4DFYA

Crystal structure of r194a mutant of camp-dependent protein kinase with unphosphorylated activation loop
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
337
structure length
310
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFATPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Structural basis for the regulation of protein kinase a by activation loop phosphorylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 94
structure length 310
sequence length 337
chains with identical sequence E
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfyA02
3A7HA 2P3GX 5DI1A 4MTAA 3PG1A 2QOCA 4IANA 4X3FC 4IAZA 3TXOA 4QQ5A 2DUVA 4I41A 4FTUA 3SA0A 5FTOA 3U6JA 3NEWA 2VTNA 2PU8A 4L8MA 5CI7A 3IQ7A 3EKKA 5DR6A 3R30A 5A3XA 5ANGA 2R3JA 5AR8A 5JFXA 3DB6A 1H27A 3DXNA 2H6DA 3QALE 4RJ8A 5HIDA 4ZZMA 4E6DA 1SM2A 4O1PA 2PVYA 4FKGA 4EL9A 4ACGA 2EXEA 5TO8A 3DK3A 4G9CA 5IQEA 1DAYA 3Q3BA 4FK3A 4AZSA 4UXLA 3QC4A 2EB3A 2ZMCA 3PLSA 4IIRA 5AJQA 4FMQA 2YM8A 4I6FA 3UO6A 3ZRKA 3MTFA 4AFJA 4PDPA 5G6VA 2OICA 3TG1A 4HVGA 3F3UA 5M53A 2PYWA 5BX0A 2RFNA 4OTHA 4NW5A 5HD7A 4U9AA 2CKQA 4D2VA 4DH5A 4FGRA 3BGPA 2YN8A 5KBQA 4EQMA 2VWVA 4JOAA 4QTCA 4V0GA 3WF9A 3HAVA 4OTGA 5BUEA 2XCKA 3A2CA 2HZ0A 3BEGA 3K54A 5LVNA 2NNWB 3C0GA 2PMLX 1GOLA 2EVAA 2WIHA 3D0EA 2W05A 5JRQA 2OU7A 2HW7A 3HV7A 4UMQA 4ZSEA 4AOJA 2GTNA 4KSPA 3QYWA 3ROCA 4D55A 4XP3A 1OKVA 5IF1A 3K2LA 5EYKA 1UU7A 1PKDA 3PZHA 4FTRA 1OZ1A 3C51A 1OKZA 3LCOA 4R1VA 4C57A 3Q4CA 3MGYA 4WUNA 3PTGA 2B54A 3EZVA 3OZ6A 5H2UA 5BMMA 5CSHA 4CFUA 2JDTA 4FIIA 1ZYDA 3I7BA 4UN0C 2VNYA 4IH8A 1WBVA 2GCDA 3TUBA 3U54A 1Q3WA 3QQHA 2JDVA 4E26A 1ZMUA 3QL8A 4PL3A 4BVUA 4CXAA 4BCMA 2ITWA 3E3PA 2OIBA 1PXLA 2CGUA 3VBTA 5I0BA 2OJIA 3LKMA 4QYGA 4YNEA 4TW9A 1NVRA 2ZV9A 3OY1A 5ETAA 4RFMA 4ZTQA 4KS8A 4MKCA 3NS9A 4KIKA 1G5SA 2XYUA 1OIYA 4EH2A 4UZHA 4J97A 3VUIA 4XG6A 4CLIA 3NR9A 5J1VA 3KMMA 4OTPA 2HXLA 4NCTA 1GNGA 3EQPA 4XOYA 4ZZOA 4K33A 3LCKA 1UNLA 1YXVA 3EWHA 3PSCA 2UW5A 2X2LA 2QOFA 3LFNA 4CNHA 4FEQA 3UMXA 3FEGA 2WO6A 4MBLA 3CY3A 2W1DA 3H9RA 