3ZRMA

Identification of 2-(4-pyridyl)thienopyridinones as gsk-3beta inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
344
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 2-(4-Pyridyl)Thienopyridinones as Gsk-3Beta Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
total genus 103
structure length 344
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zrmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zrmA01
3MESA 3ZTXA 4BN1A 1WVWA 1FMOE 3VC4A 3ZYAA 2WMXA 4RC2A 3ZO2A 4ANOA 2CGWA 2IVVA 2C4GA 3DK7A 4QTCA 1H1SA 2HK5A 4FTCA 3KRWA 5C4LA 4IZ5A 4TZRA 3LCDA 2UZOA 5ACKA 3SVVA 4F1MA 5IQIA 2VRXA 4EQCA 4PPBA 4BCJA 1MQBA 3QGYA 4OTQA 4YHJA 2CGUA 3LM0A 3MDYA 4C4GA 5IMXA 4PL3A 5DH3A 2YIWA 2ITVA 5EW8A 5EKNA 3DDPA 3ET7A 4HPTE 3EKNA 4JX3A 3HDMA 1FVTA 4PMPA 5ETIA 4G3DA 2LAVA 3R9OA 5A4CA 4FEVA 3I5ZA 4BKYA 4IWPA 1YKRA 4LL0A 5CYIA 3PXRA 3L8VA 3BYVA 2RSVA 3O23A 3SOCA 3QHWA 3AMYA 3MPMA 3QC9A 4ALWA 3R8LA 1V0BA 3U4WA 5FD2A 4DEEA 5A14A 2XNBA 4IVCA 2ZAZA 1NXKA 2B0QA 4FG8A 2VD5A 2VN9A 4QMLA 5LVNA 4RG0A 3A61A 3BGPA 4J98A 4G1WA 4CMTA 5LWMA 2UZNA 4LOQA 4PNIA 4R7IA 3VHKA 4E6CA 5L8LA 4QMSA 4R78A 1KV2A 4FE2A 2PUUA 2WTKC 5CTPA 2UZEA 3A7GA 5CAOA 5J7HA 1KOAA 3C4WA 3TXOA 4FKUA 5HX8A 3K54A 4MQ2A 2V22A 4IM3A 4W8EA 1R78A 3R9HA 4A9UA 4APPA 4TYIA 1H8FA 1HCLA 1YDSE 4C4EA 3NNWA 2X4FA 5AEPA 2G01A 3PTGA 3SRVB 4V05A 3NW7A 4L7SA 4AGUA 4K2RA 5C26A 3OEFX 1YDTE 1K3AA 1OVEA 2OWBA 2IVUA 4ERKA 3MI9A 5AMNA 3ID6C 3OXTA 1J1CA 2R4BA 2XNGA 4KIOA 4AZSA 4E73A 2W1ZA 1IA9A 1HOWA 5ETFA 3SXSA 3SXFA 2W5BA 4W4VA 1Y8GA 2GS7A 3Q4TA 4TPTA 4EOIA 3O96A 5L2SA 4MXCA 5DI1A 4BCIA 3QLFA 4E7WA 2XNOA 4HGTA 4JBOA 4ZZOA 4BCOA 4FKOA 5K4IA 2CN8A 3EL8A 4IVDA 2RGPA 5LOHA 3F7WA 4AT4A 3II5A 3UO4A 2VTJA 2YCFA 3EQHA 2BUJA 5HI2A 5CXZA 1KE8A 2QI8A 3A62A 4NW6A 3FPQA 4FTAA 3KRLA 5CSPA 2FGIA 5E4HA 4NWMA 3VBXA 3UTOA 5GIPE 1OMWA 4L46A 4QO9A 2YA9A 2WU6A 4IQ6A 4IX3A 2BRGA 3QAME 4M97A 3NW5A 3MBLA 2OG8A 3PLSA 2CNUA 2W05A 3PXYA 3MH2A 4OBOA 4KS7A 4OW8A 1QPJA 4XV3A 2VU3A 3WI6A 3AMBA 4DGGA 3GCUA 4J99A 1T45A 4YPDA 3UP2A 1L8TA 1E9HA 1OIYA 3M42A 3L9PA 4JAJA 5CWZA 4DH5A 3FI8A 5T3QA 2IG7A 2CGXA 5IUIA 4PL4A 3EQPA 5AWMA 4ZJIA 5DRBA 3AC3A 4QTBA 1YQJA 3MPAA 4DG0E 5A4LA 2W9FB 3COIA 5AP6A 4HPUE 4FEUA 2O2UA 5I9YA 2PVFA 4DC2A 4EUTA 1X8BA 4HCUA 3PA4A 4JT3A 5H9BA 2XYUA 5DRDA 1P2AA 1W98A 2ZV2A 3U87A 3F5UA 4XLVA 2W1DA 1FBNA 3SOAA 4CV9A 3V01A 1KE9A 3LFEA 3NYNA 3RAWA 3ZO1A 3W8LA 5J5TA 4O2ZA 2CKQA 1M2RA 4XHKB 4O21A 5EM6A 4AZVA 5CNNA 3FQEA 4EK3A 2B9HA 3PJ8A 5A46A 4YPSA 3EQFA 4Z7GA 4AN9A 2RFNA 1OPLA 4MNEA 2XIYA 4OTFA 5CX9A 3TNHA 3UC4A 4I0RA 2VX0A 3FXWA 5FLFA 4XMOA 4IBMA 4WG5A 3BHYA 4RLLA 2PY3A 1REKA 2VO7A 3WF7A 3PP1A 2XMYA 2PVMA 4ZLYA 4JIKA 3D5VA 4NFMA 2Y8OA 2OJJA 5KMIA 4LFIA 3U6HA 3CGOA 2JC6A 4JG8A 4S30A 2BZJA 3BQCA 3G0EA 5AUWA 5IQBA 1H1RA 4AGCA 1KV1A 4TXCA 3BYUA 1WBOA 3ZZEA 4FYOA 4FZ6A 3MSSA 3F88A 3ULIA 1URCA 2XYNA 3QD0A 4YO6A 3UZPA 4HVSA 4WNMA 5TR6A 3AMAA 1J91A 5M55A 5CENA 2OFUA 2RG5A 4UALA 2PE2A 5E8VA 5IG1A 1OUKA 2R3KA 3FYJX 4V04A 3E3PA 1PJKA 4FV7A 3GB2A 4BIEA 3B2TA 3P4KA 2R3LA 5IDNA 2YJSA 4FSQA 4KD1A 4YJSA 4CMOA 3ZLXA 4DTKA 3QRTA 3FMKA 3BI6A 4U5JA 3UG2A 3WIKA 4NCTA 1L3RE 3BCEA 2G2IA 2YZLA 4IDTA 3QZFA 4F08A 3LM5A 1ZZ2A 3PXQA 3FYKX 4IX5A 4GYIA 2I40A 3SDJA 1Y57A 4XG2A 3VWAA 1Q8YA 1ZXEA 2UVXA 1WMKA 3R8MA 2QR8A 4H58A 3TJDA 1DAYA 4E6DA 5DG5A 3IDCA 3RAHA 4E4NA 4XOZA 4H3PA 3MFRA 3QQUA 4ANQA 4C58A 4EHEA 4RC3A 3ZCLA 4YLLA 4YZBA 4C4JA 4K8AA 3FZPA 3K3JA 3QU0A 4I92A 3FXXA 4LQMA 4M15A 4HVHA 4WG3A 5BUJA 1YWVA 3IO7A 5I3RA 1W8CA 4GV1A 4RIXB 4LGDA 3DKCA 3KXXA 3QD3A 4FK6A 3EYHA 5E8ZA 4JQ7A 4EL9A 2E9UA 3I0QA 1GIIA 3MA3A 5FM2A 3Q53A 4MK0A 4DE4A 1BMKA 3RKBA 2JGZA 3DNDA 3BIZA 3FZSA 4FZFB 4XV2A 3BLQA 4MD8E 5D10A 3GQLA 4QMXA 3W2QA 2VWIA 5JK3A 5CXHA 5HG5A 3MVLA 4AA5A 3UZRA 2BAQA 4QP4A 3R7YA 5EM5A 4ERWA 3FI3A 2C0OA 2V7AA 3ETAA 2W1IA 4GCJA 1F3MC 3PG3A 4FV2A 4LL5A 2G9XA 3EQBA 4NM5A 2H34A 3NEWA 4HYHA 5FDXA 2FYSA 3NR9A 3DAJA 4WD5A 5D7VA 3ZUVA 3S3IA 4UZDA 5HBJA 4CG9A 4OBQA 3QLGA 3FLYA 4B9DA 2QHMA 2E9VA 2JITA 3UQGA 3P9JA 3RINA 4R1YA 1PW2A 4BDCA 4BZNA 5CEPA 5HORA 5EDPA 4D2RA 5M53A 3PWDA 1JKKA 3PPJA 4AGDA 3DXNA 4O1OA 4X2NA 5JRSA 2Y7JA 1HCKA 3QX4A 2IVTA 2OKRA 1YHVA 3DXPA 4BZOA 3W2SA 4DLIA 4II5A 4QP9A 3WIGA 3EQCA 5L2IA 1QL6A 3BRBA 3F9NA 3MIAA 5DR2A 2B53A 2FSMX 1OL1A 4NEUA 4J8MA 4BF2A 3ELJA 4EBWA 2NPQA 5AP5A 1NVQA 3UIUA 4FEXA 1PMEA 2WEVA 4BZDA 4NK9A 3CQUA 3FMJA 3R21A 2I7QA 3DS6A 3HUCA 3OZ6A 4NKSA 3HMIA 3LXLA 4L42A 2J2IB 2IW8A 4EOPA 2DYLA 3RP9A 4QRCA 4MHAA 5IDPA 1U54B 4FV8A 3OCSA 5TT7A 3NNXA 3DNEA 2HZIA 3R9DA 1OUYA 4I94A 4Y95A 2O65A 4DFZE 4QPMA 3HV7A 3MB6A 4AF3A 2PL0A 1UU3A 4C33A 5M57A 3R7EA 1IR3A 3V8SA 4AW5A 3KREA 1H01A 4ITHA 4NCTC 4PPAA 5IQGA 5F20A 4I0SA 4AN3A 3BKBA 5IA4A 5HD7A 4E4XA 2IPXA 2JLDA 2QKWB 2QOQA 3ZSIA 2JBOA 2WTVA 3SAYA 4G3GA 2C6OA 3EFWA 3PJ3A 4EH8A 5M44A 4O86A 3BLRA 5J9YA 5E1SA 2YHVA 4M0ZA 3OMVA 4ZLOA 5JRQA 1PKGA 5KUPA 4U40A 1F5QA 2H96A 3DB8A 3M1SA 4FT9A 4KRDA 4RWKA 5H8EA 4BTJA 4D2SA 4DEDA 4O0RA 4U45A 3DBCA 4EH5A 4WUNA 2QOFA 4FZAB 4GT3A 