KULB 5I5ZA 1H4LA 4BDHA 1JNKA 4Q9ZA 1P4FA 2QOCA 3NW7A 3RNIA 5A46A 3MSSA 4AN3A 3KRJA 2ZB0A 4FTRA 1ZMWA 4M68A 1GNGA 1Q8ZA 5M4UA 2PMLX 3MW1A 1A06A 4DTAA 3ZXZA 1TKIA 2BTRA 4I92A 5J8IA 1SYKA 3UODA 1W83A 2EXCX 3O2MA 3LVPA 4CFUA 3TJDA 1M17A 4O22A 5HO7A 1PMVA 3ZZEA 4K33A 4RBLA 2OIDA 3GQLA 3RM7A 1NVRA 1PMUA 5IQGA 3E93A 2VNWA 4JT3A 5ANEA 3R8PA 3VRZA 3WILA 2PE0A 3ORXA 1BX6A 4BI0A 5A4TA 3D7TB 3VS3A 1WCCA 3UZRA 5AEPA 2VO3A 5C9CA 3F7ZA 3R7YA 1GZ8A 4YP8A 3ZOSA 4NCTC 4U80A 2ZJWA 3HZTA 5L2QA 3LM5A 5EM6A 4DG2E 3W2CA 3R8VA 4FTAA 4E6CA 3EQHA 3O7LD 2JKMA 1LEWA 2XIRA 3I7BA 4BCIA 4DGNA 1OGUA 4M0ZA 1YHWA 3RI1A 1LR4A 4WSYA 5CALA 3I0OA 5C01A 3ACKA 1OB3A 4K8AA 1OIUA 5HLNA 2VTMA 3O71A 3QUEA 3G5DA 3L9NA 2R3MA 4HCUA 2UZVA 5AWMA 2CGWA 4FIGA 2C6OA 3DB6A 5JGAA 4N6YA 2UZOA 4EK6A 2OW3A 3ZDIA 2HY0A 3W55A 4EYMA 2QOIA 3NEWA 1WMKA 4O0YA 4D0WA 5IA4A 4BYIA 5J9YA 3UVQA 4BCMA 2Y4IC 3KY2A 4I5MA 5K0KA 4D55A 4GUBA 4M84A 5BMMA 4DHFA 3OZ6A 2ZV8A 5EKOA 5HNIX 2CPKE 5DBXA 3HV4A 2YM6A 1V0OA 4DTBA 4PDYA 5F95A 4G9RA 3OCTA 2JAVA 2GS7A 3R02A 1XJDA 4FTNA 4HZSA 3DV3A 3JVRA 5L6OA 3FI3A 2OK1A 2R0IA 4M66A 4RJ3A 4TYHA 3H0ZA 2HXLA 2ITVA 3CIKA 2CCIA 3FMMA 4H58A 1WBSA 4JL9A 4UMQA 3QTRA 4L8MA 4BIDA 4EH6A 5DH3A 2VTOA 3MGYA 4XOZA 3QUDA 4BCGA 3LIJA 1IRKA 4RRVA 4W4YA 3NYVA 3CJFA 3ZO4A 3HECA 3KCKA 3LOKA 4FIHA 5DR9A 4PPCA 3SX9A 2A4LA 3AG9A 2W5HA 2YIYA 3D7ZA 4JAJA 3AOXA 4GYGA 2XJ2A 3OOGA 3QQUA 3UYTA 4FZ7A 5DLSA 5E8XA 3AQVA 1Z57A 5CZHA 2E9OA 3H9RA 2VWWA 1ND4A 3NYOA 4WNKA 3UMXA 3DJ7A 2F7EE 3EFWA 3HMMA 4RX5A 3IKAA 3LJ0A 5H8GA 4ZJVA 5K5NA 3GCVA 4NU1A 4ZTNA 3ET7A 2JDSA 2OJ9A 2OU7A 4FT0A 1TQPA 2XH5A 4GMYA 3QYZA 4L52A 4LI5A 4YJPA 4DH3A 3MI9A 1Y8GA 4HVSA 4BZNA 2XF0A 2R3GA 2YM7A 5L8LA 2UZLA 3POOA 4QNYA 5HHWA 4O0XA 1PYEA 1ZY4A 2GNJA 3MTFA 2HYYA 3A4OX 3EQIA 2C5NA 4MVFA 4Z9LA 3BYOA 4QTAA 3RP9A 2EUFB 2X8IA 2OO8X 3EQPA 4YTCA 4XG4A 4QMNA 1ZY5A 3R83A 3OXIA 1O6LA 5DYJA 4O0VA 4OTHA 3VS0A 2WAJA 4CRSA 3DXPA 3QRIA 4TWOA 4C34A 4IEBA 4IM3A 5DT4A 2BDFA 5C8KA 5IF1A 3KVXA 4D1ZA 3CQEA 1XR1A 2QOLA 2VU3A 4M7IA 3RTPA 5KX8A 5IA1A 2F2UA 3QQLA 1G8SA 3U6IA 3PXZA 4RQVA 4TY1A 4ANQA 4ZJJA 2YAAA 3PA5A 3QBNA 3K5VA 1PXPA 3IPHA 4XP2A 2C3LA 2C30A 4DFXE 4H3PA 1PXOA 1VYZA 2I40A 3QL8A 5F1ZA 2PL0A 3ZUVA 5A9UA 3E64A 3QCYA 3F2RA 3O0GA 5EHYA 1HCLA 4Y46A 2FVDA 3UBDA 4UMTA 4CKJA 1XH7A 3CSVA 1M7NA 3ANRA 3OEFX 4MNFA 2HOGA 1VZOA 2JD5A 4F99A 5AA8A 4X7QA 4AW0A 5ANDA 3ZFYA 2BZHB 2WKMA 3EN4A 1KOAA 3PVWA 3F3UA 2ZM1A 3G6HA 4IVAA 4DFUA 3Q53A 4QP7A 3ZM4A 5A4QA 5KNJA 3CGFA 3CJGA 3FE3A 4IW0A 2O65A 1U59A 2OGVA 2ZDTA 4PDSA 5M51A 3BV2A 3JS2A 2IVVA 3PTGA 4KS8A 3QTUA 4Q5HA 3RPVA 2IW6A 4AGWA 3LM0A 3PSCA 4WHZA 4EZ5A 5J9LA 5FBNC 4PTEA 5EK7A 5D10A 4EONA 2WMUA 3BPRA 2YIXA 2I1MA 1KE9A 4BDBA 2WMWA 4ZTQA 4W8EA 1Q61A 4XYFA 2WPAA 4MXXA 4D2VA 3GC0A 5A4EA 2IZRA 4GW8A 4U5JA 3K54A 3DJ5A 4H1MA 2DQ7X 3DS6A 4M97A 1FBNA 1Y8YA 1K3AA 3U55A 2OG8A 4RJ7A 1WBNA 2YM5A 3E3PA 3AGLA 3FI2A 4DCAA 3B8RA 3F3TA 3MWUA 4UYNA 4O7RA 5HD7A 2YLFA 4GSBA 4U44A 5TR6A 3BE2A 4BCNA 4F0IA 4X6QC 1OIQA 5KHXA 1ZZ2A 5FXSA 2PVNA 4M13A 4B99A 3OS3A 4FMQA 3HRFA 4CNHA 3A7GA 1H0WA 2HWOA 3BWFA 4YGAA 3VAPA 5EYMA 2FH9A 1JKTA 4KIKB 3Q2JA 1FOTA 4LUEA 5CI6A 3GQIA 4JNWA 3QTZA 1XO2B 2RFNA 4QPMA 4V01A 5CQWA 4CKIA 4DEIA 5HX8A 5IA0A 1BUHA 5KBRA 5E7RA 2BVAA 3DBFA 3O17A 4FA2A 1GZNA 2ZMCA 4RT7A 4Y95A 5LVOA 2XIXA 2QOHA 4L67A 2GQRA 3T3VA 3PPKA 2YISA 3NIZA 3N4VA 4ITJA 3COMA 3ZFMA 1H07A 2OIBA 1OZ1A 5AUYA 2VNYA 3POZA 3SQQA 3UPZA 3DA6A 1KE8A 3E7VA 2UW0A 3Q4UA 4ZZMA 4G5JA 4M12A 4MQ2A 5I9YA 2QKWB 4O2PA 3T9TA 4YC8A 3OXTA 4YO4A 3QD3A 1SZMA 4X2GA 3CD8A 5DI1A 1Q24A 1Y91A 5CASA 4W8DA 3M2WA 4P90A 3TV6A 4KKEA 1J3HA 2QG7A 3IS5A 4R7HA 3BKBA 3ORKA 4H3BA 2XP2A 1UNLA 3DBCA 4RA4A 4BDKA 2BAQA 5IH6A 1OPKA 4I21A 4AE6A 1M2QA 5BVEA 4J71A 5IEXA 4Q2AA 3TN8A 5AR3A 5BVDA 4F1OA 2XNBA 3A7FA 4BCPA 3D14A 4MBJA 2XRWA 3BHTA 3R2YA 1FVVA 3LXNA 4AU8A 3IONA 3FMEA 4RJ5A 2JC6A 2XK8A 3PVUA 4QTCA 1XBCA 4I41A 3LFQA 2B53A 3I6UA 4NM7A 5AP5A 4BCHA 2QOBA 4DLJA 4GG5A 5GJGA 4FK3A 3KREA 3BHHA 4Y72A 3AC2A 3TIYA 3C5UA 4O0TA 4E4NA 1Q3WA 2C3IB 2NRYA 5EKNA 1H24A 5BYYA 5KHWA 4ARKA 3KXNA 5CANA 3LFAA 5HQ0A 3UZTA 2HZ0A 2PZ5A 3UOHA 4XLIA 3PDTA 1JWHA 2OFVA 4GL9A 1YKRA 4R3CA 5DR6A 2JDRA 3OD6X 4J1RA 3TKIA 4QYFA 3VBQA 3V6RA 3EQCA 4B6LA 4DH8A 2YZAA 2X39A 5ACKA 4EK5A 5FEQA 5HVYA 2ETRA 1U5RA 4J98A 4RIWA 4ANOA 3EQGA 2W4KA 4EZ3A 3G0FA 3AT2A 4AUAA 1JSVA 4U79A 3R7VA 4P5ZA 5F20A 5FDXA 5CXHA 5CAUA 4BCQA 4BR3A 2CKPA 4MH7A 3C4FA 4HGEA 1K2PA 4U8ZA 2B52A 4KSQA 4BB4A 2BZIB 2FYSA 4IZAA 3VQHA 3A4PA 4ZSAA 5L2SA 3MH3A 3R9DA 4LGGA 4KNBA 4KRCA 5D41A 3UDBA 4OAUC 3U8WA 2R3OA 3QKMA 2ITZA 3MA6A 2X4ZA 1KV2A 4S2ZA 4WSQA 4FZFB 2PUPA 3QALE 1VR2A 3FMDA 3FZSA 4FSWA 4BDCA 4RWKA 1Q3DA 1ZRZA 2X8EA 5HTCA 1J7IA 4FR4A 4WT6A 4XEYA 5AR5A 5B0XA 3HP2A 3L8PA 4MCVA 2I0HA 3OFMA 4FYOA 3SD0A 4O82A 5CENA 1PJKA 3W33A 3FZRA 4AT4A 2VTAA 4IVBA 1RDQE 2OJGA 3QRJA 4FSQA 2IVSA 3MS9A 