1PXIA 4L01A 2I0YA 5JZJA 2Z7QA 3BQRA 3FZOA 1V0PA 3SRVB 4HYUA 1P4FA 3RPVA 4LI5A 2WQMA 5TR6A 5A4EA 2BILB 2C0TA 4GS6A 4QO9A 3UNZA 4C7TA 2ITQA 2JDOA 4FKVA 5GZ9A 5AR3A 2NRYA 4AA0A 4MQ1A 3TT0A 4ITHA 5FD2A 1IAHA 3LJ1A 1PMEA 2R7BA 2WQNA 3DLZA 3RNYA 3ZXZA 5L6OA 1ZYJA 3TIYA 4GCJA 4BBFA 4YZ9A 2EB2A 1BYGA 2BDWA 3LLTA 3KU2A 3OEFX 3RAIA 3G2FA 1ZARA 4G9RA 4RGJA 3W2QA 2UZUE 3VJOA 4EC9A 2ITYA 3QKLA 3G6GA 5AP3A 2C6KA 4DLIA 5BPYA 4CKRA 2ZVAA 3OUKA 3DLSA 5KZIA 2E9VA 2W4JA 3HV6A 3OW4A 4GFGA 4GKHA 5HCZA 2WTWA 4BYIA 5M56A 2EXCX 5LQFA 2WIPA 1FMOE 3DZQA 5CQWA 5DR9A 5H9BA 4H05A 3ET7A 5I9XA 3E8DA 3IW6A 3I5ZA 5AP7A 4HJOA 1UU8A 3CTHA 1B38A 3HMMA 4GFOA 2BAJA 4G2FA 3NYVA 4Q5EA 5FXQA 1WAKA 5AIRA 1Q3DA 2JITA 4FTKA 3R21A 3GB2A 4JQ8A 4GU6A 2B1PA 4LQMA 4NJ3A 3RP9A 4E93A 2ITTA 3ZC5A 5ETCA 2ZV8A 3RKBA 2VTOA 1OBGA 2J7TA 3I5NA 5CEMA 1XQZA 2YDKA 4IB3A 3V5LA 5B7VA 5ETIA 4LL5A 3ZLWA 5CANA 3GC7A 4GUEA 2GNFA 1IAJA 2UZOA 4TXCA 4W4WA 5LMKA 4TYIA 4E4NA 2CLXA 5KCVA 3FLSA 4QMMA 1ZYCA 4EOLA 1R39A 1JQHA 1R0PA 3JPVA 3LPBA 5L6WL 3HDNA 3CKXA 4GJ3A 5AWMA 3VS3A 3JYAA 1XWSA 3LQ8A 4MNEB 4B0GA 3OOGA 3ZLXA 4QOXA 2XMYA 3Q5IA 4MEDA 4FV9A 1U5RA 4C3FA 4CQGA 3QQGA 4W4VA 2XBAA 2JEDA 3FLNC 1PJKA 2ITNA 4PY1A 3QZGA 1Y91A 2V22A 5J9LA 2C47A 3I79A 4CZYB 3HMIA 2EWAA 3KQ7A 2PMOX 5E8YA 3FPQA 5IA4A 4Q9ZA 5AA8A 4I1ZA 2J0LA 1J1BA 3CCNA 3T9IA 3ROYA 2XM9A 4GK3A 4AA5A 3S00A 2ZM3A 4O0XA 3LXKA 1LEWA 2R3HA 1IASA 4AOIA 3UZTA 3ZO4A 5F20A 4RQVA 1KSWA 2BRHA 1O9UA 2YIRA 2AUHA 2A1AB 2PZIA 3H9OA 3V8SA 4FSUA 3OTUA 2YHVA 2SRCA 3G51A 3GOKA 3HLLA 3KFAA 3KMUA 4F08A 1M7NA 2R7IA 4FGBA 5CSXA 4ACHA 3R71A 4CMUA 2YACA 3KVXA 1IA8A 2WMWA 3RZFA 4I24A 3FL5A 4EKLA 2Z7RA 3EN4A 2PZYA 3LHJA 2C5OA 4BKZA 5M4UA 3BBWA 4UX9A 4J53A 5AV2A 4GV1A 4R78A 4B8MA 3OHTA 4EKKA 3FMMA 5AUYA 3BKBA 2ZYBA 3EQIA 4WNKA 4KABA 2AYPA 4HPUE 2VWWA 4M67A 4ANMA 2YWVA 3RALA 1PW2A 3TJCA 5T3QA 3H9FA 3I6UA 3NCZA 3ZUUA 3QLFA 2HZIA 3KKVA 3DK7A 4DH1A 1E1XA 5CI6A 2BTSA 2JAMA 3P7CA 2QOIA 4Y72A 4U3ZA 5CNOA 3TTIA 4DLJA 3F66A 3OP5A 4DGGA 4JLCA 4WKQA 2YAKA 5F1ZA 3ZO1A 2JBPA 3BWFA 3FQHA 1FVVA 