4FNWA 3D7ZA 4J52A 2Z7RA 3Q96A 3TTIA 3WARA 3PWYA 1K2PA 3AT4A 1YHSA 1SMHA 2GNHA 4EKLA 4W9XA 4Y72A 5F94A 3VS7A 3UOJA 3K2LA 5IQFA 2BRHA 4I5MA 3EZVA 4F6UA 5AA8A 4RQVA 2UW5A 4J53A 5EH0A 3RK7A 5HQ0A 4CFXA 2VUWA 4GSBA 3VRZA 3HMPA 4CFFA 3HZTA 5JGBA 4RIWA 3KULA 3QA8A 4G3EA 4UWYA 5BVDA 4UMQA 5HNGA 1YOJA 3BYSA 3UMWA 1VYZA 2AUHA 2XK4A 4FTTA 5FP6A 2Q0NA 1OL7A 1MRYA 3QTUA 2PK9A 4XBRA 4U97A 4GEOA 4ENYA 4QYEA 4FKSA 2IZUA 3JS2A 3WYYA 3PVGA 4D2VA 2O3PA 2W06A 1E1VA 2Y6OA 3H10A 4RJ7A 3BLHA 3V5TA 4CD0A 4QMTA 5HE1A 5HD4A 1YXUA 3SW4A 4BCMA 4KINA 3LJ2A 3FWQA 3FC1X 5CQWA 2BROA 3CQEA 3VULA 2VO3A 2GFCA 2RFSA 4S31A 1FINA 4HGEA 1KOBA 1YI4A 3COKA 3QHRA 4IC8A 4NSTA 5HG9A 3TNPC 3ZRMA 3MPTA 4BBMA 2Y4PA 2OH0E 4PTEA 5HBHA 2XEZA 3GFEA 1WVYA 3MVMA 2HY0A 4FSWA 3C0HA 1AGWA 3NUAA 3FMDA 5AV2A 2QU5A 1JVPP 3OF0A 3GT8A 3F7ZA 2JDOA 2CMWA 1LUFA 3POZA 5HU3A 4KUJA 3F5GA 2PU8A 2C3IB 2Z7QA 1ZZLA 3OD6X 4BDKA 4E93A 4O0VA 4JBQA 3UOLA 4DH8A 4R6VA 5DMZA 1J3HA 5H8BA 3OW4A 5I9UA 3ZU7A 3OUKA 5AP1A 4BCGA 2EU9A 4K18A 2X6DA 5HVKA 3TNQB 3V8TA 3BPRA 3V8WA 2I1MA 4MNFA 5EOLA 5FXRA 3R71A 5KE0A 2GPHA 4A7CA 5BQ0A 1M7NA 2A4LA 3RGFA 5KHWA 2X9FA 2ITYA 3U51A 4AA0A 4YBJA 2V5QA 3S1HA 2RFEA 1T46A 5CZHA 3NUXA 1U46A 2R3PA 3AT3A 4PP7A 4FIFA 4RWLA 5IZFA 4LM5A 4X2FA 3BZ3A 4FNZA 4P5QA 3GC7A 2C30A 4AE6A 3ZONA 2IN6A 3JY0A 3W2PA 4YUQA 3PLAE 1Y6AA 3DV3A 3EB0A 3CBLA 3GU4A 3R83A 4JRVA 4KKHA 4A9SA 5M4CA 4I4FA 3IQ7A 5HTIA 4FEWA 1ZRZA 4OTIA 3U54A 2H9VA 4DITA 4M69A 4YZ9A 1FQ1B 3G9NA 3BHVA 4B7TA 4PV0A 2JKOA 4RBLA 5EG3A 4S34A 4CV8A 2ITQA 3I60A 3AG9A 4AOTA 1O6YA 2JDSA 4X2GA 4CMUA 5E9EA 4EYMA 3S0OA 2EWAA 5FBNC 2XNPA 2X8EA 1Q4LA 2XJ1A 2CKEA 4FGRA 2PVLA 3GP0A 1ERKA 5JQ5A 2WB8A 3E64A 4FIHA 1R0PA 4C3RA 4GFMA 2UZWE 2QOOA 1F0QA 4MBJA 4WT6A 2CCHA 2OJIA 3VVHA 3DZQA 4D28A 5HCXA 4DGOA 5IEVA 3THBA 4YNEA 3ZH8A 4EOKA 4QP2A 5E8XA 2E9NA 5BVWA 4QMZA 2A0CX 3ALOA 1XH7A 3TIYA 4ZSAA 3FMLA 2WELA 3VW6A 2O64A 3ZXTA 5E8YA 4X21A 4MBIA 2VTRA 2P2HA 2XNEA 2QODA 3PY3A 2UVYA 4FUXA 4XG6A 4OTPA 3WF8A 1ZMVA 4C8BA 3P79A 2XNNA 4FKTA 4U3ZA 5IEYA 3W55A 5K5XA 1PXIA 4G6NA 3CEKA 3MTFA 2ZJWA 4EQMA 4JG6A 2BTRA 5IA5A 4BCHA 2ZMCA 1M2PA 1O6KA 3TWJA 4BCPA 3KU2A 4TWPA 5I5ZA 1OECA 3TI1A 2CKPA 3O71A 4FICA 3OWPA 4J71A 3F6XA 3QCXA 3NRMA 3MS9A 4QP7A 4N6ZA 4RLKA 4XRJA 4YMJA 2BDWA 5KMLA 3EN4A 4HZSA 1QMZA 2X9EA 4H3QA 4TYEA 4Z7HA 2P4IA 4MKCA 5IA1A 2B9IA 3SX9A 1PRYA 3UP7A 4KS8A 5C4KA 4RVLA 2RL5A 4NKAA 5J79A 4IB0A 4D4RA 3BU3A 5E8SA 2VWWA 3E8NA 5DE2A 4EH6A 5FUTA 5CU4A 1M14A 4APCA 4O0YA 2G2FA 4G5PA 3GCPA 4ZSGA 4UV0A 3C7QA 2EB2A 2WU7A 3OWKA 4FTOA 4MF1A 3R8VA 3DDQA 4O1PA 4X6RA 2BDJA 5HNBA 2HENA 3P7BA 5DNRA 5E7RA 3DZOA 3NDMA 3FMHA 4CNHA 2RIOA 3RM6A 2C5OA 4OLIA 5BUEA 4A9TA 5AX3A 4IXPA 4YNOA 1ZARA 4AS0A 4X2JA 3RMFA 4XH6A 4B4LA 2H8HA 5JT2A 3UNKA 5G6VA 2IJMA 5HZNA 4RX9A 3ZRLA 3CCNA 3SGCA 2VGPA 3GU7A 4L8MA 4G3CA 5CU2A 3HMMA 4XG9A 1PXPA 2YJRA 2QO9A 3TL8A 1OPKA 5AV0A 2QURA 5JKGA 2QR7A 4PTGA 2R3QA 4QMNA 1BX6A 4FV6A 4AFEA 2OO8X 2C6TA 4RIXA 2OIQA 4ENXA 4DCAA 3FLWA 4ZZMA 2J5EA 5LVOA 4A4XA 2R3HA 1PY5A 2YLFA 3AD5A 4DFNA 4DH1A 5E90A 3DKGA 4I6BA 4Q9SA 5EYCA 5CAPA 5K5NA 1PXJA 3R8PA 3R73A 3FQSA 3VBVA 1J7UA 3EN5A 3R02A 2XJ0A 2VTMA 2QD9A 3G6HA 4CLIA 3BE2A 3WZEA 2JD5A 3D7TA 4ITIA 5DLSA 5M51A 2GU8A 4P90A 1KE5A 4M0YA 4JI9A 4WRSA 3UGCA 4XS2A 5D12A 5L6OA 4R7BA 3V5WA 1H08A 2O5KA 2CSNA 2IO6A 3ZHPC 2PZYA 2PTKA 2JKKA 3HA8A 3TNWA 4ZJVA 3BU5A 4QYGA 4BWPA 1PMUA 1U5RA 3V5JA 2VTIA 2BHHA 5CASA 3F69A 3KB7A 4BHZA 3ZRKA 2O8YA 2WHBA 5AAFA 5KMMA 4BDJA 5IU2A 4K11A 2I0VA 3UMXA 4DEHA 2WZJA 4X3FC 4IJPA 3T9TA 4KWPA 4K33A 3E8EA 1H27A 5HLNA 3LW0A 2JDVA 3RAKA 4BGQA 3FZRA 2PMLX 4RPVA 3SA0A 1OM1A 3HEGA 5DYJA 3FZOA 5ANEA 3LQ8A 1W82A 3VUMA 2XRWA 1UU7A 3D0EA 5AJQA 4PL5A 4Z9LA 5KMNA 5DFPA 3Q4ZA 1WBSA 3GCQA 3QRKA 2VAGA 2JKMA 4N70A 4U79A 4KB8A 3T3UA 5E92A 2HW6A 3R7GA 4BDHA 1PHKA 3TTJA 3HAMA 4YU2A 4KKEA 4HNIA 3VJOA 1JKTA 4C4FA 1WVXA 4LOPA 2ZDTA 1ND4A 1W83A 5HO6A 5M4FA 3GU8A 3ZDIA 2YM5A 4RWJA 5BVEA 2ITUA 4JR3A 3ZDUA 2QG5A 2C1BA 3D5XA 4I6HA 4GVAA 1H1PA 1UKIA 3TT0A 4NZWB 3H0YA 3I0OA 1Z57A 4RFZA 2C0TA 3TN8A 4L44A 2JFMA 4XEYA 1JSUA 4ANLA 3FAAA 3CTQA 4FTKA 4HOKA 4FK3A 4RJ6A 5HE3A 2QG7A 2WTDA 2XRUA 1MRUA 3FY2A 3PIYA 2UW7A 2W5AA 5BNJA 3WYXA 4D9TA 2SRCA 5HOAA 4X7QA 3VAPA 1OIUA 4RIOA 4Y73A 3KEXA 3KL8A 3KRRA 3OCGA 1MP8A 5E1EA 5A3XA 1OI9A 4EOMA 4EK5A 3FSKA 3PXZA 3DGKA 4ITJA 2YFXA 2UZDA 3LE6A 3CTJA 4ZS0A 4QYHA 2E2BA 2PVKA 3TV4A 4EH4A 3LXNA 1Q97A 4O7YA 4MAOA 4DBXA 3UNJA 4R5SA 2ETKA 5JFXA 4PP9A 3PRFA 4EWHA 4CSVA 4JQ8A 4L43A 3HKOA 3LXKA 4JOAA 4L52A 3VHEA 2FSLX 5JEBA 1ZY5A 3HV6A 4F9BA 1Y8YA 2R3MA 2XCHA 5K0XA 4FVPA 2WQMA 3VNTA 3FBVA 4AOIA 4OT5A 3SRVA 2OLCA 5CANA 4F4PA 3ODZX 2WOTA 4V0GB 4FSZA 4XV1A 5JZJA 2C6DA 3Q5ZA 3HX4A 4GRBA 4JNWA 4LRKA 1Q3DA 5HX6A 4TRLA 4W9WA 3IW5A 3TUCA 2DWBA 3DXQA 4FL3A 1Q3WA 4U6RA 4AFJA 3GQIA 3QTZA 3FMNA 2YN8A 3A60A 3UO6A 4AOJA 2F7XE 3QALE 2YDKA 2VTHA 4UBAA 4RFMA 2UVZA 1BI8A 4LGHA 4L6QA 4HYUA 4F70A 5LMBA 4XP2A 3NCZA 3VW8A 2A27A 4DEAA 5HLWA 4WIHA 4HVIA 3AC8A 1QCFA 1G3NA 1YXTA 3ORIA 4U9AA 2EUFB 2R3OA 4AX8A 2VTQA 4CQGA 