3NW6A 2R3RA 4L01A 4ONAA 5EOBA 2WMTA 4AFEA 4DFYA 4FVRA 3RAIA 4IAZA 5EM5A 4BKZA 3NIEA 4RIYA 5FG8A 1OL5A 3R7IA 5BUJA 3JPVA 3G0EA 1QPDA 4BWPA 4CT2A 4BIBA 3UC4A 5CF6A 5IUHA 2GHGA 5G6VA 4IFCA 4O1PA 3L8XA 2E9NA 4KKGA 2YCRA 2KTYA 2NO3A 2W06A 2WQBA 3AD4A 3CC6A 3EIDA 4X3FA 3NAYA 4Z7HA 4FKOA 3N4TA 3G90X 5BNJA 4GJ3A 4QMMA 3U54A 4O0RA 2IVTA 1FINA 3MDYA 3N9XA 3BU6A 4GV1A 4HNFA 3Q04A 5ANKA 1MRUA 4BDAA 1Y6BA 5JZJA 2C0IA 5DVRA 4ACCA 2J7TA 3CCNA 3TZ9A 1YRPA 2WIHA 3FC1X 2J0LA 2PVFA 4O21A 5TOZA 1GIJA 4GYIA 5EI8A 4CVAA 4C4JA 3Q52A 2OH4A 2X2LA 5EI6A 3W2QA 4FF8A 4EOKA 2PE2A 5I9ZA 2UZNA 5EDRA 3GEQA 3DU8A 3QD4A 3R7GA 1Z5MA 1XH4A 2VGOA 4NT4A 2C0TA 4F7NA 1L8TA 4M3QA 4Y5QA 4DFLA 4EC9A 3Q4CA 3Q6UA 5AX9A 3DAKA 3P9JA 5CSPA 3TUBA 4G3GA 2VWUA 4G6LA 4XLVA 4B4LA 5DN3A 4AP7A 4AQCA 2UW9A 5DEWA 4CG9A 3MN3A 4RC2A 3GENA 1U54B 4C4IA 4CZUA 3JXWA 3NRMA 5ETCA 2Y0AA 4ASDA 3DAEA 4FKQA 4QMOA 4Q5EA 4E6AA 3QZFA 3CKXA 1WVYA 4N6ZA 3C5IA 3DBDA 2C5VA 3ALOA 3MPAA 2GNLA 4PPAA 3GUBA 5L6PA 4LG4A 3QTWA 4WO5A 5FEEA 4FV2A 3MVJA 4CFNA 1WBVA 2C69A 3E92A 4FBXA 4I22A 5EOLA 5EHOA 3KK9A 1YXXA 2GFCA 2JDVA 4QMWA 4YURA 3RPSA 2I7QA 4FTIA 5E8YA 2JKQA 3OCBA 5DT3A 4ZTHA 3UGCA 4FKRA 4IACA 4MXZA 4WKQA 2WQEA 4C4FA 1R0EA 2XNMA 3SXSA 4D1SA 4DC2A 3FMKA 3MFRA 4RC4A 3LFFA 1H00A 5FEDA 5CVFA 4JDJA 5BQ0A 4ZMEA 3R01A 5K4JA 1CDKA 3IGGA 4FTCA 3EN5A 5I0BA 4YC3A 3SDJA 3NVMB 3RAWA 3OP5A 2VX1A 3GGFA 4IJ9A 3TI1A 4UX9A 1B39A 3RMFA 4O27B 4YJRA 3KMUA 3B2WA 4JR3A 3R1YA 3QX2A 3K3IA 4RG0A 3BHUA 4XOYA 5DRBA 4IB0A 5AMNA 3T8OA 3VW8A 5HBEA 4CCBA 4YHJA 4XG7A 3ZM9A 4F1MA 2IG7A 3IOKA 1YOLA 3DKGA 5CVHA 2OZOA 3FQSA 2R3LA 3WE4A 5CYIA 5AAFA 4FEXA 3QQGA 4QPAA 3W18A 5D1JA 2Z8CA 4F1TA 3KK8A 2HK5A 3P0MA 1YVJA 4KSPA 4NFMA 4TTHB 5JQ8A 4YLJA 4D0XA 3OUKA 3EYGA 5AR8A 4BCFA 4U3YA 3C4WA 4F7LA 5BVWA 2PU8A 5AUUA 5HD4A 5FM2A 2VTQA 3ANQA 3LAUA 5HU9A 1FPUA 2C4GA 2PK9A 5AV2A 3HAMA 4EZ7A 4ANNA 3AC1A 1H27A 2B4SB 2EB2A 4UXLA 3P7CA 4BC6A 4ZAUA 3ZYAA 4XV2A 2QG5A 3U9CA 2BRHA 3F5UA 3KCFA 2X6EA 4NM5A 3BLHA 2YERA 4XH6A 3PWDA 3BYSA 3FBVA 5EYDA 1T46A 4C35A 4EHEA 1ATPE 4AA0A 2PY3A 4EWHA 3ZC6A 4LUDA 3R7OA 3GI3A 2GS2A 5EM7A 4EUUA 2R4BA 3A61A 5C27A 1UVRA 2HZNA 3DGKA 4K77A 4RIXB 4DH5A 2B9JA 2GSFA 1V1KA 3CLYA 5GZAA 5T6KA 5KMMA 4QNAA 4S34A 4I6HA 3QLGA 3BHYA 2ZOQA 3FY0A 3FHIA 3QX4A 3UOJA 3TWJA 3EH9A 5CU3A 3ATTA 4RPVA 2X7FA 3EQDA 4R78A 5BVOA 4YBKA 5IQCA 3C51A 1FVTA 2CCHA 4E20A 5K9IA 5JSMA 2VX3A 2WZJA 3VO3A 5HZNA 3QQKA 4BGGA 3EMGA 4AN2A 2KULA 1CKPA 2QU6A 1PXNA 2RFSA 4D2WA 2GS6A 4E4MA 2PUNA 1ZYSA 4EOLA 5K4IA 3TDWA 2CSNA 1JBPE 5KMJA 1AGWA 2R2PA 2BDJA 5CTPA 1OL1A 4KS7A 1GJOA 4MNEB 4I4EA 3R7UA 4CEGA 5TF9A 2PVMA 4RJ4A 3WZJA 2HW7A 5IH4A 4AN9A 4C33A 4KB8A 4E73A 4D28A 3ODYX 3EN9A 4L45A 3R21A 2G1TA 4TYEA 4PMPA 2B1PA 5HCXA 1PXMA 5IG1A 2C68A 4C3RA 3IOPA 3TUDA 4TW9A 3N4UA 2WOTA 4APCA 3LQ5A 4F6UA 4FGBA 1WBOA 1ZZLA 2WHBA 3NCZA 2ZM4A 3QA0A 5CEIA 5AP1A 4X3JA 1KWPA 1OKYA 1H1PA 4I0TA 4YJUA 5D7VA 3W16A 4EK3A 5JFXA 2W1HA 4JDIA 4USFA 2YA9A 3QC4A 3HAVA 3T9IA 4FEQA 4IWOA 1HOWA 3QKLA 3H10A 4ID7A 1IASA 4YHFA 3V5WA 4J8MA 2R3HA 4EHZA 1MRVA 2QHNA 4FOBA 4F64A 5D11A 3S00A 4OTPA 1ZYJA 4NK9A 3FKOA 3I5ZA 3MY1A 4O38A 4BBMA 5LMAA 2QO7A 2XA4A 2J50A 4R5SA 2X1NA 3RZBA 3WF7A 4MAOA 2WTCA 3NSZA 4I93A 4UN0C 3BU5A 5HE3A 1BYGA 5LARA 3A62A 1XH5A 4XS2A 4YMJA 4QP1A 4QYHA 5HG7A 1AD5A 3IK3A 2UZTA 2VGPA 4LV5A 5GHVA 4D4SA 3ULZA 3AT3A 3ORLA 4ZEGA 4DITA 5GIOE 4XBRA 3Q2MA 3OF0A 4RX7A 3NUUA 1O6KA 2IPXA 1M2PA 4IJPA 1Q97A 2FA2A 4BCJA 3G9NA 3HMOA 4X3FC 4EH9A 3EB0A 4KABA 4LFIA 3PXYA 3D7TA 4Y8DA 2C47A 2YACA 3LCKA 4P2KA 3AC4A 4PUZA 3UYSA 2J4ZA 2HCKA 2BAKA 4YC6A 2ZDUA 3BQCA 4UYAA 3C0GA 4IMYA 3ID6C 2A0CX 2A2AA 4LMUA 3ENMA 3SLSA 4YJQA 3TZMA 3ZUUA 2AUHA 5CXZA 4HPUE 3WF5A 4AGCA 3C4EA 4JDKA 2QCSA 2OWBA 3BHVA 2ZV2A 3OW3A 4F4PA 1PKDA 3KMMA 1RW8A 3FMNA 5CZIA 3BYUA 4CFWA 2PWLA 4IM0A 3PA4A 2OJJA 3MFTA 3PZEA 3OHTA 2B9FA 4FVPA 4V04A 4YJTA 5CU2A 3CTJA 5ETFA 1IG1A 3RCDA 4ITIA 4B8MA 3QYWA 4EH4A 2JEDA 3W32A 5C8MA 1KUTA 5EH0A 3UTOA 1YI4A 4RLKA 2Z2WA 2PZPA 3I5NA 4Z16A 1KV1A 3O7LB 4FKLA 3NUAA 2H96A 5CEKA 4FE2A 4JQ8A 4LL5A 1U46A 4FNYA 5E1SA 4E5WA 3MIAA 5AP7A 2J0IA 5AP2A 2XKEA 4JJRA 3TACA 2GTMA 4NYEA 2QOFA 3OWKA 4E8AA 3E8NA 3HV5A 4FSRA 3KVWA 4YTIA 5EYKA 4OTRA 2WMSA 3NNVA 5TO8A 3ORTA 5B7VA 4MXCA 2X81A 1MRYA 3Q32A 4NKAA 5M55A 3FLSA 4A4LA 3QTXA 3RZFA 4APPA 2RL5A 4O6EA 4YNOA 3FQHA 3BZ3A 5EHLA 4QTDA 2C6EA 3HLLA 4A9RA 5FXQA 2YDJA 3L9PA 2XIZA 4U0IA 1YDRE 4EWQA 3VS1A 4G3EA 5A3XA 3HRBA 4EOPA 4GIIA 2QHMA 3FY2A 4FKVA 2IZSA 3TT0A 3R9NA 4PL5A 3FZOA 5C03A 2PE1A 1BMKA 3UO4A 3LMGA 3SV0A 3RHXA 3PJCA 1S9IA 1UKIA 4E6QA 4MKCA 5D12A 1E1XA 4DT9A 4CZTA 2F57A 4AA5A 3DNDA 3I60A 4WRSA 4DG3E 3UG2A 3Q4TA 5AX3A 4IX6A 3FL4A 3TEIA 2YITA 5LMBA 2JBOA 1J91A 2XK9A 5AIRA 3QLFA 2VN9A 3D83A 4XHKB 4F65A 5DEYA 4ZLZA 4GS6A 1JLUE 4IX3A 3UIBA 5AAGA 3FC2A 4G3DA 4I5HA 3AXWA 4R3PA 4WUAA 2VTPA 3SW4A 2DWBA 4C2VA 4ZLYA 5ITAA 5JMSA 