1QPJA 4PDSA 1XBCA 3R8MA 3EFWA 3HGKA 3UIMA 3FLYA 5AAGA 5CEPA 4OAVB 4IBMA 5HLWA 2UZBA 3BU6A 3UOJA 4C36A 3P7AA 3EN6A 3DBEA 4NSTA 3VUMA 4QQTA 3GBZA 5CYIA 4PMTA 4BHNA 3KGAA 5D7VA 3VHEA 3FAAA 2J51A 3F5XA 3ORLA 4RMZA 4S32A 2QOQA 2ZV7A 4O7LA 1J3HA 3Q4ZA 3RPYA 3KEXA 2PPQA 2NRUA 2WELA 1A48A 1FPUA 2VO0A 4K9YA 4B7TA 4CV9A 2ZJWA 3E87A 2R64A 3M42A 5CX9A 2WOUA 3LXLA 4JDJA 4J8NA 4EHGA 4LG4A 4ZJJA 3E62A 3FYJX 3SW7A 1VZOA 3CQWA 4W9XA 3PLAE 5KHWA 5J7BA 3H0YA 2B55A 5ANKA 2RG6A 1B39A 4XMOA 4YC3A 2CNVA 3LJ2A 3DQXA 1APME 2XK9A 3TKHA 3DV3A 3ZRLA 3MH3A 2P4IA 3T9TA 4MX9A 3BYMA 2WEVA 2X4ZA 2YDIA 4Q2AA 4FKWA 4G1WA 3MSSA 3PXKA 4J8MA 5C9CA 4F7SA 3KULB 3LJ0A 5IA5A 4BWPA 5T6KA 3II5A 4H1JA 4YLLA 4KUJA 4GYGA 3ORTA 3POZA 4PPAA 4I5MA 4ASEA 1KE6A 3ZFMA 4J7BA 4Y8DA 2BMCA 2W0JA 3ORKA 5ACBC 5CF8A 3BHHA 2WTDA 3TWJA 5FTGA 3QKKA 4PUZA 3UJGA 4LRJA 2Y7JA 4QTBA 4KBCA 2H96A 2ZV2A 2GHLA 3C1XA 3MV5A 4NEUA 4B9DA 4O7VA 4L68A 3QRUA 4I0TA 4C2VA 4HYSA 3U8WA 4EK3A 5KMMA 1UKIA 1UU9A 1QPEA 4ACDA 5L6PA 3KMWA 4D2PA 3O96A 3TNHA 4C61A 4FE2A 3KL8A 3DGKA 4LV8A 4RZVA 5GJDA 5HBHA 3SXSA 1W7HA 2BAKA 3NLBA 5CU0A 4ZLZA 4ZTSA 3EQCA 5JKGA 4JIAA 2ETRA 4G3CA 5HKMA 3KN6A 1H00A 5ANDA 5LWNA 3FMHA 1L8TA 1UWJA 2YISA 3I60A 3OT8A 1WVXA 5IEVA 2E9PA 2W99B 4BCGA 2R3LA 5I5ZA 2FA2A 3ZSHA 2BRNA 2CGWA 4KWPA 4KA3A 4QPSA 3MBLA 4TYJA 3AC1A 2OIQA 3FMNA 4RIWB 4V05A 1UVRA 4EORA 4DBXA 1M14A 1Q24A 4YTHA 4FTCA 1SVHA 4HCVA 3WOWA 4ENXA 2X8DA 4DEAA 2FH9A 1YXTA 3LE6A 4TYGA 2FYSA 4D2WA 3AT3A 5LARA 1FBNA 5HG8A 4PDYA 4RWIA 4XG9A 2CJMA 5ANOA 5L8LA 5C8KA 5KMLA 2C69A 3DXPA 5E8VA 3FLQA 4I6QA 4E6QA 2OBJA 4Y95A 2W06A 1U54A 3Q4TA 5F94A 2PY3A 4GVJA 1FQ1B 3TCPA 1SVGA 3ZHPC 5AV1A 2G1TA 2ACXA 4DF3A 5AEPA 4EBVA 2ITOA 4YPSA 3ZM9A 3FDNA 1NY3A 3H4JA 3LFCA 3U9CA 4CLJA 4O0UA 2Q83A 3BGZA 5BMSA 4IAKA 4WOVA 3L8SA 5DEYA 3KK9A 5HBEA 4BI2A 5C03A 2E9NA 3NVKI 2YDJA 3KXMA 4FTMA 4R3PA 3UPXA 2WGJA 5FDXA 1YHWA 3TZ9A 4IC7A 4CCBA 2QU6A 2VTPA 5A6NA 3DBQA 3P0MA 1TQPA 3Q96A 2OK1A 1DAWA 3QUPA 4NM7A 2C6IA 3F2AA 1ERKA 4YSJA 3EN7A 3EN9A 5TT7A 4AF3A 4C59A 5KE0A 3PWDA 3R0TA 