4ZOGA 4ZY4A 3IK3A 3FL5A 1V0OA 4IIRA 1UV5A 2PUPA 3IPHA 2W1CA 3HGKA 2W0JA 5KO1A 1GZ8A 3LMIA 3KXMA 3GC8A 3OTVA 4OTDA 4CKJA 3V3VA 3BEGA 5CU6A 5B2LA 4BL1A 4NIFA 3ZBFA 4I0TA 4IVBA 2F49A 4CT2A 3QQHA 3U9NA 3UODA 2UZVA 3AC1A 2G15A 3CKXA 2PUIA 2GS2A 5EKOA 4E4MA 2XA4A 2WFYA 2ZM4A 5FGKA 3RZBA 3KCKA 1BI7A 2UZBA 1NVSA 3EH9A 3L8SA 4QMWA 3VF8A 4GFGA 4Z16A 4EOQA 4FKJA 4UMPA 4F0IA 4IE9A 4U80A 4FVQA 2OH4A 1SNUA 5KBQA 5EQYA 2J0IA 3GC9A 4UX9A 4BDEA 3C4CA 4FTIA 2GQRA 4O81A 2VTPA 1XQZA 2C47A 4YJOA 4AW0A 4CCBA 5CAUA 3GOKA 5J9LA 4JG7A 5KZIA 4XG8A 1Q41A 3IW7A 3JYAA 5IQCA 3ODYX 1U54A 4GFOA 3RK9A 4Y85A 2CLQA 4IWDA 4FKLA 4WG4A 1K9AA 2IZRA 2J0JA 3ORNA 4RVKA 4QQTA 5B2MA 2OJ9A 2J5FA 4LI5A 3I7CA 1YVJA 4TW9A 4KKGA 2O63A 5AM6A 3M2WA 4F1OA 4BIBA 3KF4A 3Q32A 4D4YA 2GDOA 4IADA 3EYGA 3IW4A 4DFBA 1ZOHA 5KMOA 4DLJA 3RNIA 3FLZA 3G15A 5L6WL 4LMNA 3PY1A 4S33A 3Q9ZA 4X2KA 5E8TA 3ZM4A 4GJ2A 4E5BA 4DCEA 4PMSA 4G5JA 2E9OA 3TUDA 4C2WA 2X1NA 3QKMA 1W84A 3NPCA 4YSJA 4NW5A 3ENHA 4EK4A 4O0UA 1PYXA 4G2FA 3I4BA 1Q5KA 4UWBA 2XZSA 4FTUA 1GY3A 4YZDA 2GNLA 3JR1A 4O84A 1JNKA 4L45A 5CNOA 5HO8A 2ZM1A 4DT8A 3HNGA 4FYNA 5HKMA 3QUEA 2FA2A 4IZYA 4AZWA 1PMNA 2PZ5A 4IFCA 3RCDA 4CFNA 4YR8A 5AAEA 5DT0A 5LQFA 2YLEA 4PDSA 2QHNA 5BMMA 2GCDA 3OROA 5M56A 3AC2A 4YGAA 3VS4A 1YWRA 2RF9A 4UWCA 3ZFXA 2C6KA 2B7AA 3UIXA 4DGLC 2HY81 3LKMA 2LGCA 1UVRA 1LPUA 2WMQA 3OXIA 4ACMA 4CXAA 1KWPA 4UMRA 2I0YA 3DQWA 3C13A 5FDPA 3MWUA 2WOUA 5AP0A 2YDJA 2XNMA 3SD0A 1IAJA 2RG6A 4M3QA 3FMEA 4PMMA 3D2KA 5DWRA 1NVRA 2XK3A 3L9MA 5D9HA 5GJDA 3CD8A 1XH8A 1XBCA 2YIYA 1UWJA 3R28A 3RPOA 4CFMA 3AC4A 3PPKA 4K9YA 2W99B 3LJ0A 4GU6A 4RJ3A 3ZO3A 2X7GA 2R64A 3KF7A 2CCIA 4MWHA 5AR5A 2YIRA 3I81A 3R22A 1ZYDA 2Y0AA 3SQQA 3QCSA 5GZ9A 3Q2JA 2J0KA 5BVKA 2XK6A 4AA4A 5L8KA 3LIJA 2VTLA 3KK9A 3NCGA 2BVAA 3CD3A 1CSNA 3BHTA 4AZFA 3TNIA 4JAIA 1O6LA 2XBJA 5CF5A 4GG5A 2X4ZA 3FI4A 3QQJA 3LXPA 3QQGA 4YJQA 4RC4A 4RJ4A 3QWKA 3ZSGA 2X8DA 4EQUA 3Q9XA 3O50A 4GKIA 2WQOA 2X0GA 1XBBA 4O91A 4G17A 1YW2A 1GIHA 3HMNA 4FG9A 3P0MA 1H26A 2F2UA 5B2KA 1P4OA 4MWIA 4QMVA 5LXMA 3T3VA 4BKJA 4JX7A 5FP5A 2PMOX 5HIDA 3G9LX 2X2KA 1OKVA 4FG7A 4QQCA 2ERZE 4HYIA 4WNKA 4FKVA 5CI7A 5D11A 3E3BX 3EN7A 4LRMA 3CC6A 2XIZA 3OXZA 5HE2A 4TWOA 3UQFA 3C0GA 4FKWA 3VUTA 4EWQA 3REPA 3BHUA 3FL4A 4ZLZA 3O8PA 3FLSA 3HVCA 4ASZA 1XH9A 2AC5A 4EORA 5I9VA 4B0GA 3QUDA 2Y4IC 5M4IA 2WMVA 2HWPA 2HWOA 3KXGA 5AIRA 2GHGA 4D0WA 3VUHA 2C6MA 4ORKA 4FTRA 4FMQA 5L8JA 2ESMA 4EYJA 3DKFA 3D7TB 5DGZA 4BGGA 3HDNA 3OTUA 4ZTQA 2WMAA 2QOHA 3EN6A 4LG4A 3OVVA 3QZIA 4WKQA 5ANJA 5EYMA 5AUVA 3O51A 1UU8A 3MH1A 4FUYA 1V0PA 4EH9A 5EM8A 2AYPA 2PULA 4MVFA 4DINA 2WTIA 3K3IA 1CMKE 1UKHA 2BALA 3QTSA 4YSMA 2Y9QA 5FG8A 5ANOA 3EWHA 4TNBA 2R3FA 3FHIA 3BBWA 2C3LA 2WQNA 4IH8A 2C3KA 4V01A 5FEDA 1GJOA 4JDHA 4GU9A 3F2AA 3H4JA 2PYWA 4L7FA 4CRSA 3PP0A 5IISA 2OZAA 3C50A 5JFWA 1PXMA 3QQFA 4DEIA 3R6XA 2P2IA 1GNGA 2Y4IB 3C1XA 3H0ZA 4NJ3A 4JR7A 4YC8A 4ZMFA 1TQMA 4XV9A 2Z7LA 1SNXA 3RCJA 3V6SA 4U42A 1YOMA 5LCKA 4O7TA 1RE8A 4F63A 1XR1A 3C5UA 4XBUA 4EOOA 2R0IA 3LAUA 3QKLA 4EHZA 3E7OA 5A6NA 4OR5A 3KMMA 3HECA 4RSSA 3WZDA 3A7IA 4UMTA 3A8XA 4ZXTA 1Z5MA 4DA5A 2EXEA 1P14A 3LFNA 3WZUA 3NYOA 2ZV7A 3LCOA 4R3PA 5HCZA 4U44A 2ITPA 3QBNA 2OBJA 4BIDA 4GUEA 5AP2A 4ZJJA 3HUBA 5TE0A 4F99A 3FEGA 5JMSA 5HESA 2JIVA 2PZRA 3VBQA 3PSCA 5J95A 2UW8A 1ZOGA 3EL7A 4F7SA 3SG8A 2GQGA 3UIMA 3OG7A 2G2HA 1APME 4XNEA 3IDBA 5IH6A 2VX1A 3SW7A 5BYLA 4IAIA 3ZMMA 5FWKK 1H0WA 1R1WA 1TQIA 2W1GA 4CZYB 1MQ4A 5EI8A 3BBTB 3TUBA 3DK6A 4QP8A 3W2OA 4D5KA 3TJCA 3HA6A 4BRXA 3N4UA 4UYNA 2YWPA 3MJ2A 4DFXE 4BWKA 2XUUA 3EHAA 2ERKA 3KXNA 1WCCA 4OTRA 3RJCA 2R7IA 3E87A 3VS6A 2QCSA 4MD7E 3PXFA 4PRJA 2UV2A 2ITXA 5EOBA 4K6ZA 3W2RA 3NAXA 3NZ0A 4Y8DA 5HICA 2ACXA 3ZS5A 1J7LA 3R1NA 3NUPA 5A4EA 3NYVA 4C37A 3UZTA 4XOYA 3TV7A 3SG9A 3F82A 4FV3A 3ZZWA 3SLSA 1BUHA 1NA7A 2JDRA 4YHTA 2BR1A 5BYZA 3FLNC 3GENA 3EQDA 2XCKA 2W5HA 2HELA 5K9IA 4MXOA 3TKUA 3F3UA 3DBDA 2YEXA 4U0IA 3AXWA 3R01A 3DQXA 1UNHA 3KRXA 2BTSA 3VUIA 5CSHA 3FV8A 3H3CA 3H9OA 4MF0A 1CKPA 5AP7A 4O0TA 3VRYA 5J1WA 3ITZA 3DFCB 3GXLA 5IF1A 5AR8A 4AN2A 3ALNA 4IB5A 3ATSA 4JDKA 4BDDA 3VUDA 1FVRA 3F3TA 4EHVA 3AGLA 4QD6A 3C51A 3QYZA 2VWUA 2WIHA 3RHXA 4UY9A 3HRFA 5JFSA 4EJNA 1IEPA 4TL0A 2FH9A 3GC0A 4CFWA 1H28A 2EXCX 2ZOQA 3A7JA 3R2BA 3DK3A 3ORMA 5EM7A 3Q2MA 2WO6A 3QZGA 4FIGA 5IA2A 4FL1A 4QP3A 2HZNA 2NRUA 1Q24A 4YC3A 4BYIA 5A4TA 4FGBA 4HCTA 5GJGA 3UIBA 3ZUTA 1ZY4A 4IANA 2WMSA 3D83A 3OUNB 4LV5A 4U81A 2A2AA 1M17A 1ZMWA 3K5VA 3L8PA 4GVJA 5KX8A 2IZSA 3QD4A 4O7RA 3TIZA 3FJQE 4FSYA 4XP3A 4E20A 4AT5A 2PVNA 3GFWA 3TZ7A 3UPXA 3CPCA 1U4DA 2OXXA 4U8ZA 2XK9A 1H4LA 2XIKA 4OT6A 3F5XA 4I5PA 4P7EA 1WBVA 1BKXA 1VJYA 4TWNA 4ALVA 4O7LA 3VIDA 4M12A 5GIOE 3IG7A 4D9UA 1BYGA 1YHWA 2R9SA 4EZ7A 3LHJA 4Q5EA 4HVDA 3QTIA 1IASA 4FKPA 4GIIA 3OC1A 4I5HA 4M68A 3TCPA 2JKQA 1XH6A 3AD6A 4PMTA 2BFYA 3IOKA 2YAKA 3P1AA 3V5LA 5EDQA 3QTQA 5ITAA 3CY2A 2RFDA 3EJ1A 3OEZA 5HLPA 4RMZA 3N4TA 2GNFA 4PWNA 3GU5A 3RPRA 2WMTA 4D5HA 1B38A 4F0GA 4K77A 4NJDA 3Q4CA 1SVGA 1FGIA 2OJFE 3RK5A 4M67A 2XIXA 5KKRC 2ZB1A 3DJ6A 