2GNGA 4YR8A 4BBFA 4S31A 2B0QA 1AQ1A 3D5WA 4BTFA 5BPYA 4RVKA 1BI7A 2WTKC 5L8JA 2JAMA 4N70A 5KE0A 4X2KA 3SOCA 3I4BA 3SXRA 5C4KA 2EU9A 3D5XA 3E8DA 4EJ7A 1H1SA 2OLCA 2BKKA 4YJSA 5HNBA 1YW2A 4QQJA 4EOJA 2V5QA 4OUCA 1A9UA 3CS9A 4MEDA 2FGIA 3MPTA 5E8WA 4UWCA 2O64A 3BYVA 3CE3A 4FYNA 4J8NA 4UBAA 4AGDA 4BFMA 4E6DA 4ACGA 3MV5A 4E93A 5FTGA 1YQJA 4F0GA 2FO0A 4GCJA 4IWDA 2R0UA 4QMTA 4XRLA 4ZY6A 3F88A 5AJQA 2Y8OA 2VX0A 3IECA 4K11A 4RFMA 5HE1A 4DEDA 4R7BA 1PMEA 2WMQA 1YXSA 3D9VA 3ZLXA 4GG7A 3U6JA 3V8TA 1OECA 3QCXA 4KIPA 3B8QA 5IQFA 5AP3A 2CNUA 3IG7A 1M7QA 4WG4A 5J5TA 3TUCA 2F49A 4DLIA 5HIBA 4D5KA 4UEUA 4FEWA 3VN9A 2CGXA 3NUXA 3KXGA 3F66A 3RK7A 4K9YA 3QUPA 2XJ0A 5B2KA 4BYJA 4EH3A 4K0YA 5L4QA 2VTTA 1OBDA 3NLBA 2R7IA 4RX8A 1T45A 3G2FA 4C61A 4DE4A 5LOHA 4FV8A 4CRLA 4FZDB 1LEZA 4WOVA 2E9PA 4XP3A 4AZWA 4TN6A 2WFYA 2GFSA 2HIWA 4X21A 4RX9A 4AG8A 5GINE 4LM5A 3P5KA 4B0GA 1W8CA 3QHRA 3ZH8A 5EFQA 4R3RA 1LPUA 1O6YA 5HLWA 3GU5A 3ZO1A 1YXTA 4O7LA 3HVCA 3LFNA 3ORPA 1ZOHA 5JFSA 2GHLA 3ORMA 5KMIA 2YIWA 3FL5A 4NEUA 3OCSA 5KKRB 4KIKA 3QXOA 4PRJA 3PLAE 4CZYB 3W10A 2XK7A 2VWIA 4FT9A 3UQGA 2C0OA 3PFQA 3PPZA 3CQWA 4FG9A 4L3LA 1OBGA 4W4VA 1TVOA 1SMHA 3REPA 2VWVA 5CSHA 3SGCA 4ZZNA 1PRYA 3RM6A 2UV2A 2VAGA 3GC7A 2Q83A 1OIYA 4GH2A 5LWNA 5LVNA 4FV6A 5AR7A 2Y6MA 3K2LA 1NA7A 1LP4A 3FAAA 5TKDA 5IU2A 3U4UA 4TNBA 2QKRA 3W1FA 2F7XE 2BHEA 2OF4A 3F5GA 3O8PA 4MF0A 3VUKA 4O7YA 1UV5A 4AOTA 4CKRA 2DUVA 5IDNA 4XRJA 3F3WA 5K3YA 4HGLA 5CAVA 3PP0A 3A60A 4LGDA 4UMRA 4FT5A 3Q9ZA 3GU4A 4HJOA 3NNXA 4F6WA 3PJ1A 4O96A 4DFZE 4WNMA 4F9BA 4ZMFA 4O81A 3GCUA 1UKHA 5E1EA 3CD3A 3HL7A 4A9UA 5J1VA 4ZK5A 2RFEA 4W4WA 2C3KA 3UQFA 3VS6A 3HV6A 4ANMA 4O6LA 4JRVA 4QP9A 4O0SA 2W4OA 3BWJA 3FSFA 3GC9A 4H36A 4KA3A 2GU8A 2ONLA 2PVHA 4H1JA 3B2TA 4IDVA 4IZYA 4USEA 5JGDA 3FDNA 1GIHA 3BBWA 2CJMA 5H9BA 1YWRA 4EJNA 4O86A 4B7TA 4D2TA 2QLQA 4B8LA 3IW4A 2W1GA 4G9CA 3ZSGA 4FV9A 3VS7A 4C7TA 5IEVA 5BVNA 2ITUA 3F5PA 3RK5A 4IIRA 4WBOA 3DAJA 4X2JA 4U3ZA 4HCVA 1CKJA 4MTAA 3TIZA 4IANA 3VBVA 5CF5A 4LV8A 3UMWA 2VD5A 3TJCA 5ACBC 2UW5A 1WBTA 3H30A 3OY3A 4IAFA 3Q6WA 3R71A 3WYXA 2WTWA 3UIMA 5EYCA 2E2BA 2BDWA 2XEYA 4H3QA 3V5LA 3ZUTA 5C1QB 5HTBA 2PVJA 2XJ1A 3NX8A 4YSJA 5J95A 5ANIA 5KCVA 5I9XA 2UW7A 3L1SA 4QT1A 4HYIA 1G8AA 2WGJA 3EOCA 2W0JA 4FKIA 4U9AA 4JBPA 5EQYA 4PDPA 2GPHA 3AT4A 3D94A 4UY9A 2P33A 3P7AA 2QOQA 2IWIA 1R3CA 3HX4A 3C4XA 3ROYA 3ZC5A 2C1AA 2X0GA 2HW6A 1F3MC 4ZTMA 4R8QA 3D5UA 3MY5A 4U42A 3QD0A 5AUXA 5D7AA 5M57A 4GT3A 3LQ3A 2WELA 5JZNA 3ZONA 5E9EA 3UZPA 4CD0A 4F9AA 4UXQA 2QD9A 4AT5A 2XKFA 2C5XA 5DT0A 4IXPA 3JYAA 5AP0A 4D1XA 5LQFA 2E9VA 3IDPA 5DIAA 3IGOA 3IW7A 4EYJA 1R39A 5JRQA 3Q3BA 3E5AA 4YZCA 3PZHA 3PE1A 3TV4A 5IMXA 3PUPA 4F9CA 3QC9A 3D15A 5LVPA 2YLEA 4GEOA 4IAKA 1JQHA 4TRLA 3V5QA 4EEVA 4D9TA 3ALNA 4A9TA 2YN8A 3HKOA 4IQ6A 3ITZA 2OXYA 2RGPA 1PMNA 4RVTA 4PTCA 3L8SA 1SNXA 3FXXA 5FRIA 4BDJA 4NIFB 1CM8A 3S3IA 3GC8A 4Y5HA 1FMKA 2Z7QA 1CKIA 4AACA 3D2KA 4I0SA 2E9UA 2UW6A 2XB7A 2PVLA 1ZAOA 4RGJA 4GT5A 1YOJA 3EFLA 3GU8A 1YXUA 3OC1A 3NPCA 3VC4A 4QQ5A 2WEVA 1W98A 3C4ZA 3TTJA 4YZ9A 4DINA 2PYWA 5CS6A 2PHKA 4O7NA 4QP8A 4OLIA 4U81A 3VF9A 3DZQA 2ZVAA 4FKUA 4N57A 4IC7A 3PY0A 4C58A 4ENXA 3CY2A 5IQAA 2X9FA 2RG5A 5CAOA 4U41A 3HGKA 2H6DA 3NAXA 4C3PA 1H08A 4EL9A 5K5XA 4WUNA 1P4OA 3KXHA 2P4IA 5FM3A 1QPCA 3GU7A 3SRVB 4DEAA 4YZDA 3A99A 5JGBA 2X8DA 4U7ZA 3TV7A 5IZFA 3W2SA 1U54A 1MQBA 3HMIA 3H9FA 2ZB1A 3CPCA 2CGUA 3FLYA 5JH6A 3VS5A 3DBEA 3Q9WA 2OXDA 4DG0E 3PXRA 3R9HA 3WE8A 4A4XA 4I94A 3LJ1A 4J97A 3Q60A 4IVCA 4PL3A 2XBJA 2UW3A 4DEGA 2Z60A 4NKSA 4IAYA 1H25A 3FKNA 4FX3A 3WBLA 1SVGA 3WF8A 2BCJA 4R6VA 2C6KA 1ZYLA 2CDZA 1OUKA 3RGFA 1REJA 4RVMA 1I44A 2OFUA 4AZSA 4ZTRA 3FQEA 2CHLA 1W7HA 5ICPA 3NS9A 4YZNA 5CX9A 2XS0A 3COKA 5HU3A 3QQJA 3TNIA 3VJOA 4JS8A 3AGMA 1G3NA 5GNKA 4LOQA 3RINA 2C6IA 2G2FA 3BI6A 1QL6A 2ESMA 2XEZA 3E7OA 3QCSA 3V5TA 4BBEA 5KMOA 3BGZA 2B7AA 5EW8A 1PKGA 2OKRA 1JSTA 2ZM3A 4EQMA 3SW7A 3EN7A 5BX0A 5AUVA 1UU9A 3AMAA 2J0MB 3DDPA 4L9IA 2HAKA 4U6RA 2J5FA 3NUSA 4BI2A 5E8SA 4YJOA 5I9UA 4BKJA 4ERWA 3VRYA 4AZEA 3FMHA 2UVZA 1XBBA 3AC8A 4TWCA 5CSWA 1W0XC 1JVPP 5JFVA 2YWVA 4CQEA 4YJVA 3IW8A 3OT3A 5H2UA 1ZARA 1OI9A 3KXMA 1A48A 1OPJA 3PVBA 5J5SA 2I0YA 4CTBA 3DFAA 5CEQA 3CY3A 3QAME 4ANSA 5A4LA 4FL1A 2NPQA 2UZEA 4GK2A 1WAKA 5ANOA 1YOMA 3PE2A 3UPXA 4BGQA 5HICA 2EXMA 3EWHA 4OBPA 3UC3A 3MBLA 4F7JA 3MB6A 3DB8A 4QP3A 1DAYA 3VBYA 1CMKE 1ZYCA 2BAJA 2OF2A 3C0HA 1UU8A 2Q0BA 4UV0A 2NRUA 2P55A 2Z7RA 3NR9A 4A9SA 1J7UA 1CTPE 4YBJA 2OICA 3RBWA 3ZDUA 2V0DA 5JKGA 4EOIA 4JG7A 3WOWA 4GU6A 4GFGA 2F9GA 4LMNA 2GQGA 4FIJA 2YJRA 3PIXA 3UO6A 1Q8WA 3I79A 3FMJA 4RIXA 4ZSLA 5AV0A 4Z55A 4AAAA 2PZYA 1FMOE 3IW5A 4YTFA 2ITYA 4E1ZA 4JDHA 1MQ4A 2CLQA 4LOPA 4XV9A 5ETIA 3EZRA 1YDTE 4GU9A 3QKKA 3G15A 3KEXA 2ONLC 4L7FA 2XNOA 4JI9A 3GU6A 5M44A 5KMKA 3QA8A 3CQUA 3QGWA 4IZ7A 3VUDA 1URWA 5LXMA 1UA2A 4FSTA 1MP8A 3PLSA 2BRGA 5AIKA 1XWSA 