4C4IA 3PSBA 5EOLA 4EK4A 3NW7A 5FM2A 4DFZE 3FWQA 4HGEA 4PPCA 3NUAA 4EYJA 2UZWE 3Q53A 5JZNA 2JAVA 2GNJA 4G5JA 1UA2A 4XV3A 5AP5A 4EH4A 3MVHA 2X8EA 3HV4A 4S31A 3GCSA 2YWPA 1JKKA 4KD1A 4LV5A 1NXKA 1OPLA 3T3VA 2QO7A 2VWZA 4I22A 4PWNA 4IXPA 5HLPA 3UGCA 2WD1A 1BL6A 4UWBA 4D1ZA 2HELA 4IZAA 4I5PA 3U55A 1PXPA 3BPRA 4N6ZA 4DEDA 5CF4A 2R3NA 3FI8A 4MQ2A 2OXYA 3OROA 1FINA 3RPOA 1FGKA 4ALUA 3UO4A 3F2RA 3DAKA 3Q5ZA 1OUKA 2B9HA 2XNPA 4KKHA 4ZIMA 3UIUA 3PVBA 1ZOEA 1NVSA 4KKEA 3HZTA 4Y46A 5AR5A 4U43A 4YNOA 4RJ5A 1OBDA 4G6OA 4MXXA 4FZ6A 2OXXA 2PZPA 3FI2A 2OJJA 4BKJA 2QO2A 4LUEA 1BI8A 4MHAA 2PVMA 2I0EA 5EHYA 3ZTXA 3P9JA 2WTJA 3A7FA 4M7IA 4NFMA 2QD9A 3V5PA 3IPHA 5HHWA 2QONA 3OG7A 4AN2A 3LMHA 3LMGA 1LUFA 4IAAA 2B9JA 3OS3A 4CZUA 4FEUA 4QP6A 3AT2A 3BLQA 1RE8A 4C4JA 2Y6OA 4FKQA 3RI1A 3FQSA 2BCJA 1PMUA 2XJ1A 1W98A 3DU8A 3KF4A 3OCSA 4U40A 4ENYA 5IDPA 2P2HA 1W83A 2UW0A 4AP7A 4AZEA 3DDPA 1ZOHA 2PMIA 3F61A 1Y6AA 4L00A 3UDBA 3E93A 4F65A 3WZUA 3NPCA 5K5NA 2Q0BA 1URCA 3Q9XA 4RJ4A 2PE2A 3ACJA 4PL5A 1KV2A 5B2MA 2IG7A 4N6YA 3PFQA 4H1MA 4ASDA 1GIIA 4XNEA 4FTAA 4MBIA 3E64A 4FEWA 3NX8A 4O38A 2HOGA 2XEZA 4QP1A 5KMNA 4YJOA 5CF6A 4B99A 2I40A 3CBLA 5EI6A 3O17A 4LM5A 4QNYA 3RAHA 4NIFB 2IW9A 4C02A 2XRUA 2IW8A 5CEOA 3ACKA 4BDIA 4JXFA 4L9IA 4DFYA 4UMRA 3CC6A 4NT4A 4RIXA 4HVIA 5IQGA 2WMQA 2WZJA 3CQUA 5LCJA 3K3IA 4N70A 2F49A 3TNWA 3BQCA 4UV0A 3W2RA 5IMXA 3BU3A 3DTWA 3Q9WA 2FSOX 4E5AX 3HRBA 4MD7E 4AQCA 3A8XA 1XBAA 2DS1A 4DGMA 1PMNA 3H0ZA 2F7XE 1XJDA 3H3CA 4DG2E 2WAJA 1RJBA 3DNDA 5IG1A 4JDKA 2QQ7A 3W2PA 2W7XA 2UVZA 4HCUA 2YCSA 4FR4A 5EYCA 4LL0A 4CD0A 5IISA 4V01A 4XYFA 4BZOA 3TM0A 2OWBA 2RG5A 4IVAA 4J98A 1TKIA 5FTQA 5JQ5A 4I5CA 2RSVA 4OBPA 4XRLA 5LCKA 4DTBA 2UZEA 4CZTA 1T45A 2CKOA 4WT6A 3WIKA 4MD8E 4LFIA 1M17A 4EHZA 4MXAA 2XK7A 2VWYA 3U9NA 4CYJA 3F69A 4GT3A 3BHVA 2OH0E 3A60A 2C68A 1PKGA 3GEQA 5AP6A 3AC3A 5AUXA 5I3RA 5LVMA 3BIZA 2VTSA 2VZ6A 3POOA 4GK4A 4X2NA 4TWCA 3BELA 4XH6A 4C3PA 5EKOA 5CAQA 4ZSLA 4ALVA 3M11A 4CFNA 4O83A 3AC2A 4A4OA 5AX3A 4O22A 3WZKA 4YBKA 3FMEA 4BF2A 1CMKE 4X3FA 1P5EA 