3TM0A 3OBGA 3QA0A 2WIPA 4ZZNA 2CNVA 5DN3A 4F9CA 4WO5A 5GJFA 5IMEA 2DQ7X 3B8QA 4NH1A 1CM8A 1A48A 3COMA 2V62A 5CSWA 1OL6A 3UG1A 4CQEA 5F9EA 3VBYA 3OCTA 1YOLA 3W32A 3W8QA 3BYOA 3R0TA 4I23A 4MYGA 4D0XA 2OXYA 5I3OA 2A1AB 3BELA 4MD9E 3Q60A 1XO2B 3KN5A 4LGGA 4R3RA 3WF6A 2IW6A 2QONA 4YC6A 3UOKA 1S9JA 3KULB 1GZNA 1JPAA 1Q8WA 4FV9A 4XX9A 3FY0A 3LFQA 4RRVA 4QPSA 5H3QA 3PG1A 4YZNA 3VS1A 5I9XA 4NT4A 1ZMUA 4J95A 2WNTA 3Q5IA 4F6SA 3MH0A 1ZYSA 4Z55A 5J7BA 4OUCA 4O82A 3RM7A 3S4QA 5LVMA 4M13A 4EOJA 1Q62A 4UMUA 2HCKA 1DS5A 5AV4A 5KBRA 2W4KA 2YACA 4NUSA 2HIWA 4DEBA 4N4SA 4EH3A 4USEA 3G6GA 3O17A 2UUEA 4D1XA 2ITWA 3BYMA 4EZ5A 4FC0A 4M84A 4MXXA 2EVAA 3E62A 4CEGA 4CZTA 4ZEGA 3OT3A 3PFQA 2YCSA 4JIAA 4YZCA 3NUUA 5GZ8A 5JGDA 5CEKA 3ZEPA 2GSFA 3N51A 1XBAA 4EOSA 4QMMA 3PDTA 4JLCA 4C3PA 3C4ZA 1FMKA 3LFFA 3VBWA 1V1KA 4NM0A 3OY3A 4BDAA 2PMIA 3F5PA 4GK3A 4M66A 5JQ8A 4TYHB 3ZFMA 5A4QA 3R2YA 3QKKA 5AP3A 4LRJA 2DUVA 3PJCA 4FR4A 4MX9A 3KY2A 4P2KA 2OJGA 5IEXA 4YJVA 4I6FA 4WUAA 2XKCA 5HBEA 2PHKA 2BFXA 1OITA 3ORTA 3R1YA 2BILB 1VYWA 4FF8A 5DA3A 3DTCA 3R7VA 1AQ1A 2XM8A 3P08A 3F61A 4ZTMA 2PMNX 3DJ7A 4K1BA 5HE0A 1JOWB 4NIFB 2OF4A 4BR3A 3MVJA 1KSWA 3BWJA 4X3JA 2XJ2A 1CDKA 2X2MA 5E91A 4J7BA 3PPZA 1JSTA 1URWA 4TWCA 5D41A 4FIEA 4M7IA 3UNZA 4RIYA 3ZO4A 4GT4A 3D14A 1LR4A 3KGAA 3KXHA 4R1VA 4H36A 5EI2A 3ZSHA 4C36A 3UVPA 3R1QA 4BDFA 5JFVA 3TKHA 4I4EA 4EONA 4EC9A 5J1VA 3MYGA 2UZUE 4AWIA 3PSBA 1DI9A 3Q52A 2QKRA 1M7QA 2VWBA 2QO7A 2GQSA 1SVHA 3IDPA 4ZP5A 1H25A 1A06A 2HOGA 4O7ZA 2EXMA 2C6EA 3DBQA 3FDNA 3C0IA 1XJDA 4ZSLA 4BB4A 5BVNA 3RPYA 4F64A 3K5UA 5LVLA 2ITOA 5IQDA 2OU7A 4FTQA 5CSVA 4FOCA 4RGJA 1JSVA 1S9IA 4FV5A 3U4UA 4CGAA 3ANRA 4D2TA 5LJJA 3QC4A 5CVGA 2FO0A 4YJTA 4CFVA 1R39A 2OGVA 3HV5A 3FUPA 1FPUA 3Q4UA 4G6OA 3GEQA 4D2WA 5CLPA 3MB7A 1EH4A 3IS5A 3G90X 2ZB0A 3QQKA 1YRPA 2R3RA 4M8TA 1VR2A 3PJ1A 5AUTA 2VNWA 2JDTA 5LCJA 3U6JA 1NW1A 2OZAB 4GJ3A 3CY3A 5AAGA 1A9UA 2GNGA 3LFSA 3HL7A 1WBWA 5GHVA 3DLZA 3ORPA 4MTAA 5CF4A 3G33A 4MEDA 1RJBA 4DAWA 4U3YA 3RTPA 1LEZA 3OS3A 4LV8A 1Q61A 2XKDA 2HAKA 1OIQA 1WFCA 3PYYA 3R04A 5AR4A 4D58A 1OKYA 2HXLA 3DBFA 3LOKA 3MFTA 3PUPA 3IGGA 3E7VA 4LUEA 4C2VA 1ZYCA 5M09A 4ZTHA 2ZDUA 4C02A 4C59A 5HTBA 2YCRA 5K0KA 3TKIA 2B4SB 2O0UA 3R63A 4IFGA 5AUYA 1G8SA 4FTNA 2QOBA 4NTTA 3LZBA 3WOWA 3HMOA 2CKOA 1I44A 4L3PA 2W1EA 4OGRA 4U43A 5CT7A 5FBOA 3WE8A 4E6AA 2WAJA 5DPVA 5EQEA 3NUNA 3G5DA 4BDIA 3ZLSA 4Q9ZA 3B8RA 3QX2A 2P3GX 3A7FA 4IZ7A 3PZEA 4O0XA 2V7OA 3TZ9A 2OIBA 2UW9A 3HRCA 3R1SA 5EK7A 4L53A 5TF9A 2CDZA 3AT2A 3VS2A 4ZTRA 2FUMA 2XBAA 4G34A 2GTNA 3BU6A 1Q8TA 2XH5A 4KIKA 3BWFA 4KA3A 1ZWSA 5CAQA 2XVDA 1NY3A 3MJ1A 4YTIA 3VUKA 2CN5A 4C62A 1SYKA 3NSZA 4FSNA 3D2IA 4G16A 4JBPA 4WBBB 3ORZA 1WBNA 2B1PA 2VWZA 5HO7A 5HGIA 2B52A 3MTLA 3N9XA 4WRGA 3R8UA 1OGUA 2VNYA 4KRCA 4J8NA 4EC8A 4ZAUA 3PVWA 3E92A 3PJ2A 4GK2A 1YXSA 5F4NA 5AA9A 1XH4A 2I0EA 4I5CA 5ANDA 2I6LA 5JGAA 4R8QA 3QRIA 1E1XA 3CJFA 3I6UA 4X3FA 5HVJA 3SKCA 3PA3A 5ACBC 4FT5A 1OL5A 1OL2A 2QC6A 4RX7A 5E8WA 3L8XA 5L2WA 3UBDA 4E6QA 4PF4A 3NMUF 2IW9A 4OBPA 2HYYA 5EW9A 4USDA 3CQWA 3CSVA 5M07A 4FT3A 3VS3A 1R3CA 4EBVA 4J1RA 2VTTA 3NYXA 4YURA 2Y6MA 4I24A 3GI3A 4USFA 5KCVA 2XS0A 3LFDA 4QPAA 4JBVA 4BYJA 2QLQA 3LMHA 3SHEA 4NL0A 2OFVA 4BCNA 4E5WA 1OIRA 5HIBA 3FZTA 3VF9A 2WD1A 2PVJA 4QOXA 5BUIA 3MFUA 3RNYA 1OB3A 4ASXA 4MXYA 3WBLA 3ORLA 2ZYBA 3CKWA 3HP5A 3PVUA 2VWVA 5D7AA 1UWHA 3IONA 1ZOEA 4DF3A 4ANMA 4QMQA 2QO2A 4F0FA 4FIIA 2ZV9A 4IM0A 1H1QA 2WXVA 1VEBA 2PWLA 1LP4A 2B9JA 3DLSA 4H05A 4ZMEA 3ZXZA 2WTJA 5J8IA 3B2WA 3L1SA 3TG1A 2H6DA 1TKIA 1W7HA 3KN6A 3WF9A 2GHMA 3UQCA 3ENMA 3EFKA 3KXZA 3VS0A 4FOBA 4FA2A 3W33A 5GINE 4AZEA 4IAYA 5C8MA 2NO3A 3OOMA 2XK8A 4BI0A 4BVUA 4O7WA 4HGSA 5LWNA 3NS9A 5BPYA 1G5SA 5KMJA 3UDBA 4OAVB 4WOVA 4C38A 2ZM3A 4FSTA 2WEIA 3NIEA 3KFAA 2JEDA 4F9AA 2WMRA 4JRNA 5FTGA 4BY9E 3NIZA 2BZIB 3LMGA 2NRYA 3MN3A 3Q04A 4WNOA 5CQUA 3TZMA 3QD2B 4YJUA 3IW6A 1RQQA 3O8TA 3KC3A 5T68A 3ZFYA 4YJPA 3DAEA 3Q6UA 2IVSA 3G2FA 4KBAA 1KUTA 3LCKA 2ITNA 5AFVA 4L01A 3MY5A 4Y5HA 4HNFA 5HVYA 2GNJA 1PXKA 2ZV8A 2CNQA 1MUOA 3BGZA 4RIWB 4IWQA 3S95A 3DB6A 4L00A 3EQGA 2JBPA 3DBEA 5L3AA 4DTBA 4RVTA 4NFNA 2J6MA 2XP2A 1XH5A 4WSQA 2AC3A 3QCQA 1WBPA 5HCYA 2OI4X 1VZOA 2WQEA 4FX3A 5GZAA 1H24A 5C01A 3DT1A 4BTMA 3QUPA 5AIKA 2C5NA 5AR2A 4EH2A 3UJGA 1JKSA 1JLUE 3RPVA 1IG1A 1Y91A 2W4OA 4ZTSA 2JIIA 4FSRA 4FZDB 3TEIA 2QLUA 2RKUA 2YABA 3H9FA 1OKWA 4D1SA 3OWJA 4XG3A 5CAVA 1QPEA 3A7HA 2P55A 4W4YA 4S32A 3S00A 3EFJA 5BMSA 4A07A 4OTGA 4TY1A 4EHGA 3RWPA 1Q99A 2VTAA 2F57A 3PVBA 3R8ZA 4IJ9A 4GH2A 4W8DA 3FZ1A 3U9CA 4ZTNA 5I9WA 5HNIX 2IZTA 4PDYA 2OZOA 4IAAA 4ONAA 3O7LB 2YAAA 5I4NA 1OBDA 3RI1A 4BHNA 4F65A 2J0LA 3IKAA 2P33A 4YLJA 2F4JA 2QOLA 4QTAA 3ULZA 5J9ZA 4HCVA 4FI1A 4S2ZA 4I20A 5FRIA 3TZ8A 2WMBA 4E5AX 4CYIA 3QZHA 4QTEA 1RW8A 5CF6A 3W18A 3F66A 3LVPA 5I0BA 2UW0A 3OFMA 3IW8A 3DA6A 1JKLA 5A6OA 2WMUA 3CP9A 4EKKA 2UZTA 3ZEWA 1M2QA 4QNAA 2PZIA 3RVGA 1KE6A 3LCSA 3RBWA 3KVXA 3SXRA 3JY9A 4EOLA 3FQHA 3KRJA 4HYSA 4R7HA 1DAWA 5ANGA 2R3IA 2W9ZB 5B0XA 3SV0A 2F7ZE 2YIXA 3FC2A 4CVAA 