4USDA 4W9XA 4L6QA 4CYIA 5A14A 4FG8A 3H4JA 4O7TA 2BPMA 5A54A 5KZ0A 2PZIA 3KKVA 2WU7A 3LPBA 2W9FB 3IDCA 4RVLA 4F9YA 3OVVA 3MVLA 3DOGA 4O7ZA 4MD9E 5HVJA 1APME 4CMOA 2REIA 2R7BA 1KE6A 4IH8A 1XQZA 2C6MA 4U97A 3PXQA 2W96B 4MNEA 4UZDA 4F09A 4PQNA 3TDVA 4KAOA 1Q4LA 4TNDA 3ATSA 2XRUA 2YIRA 4KD1A 3QXPA 2VRXA 2J51A 2YEXA 1J7LA 2QO9A 4AW2A 4EBWA 3VW6A 4O84A 1M2RA 3PIYA 4LQMA 4BTMA 4TZRA 3TXOA 2A27A 4E5BA 2O5KA 4Q9SA 1RJBA 5CU6A 3OMVA 2BMCA 3OROA 2W7XA 3F7WA 1KSWA 1KOBA 2W1EA 3HV7A 4A07A 4DAWA 3RCJA 1OUYA 4CMUA 4EOQA 4UWBA 5CSXA 3VUHA 2XK3A 4L44A 1YWNA 2WMAA 1UNGA 4I24A 4ZLOA 5CQUA 3S95A 3QRKA 3CXWA 4AX8A 2PSQA 5AM6A 5CVGA 2QI8A 5IA3A 1RQQA 4OTDA 4XBUA 4G17A 3DPKA 4J52A 4GFOA 2PVRA 2FSTX 4Y85A 4BHZA 2X2MA 3FV8A 4IE9A 4HW7A 1R0PA 5IDPA 5T68A 1XKKA 5HIDA 5M4CA 1B38A 1G5SA 3OBJA 4KBKA 5CF8A 2G2HA 3O23A 2P2HA 1JPAA 2ERKA 2A1AB 1WBWA 5JK3A 4XX9A 2B55A 4DEEA 1P2AA 5DMZA 5E4HA 5LVMA 3R8MA 1IA8A 3BX5A 3N51A 4OAVB 1BL7A 3BBTB 3UNJA 4A7CA 2JIIA 3G51A 2VWYA 3UJGA 2P0CA 4FTKA 3LHJA 5FP5A 3TKHA 2XKDA 1U4DA 4O91A 4QP4A 1WVWA 2PTKA 2WTJA 4JIKA 4YTHA 4AS0A 4I0RA 2EXEA 3A7JA 3ZS5A 2W1ZA 4IAIA 4WNOA 3OWJA 5FD2A 3S1HA 2IZUA 3KF4A 3R30A 2PVKA 2OH0E 5HCYA 2W1IA 4TPTA 3W8QA 3O51A 4J7BA 5L3AA 4L46A 4IVDA 2VWXA 4Y73A 2BR1A 3AMBA 3KRWA 3IO7A 5ETAA 2C6LA 3TKUA 3R0TA 1YDSE 3BYMA 4KKHA 5IISA 4DT8A 5M09A 1Q8TA 4QYYA 5AFVA 3WI6A 2XKCA 2YHVA 1E1VA 2BZJA 2I0EA 2WB8A 3F2AA 3PRIA 2J9MA 4NSTA 5CNNA 3FYJX 4NM0A 1QPEA 4E4LA 4JR7A 3NNWA 4RJ6A 4D9UA 3G6GA 4L3PA 4C57A 4Y83A 1H1QA 3S4QA 3R1NA 5KBQA 1UNHA 4O7WA 5M53A 4FZAB 4O7SA 4QMZA 2Q0NA 1SNUA 3AD5A 3C7QA 3AC3A 3FZ1A 3D5VA 4GJ2A 4GRBA 5CT0A 5GJDA 5T3QA 3GOPA 4N4SA 3EYHA 2YM4A 2WIPA 3ZFXA 4CT1A 5IUGA 2JFLA 3O96A 2BUJA 3MIYA 4ACHA 1QCFA 3MA3A 4JVGA 4YLKA 4ALUA 4K18A 2C3JA 5AUZA 3KULA 1UU3A 2ITTA 1F5QA 4RZWA 4NH1A 3R2BA 4DGMA 1NW1A 5CEOA 2ZAZA 5FXRA 4XG6A 2HZIA 2CNQA 5IH5A 4ACMA 1OL2A 4C4EA 2BROA 4I6FA 4I5PA 2RFDA 4FKTA 4FSUA 4BWXA 3A7HA 4I6BA 4FG7A 4RC3A 2Y4IB 4CXAA 1DM2A 2Y9QA 1RE8A 3FJQE 3M1SA 2YFXA 2LAVA 3QQHA 5LWMA 2PVYA 2RSVA 1UWJA 4RMZA 5GZ9A 5IQEA 3EKNA 3OBGA 3S0OA 4FKWA 3RNYA 3WZUA 3HV3A 1YI3A 3V3VA 2XVDA 2XZSA 3MFUA 4JBQA 3ZBFA 1F0QA 1XH9A 5B2LA 1OVEA 1GY3A 4PTGA 2C6TA 3HRCA 5DGZA 3LXPA 4PY1A 2XK6A 3DLZA 3FLZA 5AP4A 1L3RE 2WQMA 3WZKA 4AZTA 4BCOA 4OR5A 3KXZA 2EVAA 1M52A 2J0JA 4NUSA 4QYGA 3MJ1A 3VUTA 4J96A 5I3OA 4QPSA 4V0GB 3KC3A 3OWLA 3UOKA 5EQEA 3GCSA 3FZPA 1ZLTA 3EZVA 5E8VA 4ANBA 4FKJA 2VTHA 4JQEA 4TWPA 4JBVA 4ALVA 3HYHA 4BICA 2QURA 2VTSA 3PJ8A 3QCQA 4FOCA 4HGSA 2O3PA 1B6CB 4S33A 3NUPA 3FPQA 3KXXA 3MPMA 3WZEA 2W4JA 4HYUA 3V04A 3BQRA 5CLPA 3BELA 1KE7A 2OJFE 4BTJA 1QPJA 2CKOA 4EK4A 3UG1A 3OTUA 3KFAA 4M69B 5EM8A 3KMWA 3BCEA 3M11A 3PG1A 3PY3A 2YM8A 3DXQA 3PXFA 4G6OA 1OL6A 2BIKB 2UZWE 5EI2A 4ZIMA 5HESA 2FUMA 4WNPA 5EDPA 4I1ZA 2H34A 4FODA 5A4CA 4TWNA 4H05A 2YIQA 2R3FA 3DK3A 4ANLA 3K3JA 4BTKA 1IR3A 5F4NA 3KGAA 1NXKA 4FV3A 5C8NA 4QTBA 3HUBA 2F7ZE 3GFEA 3UNKA 1ZMVA 3C0IA 4FIEA 4GIHA 4D2RA 4YO6A 4PF4A 3NGAA 3EHAA 4GT4A 2PMIA 4IX4A 2O2UA 3FXWA 1ZYDA 2ITOA 4CV8A 4E5AX 3C1XA 2VZ6A 3FSKA 4HYHA 1YHSA 4IHPA 5D9HA 3UE4A 3UOLA 3VNTA 5E91A 4EHGA 3CBLA 3P23A 4JLCA 4GVJA 4ZP5A 4YNEA 2VTRA 5GJFA 1PW2A 4O7VA 3O50A 3UO5A 3UQCA 4II5A 3OEZA 2J0KA 4MQ1A 3RPRA 4C37A 4YU2A 3BV3A 3ZU7A 4I5CA 2H9VA 2FSMX 2OZAB 4NTTA 4GK4A 4BRXA 4B9DA 1QMZA 1GZKA 1CSNA 4C0TA 2O8YA 3R1SA 4V05A 4QO9A 5HNGA 5GZ8A 2CGVA 4GKIA 3R9RA 4YHTA 2B54A 4U40A 4KINA 3THBA 3IQ7A 3G33A 4NWMA 4CLJA 4FICA 3I81A 3NW5A 4OGRA 4AW5A 2VTNA 3AD6A 4HVDA 4EOOA 2W1FA 4JAIA 3Q96A 3VUMA 5H3QA 5FWKK 2BALA 2CKEA 3FMLA 3EFJA 4EUTA 3LLTA 1PXJA 4HPTE 3COHA 4QTEA 1PXLA 3R8UA 4FV4A 4L53A 4ACDA 5HG8A 1JSUA 3FZTA 2JLDA 3P4KA 3DKCA 4FVQA 2OJIA 3E63A 3CEKA 4FT7A 4BDGA 1OITA 4BWKA 4M15A 4UMUA 2WMXA 4AXAA 4IB3A 4TYGA 2GNFA 3QGYA 2NP8A 5KUPA 4M8TA 4YZMA 1Y6AA 3QWKA 2JFMA 3HA6A 2QVSE 3QTIA 4ZY5A 2OIQA 1UU7A 3D4QA 3ERKA 2YM3A 2W5AA 2WO6A 2QR7A 2UVXA 4L68A 2ZYBA 3VUGA 3ZEWA 5DE2A 3R73A 4M0YA 4FTQA 1E9HA 3E8EA 3P7BA 4RLLA 2HXQA 2IVUA 4WD5A 1R78A 4FV7A 5LCKA 3PVGA 2IW9A 4MD7E 2WOUA 1R1WA 2SRCA 2QR8A 4JBOA 3HMPA 4I20A 3EFKA 3SXFA 3I1AA 4S32A 4UZHA 2C6DA 1Q41A 1NY3A 2UW8A 1HCKA 3OY1A 2P2IA 1OIRA 2XIYA 4IDTA 4LL0A 4IB1A 5FGKA 3ZTXA 3ELJA 3ZRMA 5KO1A 3RHKA 4EKLA 3F61A 5BUEA 4F70A 3TCPA 2XYUA 5CY3A 3SOAA 1FGIA 5HE2A 3NYXA 2W05A 5BYLA 3BLRA 1BKXA 4BL1A 3FWQA 4FSZA 3WF9A 4KBCA 4G1WA 4DFBA 5IQHA 3I7CA 5DHJA 4EH5A 2ACXA 5DG5A 3PP1A 4RA5A 2H8HA 3EQRA 4XG9A 5DA3A 3KL8A 5CEMA 2XNGA 4QMPA 4NFNA 3ODZX 4FNWA 3VBXA 4EKKA 4BCKA 5HO6A 2BFXA 3W2PA 4DN5A 3R22A 5CU4A 2XUUA 4HVGA 4Z7GA 2W9ZB 4I6QA 4NL0A 4DFNA 3JR1A 3T3UA 4UWYA 3WF6A 4BI1A 5C26A 5J1WA 1ZOGA 3HDNA 4HGTA 4PWNA 2QU5A 3SKCA 1W84A 5E92A 2VUWA 4C8BA 3Q9YA 4CQGA 3R8LA 3F9NA 2XCKA 3OWPA 3PYYA 4UALA 4BF2A 4C36A 2QODA 2XNNA 4MBIA 4YUQA 2BRBA 3ZCLA 4FTOA 3P1AA 2YCSA 1X8BA 3QTSA 4P5QA 4JX3A 1P14A 2VWBA 4Z3VA 3PG3A 