4GVAA 5ETFA 4EOJA 3BHUA 4FIFA 5BVFA 2XBJA 4PTGA 2CLQA 5C1QB 2F2CB 4H58A 2X81A 4YHTA 5AUVA 5CS6A 4FA2A 5FUTA 3E8CA 3ID6C 3U6HA 3OWLA 3ZFYA 3NUPA 3SV0A 4FSYA 2OFVA 4UXQA 4H3PA 3DDQA 3LFAA 4ZAUA 3N4TA 4PTEA 3NCGA 5DR2A 4H39A 3WARA 4C38A 2JKOA 3PPKA 3WF8A 4JT3A 4LOPA 2VTHA 3ETAA 4BCPA 4ZXTA 4U3YA 4P90A 2B0QA 1M52A 2QI8A 4O6LA 4UYNA 4NTTA 2RGPA 5E7RA 5B0XA 1VYZA 4HYIA 4USDA 4ZY5A 4XG3A 4WG4A 2QCSA 3R04A 4KINA 4X2FA 4BTMA 3IGGA 4H3QA 5AM7A 4U44A 4D2RA 2WTIA 4EHEA 4IWQA 2J2IB 2OJGA 2VUWA 4OTFA 2J0JA 3A7JA 3R01A 3VAPA 4XV9A 2I0HA 4GG7A 5IA2A 3VQHA 3PJ3A 3LVPA 3QTZA 2QO9A 4GH2A 4TT7A 5E8SA 4U0IA 3ODYX 1UKHA 5FBOA 3RPSA 3LZBA 4A9RA 2OGVA 3IKAA 4ANBA 4LRMA 3QC9A 5AV3A 4F7NA 2XKFA 5IPJA 4C34A 3QTUA 4ALWA 4FI1A 4X2JA 3FC1X 5CVHA 4AW1A 4O21A 1GJOA 3ZMMA 2YITA 3I0OA 2Q0NA 4TY1A 3D5UA 3C9WA 4MK0A 2YZAA 3A4OX 4MXCA 1YDRE 5KKRB 1H0WA 4B6LA 3MFSA 5FM3A 5E91A 2QG5A 3COHA 1OIQA 2B53A 2EUFB 3LFDA 1NA7A 3ZC6A 4Y5QA 2V7OA 3MH1A 1YDTE 4UB7A 4OTQA 2XM8A 4CRLA 4YURA 3ZSIA 2BAQA 5HE2A 4EQUA 3QD0A 4PRJA 3RBWA 4C4EA 3SLSA 4FNWA 2WMAA 3EMGA 3G5DA 3V5WA 5KX8A 4YP8A 3ZU7A 1YHVA 5B2LA 3AD6A 5DH3A 1Y8GA 3NWWA 2P55A 4E8AA 5I9VA 5E8UA 3A62A 3NMUF 3MJ2A 4K77A 1NT2A 1WBTA 4EZ3A 4W4XA 4EJ7A 4QYFA 1FGIA 3AQVA 2J0IA 2UW7A 4DT9A 4EOPA 2YJSA 1VR2A 1LP4A 2YIXA 1W8CA 3EYHA 4AN3A 1YXSA 2GTMA 5AR4A 2XVDA 3BLRA 5DEWA 4KKGA 3RCJA 3IDCA 4A4XA 4A9SA 4D1SA 3QTXA 3UNKA 3HAMA 4KNBA 2UZDA 5FGKA 4OT5A 5CAVA 5J1WA 3TDWA 2X7FA 3HRFA 5ACKA 4AFEA 3FZRA 5EW9A 5LVLA 4KRCA 4ZLYA 4IDVA 5JSMA 3UQCA 3VUTA 5AFVA 2VTQA 3SVVA 4MH7A 2AC3A 4BCJA 3D83A 2QODA 5CSVA 2V55A 5KMOA 4FIEA 3TNIA 4DT8A 4YC6A 5JQ8A 4EH5A 3BE9A 4M66A 4LMUA 2JC6A 2WMXA 3QTWA 4H3BA 4HCTA 1I44A 2REIA 2YAAA 3DKOA 3TL8A 2ITUA 4I0RA 1Q4LA 4A9TA 4YJTA 2PVFA 1H8FA 2GPHA 3HP2A 4M15A 3S4QA 3UOHA 3OXZA 3FZ1A 4WG3A 3VO3A 4BL1A 4DCAA 5GINE 3PA3A 3AOXA 4I20A 2RIOA 1YI3A 2VN9A 3KXHA 4IB0A 3GFEA 4R1YA 4Y5HA 3PP0A 3PXRA 3VUDA 1G8AA 3E8EA 4ANOA 4I93A 2H9VA 4BYJA 2ERKA 3FL4A 4IVCA 4XG8A 4KIQA 2VU3A 4ZTHA 3MB6A 4QMYA 3PY0A 2WEIA 3HUBA 3SD0A 4YZCA 2OH4A 3R1SA 