5EQPA 2HXQA 4AW1A 4B8MA 1PMVA 2XM9A 4YJNA 1JWHA 1Y6BA 1FVVA 3NW6A 1STCE 4O2PA 3EFLA 5TKDA 1BLXA 2PZPA 4FKGA 3LLTA 4GS6A 5FEEA 4Y83A 1TVOA 1JAMA 1FOTA 3FKNA 3MW1A 4I1ZA 4W4XA 3QTRA 4N6YA 3AOXA 3E93A 3O8UA 4X0MA 3V6RA 5FXSA 5DOSA 5H2UA 2IWIA 2VO6A 2VTOA 4BWXA 3FE3A 2HW7A 3JXWA 5AUUA 2YISA 2CJMA 3NNUA 3P7CA 5CZIA 5G1XA 4M69B 3D15A 3CTHA 4BDGA 4HW7A 5L6PA 2W1FA 2WKMA 3CGFA 2PVHA 3NVMB 5DVRA 3ACJA 3MV5A 4L3JA 2DS1A 1IRKA 3D94A 3HV4A 1GOLA 3EQIA 3ZBXA 4I3ZA 4BI2A 4PY1A 2PPQA 3BV3A 1PKDA 4CCUA 3OW3A 3AC5A 4CZUA 3GVUA 4E26A 5LMKC 2J90A 4RWIA 3BQRA 5CVFA 2ITZA 3HRBA 4MNEB 4BCQA 1YDRE 2VZ6A 2FSTX 4IX6A 2C6LA 4DFUA 4GT5A 1WZYA 4QYFA 4PDPA 4PUZA 3KA0A 4GKHA 4IEBA 4GMYA 2G1TA 4QT1A 5FXQA 4AXAA 3DKOA 4CKRA 3CR0A 3FSFA 4PX6A 3COHA 4YBKA 5DBXA 4AQCA 4R5YA 4O6LA 1ZYLA 2QOIA 5AADA 5KHXA 2OK1A 3ERKA 3W16A 4AAAA 4KAOA 4YO4A 4JJRA 2C69A 3RHKA 3VQHA 3Q9YA 1RDQE 4I41A 4AZTA 3W2CA 3EMGA 3HLLA 3OOGA 4QNYA 4BICA 3ZLWA 3PIXA 3KMUA 2FSOX 5C8NA 2GTMA 3DCVA 4XP0A 5CEQA 4ID7A 1SVEA 4ZS4A 3VS5A 3DOGA 3R9RA 2VWXA 4RJ5A 4AGWA 3GGFA 2BIKB 3U55A 5LMAA 1B39A 4UB7A 4ANNA 3ATTA 2W17A 4M14A 2QVSE 4RX8A 3VUGA 3V5PA 1WAKA 1OPJA 3R00A 1H07A 3D4QA 2X81A 1UU9A 3OY1A 4KABA 4QMOA 4ACGA 4QMPA 2OXDA 3AGMA 4F7NA 3ZLYA 5F1ZA 4AACA 5IA0A 2CHLA 4G9CA 4LUDA 1DI8A 5ETCA 5HG7A 3V5QA 3HYHA 3CIKA 5AUXA 3VN9A 3TDWA 4A9RA 4FSUA 2YCQA 3KQ7A 4O7VA 3SC1A 4EJ7A 3IECA 1XWSA 5KKRB 5A9UA 3LFAA 2Z8CA 4RFYA 2R7BA 4F1TA 5BVFA 5M4UA 4P5ZA 5HU9A 1AD5A 3I7BA 4O96A 1PYEA 3AD4A 2GMXA 4IAFA 3GNIB 1UNGA 4FVRA 2GHLA 4FV4A 4JS8A 4JVGA 2ITTA 3QYWA 2JIUA 3S2PA 2X7FA 4IB3A 2ONLC 4O27B 4BBEA 3TACA 4FIJA 3UPZA 4QP1A 5C27A 4B8LA 1G8AA 4YTHA 3A8WA 2BMCA 4IMYA 4R3CA 5C03A 3W1FA 1ATPE 4EK6A 3F2NA 2BKKA 2KULA 4L68A 5E8UA 1TQPA 5AM7A 4DYMA 3LFBA 3O0GA 4FTJA 5BX0A 4QYYA 4FZ7A 4Q2AA 4QTDA 2C6IA 4CG8A 4HZRA 2V55A 4G3FA 4OTHA 3DJ5A 3LPBA 2VO0A 4DEGA 3C9WA 3QCYA 1PXOA 2BAKA 2VV9A 3KMWA 3R30A 4TYJA 1UA2A 3WZJA 3C4XA 2OW3A 4O0SA 2ETMA 3P5KA 5HHWA 4UZHA 1W0XC 5EHYA 4ASDA 4BFMA 2NNWB 3JVRA 3LQ3A 4XJ0A 3JUHA 1GAGA 3NNVA 3CE3A 2JAVA 3E8DA 3MGYA 3QTWA 5LMKA 1YI6A 3GU6A 1CKJA 2HZ0A 4QMYA 4GUBA 5IQHA 4IM2A 3PSDA 3EN9A 4ZY6A 3R7IA 3MY0A 4G9RA 5DEWA 5L4QA 5AX9A 5EW3A 5CEIA 4TN6A 3GCVA 3EIDA 3NUYA 4TKSA 4YTFA 4MXAA 4RQKA 2PE0A 4FBXA 2YM6A 3OCBA 2BRBA 2XB7A 3QQLA 2PVYA 4E3CA 3NX8A 3E8CA 1GIJA 4DN5A 4CLJA 4FKIA 4AP7A 4FV1A 1BL6A 4UYAA 1OBGA 5JZNA 4J97A 2QOCA 4DG3E 4NM7A 2J9MA 3QF9A 4B99A 4Z3VA 5TO8A 3E63A 3I5NA 4RA4A 4ZK5A 1ZLTA 4I6QA 5KMKA 4XYFA 3ORXA 4D55A 4ALUA 2JAMA 4Y5QA 4QP6A 4H39A 4IDVA 2BAJA 2J51A 5M08A 3EOCA 4QQJA 1SZMA 2WPAA 1U59A 3V04A 5IUGA 5K4JA 1YXXA 1Q8UA 1IA8A 4FL2A 4RT7A 3R9NA 3QRUA 4ZTLA 4A4LA 4I22A 5IUHA 5IA3A 1PXNA 2F9GA 3KK8A 4IB1A 5K3YA 2Z60A 3LCTA 3T9IA 4GYGA 4XG4A 2J4ZA 5H8GA 3RWQA 4IACA 2YM3A 4IVAA 3Q9WA 2C5YA 2VX3A 4NTSA 4F09A 4P4CA 1MRVA 3ZC6A 5JSMA 1IAHA 3F2RA 3RAIA 4O7SA 1BL7A 5CEOA 4ZSJA 3G0FA 5B7VA 2E9PA 1O9UA 2XF0A 5FM3A 4B6LA 3FMMA 3UE4A 4QMUA 2ZVAA 4F7LA 3U6IA 3A4OX 4CT1A 4H1JA 1J7IA 2XEYA 4DH7A 4R77A 4KIQA 4FKRA 4OTWA 3VO3A 2X7OA 2Q0BA 2YDIA 3P7AA 4BGHA 3JVSA 3F3ZA 3WZKA 3ROYA 2UW3A 4PNKA 5CEMA 4EK8A 4IHPA 3NUSA 4HGLA 4AG8A 4OAUC 1B6CB 4N0SA 1UNLA 4KSPA 3I1AA 1YWNA 5DIAA 3CS9A 4D4VA 1U5QA 3E88A 3KCFA 1PXLA 4A4OA 2R5TA 2YWVA 3DFAA 4CRLA 5EFQA 3R7UA 2X6EA 4JXFA 4ZY5A 5DT3A 3CJGA 4EH7A 3F3WA 4HJOA 4JL9A 4AE9A 2YM8A 2C1AA 3F3VA 4EZ3A 4KBCA 2J0MB 5L2QA 3OP5A 4GL9A 2HZ4A 3L9LA 4IZAA 3DY7A 2ZMDA 3D5WA 2VWYA 5J5SA 4A9YA 2R0UA 2CLXA 3GCSA 4MCVA 1OKZA 4D4SA 4DGNA 3UYSA 4O38A 2YIQA 4C3FA 4V0GA 3G51A 2WTWA 4IC7A 5EI6A 4G31A 4CYJA 2BDFA 4XRLA 3ZUUA 4EEVA 5DEYA 4BI1A 3LFCA 4KBKA 1Q8ZA 4JQEA 3RZFA 3PRIA 4PTCA 4EUUA 3OT8A 4LOOA 4FSMA 5TOZA 3V51A 4TYGA 3FLQA 5CU3A 5HIEA 5AUZA 5BYYA 4UEUA 3CXWA 4ACCA 4WBOA 2C5VA 4FT0A 4ARKA 3POOA 1YXVA 3QXOA 4H1MA 5LVPA 4GW8A 1I09A 2Z02A 5AP4A 4TYHA 4BCFA 2WMWA 3TV6A 3U8WA 4TTHB 3KKVA 4RA5A 4KIPA 3UVQA 4UXLA 3I6WA 2YZAA 2CGVA 2XKEA 4U41A 4DGMA 4I93A 4MBLA 5ICPA 1NT2A 3MIYA 3FXZA 4X3FB 3D9VA 2OICA 3NAYA 1JBPE 3QFVA 2YM4A 4C57A 1KE7A 4IX4A 3NLBA 4BCKA 2BHEA 2X2LA 4XLIA 5CY3A 3OWLA 2Z2WA 5IH4A 3WF5A 2XIRA 4FNYA 4GIHA 4L3LA 1XKKA 2GFSA 4C4HA 3BV2A 4YJRA 3BEAA 4C34A 5AV1A 1REJA 4D1ZA 2JFLA 4FTLA 1H0VA 5CS6A 3CPBA 3GOPA 4NYEA 4FT7A 3A99A 2VTNA 4NM3A 2I0HA 5HTCA 4WHZA 1H00A 4F7JA 5C1QB 4UXQA 3WILA 4J96A 2UW4A 4AT3A 3LLAA 4MQ1A 2XK7A 4CKIA 2YM7A 1R0EA 2PSQA 4WNPA 4BKZA 4IAKA 5D1JA 3EKKA 4CFUA 1P5EA 5C8KA 4L67A 4O22A 4FV0A 3QGWA 5AR3A 3LJ1A 2NP8A 2PE1A 3VJNA 3PXKA 4KSQA 2W1HA 4ANSA 4RVMA 3IOPA 5CF8A 4FNXA 5L2TA 2P0CA 5HG8A 3W10A 1SM2A 4FKQA 4CTBA 3CLYA 1J1BA 1OZ1A 4DH3A 4PDOA 2J7TA 5JH6A 3BHHA 4I21A 2WTKB 5I9ZA 3M11A 2FB8A 4C61A 4XG7A 1GZKA 4E1ZA 4AU8A 5FQDC 1CTPE 5J87A 3FHRA 2VGOA 2OSCA 2KTYA 3P78A 3QWJA 4EI4A 3OBJA 4FODA 3QTXA 4JDJA 3UYTA 1H1WA 2B54A 4D2PA 5DR6A 5EHLA 1LEWA 3PE1A 4DBNA 5CALA 4C35A 2PVRA 2UZLA 3MH3A 5FEQA 3BE9A 2GNIA 4IW0A 3MVHA 2FVDA 4IWOA 4QQ5A 3A2CA 5AV3A 4ZIMA 3HP2A 4RX5A 2X39A 4PPCA 4ASEA 2OF2A 5IH5A 4Y46A 3FI2A 2ETRA 3ROCA 4G6LA 5KNJA 3I79A 3UVRA 1QPDA 