5TT7A 1STCE 2GMXA 3MB7A 5FTOA 1OM1A 2HELA 5M08A 5AR4A 5IKWA 2VV9A 4BKYA 3FYKX 3TM0A 2F4JA 5CAPA 4AZVA 4XUFA 1XBAA 5L2TA 4BGHA 4FTLA 1OKWA 4O1OA 2IJMA 3LCOA 4QQTA 4KWPA 3SVVA 3U6HA 1DI8A 5CAQA 3QZHA 4MWHA 4HOKA 1H28A 4TKSA 3HUCA 4OT6A 3DNEA 3I0QA 4R77A 4QMVA 3PSDA 5FDPA 4MXOA 2R3QA 5CI7A 3QHWA 2HWPA 2AYPA 4CGAA 4ZJIA 4TYHB 3ZZWA 1IA9A 2XIKA 3ZXTA 4DBNA 2ETMA 1OL7A 4FIIA 4J95A 3OT8A 4FUYA 3SC1A 3VBTA 3OW4A 4C38A 3QTQA 2I0VA 1SVHA 4XP0A 4FZ6A 2VWZA 4TXCA 3LE6A 5I9WA 1K9AA 2B9IA 1XHAA 3DKOA 3V5PA 1DAWA 3DKFA 3LLAA 5CF4A 3U51A 3EN6A 4JXFA 4R5YA 5JFWA 4IZ5A 4W9WA 4BHNA 4EC8A 3GP0A 4WIHA 4I23A 2QOOA 4FV0A 5AV3A 1FVRA 2QNJA 2UZUE 1Q8UA 4G5PA 4QRCA 3H9OA 5HKMA 3SA0A 4CFMA 4FTUA 3HP5A 3QFVA 3OOMA 3U9NA 2YCFA 3CP9A 4BZDA 2G9XA 1PXKA 2BFYA 2R3PA 4QYEA 4NIFA 4QMYA 1PHKA 3VWAA 3LXKA 3P08A 5I4NA 3TNPC 5EG3A 4AF3A 4CCUA 4IWQA 2JKOA 4HCTA 4BDFA 4D2SA 3BIZA 4FKSA 3BEAA 3UVRA 5M4FA 2BZKB 3C13A 4XG8A 4KIOA 4I4FA 3BE9A 2JIUA 4PL4A 4ZSGA 4AOIA 4L7SA 5BYZA 3H0YA 4C02A 4N0SA 2HENA 3DK6A 2W1CA 4M14A 1WBPA 3ULIA 3FXZA 3GXLA 3FI4A 4R1VA 5A6NA 2G15A 3NZ0A 5DRDA 4FGRA 1URCA 3V8WA 1Q8YA 3CTQA 3HMNA 5IQIA 3DQWA 1OPLA 3ZHPC 4AT3A 2CKQA 4ERKA 3Q9XA 1GOLA 2EB3A 3WYYA 3SRVA 3VS4A 4IC8A 2VTJA 4IAAA 3VBWA 3F3VA 1JKSA 4F08A 3A8WA 4E7WA 2W5BA 3QU0A 4NW6A 2R9SA 3PRFA 5CNOA 4M67A 1BL6A 1Q62A 3P78A 3QRUA 3MFSA 2RG6A 4DTKA 5M4IA 4IADA 1FGKA 2C5YA 3LZBA 2YAKA 2JDOA 3A7IA 4AWIA 5LMKA 3MH2A 3DTCA 5AP6A 3VF8A 4BVUA 2WMBA 4CLIA 3C50A 4D4VA 4EQUA 2JDTA 1J1BA 3H3CA 4DEHA 3UIXA 4HZRA 1V0PA 4NM3A 2V22A 3KA0A 3ZO2A 1MUOA 3ZLSA 3KRXA 4IBMA 3LQ8A 5CWZA 4HVIA 4PMSA 4JX7A 4G6NA 5DOSA 2CN8A 1TQMA 1VYWA 4O2ZA 3TNHA 3IW6A 3UP2A 2YABA 5BVFA 3QF9A 1WFCA 1BLXA 3DY7A 3O8UA 3LFSA 3QWJA 3CTHA 4MXAA 5J79A 5DPVA 3FI8A 3LCTA 3LMHA 4BY9E 5CEPA 4PV0A 3RWPA 2YZLA 1H1WA 3TNWA 2WD1A 3M42A 4U45A 3PSBA 2ITPA 4PMTA 4NW5A 4PNIA 1GZOA 2J5EA 5EDQA 2ITXA 3D2IA 3GVUA 4MD8E 3W8LA 3GOKA 2WTVA 2QQ7A 5ANGA 3LJ2A 3KU2A 2R3IA 4OTIA 5KKRC 4QQCA 3ZLYA 2A19B 2VO6A 4DGOA 4IX5A 1U5QA 4YZBA 4FEVA 4EK8A 3DK7A 1LUFA 4HYSA 4ASZA 2XNEA 1REKA 4XJ0A 5HIEA 4FSNA 4FSYA 2ITNA 4K2RA 2JBPA 3TL8A 2EWAA 2RKUA 2UZDA 3VVHA 2YWPA 2ZMDA 4LGHA 2WEIA 5H8EA 2V62A 2VO7A 4ZOGA 4MYGA 4TYJA 3RJCA 2XCHA 1YXVA 4JG8A 4OTGA 5HORA 2BIYA 2XMYA 4RIOA 2QO2A 5G1XA 4D4YA 2X6DA 3JVSA 4EQCA 1DS5A 4QP6A 4CFFA 2UZBA 2WTIA 3LFBA 4C59A 4JRNA 4K6ZA 2PMOX 5LCJA 4L43A 4FTTA 4AFJA 1ZMUA 3R63A 4EH2A 1Q5KA 3KN5A 4XCUA 2R3KA 4OTWA 5AV4A 2WQOA 2V7AA 4U43A 5JEBA 2IO6A 4OBOA 4PMMA 2GDOA 3G9LX 3PJ3A 4LRJA 4TL0A 3R28A 3VHKA 4E3CA 3AMYA 3NWWA 2PPQA 4RSSA 3DDQA 4JG6A 3WARA 4E4XA 1KE5A 3SG9A 3WIGA 1H0VA 2OI4X 4X2NA 4G16A 2CLXA 3Q5IA 4ZZOA 5I9VA 2WQNA 2JIVA 2ERZE 3F2NA 1SVEA 4CG8A 3U4WA 1WZYA 2J90A 1JKKA 2LGCA 3GNIB 3FLNC 1H01A 4MXYA 5HGIA 4PPBA 2PULA 3MH1A 1I09A 5FP6A 2Y6OA 1UWHA 1J1CA 3TZ8A 3HNGA 1H26A 4FC0A 5AV1A 5HVKA 2ZV9A 3E62A 3DJ6A 5IQDA 2VTIA 3P86A 3W2OA 4D4RA 5AUTA 5M07A 3NUNA 4RWIA 4HVHA 2UVYA 1ERKA 4XG3A 1BI8A 2QOKA 3L9LA 1H8FA 2IN6A 2BKZA 2FB8A 4QMUA 3P79A 2XBAA 3NVKI 2UW4A 2CMWA 4RJ8A 3F3ZA 4ITHA 4C4GA 4FEUA 3KN6A 4TYIA 4PX6A 4QMLA 4UB7A 1PF8A 5J7HA 4BN1A 1S9JA 3ZRLA 5EW9A 1YHVA 4DGLC 1PYXA 2X9EA 3L8VA 1P5EA 3DBQA 3V8SA 3MTLA 5M56A 4DA5A 4AZFA 2X2KA 4L00A 4JIAA 2F2CB 2VTLA 2GNHA 3NCGA 3GCPA 3JUHA 4CV9A 4MWIA 2YDKA 3KQ7A 3BGQA 4NZWB 4BIEA 4FK6A 5KMLA 5C4LA 4RFZA 4S30A 1JKLA 3GFWA 3RAKA 1Y57A 4QMSA 4A4OA 3HDMA 4L3JA 2V7OA 4XMOA 4EHVA 4R7IA 5IA2A 2X7GA 4ZS4A 4LRKA 1YI6A 3UIUA 2HY81 4DCEA 4YLLA 2GCDA 3MYGA 5A6OA 3TTIA 4AE9A 4KUJA 3MY0A 3HA8A 3KF7A 2DYLA 2OSCA 2WTDA 4RIWB 5J9ZA 2IZTA 2PUIA 4R1YA 3DFCB 4WRGA 3LFEA 2R5TA 3W2RA 2BRMA 2BILB 5BUIA 1H1RA 5DNRA 4DYMA 2PUUA 1XH6A 4FV1A 2WMRA 3ROCA 3CR0A 4CFXA 5H8BA 3OTVA 4DGGA 3LCDA 4QOXA 2J2IB 5L8KA 3ETAA 4WG5A 2JGZA 4EH7A 5IPJA 4G3FA 3ZSIA 3LCSA 1M14A 3LW0A 3FUPA 4F7SA 4ZTSA 1VJYA 3C4CA 4NTSA 4WA9A 3KB7A 3Q5ZA 3QD2B 4RWLA 2W99B 1VEBA 2QC6A 3LFCA 3VJNA 5KMNA 5L2IA 2JITA 4BDDA 3WIKA 3C9WA 4LOOA 3NDMA 5HE0A 4CMTA 4YPSA 4CFVA 5JRSA 4EBVA 2YDIA 3COIA 1OKZA 4H39A 5J87A 5ANJA 2Z02A 3TNQB 5HOAA 3U87A 4A9YA 4IFGA 5L6WL 2C1BA 5AAEA 1IAJA 3BLQA 4D2PA 4C3FA 5LJJA 4ORKA 4QMXA 4CYJA 3Q4ZA 4LRMA 2X4FA 4YJNA 4ASEA 1NVQA 5DFPA 3RK9A 3V6SA 3E3BX 1YWVA 4ALWA 5HG5A 1WVXA 4RIYB 3BEGA 4PDOA 4FKGA 3ACJA 3E87A 3QRTA 1ZWSA 2Y4PA 3QZGA 4FL3A 4YPDA 1ZOEA 5CSVA 5KZIA 3O8TA 3FLWA 3ENHA 4X0MA 2W1DA 3CKWA 4X3FB 4ZTLA 3R7EA 4ENYA 3ZSHA 3LFDA 4J99A 4KRDA 3F82A 4XNEA 3DXNA 2R3NA 3E8CA 3DT1A 3CPBA 3OUNB 4OTFA 4O83A 4EOMA 3DLSA 5HTIA 3R6XA 2XM9A 4NCTA 4FUXA 4WG3A 4XG2A 3WZDA 3RKBA 5GIPE 4RFYA 3PA3A 1PXIA 4NJ3A 4ZXTA 3PXKA 4G3CA 2UUEA 3GCQA 5EQPA 4IB5A 5B2MA 2WNTA 3D0EA 3RPYA 4HNIA 5LMKC 1NVSA 4FTJA 2WU6A 3MVHA 2Y7JA 2GTNA 3MVMA 4ZSEA 5HCZA 5F9EA 5E90A 5JQ5A 3A2CA 3I6WA 4E26A 4GVAA 3FHRA 4F6SA 2YCQA 5FUTA 3VIDA 3UNZA 1W82A 3ZBXA 3GBZA 3EQFA 3EQBA 2IW8A 4KBAA 2XK4A 5BMSA 4D5HA 2BHHA 4PNKA 