4YJUA 2XKEA 3EN5A 4IDTA 4MWHA 4CT2A 3R83A 3O23A 2IZUA 4ZSJA 3SHEA 4AACA 3OCGA 1ZZ2A 3H10A 4YC8A 2IZTA 3N9XA 4PL4A 3QWJA 1XHAA 2X2MA 3SDJA 3SAYA 1OL7A 4RFZA 3LLAA 4EH8A 5LWMA 2PUNA 2J4ZA 3SQQA 2Y6MA 2FB8A 1MRVA 1AD5A 5ICPA 3E88A 3VUGA 4K8AA 1FVTA 4LUDA 3W10A 2I6LA 4QMLA 4R8QA 4BGHA 3G9LX 5HX8A 3K5VA 4OGRA 4RX7A 3WZJA 2QG7A 5BVDA 3QAME 4IAFA 2VRXA 1I09A 4RVMA 2H34A 4A06A 2CKPA 1PHKA 2OZOA 3L9NA 4O91A 4O0YA 3LCDA 3EHAA 1QMZA 3UC4A 4CFMA 5CF5A 2CPKE 4ARKA 3QBNA 5HG7A 5FBNC 3KXGA 3RK9A 3WYXA 1DI8A 4AZVA 3ZS5A 1WBSA 2O65A 4P4CA 5J5TA 4NYEA 4FSRA 4TYHB 5M44A 1H0VA 3UE4A 2WFYA 4M8TA 4PNKA 2ONLC 4BDBA 4DBNA 4QMWA 4D0WA 4BI0A 3R8UA 2C0IA 1XH6A 2AC5A 3MI9A 4IM3A 4JJRA 3AGLA 3F3TA 3QD4A 3FSFA 4CRSA 2CN8A 4QPAA 2YCRA 5HESA 1OL1A 3UIXA 3ORMA 2A0CX 2X0GA 4UY9A 3RWQA 3VQUA 3WF5A 3OCTA 3VNTA 4U8ZA 2OLCA 4IQ6A 3CJGA 3W55A 2Z8CA 3THBA 1WBWA 3W16A 3VS7A 4EWQA 5CWZA 4JBVA 3AMBA 4IX6A 2ITZA 3AG9A 2PE0A 4AW0A 3IW8A 5A4TA 2W9ZB 1K2PA 4M69B 2YM7A 3V8WA 2Z2WA 3KRJA 5IQCA 3VW6A 4CG8A 3V5TA 4YTFA 2GHGA 2C5VA 3ULIA 5M06A 3QQUA 3FKOA 3DBFA 3G90X 2GFSA 5EH0A 3GVUA 5K5XA 4C4GA 2C4GA 4U41A 5FEDA 4O82A 2FSLX 4OTDA 4Q9SA 3IW7A 2BIYA 4RX5A 3SRVA 4WRGA 2F2UA 4JDIA 3LXPA 4Z16A 1VEBA 5DE2A 3HKOA 1UWHA 3KXZA 3ZM4A 3ENHA 4R7IA 3O71A 3WF7A 4CQEA 4PDOA 2QLQA 2UVYA 3FHRA 2YIQA 4DGOA 3ALOA 3L9MA 2ZOQA 4AZWA 3U87A 4FIJA 2QOBA 2YM5A 4RC2A 5EYMA 3V8TA 4BIBA 3BLHA 4BBMA 2V0DA 4DEIA 5M4IA 4FKSA 1Z57A 2OI4X 5FEQA 3LAUA 4NW6A 4TWNA 3R8VA 5EW3A 4DHFA 5IDNA 2EU9A 5LMBA 4FT3A 4BB4A 5EQPA 3LFSA 3DXQA 3KREA 3NIEA 4E4MA 5CU4A 2G15A 3ZZEA 1OIRA 3L9PA 3OF0A 4NM0A 4JI9A 2YABA 3JR1A 1KE7A 4EQCA 4G6NA 4BDDA 3EJ1A 5ANIA 5KO1A 1ZMVA 5CASA 1O6LA 2R0IA 4FKTA 3REPA 4G3GA 4F6WA 4BCKA 4QMTA 2G2FA 3HMNA 2BDJA 5E90A 4AS0A 4K6ZA 4FV3A 3LQ3A 1Q62A 3JVRA 3UC3A 2C6EA 2R3PA 3ORIA 3PRFA 3ALNA 5IH4A 4IB5A 4JNWA 1R3CA 3FI4A 4KBAA 5DT0A 3BV3A 4O7WA 4D0XA 3N4UA 5KMKA 3PVUA 4L53A 2VTAA 4R7BA 2W1EA 3D7TB 2YZLA 4RVKA 2IVUA 3QUEA 1ATPE 2BTRA 1O6KA 1W84A 1BLXA 1OKYA 2FSMX 3FI3A 4QPMA 5BYLA 1OGUA 2Y0AA 2V5QA 4MYGA 3LW0A 