2EB3A 4DFYA 1XHAA 4E8AA 1JQHA 2PUNA 4IAZA 4DT9A 3ANQA 3QL8A 4LMUA 3BX5A 3P23A 2WTCA 3HV3A 4XUFA 5EYKA 3C4EA 3HAVA 3C4FA 3PY0A 2B55A 2C68A 3BGQA 4FEQA 5ANKA 4BTFA 3PE2A 5M06A 4YHFA 1P4FA 4O83A 4L9IA 2GS6A 2BIYA 3JPVA 3FKOA 3Q3BA 2QU6A 3DAKA 3Q6WA 4O7NA 4X6QC 4YTCA 2R3JA 5KZ0A 3QXPA 2REIA 5IKWA 5DT4A 3O7LD 4DHFA 2V0DA 4MH7A 4UN0C 4DG2E 5CT0A 3MA6A 4FTMA 2B9FA 4RZWA 4F9YA 5FTQA 2R2PA 3AQVA 4O0WA 2Q83A 5FTOA 3VBTA 3DPKA 2F7EE 2X8IA 4ANBA 4ACHA 2WGJA 3GBZA 3TDVA 5HEZA 3GUBA 3VQUA 3ZC5A 4O6EA 3LQ5A 4BTKA 1WBTA 2BCJA 1GZOA 4C4IA 1M52A 3EQRA 2UW6A 4GG7A 4WSYA 4YLKA 1YI3A 2BRNA 3NWWA 4ACDA 3KVWA 2Z7SA 4U7ZA 3ORKA 5AR7A 3ZOSA 2C5XA 3PIZA 5C9CA 2R3NA 2CPKE 4BDBA 4RJ8A 2OIDA 2QNJA 2WQBA 4E4LA 4DTAA 2W7XA 3O2MA 3P86A 3NVKI 3OHTA 3H30A 3A4PA 5CVHA 3L9NA 3NGAA 3MFSA 4TNDA 5CSXA 3UC3A 5A54A 4A06A 5JN2A 5BVOA 2C3JA 3RALA 4KIKB 3QRJA 3D5UA 2J50A 4TT7A 2W4JA 4HVGA 3N4VA 4RZVA 3PZHA 4AW2A 4CTCA 5IPJA 5ETAA 3FKLA 4H3BA 2C0IA 4W4WA 3T8OA 4C7TA 1QPCA 5EHOA 4ZSEA 4N57A 5EDRA 3WE4A 1PF8A 1CKIA 3E5AA 1DM2A 2BZHB 4XCUA 5DHJA 5T6KA 3UO5A 1FGKA 3DTWA 4F9WA 3C5IA 2BKZA 5CI6A 1Z9XA 4JDIA 2YERA 3FPMA 5DR9A 3ZM9A 5EYDA 1ZYJA 3IGOA 4YP8A 3DU8A 3EZRA 2W96B 5GNKA 2A19B 4GK4A 5CU0A 5ANIA 4Q5HA 3RPSA 2BPMA 2BZKB 2QOKA 2VTSA 4KNBA 4PQNA 4RIYB 2QQ7A 4AUAA 2BRMA 4WA9A 4K0YA 4F6WA 4LYNA 4MXZA 2ONLA 4YZMA 2YITA 2R3GA 3UOHA 3MY1A 4BBFA 5LARA 3R7OA 3H9RA 5F95A 3ACKA 5IQAA 4DFLA 4C0TA 4BC6A 2XKFA 2F2CB 4NU1A 3PA5A 5IQEA 1ZAOA
chains in the Genus database with same CATH superfamily
3MESA 3ZTXA 4BN1A 1WVWA 1FMOE 3VC4A 3ZYAA 2WMXA 4RC2A 3ZO2A 4ANOA 2CGWA 2IVVA 2C4GA 3DK7A 4QTCA 1H1SA 2HK5A 4FTCA 3KRWA 5C4LA 4IZ5A 4TZRA 3LCDA 2UZOA 5ACKA 3SVVA 4F1MA 5IQIA 2VRXA 4EQCA 4PPBA 4BCJA 1MQBA 3QGYA 4OTQA 4YHJA 2CGUA 3LM0A 3MDYA 4C4GA 5IMXA 4PL3A 5DH3A 2YIWA 2ITVA 5EW8A 5EKNA 3DDPA 3ET7A 4HPTE 3EKNA 4JX3A 3HDMA 1FVTA 4PMPA 5ETIA 4G3DA 2LAVA 3R9OA 5A4CA 4FEVA 3I5ZA 4BKYA 4IWPA 1YKRA 4LL0A 5CYIA 3PXRA 3L8VA 3BYVA 2RSVA 3O23A 4O4DA 3SOCA 3QHWA 3AMYA 3MPMA 3QC9A 4ALWA 3R8LA 1V0BA 3U4WA 5FD2A 4DEEA 5A14A 2XNBA 4IVCA 2ZAZA 1NXKA 2B0QA 4FG8A 2VD5A 2VN9A 4QMLA 5LVNA 4RG0A 3A61A 3BGPA 4J98A 4G1WA 4CMTA 5LWMA 2UZNA 4LOQA 4PNIA 4R7IA 3VHKA 4E6CA 5L8LA 4QMSA 4R78A 1KV2A 4FE2A 2PUUA 2WTKC 5CTPA 2UZEA 3A7GA 5CAOA 3KIOC 5J7HA 3W0QA 1KOAA 3C4WA 3TXOA 4FKUA 5HX8A 4DHIB 3K54A 4MQ2A 2V22A 4IM3A 4W8EA 1R78A 3R9HA 4A9UA 4APPA 4TYIA 1H8FA 1HCLA 1YDSE 4C4EA 3NNWA 2X4FA 5AEPA 2G01A 3PTGA 3SRVB 4V05A 3NW7A 4L7SA 4AGUA 4K2RA 5C26A 3OEFX 1YDTE 1K3AA 1OVEA 2OWBA 2IVUA 4ERKA 3MI9A 3AKKA 4O4CA 5AMNA 3ID6C 3OXTA 1J1CA 2R4BA 2XNGA 4KIOA 4AZSA 4E73A 2W1ZA 1IA9A 1HOWA 5ETFA 3SXSA 3SXFA 2W5BA 4W4VA 1Y8GA 2GS7A 3Q4TA 4TPTA 4EOIA 3O96A 5L2SA 4MXCA 5DI1A 4BCIA 3QLFA 4I6LA 4E7WA 2XNOA 4HGTA 4JBOA 4ZZOA 4BCOA 4FKOA 5K4IA 2CN8A 3EL8A 4IVDA 2RGPA 5LOHA 3F7WA 4AT4A 3II5A 3UO4A 2VTJA 2YCFA 3EQHA 2BUJA 5HI2A 5CXZA 1KE8A 2QI8A 3A62A 4NW6A 3FPQA 4FTAA 3KRLA 5CSPA 2FGIA 5E4HA 4NWMA 3VBXA 3UTOA 5GIPE 5BV3A 1OMWA 4L46A 4QO9A 2YA9A 3AKLA 2WU6A 4IQ6A 4IX3A 2BRGA 3QAME 2X0QA 4M97A 3NW5A 3MBLA 2OG8A 3PLSA 2CNUA 2W05A 3PXYA 3MH2A 4OBOA 4KS7A 4OW8A 4JMQA 1QPJA 4XV3A 2VU3A 3WI6A 3AMBA 4DGGA 3GCUA 4J99A 1T45A 4YPDA 3UP2A 1L8TA 1E9HA 1OIYA 3M42A 3L9PA 4JAJA 5CWZA 4DH5A 3FI8A 5T3QA 2IG7A 2CGXA 5IUIA 4PL4A 3EQPA 5AWMA 4ZJIA 5DRBA 3AC3A 4QTBA 1YQJA 3MPAA 4DG0E 5A4LA 2W9FB 3COIA 5AP6A 4HPUE 4FEUA 2O2UA 5I9YA 2PVFA 4DC2A 4EUTA 1X8BA 4HCUA 3PA4A 4JT3A 5H9BA 2XYUA 5DRDA 1P2AA 1W98A 2ZV2A 3U87A 3F5UA 4XLVA 2W1DA 1FBNA 3SOAA 4CV9A 3V01A 1KE9A 3LFEA 3NYNA 3RAWA 3ZO1A 3W8LA 5J5TA 4O2ZA 2CKQA 1M2RA 4XHKB 4O21A 5EM6A 4AZVA 5CNNA 3FQEA 4EK3A 2B9HA 3PJ8A 5A46A 4YPSA 3EQFA 4Z7GA 4AN9A 2RFNA 4QEBA 1OPLA 4MNEA 2XIYA 4OTFA 5CX9A 3TNHA 3UC4A 4I0RA 2VX0A 3FXWA 5FLFA 4XMOA 4IBMA 4WG5A 3BHYA 4RLLA 2PY3A 1REKA 2VO7A 3WF7A 3PP1A 2XMYA 2PVMA 4ZLYA 4JIKA 3D5VA 4NFMA 2Y8OA 2OJJA 5KMIA 4LFIA 3U6HA 3CGOA 2JC6A 4JG8A 4S30A 2BZJA 3BQCA 3G0EA 5AUWA 5IQBA 1H1RA 4AGCA 1KV1A 4TXCA 3BYUA 1WBOA 3ZZEA 4FYOA 4FZ6A 3MSSA 3F88A 3ULIA 1URCA 2XYNA 3QD0A 4YO6A 3UZPA 4HVSA 4WNMA 5TR6A 3AMAA 1J91A 5M55A 5CENA 2OFUA 2RG5A 4UALA 2PE2A 5E8VA 5IG1A 1OUKA 2R3KA 3FYJX 4V04A 3E3PA 1PJKA 4FV7A 3GB2A 4BJJA 4BIEA 3B2TA 3P4KA 2R3LA 5IDNA 2YJSA 4FSQA 4KD1A 4YJSA 4CMOA 3ZLXA 4DTKA 3QRTA 3FMKA 3BI6A 4U5JA 3UG2A 3WIKA 4NCTA 1L3RE 3BCEA 2G2IA 2YZLA 4IDTA 3QZFA 4F08A 3LM5A 1ZZ2A 3PXQA 3FYKX 4IX5A 4GYIA 2I40A 3SDJA 1Y57A 4XG2A 3VWAA 1Q8YA 1ZXEA 2UVXA 1WMKA 3R8MA 2QR8A 4H58A 3TJDA 1DAYA 4E6DA 5DG5A 3IDCA 3RAHA 4E4NA 4XOZA 4H3PA 3MFRA 3QQUA 4ANQA 4C58A 4EHEA 4RC3A 3ZCLA 4YLLA 4YZBA 4C4JA 4K8AA 3FZPA 3K3JA 3QU0A 4I92A 3FXXA 4LQMA 4M15A 4HVHA 4WG3A 5BUJA 1YWVA 3IO7A 5I3RA 1W8CA 4GV1A 4RIXB 4LGDA 3DKCA 3KXXA 3QD3A 4FK6A 3EYHA 5E8ZA 4JQ7A 4EL9A 2E9UA 3I0QA 1GIIA 3MA3A 5FM2A 3Q53A 4MK0A 4DE4A 1BMKA 3RKBA 2JGZA 3DNDA 3BIZA 3FZSA 4FZFB 4XV2A 3BLQA 4MD8E 5D10A 3GQLA 4QMXA 3W2QA 2VWIA 5JK3A 5CXHA 5HG5A 3MVLA 4AA5A 3UZRA 2BAQA 4QP4A 4LDTA 3R7YA 5EM5A 4ERWA 3FI3A 2C0OA 2V7AA 3ETAA 2W1IA 4GCJA 1F3MC 3PG3A 