2ITQA 3ZLWA 5AADA 4JOAA 4MX9A 5L2WA 3PY1A 4FKPA 4OTQA 2G2IA 1Q99A 4QP2A 2WMVA 1DI9A 1O9UA 2GQSA 2I6LA 3RALA 4D58A 5IMEA 4GKHA 4CTCA 5BVKA 3V01A 3KRLA 4FIFA 2W17A 5E8UA 3PPJA 2FSOX 2B9HA 5HBJA 3DTWA 3FEGA 5AM7A 4O0WA 1PY5A 5DR2A 4DH1A 3K5UA 3R00A 1NT2A 4FV5A 3PJ2A 5CU0A 3F6XA 4MBLA 5EW3A 1V0BA 4FTMA 3ORZA 4PP7A 3ZO3A 3JY0A 1IAHA 2ITWA 3AC5A 4ZSJA 5HG9A 1Z9XA 4V0GA 2QLUA 4K1BA 2ZV7A 4IWPA 5IQBA 2XYNA 2WXVA 4C62A 3IDBA 5F94A 3EJ1A 5HX6A 4AA4A 2RIOA 4FSMA 3FPMA 3BU3A 3E88A 4GUEA 3VQUA 4EOSA 3RWQA 2QONA 3LKMA 5FLFA 4DEBA 3QQFA 4M69A 4XV1A 5IEYA 1TQIA 1IEPA 2YJSA 3OXZA 4CSVA 4EH8A 3DZOA 2G01A 4WBBB 4ZS0A 5AUWA 3EL8A 5CT7A 4C4HA 2AC5A 5J7BA 2BRNA 4OBQA 3S2PA 2CNVA 4JQ7A 4G2FA 4L42A 3MESA 2OXXA 4FI1A 4F0FA 3FLQA 3LXLA 4A06A 4YSMA 5FQDC 3R9OA 3PIZA 2VO0A 3UP7A 4DH7A 3RVGA 3NNUA 3GT8A 3L9MA 2WTKB 2XM8A 2CN5A 3EL7A 4J53A 3NMUF 4G34A 4F9WA 4ZY4A 4DF3A 5HI2A 3SAYA 4XV3A 2BTSA 5LVLA 4RZVA 5TE0A 2PZRA 5JN2A 2Z7LA 4MHAA 3DQXA 3II5A 4BDIA
chains in the Genus database with same CATH superfamily
5E8TA 3VULA 1EH4A 3CGOA 3KRRA 3DCVA 3NYNA 4OW8A 4P4CA 2OZAA 4FNXA 5E8ZA 1ZXEA 1GAGA 3TZ7A 3HEGA 5HBHA 3SG8A 2PMNX 5FBOA 3MJ2A 3AKKA 4GFMA 5IA5A 4RWJA 4TT7A 4EORA 3EKKA 4O0UA 5DWRA 4FT3A 4OT5A 3QZIA 4ASXA 3ORIA 4RQKA 3JY9A 5M06A 2JKKA 3VS2A 4PP9A 5IUIA 5K0XA 4P7EA 4GK3A 2C5OA 4DBXA 3PWYA 4BZOA 3A8XA 1JOWB 4BDEA 2ETKA 5JT2A 2V55A 2O0UA 3MH0A 2HZ4A 3OG7A 3R8ZA 4AOJA 2O63A 3V5JA 3R1QA 4QMQA 3NUYA 5HLPA 5HO8A 3VHEA 3V51A 4UMPA 2DS1A 2R64A 4C2WA 4I3ZA 4W4XA 2GNIA 2GHMA 2P3GX 1OKVA 4MK0A 4FL2A 2XNPA 4X6RA 3TG1A 3ZMMA 2RF9A 1OMWA 4FNZA 4KIQA 2OBJA 3F5XA 4G31A 4O4FA 4QD6A 3LMIA 1SM2A 2Z7SA 5AR2A 3BGPA 3GB2A 3RPOA 3FKLA 5FTQA 3ZEPA 3SHEA 4AGUA 3ZRKA 5I3RA 4X2FA 2R3JA 1JAMA 2AC3A 4EI4A 3R04A 4AW1A 1FQ1B 3RAHA 2J6MA 2AQXA 4IM2A 3ORNA 4LYNA 4NJDA 5AA9A 2X7OA 1XH8A 1GIIA 2NNWB 2FSLX 3OCGA 3BRBA 4MF1A 3VUIA 3F69A 4F63A 3UVPA 5HEZA 3KULB 5I5ZA 1H4LA 4BDHA 1JNKA 4Q9ZA 1P4FA 2QOCA 3NW7A 3RNIA 5A46A 3MSSA 4AN3A 3KRJA 2ZB0A 4FTRA 1ZMWA 4M68A 1GNGA 1Q8ZA 5M4UA 2PMLX 2X0QA 1A06A 3MW1A 3ZXZA 1TKIA 2BTRA 4I92A 5J8IA 1SYKA 3UODA 1W83A 2EXCX 3O2MA 3LVPA 2ZFYA 4CFUA 3TJDA 1M17A 4O22A 5HO7A 1PMVA 3ZZEA 4K33A 4RBLA 2OIDA 3GQLA 3RM7A 1NVRA 1PMUA 5IQGA 3E93A 2VNWA 4JT3A 5ANEA 3R8PA 3VRZA 3WILA 2PE0A 3ORXA 1BX6A 4BI0A 5A4TA 3D7TB 3VS3A 1WCCA 3UZRA 5AEPA 2VO3A 5C9CA 3F7ZA 3R7YA 1GZ8A 4YP8A 3ZOSA 4NCTC 4U80A 2ZJWA 3HZTA 5L2QA 3LM5A 5EM6A 4DG2E 3W2CA 3R8VA 4FTAA 1ST4A 4E6CA 3EQHA 3O7LD 2JKMA 1LEWA 2XIRA 3I7BA 4BCIA 4DGNA 1OGUA 4M0ZA 4FJVA 1YHWA 3RI1A 1LR4A 4WSYA 5CALA 3I0OA 3AKLA 5C01A 3ACKA 1OB3A 4K8AA 1OIUA 5HLNA 2VTMA 3O71A 3QUEA 3G5DA 3L9NA 2R3MA 4HCUA 2UZVA 5AWMA 2CGWA 4FIGA 2C6OA 3DB6A 5JGAA 4N6YA 2UZOA 4EK6A 2OW3A 3ZDIA 2HY0A 3W55A 4EYMA 2QOIA 3NEWA 1WMKA 4O0YA 4D0WA 5IA4A 4BYIA 5J9YA 3W0PA 3UVQA 4BCMA 2Y4IC 3KY2A 4I5MA 5K0KA 4D55A 4GUBA 4M84A 5BMMA 4DHFA 3OZ6A 2ZV8A 5EKOA 5HNIX 2CPKE 5DBXA 3HV4A 2YM6A 1V0OA 4DTBA 4PDYA 5F95A 4G9RA 3OCTA 2JAVA 2GS7A 3R02A 1XJDA 4FTNA 4HZSA 3DV3A 3JVRA 5L6OA 3FI3A 2OK1A 2R0IA 4M66A 4RJ3A 4TYHA 3H0ZA 2HXLA 2ITVA 3CIKA 2CCIA 3FMMA 4H58A 1WBSA 4JL9A 4UMQA 3QTRA 4L8MA 4BIDA 4EH6A 5DH3A 2VTOA 3MGYA 4XOZA 3QUDA 4BCGA 3LIJA 1IRKA 4RRVA 4W4YA 3NYVA 3CJFA 3ZO4A 1W2DA 3HECA 3KCKA 3LOKA 4FIHA 5DR9A 4PPCA 3SX9A 2A4LA 3AG9A 2W5HA 2YIYA 3D7ZA 4JAJA 3AOXA 4GYGA 2XJ2A 3OOGA 3QQUA 3UYTA 4FZ7A 5DLSA 5E8XA 3AQVA 1Z57A 5CZHA 2E9OA 3H9RA 2VWWA 1ND4A 4O4BB 3NYOA 4WNKA 3UMXA 3DJ7A 2F7EE 3EFWA 3HMMA 4RX5A 3IKAA 3LJ0A 4O4EA 5H8GA 4ZJVA 5K5NA 3GCVA 4NU1A 4ZTNA 3ET7A 2JDSA 2OJ9A 2OU7A 4FT0A 1TQPA 2XH5A 4GMYA 3QYZA 4L52A 4LI5A 4YJPA 4DH3A 3UDSA 3MI9A 1Y8GA 4HVSA 3W0MA 4BZNA 2XF0A 2R3GA 2YM7A 5L8LA 2UZLA 3POOA 4QNYA 5HHWA 3W0QA 4O0XA 1PYEA 1ZY4A 2GNJA 3MTFA 2HYYA 3A4OX 1XMMA 3EQIA 2C5NA 4MVFA 4Z9LA 3BYOA 4QTAA 3RP9A 2EUFB 2X8IA 2OO8X 3EQPA 4YTCA 4XG4A 4QMNA 1ZY5A 3R83A 3OXIA 1O6LA 5DYJA 4O0VA 4OTHA 3VS0A 2WAJA 4CRSA 3DXPA 3QRIA 4TWOA 3BL9A 4C34A 4IEBA 4IM3A 5DT4A 2BDFA 5C8KA 5IF1A 3KVXA 4D1ZA 3CQEA 1XR1A 2QOLA 2VU3A 4M7IA 3RTPA 5KX8A 5IA1A 2F2UA 3QQLA 1G8SA 3U6IA 3PXZA 4RQVA 4TY1A 4ANQA 4ZJJA 2YAAA 3PA5A 3QBNA 3K5VA 1PXPA 3IPHA 4XP2A 2C3LA 2C30A 4DFXE 4H3PA 1PXOA 1VYZA 2I40A 3QL8A 5F1ZA 2PL0A 3ZUVA 5A9UA 3E64A 3QCYA 3F2RA 3O0GA 5EHYA 1HCLA 4Y46A 2FVDA 3UBDA 4UMTA 4CKJA 1XH7A 3CSVA 1M7NA 3ANRA 3OEFX 4MNFA 2HOGA 1VZOA 2JD5A 4F99A 5AA8A 4X7QA 4AW0A 5ANDA 3ZFYA 2BZHB 2WKMA 3EN4A 1KOAA 3PVWA 3F3UA 2ZM1A 3G6HA 4IVAA 4DFUA 3Q53A 4QP7A 3ZM4A 5A4QA 5KNJA 3CGFA 3CJGA 3FE3A 4IW0A 2O65A 1U59A 2OGVA 2ZDTA 4PDSA 5M51A 3W0SA 3BV2A 3JS2A 2IVVA 3PTGA 4KS8A 3QTUA 4Q5HA 3RPVA 2IW6A 4AGWA 3LM0A 3PSCA 4WHZA 4EZ5A 5J9LA 5FBNC 4PTEA 5EK7A 5D10A 4EONA 2WMUA 3BPRA 2YIXA 2I1MA 1KE9A 4BDBA 2WMWA 4ZTQA 4W8EA 1Q61A 4XYFA 2WPAA 4MXXA 4D2VA 3GC0A 5A4EA 2IZRA 4GW8A 4U5JA 3K54A 3DJ5A 4H1MA 2DQ7X 3DS6A 4M97A 1FBNA 1Y8YA 1K3AA 3U55A 2OG8A 