2XRWA 5DIAA 4F0IA 3DZOA 2HW6A 1Z9XA 2ETMA 1LEZA 3L8XA 4UMTA 4BGGA 4G34A 3B2WA 4XG2A 3F6XA 4X0MA 4DEEA 2XIXA 4EOOA 3QLGA 1DI9A 5M09A 3EKNA 2XK3A 4L44A 4QQCA 2C5YA 2WQBA 3MVJA 5DWRA 1V0BA 2WXVA 4ANSA 3R7EA 1NVQA 3OWPA 4EHVA 3MFRA 3R7IA 4IM0A 3WBLA 4MNEA 3VVHA 4E6CA 4O0SA 1J7LA 4DINA 4FV8A 2X6EA 4FKOA 4W4YA 5CZHA 1BKXA 3KRRA 4GMYA 4G6LA 5KZ0A 3CSVA 4A9UA 3GUBA 3EL7A 4FUYA 4IEBA 4GT5A 3WF6A 3D2IA 5IH5A 3S1HA 4M12A 4TKSA 4XCUA 3R2BA 1IR3A 3RAKA 5AADA 4JG7A 3U4WA 3MA6A 2P2IA 4FODA 3QUDA 2WU6A 4P2KA 1RQQA 3GCUA 4RIYB 2VO3A 3ORPA 4E3CA 4XG7A 2KULA 3NSZA 4JR7A 4RZWA 3FKLA 3OBJA 3N4VA 3G0FA 3PY1A 4JDHA 5J79A 3LOKA 4HGSA 1ZY4A 1V1KA 2A4LA 4MF0A 4RX8A 5DHJA 4Z55A 4IACA 3R7GA 5EI8A 5JFWA 4QMNA 4R7HA 3R7VA 4L46A 1Q8ZA 2HENA 2R5TA 5HGIA 3ITZA 3VF8A 4O96A 4AAAA 2R3QA 1SNXA 2E9OA 3F3ZA 4MXZA 4KBKA 3BBTB 3QA8A 4ID7A 4XEYA 4D58A 2EXMA 3TV6A 1H1RA 3PWYA 2O5KA 3C7QA 3F5PA 3MIAA 5I9WA 1J7IA 3PJ8A 1IEPA 2XEYA 4YJNA 1OI9A 3A61A 4N4SA 4RWKA 4J71A 4LMNA 3WYYA 4FZ7A 3DPKA 3F88A 4RQKA 5EM7A 4DG0E 3UOKA 3PE1A 4O7RA 4GT4A 5FXSA 3GFWA 5DNRA 1B6CB 1A9UA 3EH9A 4DH8A 4F64A 1V0OA 5EM5A 4FG8A 4BR3A 2ZB0A 1W0XC 5EM6A 4BCHA 2Z02A 1H26A 3DNEA 1RW8A 4OBQA 3QU0A 4X6QC 2WMUA 2JIIA 3GCQA 4D2SA 3I6WA 3O2MA 3IGOA 2ERZE 2PMNX 4IX3A 2YCFA 5CNNA 4USFA 4FSZA 4M0YA 4JX7A 2HZ4A 4FTTA 3VJNA 3MA3A 5EDPA 2GNLA 4QMXA 5AUTA 2H8HA 4O84A 4OW8A 2J9MA 3QX2A 2ITPA 3JVSA 5AAEA 2BHEA 2R3KA 4GUBA 4MCVA 4O7SA 4AZTA 5IA1A 3AMAA 1QPDA 5EDRA 3QRKA 4BDAA 3RM6A 3DA6A 3QZFA 3MB7A 2WTCA 5GZAA 5L8KA 3NNUA 3D14A 5M4CA 4KRDA 4YHFA 4DGNA 4O0VA 4C3RA 1ZAOA 4RT7A 5HI2A 4YJSA 3VS0A 2W1HA 2XNNA 1E1VA 3D9VA 4FV7A 4WNOA 4IE9A 2QOOA 3CLYA 4MAOA 3VS2A 4D4SA 3TUCA 1WCCA 3BCEA 3OUNB 4K1BA 3ATTA 5HNBA 2RKUA 3RJCA 4BBEA 3VN9A 3UQGA 3MY0A 4PX6A 2UUEA 3EZRA 3HYHA 3R1YA 4P7EA 4JAIA 3QKMA 5CAUA 5E8ZA 5K4JA 4UBAA 2VTJA 4BWKA 3RAWA 4RIOA 4YZNA 5BUIA 2ZMDA 3PG3A 2QHMA 2HYYA 3KULA 3P86A 5DG5A 4EWHA 4BICA 3DS6A 3GOPA 1YDSE 1PXJA 5BVOA 3BRBA 3ANRA 4ONAA 2X7GA 3S2PA 4BZNA 2CHLA 2PHKA 3CY2A 3CEKA 3FYKX 4L67A 3CJFA 2CNUA 3GC9A 2BHHA 