4FV2A 4LL5A 2G9XA 3EQBA 4NM5A 2H34A 3NEWA 4HYHA 5FDXA 2FYSA 3NR9A 3DAJA 4WD5A 5D7VA 3ZUVA 3S3IA 4UZDA 5HBJA 4CG9A 4OBQA 3QLGA 3FLYA 4B9DA 2QHMA 2E9VA 2JITA 3UQGA 3P9JA 3RINA 4R1YA 1PW2A 4BDCA 4BZNA 5CEPA 5HORA 5EDPA 4D2RA 5M53A 3PWDA 1JKKA 3PPJA 4AGDA 3DXNA 4O1OA 4X2NA 5JRSA 2Y7JA 1HCKA 3QX4A 2IVTA 2OKRA 1YHVA 3DXPA 4BZOA 3W2SA 4DLIA 4II5A 4QP9A 3WIGA 3EQCA 5L2IA 1QL6A 3BRBA 3F9NA 3MIAA 5DR2A 2B53A 2FSMX 1OL1A 4NEUA 4J8MA 4BF2A 3ELJA 4EBWA 2NPQA 5AP5A 1NVQA 3UIUA 4FEXA 4DDIA 1PMEA 2WEVA 4BZDA 4NK9A 3CQUA 3FMJA 3R21A 2I7QA 3DS6A 3HUCA 3OZ6A 4NKSA 3HMIA 3LXLA 4L42A 2J2IB 2IW8A 4EOPA 2DYLA 3RP9A 4QRCA 4MHAA 5IDPA 1U54B 4FV8A 3OCSA 5TT7A 3NNXA 3DNEA 2HZIA 3R9DA 1OUYA 4I94A 4Y95A 2O65A 4DFZE 4QPMA 3HV7A 3MB6A 4AF3A 2PL0A 1UU3A 4C33A 5M57A 3R7EA 3ML1A 1IR3A 3V8SA 4AW5A 3KREA 1H01A 4ITHA 4NCTC 4PPAA 4AXFA 5IQGA 5F20A 4I0SA 4AN3A 3BKBA 5IA4A 5HD7A 4E4XA 2IPXA 2JLDA 2QKWB 2QOQA 3ZSIA 2JBOA 2WTVA 3SAYA 4G3GA 2C6OA 3EFWA 3PJ3A 4EH8A 5M44A 4O86A 3BLRA 5J9YA 5E1SA 2YHVA 4M0ZA 3OMVA 4ZLOA 5JRQA 1PKGA 5KUPA 4U40A 1F5QA 2H96A 3DB8A 3M1SA 4FT9A 4KRDA 4RWKA 5H8EA 4BTJA 4D2SA 4DEDA 4O0RA 4U45A 3DBCA 4EH5A 4WUNA 2QOFA 4FZAB 4GT3A 4FNWA 3D7ZA 4J52A 2Z7RA 3Q96A 3TTIA 3WARA 3PWYA 1K2PA 3AT4A 1YHSA 1SMHA 2GNHA 4EKLA 4W9XA 4Y72A 5F94A 3VS7A 3UOJA 3K2LA 5IQFA 2BRHA 4I5MA 3EZVA 4F6UA 5AA8A 4RQVA 2IF8A 2UW5A 4J53A 5EH0A 3RK7A 5HQ0A 4CFXA 2VUWA 4GSBA 3VRZA 3HMPA 4CFFA 3HZTA 5JGBA 4RIWA 3KULA 3QA8A 4G3EA 4UWYA 5BVDA 4UMQA 5HNGA 1YOJA 3BYSA 3UMWA 1VYZA 2AUHA 2XK4A 4FTTA 5FP6A 2Q0NA 1OL7A 1MRYA 3QTUA 2PK9A 4XBRA 4U97A 4GEOA 4ENYA 4QYEA 4FKSA 2IZUA 4AXCA 3JS2A 3WYYA 3PVGA 4D2VA 2O3PA 2W06A 1E1VA 2Y6OA 3H10A 4RJ7A 3BLHA 3V5TA 4CD0A 1OGYA 4QMTA 5HE1A 5HD4A 1YXUA 3SW4A 4BCMA 4KINA 3LJ2A 3FWQA 3FC1X 5CQWA 2BROA 3CQEA 3VULA 2VO3A 2GFCA 2RFSA 4S31A 1FINA 4HGEA 1KOBA 1YI4A 3COKA 3QHRA 4IC8A 4NSTA 5HG9A 3TNPC 3ZRMA 3MPTA 4BBMA 2Y4PA 2OH0E 4PTEA 5HBHA 2XEZA 3GFEA 1WVYA 3MVMA 2HY0A 4FSWA 3C0HA 1AGWA 3NUAA 3FMDA 5AV2A 2QU5A 1JVPP 3OF0A 3GT8A 2JDOA 2CMWA 3F7ZA 1LUFA 3POZA 5HU3A 4KUJA 3F5GA 2PU8A 2C3IB 2Z7QA 1ZZLA 3OD6X 4BDKA 4E93A 4O0VA 4JBQA 3UOLA 4DH8A 4R6VA 5DMZA 1J3HA 5H8BA 3OW4A 5I9UA 3ZU7A 3OUKA 5AP1A 4BCGA 2EU9A 4K18A 2X6DA 5HVKA 3TNQB 3O5AA 3V8TA 3BPRA 3V8WA 2I1MA 4MNFA 5EOLA 5FXRA 3R71A 5KE0A 2GPHA 4A7CA 5BQ0A 1M7NA 2A4LA 3RGFA 3P5JC 5KHWA 2X9FA 2ITYA 3U51A 4AA0A 4YBJA 1G8KA 2V5QA 3S1HA 2RFEA 1T46A 5CZHA 3NUXA 1U46A 2R3PA 3AT3A 4PP7A 4FIFA 4RWLA 5IZFA 4LM5A 4X2FA 3BZ3A 4FNZA 4P5QA 3GC7A 2C30A 4AE6A 3ZONA 2IN6A 3JY0A 3W2PA 4YUQA 3PLAE 1Y6AA 3DV3A 3EB0A 3CBLA 3GU4A 3R83A 4JRVA 4KKHA 4A9SA 5M4CA 4I4FA 3IQ7A 5HTIA 4FEWA 1ZRZA 4OTIA 3U54A 2H9VA 4DITA 4M69A 4YZ9A 1FQ1B 3G9NA 3BHVA 4B7TA 2XAOA 4PV0A 2JKOA 4RBLA 5EG3A 3PFYA 4S34A 4CV8A 2ITQA 3I60A 3AG9A 4AOTA 1O6YA 2JDSA 4X2GA 4CMUA 5E9EA 4EYMA 3S0OA 2EWAA 5FBNC 2XNPA 2X8EA 1Q4LA 2XJ1A 2CKEA 4FGRA 2PVLA 3GP0A 1ERKA 5JQ5A 2WB8A 3E64A 4FIHA 1R0PA 4C3RA 4GFMA 2UZWE 2QOOA 1F0QA 4MBJA 4WT6A 2CCHA 2OJIA 3VVHA 3DZQA 4D28A 5HCXA 4DGOA 5IEVA 2XARA 3THBA 4YNEA 3ZH8A 4EOKA 4QP2A 5E8XA 2E9NA 5BVWA 4QMZA 2A0CX 3ALOA 1XH7A 3TIYA 4ZSAA 3FMLA 2WELA 3VW6A 2O64A 3ZXTA 5E8YA 4X21A 4MBIA 2VTRA 2P2HA 2XNEA 2QODA 3PY3A 2UVYA 4FUXA 4XG6A 4OTPA 3WF8A 1ZMVA 4C8BA 3P79A 2XNNA 4FKTA 4U3ZA 5IEYA 3W55A 5K5XA 1PXIA 4G6NA 3CEKA 3MTFA 2ZJWA 4EQMA 4JG6A 2BTRA 5IA5A 4BCHA 2ZMCA 1M2PA 1O6KA 3TWJA 4BCPA 3KU2A 4TWPA 5I5ZA 1OECA 3TI1A 2CKPA 3O71A 4FICA 3OWPA 4J71A 3F6XA 3QCXA 3NRMA 3MS9A 4QP7A 4N6ZA 4RLKA 4XRJA 4YMJA 2BDWA 5KMLA 3EN4A 4HZSA 1QMZA 2X9EA 4H3QA 4TYEA 4Z7HA 2P4IA 4MKCA 5IA1A 2B9IA 3SX9A 1PRYA 3UP7A 4KS8A 5C4KA 1TZDA 4RVLA 2RL5A 4NKAA 1W2DA 5J79A 4IB0A 4D4RA 3BU3A 5E8SA 2VWWA 3E8NA 5DE2A 4EH6A 5FUTA 5CU4A 1M14A 4APCA 4O0YA 2G2FA 4G5PA 3GCPA 4ZSGA 4UV0A 3C7QA 2EB2A 2WU7A 3OWKA 4FTOA 4MF1A 3R8VA 3DDQA 4O1PA 4X6RA 2BDJA 5HNBA 2HENA 3P7BA 5DNRA 5E7RA 3DZOA 3NDMA 4F78A 3FMHA 4CNHA 2RIOA 3RM6A 2C5OA 4OLIA 5BUEA 4A9TA 5AX3A 4IXPA 4YNOA 1ZARA 4AS0A 4X2JA 3RMFA 4XH6A 4B4LA 2H8HA 5JT2A 3UNKA 4LV7A 5G6VA 2IJMA 5HZNA 4RX9A 3ZRLA 3CCNA 3SGCA 3W0MA 2VGPA 3GU7A 4L8MA 4G3CA 5CU2A 3HMMA 4XG9A 1PXPA 2YJRA 2QO9A 3TL8A 1OPKA 5AV0A 2QURA 5JKGA 2QR7A 4PTGA 2R3QA 4QMNA 1BX6A 4FV6A 4AFEA 2OO8X 2C6TA 4RIXA 2OIQA 4ENXA 4DCAA 3FLWA 4ZZMA 4AQKA 2J5EA 5LVOA 4A4XA 2R3HA 1PY5A 2YLFA 3AD5A 4DFNA 4DH1A 5E90A 3DKGA 4I6BA 4Q9SA 5EYCA 5CAPA 5K5NA 1PXJA 3R8PA 3R73A 3FQSA 3VBVA 1J7UA 3EN5A 3R02A 2XJ0A 2VTMA 2QD9A 3G6HA 4CLIA 3BE2A 3WZEA 2JD5A 3D7TA 4ITIA 5DLSA 5M51A 2GU8A 4P90A 1KE5A 4M0YA 4JI9A 4WRSA 3UGCA 4XS2A 5D12A 5L6OA 4R7BA 3V5WA 1H08A 2O5KA 2CSNA 2IO6A 3ZHPC 2PZYA 2PTKA 2JKKA 3HA8A 3TNWA 4ZJVA 3BU5A 4QYGA 4BWPA 1PMUA 1U5RA 3V5JA 2VTIA 2BHHA 5CASA 3F69A 3KB7A 4BHZA 3ZRKA 2O8YA 2WHBA 5AAFA 5KMMA 4BDJA 5IU2A 4K11A 2I0VA 3UMXA 4DEHA 2WZJA 4X3FC 4IJPA 3T9TA 4KWPA 4K33A 3E8EA 1H27A 5HLNA 3LW0A 2JDVA 3RAKA 4BGQA 3FZRA 2PMLX 4RPVA 3SA0A 1OM1A 3HEGA 5DYJA 3FZOA 5ANEA 2A98A 1W82A 3LQ8A 3VUMA 2XRWA 1UU7A 3D0EA 5AJQA 4PL5A 4Z9LA 5KMNA 5DFPA 3Q4ZA 1WBSA 3GCQA 3QRKA 2VAGA 