4RJ7A 1WBNA 2YM5A 3E3PA 3AGLA 3FI2A 3NFGB 3B8RA 4DCAA 3F3TA 3MWUA 4UYNA 4O7RA 2IEWA 5HD7A 2YLFA 4GSBA 4U44A 5TR6A 3BE2A 4BCNA 4F0IA 4X6QC 1OIQA 5KHXA 1ZZ2A 5FXSA 2PVNA 4M13A 4B99A 3OS3A 4FMQA 3HRFA 4CNHA 3A7GA 1H0WA 2HWOA 3BWFA 4YGAA 3VAPA 5EYMA 2FH9A 1JKTA 4LV7A 4KIKB 3Q2JA 1FOTA 4LUEA 5CI6A 3GQIA 4JNWA 3QTZA 1XO2B 2RFNA 4QPMA 4V01A 5CQWA 4CKIA 4DEIA 5HX8A 5IA0A 1BUHA 5KBRA 5E7RA 2BVAA 3DBFA 3O17A 4FA2A 1GZNA 2ZMCA 4RT7A 4Y95A 5LVOA 2XIXA 2QOHA 4L67A 2GQRA 3T3VA 3PPKA 2YISA 3NIZA 3N4VA 4ITJA 3COMA 3ZFMA 1H07A 2OIBA 1OZ1A 5AUYA 2VNYA 3POZA 3SQQA 3UPZA 3DA6A 1KE8A 3E7VA 2UW0A 3Q4UA 4ZZMA 4G5JA 4M12A 4MQ2A 5I9YA 2QKWB 4O2PA 3T9TA 4YC8A 3OXTA 4YO4A 3QD3A 1SZMA 4X2GA 3CD8A 5DI1A 1Q24A 1Y91A 5CASA 4W8DA 3M2WA 4P90A 3TV6A 4KKEA 1J3HA 2QG7A 3IS5A 4R7HA 3BKBA 3ORKA 4H3BA 2XP2A 1UNLA 3DBCA 4RA4A 4BDKA 2BAQA 5IH6A 1OPKA 4I21A 4AE6A 1M2QA 5BVEA 4J71A 5IEXA 4Q2AA 3TN8A 5AR3A 5BVDA 4F1OA 2XNBA 3A7FA 4BCPA 3D14A 4MBJA 2XRWA 3BHTA 3R2YA 1FVVA 3LXNA 4AU8A 3IONA 3FMEA 4RJ5A 2JC6A 2XK8A 3PVUA 4QTCA 1XBCA 4I41A 3LFQA 2B53A 3I6UA 4NM7A 5AP5A 4BCHA 2QOBA 4DLJA 4GG5A 5GJGA 4FK3A 2A98A 3BHHA 4Y72A 3KREA 3AC2A 3TIYA 3C5UA 4O0TA 4E4NA 1Q3WA 2C3IB 2NRYA 5EKNA 1H24A 5BYYA 5KHWA 2IF8A 4ARKA 3KXNA 5CANA 3LFAA 5HQ0A 3UZTA 2HZ0A 2PZ5A 3UOHA 4XLIA 3PDTA 1JWHA 2OFVA 4GL9A 1YKRA 4R3CA 5DR6A 2JDRA 3OD6X 2XAOA 4J1RA 3TKIA 4QYFA 3VBQA 3V6RA 3EQCA 4B6LA 4DH8A 2YZAA 2X39A 5ACKA 4EK5A 2NYAA 5FEQA 5HVYA 2ETRA 1U5RA 4J98A 4RIWA 4ANOA 3EQGA 2W4KA 4EZ3A 3G0FA 3AT2A 4AUAA 1JSVA 4U79A 3R7VA 4P5ZA 5F20A 5FDXA 5CXHA 5CAUA 4BCQA 4BR3A 2CKPA 4MH7A 3C4FA 4HGEA 1K2PA 4U8ZA 2B52A 4KSQA 4BB4A 2BZIB 2FYSA 4IZAA 3VQHA 3A4PA 4ZSAA 5L2SA 3MH3A 3R9DA 4LGGA 4KNBA 4KRCA 5D41A 3UDBA 4OAUC 3U8WA 2R3OA 3QKMA 2ITZA 3MA6A 2X4ZA 1KV2A 4S2ZA 4WSQA 4FZFB 2PUPA 3QALE 1VR2A 3FMDA 3FZSA 4FSWA 4BDCA 4RWKA 1Q3DA 1ZRZA 2X8EA 5HTCA 1J7IA 4FR4A 4WT6A 4XEYA 5AR5A 5B0XA 3HP2A 3L8PA 4MCVA 2I0HA 3OFMA 4FYOA 3SD0A 4O82A 5CENA 1PJKA 3W33A 3FZRA 4AT4A 2VTAA 4IVBA 1RDQE 2OJGA 3QRJA 4FSQA 2IVSA 3MS9A 3NW6A 2R3RA 4L01A 4ONAA 5EOBA 2WMTA 4AFEA 4DFYA 4FVRA 3RAIA 4IAZA 5EM5A 4BKZA 3NIEA 4RIYA 5FG8A 1OL5A 3R7IA 5BUJA 3JPVA 3G0EA 1QPDA 4BWPA 4CT2A 4BIBA 3UC4A 5CF6A 5IUHA 2GHGA 5G6VA 4IFCA 4O1PA 3L8XA 2E9NA 4KKGA 2YCRA 2KTYA 2NO3A 2W06A 2WQBA 3AD4A 3CC6A 3EIDA 4X3FA 3NAYA 4Z7HA 4FKOA 3N4TA 3G90X 5BNJA 4GJ3A 4QMMA 3U54A 4O0RA 2IVTA 1FINA 3MDYA 3N9XA 3BU6A 4GV1A 4HNFA 3Q04A 5ANKA 1MRUA 4BDAA 1Y6BA 5JZJA 1OGYA 2C0IA 5DVRA 4ACCA 2J7TA 3CCNA 3TZ9A 1YRPA 2WIHA 3FC1X 2J0LA 2PVFA 4O21A 5TOZA 1GIJA 4GYIA 5EI8A 4CVAA 4C4JA 3Q52A 2OH4A 2X2LA 5EI6A 3W2QA 4FF8A 4EOKA 2PE2A 5I9ZA 4QDVA 2UZNA 5EDRA 3GEQA 3DU8A 3QD4A 3R7GA 1Z5MA 1XH4A 2VGOA 4NT4A 2C0TA 4F7NA 1L8TA 4M3QA 4Y5QA 4DFLA 4EC9A 3Q4CA 3Q6UA 5AX9A 3DAKA 3P9JA 5CSPA 3TUBA 4G3GA 2VWUA 4G6LA 4XLVA 4B4LA 5DN3A 4AP7A 4AQCA 2UW9A 5DEWA 4CG9A 3MN3A 4RC2A 3GENA 1U54B 4C4IA 4CZUA 3JXWA 3NRMA 5ETCA 2Y0AA 4ASDA 3DAEA 4FKQA 4QMOA 4Q5EA 4E6AA 3QZFA 3CKXA 1WVYA 4N6ZA 3C5IA 3DBDA 2C5VA 3ALOA 3MPAA 2GNLA 4PPAA 3GUBA 5L6PA 4LG4A 3QTWA 4WO5A 5FEEA 4FV2A 3MVJA 4CFNA 1WBVA 2C69A 3E92A 4FBXA 4I22A 5EOLA 5EHOA 3KK9A 1YXXA 2GFCA 2JDVA 4QMWA 4YURA 3RPSA 2I7QA 4FTIA 5E8YA 2JKQA 3OCBA 5DT3A 4ZTHA 3UGCA 4FKRA 4IACA 4MXZA 4WKQA 2WQEA 4C4FA 1R0EA 2XNMA 3SXSA 4D1SA 4DC2A 3FMKA 3MFRA 4RC4A 3LFFA 1H00A 5FEDA 5CVFA 4JDJA 5BQ0A 4ZMEA 3R01A 5K4JA 1CDKA 3IGGA 4FTCA 3EN5A 5I0BA 4YC3A 3SDJA 3NVMB 3RAWA 3OP5A 2VX1A 3GGFA 4IJ9A 3TI1A 4UX9A 1B39A 3RMFA 4O27B 4YJRA 4F78A 3KMUA 3B2WA 4JR3A 3R1YA 3QX2A 3K3IA 4RG0A 3BHUA 4XOYA 5DRBA 4IB0A 5AMNA 3T8OA 3VW8A 1VLRA 5HBEA 4CCBA 4YHJA 4XG7A 3ZM9A 4F1MA 2IG7A 3IOKA 4AAYA 1YOLA 3DKGA 5CVHA 2OZOA 3FQSA 2R3LA 3WE4A 5CYIA 5AAFA 4FEXA 3QQGA 4QPAA 3W18A 5D1JA 2Z8CA 4F1TA 3KK8A 2HK5A 3P0MA 1YVJA 4KSPA 4NFMA 4TTHB 5JQ8A 4YLJA 4D0XA 3OUKA 3EYGA 5AR8A 4BCFA 4U3YA 3C4WA 4F7LA 5BVWA 2PU8A 5AUUA 5HD4A 5FM2A 2VTQA 3ANQA 3LAUA 5HU9A 1FPUA 2C4GA 2PK9A 5AV2A 3HAMA 4EZ7A 4ANNA 3AC1A 1H27A 2B4SB 2EB2A 4UXLA 3P7CA 4BC6A 4ZAUA 3ZYAA 4XV2A 2QG5A 3U9CA 2BRHA 3F5UA 3KCFA 2X6EA 4NM5A 3BLHA 2YERA 4XH6A 3PWDA 3BYSA 3FBVA 5EYDA 1T46A 4C35A 4EHEA 1ATPE 4AA0A 2PY3A 4EWHA 3ZC6A 4LUDA 3R7OA 3GI3A 2GS2A 5EM7A 4EUUA 2R4BA 3A61A 5C27A 1UVRA 2HZNA 3DGKA 4K77A 4RIXB 4DH5A 2B9JA 2GSFA 1V1KA 3CLYA 5GZAA 5T6KA 5KMMA 4QNAA 4S34A 4I6HA 3QLGA 3BHYA 2ZOQA 3FY0A 3FHIA 3QX4A 3UOJA 3TWJA 3EH9A 5CU3A 3ATTA 4RPVA 2X7FA 3W0OA 3EQDA 4R78A 5BVOA 4YBKA 5IQCA 3C51A 1FVTA 2CCHA 4E20A 5K9IA 5JSMA 2VX3A 2WZJA 3VO3A 5HZNA 3QQKA 4BGGA 3EMGA 4AN2A 2KULA 1CKPA 2QU6A 1PXNA 4DHZA 2RFSA 4D2WA 2GS6A 4E4MA 2PUNA 1ZYSA 4EOLA 5K4IA 3TDWA 2CSNA 1JBPE 5KMJA 1AGWA 2R2PA 2BDJA 5CTPA 1OL1A 4KS7A 1GJOA 4MNEB 4I4EA 3R7UA 4CEGA 5TF9A 2PVMA 4RJ4A 3WZJA 2HW7A 5IH4A 4AN9A 4C33A 4KB8A 4E73A 4D28A 4DDGA 3ODYX 3EN9A 4L45A 3R21A 2G1TA 4TYEA 4PMPA 2B1PA 5HCXA 1PXMA 5IG1A 2C68A 4C3RA 3IOPA 3TUDA 4TW9A 3N4UA 2WOTA 4APCA 3LQ5A 4F6UA 4FGBA 1XMLA 1WBOA 1ZZLA 2WHBA 3NCZA 2ZM4A 3QA0A 5CEIA 5AP1A 4X3JA 1KWPA 1OKYA 1H1PA 4I0TA 4YJUA 5D7VA 3W16A 4EK3A 5JFXA 2W1HA 4JDIA 4USFA 2YA9A 3QC4A 3HAVA 3T9IA 4FEQA 4IWOA 1HOWA 3QKLA 3H10A 4ID7A 1IASA 4YHFA 3V5WA 4J8MA 2R3HA 4EHZA 1MRVA 2QHNA 4FOBA 4F64A 5D11A 3S00A 4OTPA 1ZYJA 4NK9A 3FKOA 3I5ZA 3MY1A 4O38A 4BBMA 5LMAA 2QO7A 2XA4A 2J50A 4R5SA 2X1NA 3RZBA 3WF7A 4MAOA 4AXCA 2WTCA 3NSZA 4I93A 4UN0C 3BU5A 5HE3A 1BYGA 5LARA 3A62A 3ML1A 1XH5A 4FRFA 4XS2A 4YMJA 4QP1A 4QYHA 5HG7A 1AD5A 3IK3A 2UZTA 2VGPA 4LV5A 3NFFB 5GHVA 4D4SA 3ULZA 3AT3A 3ORLA 4ZEGA 4DITA 5GIOE 4XBRA 3Q2MA 3OF0A 4RX7A 3NUUA 1O6KA 2IPXA 1M2PA 4IJPA 1Q97A 2FA2A 4BCJA 3G9NA 3HMOA 4X3FC 4EH9A 3EB0A 4KABA 4LFIA 3PXYA 3D7TA 4Y8DA 2C47A 2YACA 3LCKA 4P2KA 3AC4A 4PUZA 3UYSA 2J4ZA 2HCKA 2BAKA 4YC6A 2ZDUA 3BQCA 4UYAA 3C0GA 4IMYA 3ID6C 2A0CX 2A2AA 4LMUA 3ENMA 3SLSA 4YJQA 3TZMA 3ZUUA 2AUHA 5CXZA 4HPUE 3WF5A 4AGCA 3C4EA 4JDKA 2QCSA 2OWBA 3BHVA 2ZV2A 3OW3A 4F4PA 1PKDA 3KMMA 1RW8A 3FMNA 5CZIA 3BYUA 4CFWA 2PWLA 4IM0A 3PA4A 2OJJA 3MFTA 3PZEA 3OHTA 2B9FA 4FVPA 4V04A 4YJTA 5CU2A 3CTJA 5ETFA 1IG1A 3RCDA 4ITIA 4B8MA 3QYWA 4EH4A 2JEDA 3W32A 5C8MA 1KUTA 5EH0A 1TZDA 1YI4A 4RLKA 3UTOA 2Z2WA 2PZPA 3I5NA 4Z16A 1KV1A 3O7LB 4FKLA 3NUAA 2H96A 5CEKA 4FE2A 4JQ8A 4LL5A 1U46A 4FNYA 5E1SA 4E5WA 3MIAA 5AP7A 2J0IA 5AP2A 2XKEA 4JJRA 3TACA 4DTAA 2GTMA 4NYEA 2QOFA 3OWKA 4E8AA 3E8NA 3HV5A 1W2CA 4FSRA 3KVWA 4YTIA 5EYKA 4OTRA 2WMSA 3NNVA 5TO8A 3ORTA 5B7VA 4MXCA 2X81A 1MRYA 3Q32A 4NKAA 5M55A 3FLSA 4A4LA 2XARA 3QTXA 3RZFA 4APPA 2RL5A 4O6EA 4YNOA 3FQHA 3BZ3A 5EHLA 4QTDA 2C6EA 3HLLA 4A9RA 5FXQA 2YDJA 3L9PA 2XIZA 4U0IA 1YDRE 4EWQA 3VS1A 4G3EA 5A3XA 3HRBA 4EOPA 4GIIA 2QHMA 3FY2A 4FKVA 2IZSA 3TT0A 3R9NA 4PL5A 3FZOA 5C03A 2PE1A 1BMKA 3UO4A 3LMGA 3SV0A 3RHXA 3PJCA 1S9IA 1UKIA 4E6QA 4MKCA 5D12A 1E1XA 4DT9A 4CZTA 2F57A 3W0NA 4AA5A 3DNDA 3I60A 4WRSA 3AKJA 4DG3E 3UG2A 3Q4TA 5AX3A 4IX6A 3FL4A 3UDZA 3TEIA 2YITA 5LMBA 3BL7A 2JBOA 1J91A 2XK9A 5AIRA 3QLFA 2VN9A 3D83A 4XHKB 4F65A 5DEYA 4ZLZA 4GS6A 1JLUE 4IX3A 3UIBA 5AAGA 3FC2A 4G3DA 4I5HA 3AXWA 4R3PA 4WUAA 2VTPA 3SW4A 2DWBA 4C2VA 4ZLYA 5ITAA 5JMSA 2GNGA 4YR8A 4BBFA 4S31A 2B0QA 1AQ1A 3D5WA 4BTFA 5BPYA 4RVKA 1BI7A 2WTKC 5L8JA 2JAMA 4N70A 5KE0A 4X2KA 3SOCA 3I4BA 3SXRA 5C4KA 2EU9A 3D5XA 3E8DA 4EJ7A 2XAMA 1H1SA 2OLCA 2BKKA 4YJSA 5HNBA 1YW2A 4QQJA 4EOJA 2V5QA 4OUCA 1A9UA 3CS9A 4MEDA 2FGIA 3MPTA 5E8WA 4UWCA 1G8JA 2O64A 3BYVA 3CE3A 4FYNA 4J8NA 4UBAA 4AGDA 4BFMA 4E6DA 4ACGA 3MV5A 4E93A 5FTGA 1YQJA 4F0GA 2FO0A 4GCJA 4IWDA 2R0UA 4QMTA 4XRLA 4ZY6A 3F88A 5AJQA 2Y8OA 2VX0A 3IECA 4K11A 4RFMA 5HE1A 4DEDA 4R7BA 1PMEA 2WMQA 1YXSA 3D9VA 3ZLXA 4GG7A 3U6JA 3V8TA 1OECA 3QCXA 4KIPA 3B8QA 5IQFA 5AP3A 2CNUA 3IG7A 1M7QA 4WG4A 5J5TA 3TUCA 2F49A 4DLIA 5HIBA 4D5KA 4UEUA 4FEWA 3VN9A 2CGXA 3NUXA 3KXGA 3F66A 3RK7A 4K9YA 3QUPA 2XJ0A 5B2KA 4BYJA 4EH3A 4K0YA 5L4QA 2VTTA 1OBDA 3NLBA 2R7IA 4RX8A 1T45A 3G2FA 4C61A 4DE4A 5BV3A 5LOHA 4FV8A 4CRLA 4FZDB 1LEZA 4WOVA 2E9PA 4XP3A 4AZWA 4TN6A 2WFYA 2GFSA 2HIWA 4X21A 4RX9A 4AG8A 5GINE 4LM5A 3P5KA 4B0GA 1W8CA 3QHRA 3ZH8A 5EFQA 4R3RA 1LPUA 1O6YA 5HLWA 3GU5A 3ZO1A 1YXTA 4O7LA 3HVCA 3LFNA 3ORPA 1ZOHA 5JFSA 2GHLA 3ORMA 4JMQA 5KMIA 2YIWA 3FL5A 4NEUA 3OCSA 5KKRB 4KIKA 3QXOA 4PRJA 3PLAE 4CZYB 3W10A 2XK7A 2VWIA 4FT9A 3UQGA 2C0OA 3PFQA 3PPZA 3CQWA 4FG9A 4L3LA 1OBGA 4W4VA 1TVOA 1SMHA 3REPA 2VWVA 5CSHA 3SGCA 4ZZNA 1PRYA 3RM6A 2UV2A 2VAGA 3GC7A 2Q83A 1OIYA 4GH2A 5LWNA 5LVNA 4FV6A 5AR7A 2Y6MA 3K2LA 1NA7A 1LP4A 3FAAA 5TKDA 5IU2A 3U4UA 4TNBA 2QKRA 3W1FA 2F7XE 2BHEA 2OF4A 3F5GA 3O8PA 4MF0A 3VUKA 4O7YA 1UV5A 4AOTA 4CKRA 2DUVA 5IDNA 4XRJA 3F3WA 5K3YA 4HGLA 5CAVA 3PP0A 3A60A 4LGDA 4UMRA 4FT5A 3Q9ZA 3GU4A 4HJOA 3NNXA 4F6WA 3PJ1A 4O96A 4DFZE 4WNMA 4F9BA 4ZMFA 4O81A 3GCUA 1UKHA 5E1EA 3CD3A 3HL7A 4A9UA 5J1VA 4ZK5A 4DDIA 2RFEA 4O4CA 4W4WA 2C3KA 3UQFA 3VS6A 3HV6A 4ANMA 4O6LA 4QDEA 4JRVA 4QP9A 4O0SA 2W4OA 3BWJA 3FSFA 3GC9A 4H36A 4KA3A 2GU8A 2ONLA 2PVHA 4H1JA 3B2TA 4IDVA 4IZYA 4USEA 5JGDA 3FDNA 1GIHA 3BBWA 2CJMA 5H9BA 1YWRA 4EJNA 4O86A 4B7TA 4AXFA 4D2TA 2QLQA 4B8LA 3IW4A 2W1GA 4G9CA 3ZSGA 4FV9A 3VS7A 4C7TA 5IEVA 5BVNA 2ITUA 3F5PA 3RK5A 4IIRA 4WBOA 3DAJA 4X2JA 4U3ZA 4HCVA 1CKJA 4MTAA 3TIZA 4IANA 3VBVA 5CF5A 4LV8A 3UMWA 2VD5A 3TJCA 5ACBC 2UW5A 1WBTA 3H30A 3OY3A 4IAFA 3Q6WA 3R71A 3WYXA 2WTWA 3UIMA 5EYCA 2E2BA 2BDWA 2XEYA 4H3QA 3V5LA 3ZUTA 5C1QB 5HTBA 2PVJA 2XJ1A 3NX8A 4YSJA 5J95A 5ANIA 5KCVA 5I9XA 2UW7A 3L1SA 4QT1A 4HYIA 1G8AA 2WGJA 3EOCA 2W0JA 4FKIA 4U9AA 4JBPA 5EQYA 4PDPA 2GPHA 3AT4A 3D94A 4UY9A 2P33A 3P7AA 2QOQA 2IWIA 1R3CA 3HX4A 3C4XA 3ROYA 3ZC5A 2C1AA 2X0GA 2HW6A 1F3MC 4ZTMA 4R8QA 3D5UA 3MY5A 4U42A 3QD0A 5AUXA 5D7AA 5M57A 4GT3A 3LQ3A 2WELA 5JZNA 3ZONA 5E9EA 3UZPA 4CD0A 4F9AA 4UXQA 2QD9A 4AT5A 2XKFA 2C5XA 5DT0A 4IXPA 3JYAA 5AP0A 4D1XA 5LQFA 2E9VA 3IDPA 5DIAA 3IGOA 3IW7A 4EYJA 1R39A 5JRQA