2JKMA 4N70A 4U79A 4KB8A 3T3UA 5E92A 2HW6A 3R7GA 4BDHA 1PHKA 3TTJA 3HAMA 4YU2A 4KKEA 4HNIA 3VJOA 1JKTA 4C4FA 1WVXA 4LOPA 2ZDTA 1ND4A 1W83A 5HO6A 5M4FA 3GU8A 3ZDIA 2YM5A 4RWJA 5BVEA 2ITUA 4JR3A 3ZDUA 2QG5A 2C1BA 3D5XA 4I6HA 4GVAA 1H1PA 1UKIA 3TT0A 4NZWB 3H0YA 3I0OA 1Z57A 4RFZA 2C0TA 3TN8A 4L44A 2JFMA 4XEYA 1JSUA 4ANLA 3FAAA 3CTQA 4FTKA 4HOKA 4FK3A 4RJ6A 5HE3A 2QG7A 3W0NA 2WTDA 2XRUA 1MRUA 3FY2A 3PIYA 4AAYA 2UW7A 2W5AA 5BNJA 3WYXA 4D9TA 2SRCA 5HOAA 4X7QA 3VAPA 1OIUA 4RIOA 4Y73A 3KEXA 3UDZA 3KL8A 3KRRA 3OCGA 1MP8A 5E1EA 5A3XA 1OI9A 4EOMA 4EK5A 3FSKA 3PXZA 3DGKA 4ITJA 2YFXA 2UZDA 3LE6A 3CTJA 4ZS0A 4QYHA 2E2BA 2PVKA 3TV4A 4EH4A 3LXNA 1Q97A 4O7YA 4MAOA 4DBXA 3UNJA 4R5SA 2ETKA 5JFXA 4PP9A 3PRFA 4EWHA 4CSVA 4JQ8A 4L43A 3HKOA 3LXKA 4JOAA 4L52A 3VHEA 2FSLX 5JEBA 1ZY5A 3HV6A 4F9BA 1Y8YA 2R3MA 2XCHA 5K0XA 4FVPA 2WQMA 3VNTA 3FBVA 4AOIA 4OT5A 3SRVA 2OLCA 5CANA 4F4PA 3ODZX 2WOTA 4V0GB 4FSZA 4XV1A 5JZJA 2C6DA 3Q5ZA 3HX4A 4GRBA 4JNWA 4LRKA 1Q3DA 5HX6A 4TRLA 4W9WA 3BL7A 3IW5A 3TUCA 3VONA 2DWBA 3DXQA 4FL3A 1Q3WA 4U6RA 4AFJA 3GQIA 3QTZA 3FMNA 2YN8A 3A60A 3UO6A 4AOJA 2F7XE 3QALE 2YDKA 2VTHA 4UBAA 1W2CA 4RFMA 2UVZA 1BI8A 4LGHA 4L6QA 4HYUA 4F70A 5LMBA 4XP2A 3NCZA 3VW8A 2A27A 4DEAA 5HLWA 4WIHA 4HVIA 3AC8A 1QCFA 1G3NA 1YXTA 3ORIA 4U9AA 2EUFB 2R3OA 4AX8A 2VTQA 4CQGA 4ZOGA 4ZY4A 3IK3A 3FL5A 1V0OA 2AEGA 4IIRA 1UV5A 2PUPA 3IPHA 2W1CA 3HGKA 2W0JA 5KO1A 1GZ8A 3LMIA 3KXMA 3GC8A 3OTVA 4OTDA 4CKJA 3V3VA 3BEGA 5CU6A 5B2LA 4BL1A 4NIFA 3ZBFA 4I0TA 4IVBA 2F49A 4CT2A 3QQHA 4AXEA 1W2FA 3U9NA 3UODA 2UZVA 3AC1A 2G15A 3CKXA 2PUIA 2GS2A 5EKOA 4E4MA 2XA4A 2WFYA 2ZM4A 5FGKA 3RZBA 3KCKA 1BI7A 2UZBA 1NVSA 3EH9A 3L8SA 4QMWA 3VF8A 4GFGA 4Z16A 4EOQA 4FKJA 4UMPA 4F0IA 4IE9A 4U80A 4FVQA 2OH4A 4QDVA 1SNUA 5KBQA 5EQYA 2J0IA 3GC9A 4UX9A 4BDEA 3C4CA 4FTIA 2GQRA 4O81A 2VTPA 1XQZA 2C47A 4YJOA 4AW0A 4CCBA 5CAUA 3GOKA 5J9LA 4JG7A 5KZIA 4XG8A 1Q41A 3IW7A 3JYAA 5IQCA 3ODYX 1U54A 4GFOA 3RK9A 4Y85A 2CLQA 4IWDA 4FKLA 4WG4A 1K9AA 2IZRA 2J0JA 3ORNA 4RVKA 4QQTA 5B2MA 2OJ9A 2J5FA 4LI5A 3I7CA 1YVJA 4TW9A 4KKGA 2O63A 5AM6A 3M2WA 4F1OA 4BIBA 3KF4A 3Q32A 4D4YA 2GDOA 4IADA 3EYGA 3IW4A 4DFBA 1ZOHA 5KMOA 4DLJA 3RNIA 3FLZA 3G15A 5L6WL 4LMNA 3PY1A 4S33A 3Q9ZA 4X2KA 5E8TA 3ZM4A 4GJ2A 4E5BA 4DCEA 4PMSA 4G5JA 2E9OA 4MUQA 3TUDA 4C2WA 2X1NA 3QKMA 1W84A 3NPCA 4YSJA 4NW5A 3ENHA 4EK4A 4O0UA 1PYXA 4G2FA 3I4BA 1Q5KA 4UWBA 2XZSA 4FTUA 1GY3A 4YZDA 2GNLA 3JR1A 4O84A 1JNKA 4L45A 5CNOA 5HO8A 2ZM1A 2AQXA 4DT8A 3HNGA 4FYNA 5HKMA 3QUEA 2FA2A 2XANA 4IZYA 4AZWA 1PMNA 2PZ5A 4IFCA 3RCDA 4CFNA 4YR8A 5AAEA 5DT0A 5LQFA 2YLEA 4PDSA 2QHNA 5BMMA 1ST4A 2GCDA 3OROA 5M56A 3AC2A 4YGAA 3VS4A 1YWRA 2RF9A 4UWCA 3ZFXA 2C6KA 2B7AA 3UIXA 4DGLC 2HY81 3LKMA 2LGCA 1UVRA 1LPUA 2WMQA 3OXIA 4ACMA 4CXAA 1KWPA 4UMRA 2I0YA 3DQWA 3C13A 5FDPA 3MWUA 2WOUA 5AP0A 2YDJA 2XNMA 4BJJB 3SD0A 1IAJA 2RG6A 4M3QA 3FMEA 4PMMA 3D2KA 5DWRA 1NVRA 2XK3A 3L9MA 5D9HA 5GJDA 3CD8A 1XH8A 1XBCA 2YIYA 1UWJA 3R28A 3RPOA 4CFMA 3AC4A 3PPKA 4K9YA 2W99B 3LJ0A 4GU6A 4RJ3A 3ZO3A 2X7GA 2R64A 3KF7A 2CCIA 4MWHA 5AR5A 2YIRA 3I81A 3R22A 1ZYDA 2Y0AA 3SQQA 3QCSA 5GZ9A 3Q2JA 2J0KA 5BVKA 2XK6A 4AA4A 5L8KA 3LIJA 2VTLA 3KK9A 3NCGA 2BVAA 3BLAA 3CD3A 1CSNA 3BHTA 4AZFA 3TNIA 4JAIA 1O6LA 2XBJA 5CF5A 4GG5A 2X4ZA 3FI4A 3QQJA 3LXPA 3QQGA 4YJQA 4RC4A 4RJ4A 3QWKA 3ZSGA 2X8DA 4EQUA 3Q9XA 3O50A 4GKIA 2WQOA 1ST0A 2X0GA 1XBBA 4O91A 4G17A 1YW2A 1GIHA 3HMNA 4FG9A 3P0MA 1H26A 2F2UA 5B2KA 1P4OA 4MWIA 4QMVA 5LXMA 3T3VA 4BKJA 4JX7A 5FP5A 2PMOX 5HIDA 3G9LX 2X2KA 1OKVA 4FG7A 4QQCA 2ERZE 4HYIA 4WNKA 4FKVA 5CI7A 5D11A 3E3BX 3EN7A 4LRMA 3CC6A 2XIZA 3OXZA 5HE2A 4TWOA 3UQFA 3C0GA 4FKWA 3VUTA 4EWQA 3REPA 3BHUA 3FL4A 4ZLZA 3O8PA 3FLSA 3HVCA 4ASZA 1XH9A 2AC5A 4EORA 5I9VA 4B0GA 3QUDA 2Y4IC 5M4IA 2WMVA 2HWPA 2HWOA 3KXGA 5AIRA 2GHGA 4D0WA 3VUHA 2C6MA 4ORKA 4FTRA 4FMQA 5L8JA 2ESMA 4EYJA 3DKFA 3D7TB 5DGZA 4BGGA 3HDNA 3OTUA 4ZTQA 2WMAA 2QOHA 3EN6A 4LG4A 3OVVA 3QZIA 4WKQA 5ANJA 5EYMA 5AUVA 3O51A 1UU8A 3MH1A 4FUYA 1V0PA 4EH9A 5EM8A 2AYPA 2PULA 4MVFA 4DINA 2WTIA 3K3IA 1CMKE 1UKHA 2BALA 3QTSA 4YSMA 2Y9QA 5FG8A 5ANOA 3EWHA 4TNBA 2R3FA 3FHIA 3BBWA 2C3LA 2WQNA 4IH8A 2C3KA 4V01A 5FEDA 1GJOA 4JDHA 4GU9A 3F2AA 3H4JA 2PYWA 4L7FA 4CRSA 3PP0A 5IISA 2OZAA 3C50A 5JFWA 1PXMA 3UDTA 3QQFA 4DEIA 3R6XA 2P2IA 1GNGA 2Y4IB 3C1XA 3H0ZA 4NJ3A 4JR7A 4YC8A 4ZMFA 1TQMA 4XV9A 2Z7LA 1SNXA 3RCJA 3V6SA 4U42A 1YOMA 5LCKA 4O7TA 1RE8A 4F63A 1XR1A 3C5UA 4XBUA 4EOOA 2R0IA 3LAUA 3QKLA 4EHZA 3E7OA 5A6NA 4OR5A 3KMMA 3HECA 4RSSA 3WZDA 3A7IA 4UMTA 3A8XA 4ZXTA 1Z5MA 4DA5A 2EXEA 1P14A 3LFNA 3WZUA 3NYOA 2ZV7A 3LCOA 4R3PA 5HCZA 4U44A 2ITPA 3QBNA 2OBJA 4BIDA 4GUEA 5AP2A 4ZJJA 3HUBA 5TE0A 4F99A 3FEGA 5JMSA 5HESA 2JIVA 2PZRA 3VBQA 3PSCA 5J95A 2UW8A 1ZOGA 3EL7A 4F7SA 3SG8A 2GQGA 3UIMA 3OG7A 4DDGA 3TYKA 2G2HA 1APME 4XNEA 3IDBA 5IH6A 2VX1A 3SW7A 5BYLA 4IAIA 3ZMMA 5FWKK 1H0WA 1R1WA 1TQIA 2W1GA 4CZYB 1MQ4A 5EI8A 3BBTB 3TUBA 3DK6A 4QP8A 3W2OA 4D5KA 3TJCA 3HA6A 4BRXA 3N4UA 4UYNA 2YWPA 3MJ2A 4DFXE 4BWKA 2XUUA 3EHAA 2ERKA 3KXNA 1WCCA 4OTRA 3RJCA 2R7IA 3E87A 3VS6A 2QCSA