4FTLA 5AP0A 4F09A 4N0SA 5HG9A 4FYOA 2JGZA 2VX1A 4WRSA 4DH7A 3UTOA 4FTOA 3GC0A 3C13A 5HO6A 4CFXA 2YIWA 1MQBA 4I5HA 4YO6A 4AT5A 3D7ZA 3S0OA 2I0VA 3QTSA 4FVQA 4FSTA 4RPVA 4IZ5A 4RJ3A 4HVHA 1QCFA 3O8PA 4KB8A 3R63A 3Q6WA 1JWHA 2BRBA 3TV7A 1OECA 2RF9A 4Y85A 4L43A 5IQHA 2R2PA 5DBXA 5J8IA 2P33A 2GQSA 4TPTA 4YLJA 5DT3A 2FVDA 3QRJA 1ZWSA 4I92A 5HQ0A 3UG2A 3NUXA 1OL6A 4QP4A 1HOWA 3SW4A 4V04A 3CIKA 4JBOA 4RIWA 1OKWA 3VBVA 4UWCA 4EH6A 4AU8A 4W8EA 3F82A 5JMSA 4NM3A 4XP0A 3C4XA 4YLKA 4XS2A 5JRSA 2PULA 2WHBA 2XIRA 4RA4A 5HO8A 4M0ZA 5HD4A 3HNGA 4CFWA 3OBGA 4BN1A 4D9UA 4DA5A 3BYUA 3WI6A 3UO5A 2VO7A 3QCXA 3PY3A 5FDPA 5LVOA 2KTYA 4JVGA 5H8GA 4QYYA 3MN3A 3R2YA 1S9IA 2WQEA 4DN5A 3KN5A 5HO7A 4DGLC 1FMKA 3QWKA 4XG4A 3UBDA 1MRUA 1MUOA 4DTKA 3HEGA 2B9IA 4U97A 3PRIA 4AWIA 4S30A 5AV0A 4CG9A 4FSQA 4FEVA 3BZ3A 3DTCA 4X7QA 4AE9A 4PTCA 2VTRA 4D5HA 4PP7A 3DY7A 4RJ7A 5AMNA 3VUHA 3PYYA 3CP9A 4YHJA 3TNPC 5FXRA 4CMTA 5IQBA 4BTJA 4TNBA 2HK5A 4FV1A 4EI4A 4NJDA 2QNJA 4X2KA 5DT4A 5D11A 4R5YA 3TV4A 4ANLA 5DMZA 3B8RA 4HPTE 1X8BA 4MF1A 4O7YA 4D9TA 4FG9A 4FKLA 3V5JA 1JKTA 4Q5HA 3ZOSA 4WSQA 1JAMA 3MDYA 3DJ6A 3DJ5A 4IWOA 4FV6A 5C8MA 4WUAA 2W9FB 4IHPA 4ZMEA 4RLLA 2G9XA 4AX8A 2QVSE 2HWPA 2C6TA 3G33A 3KXNA 5ANEA 4U81A 2ITXA 3HMPA 4GG5A 3IOPA 3TKUA 4ZY4A 4I6BA 3B8QA 4R6VA 4CKJA 3VIDA 4PQNA 4WD5A 5CZIA 2XNGA 3WE4A 1UNGA 1OL5A 3DFAA 3OT3A 4RG0A 3UIBA 3GCVA 4I3ZA 4QMZA 3W8QA 2OW3A 4QYEA 3R9HA 1CSNA 2CKEA 1XBBA 3COKA 3KVWA 4GW8A 4IMYA 1NW1A 2E2BA 1RDQE 2R3MA 4BFMA 2XF0A 3M1SA 4BDEA 4FKIA 4MWIA 5HTCA 2XJ2A 3BYVA 1JOWB 2O3PA 2BVAA 3OXIA 5IKWA 4IC8A 3NUSA 4BDFA 5M51A 1OIUA 4OTRA 4S33A 4EUTA 5BUJA 3QXOA 3FMKA 1WBPA 3V5QA 3GI3A 3LMIA 5EKNA 5TKDA 5B2KA 1GAGA 3MH0A 4CFVA 2WPAA 4QMPA 1Q8WA 3DBDA 3PP1A 3MFUA 4CFFA 3GQLA 3UMWA 3TKIA 4U5JA 5HE0A 3C5IA 3I7CA 4RRVA 4F9YA 2J5FA 3FHIA 1OL2A 5K4IA 4DEGA 4X2GA 4AZFA 2JLDA 1M2PA 3MVLA 4JRNA 2GQGA 2Y4PA 3FXXA 4G16A 4Z9LA 1BX6A 3WZEA 4B8LA 3PVWA 4U79A 4BCOA 4FNYA 2CCHA 5HVKA 2PWLA 4FVPA 4I4FA 4C4FA 3AC8A 2YM6A 3NW6A 4FUXA 2R3IA 5C01A 3G15A 3NUUA 2F4JA 3EB0A 4MNFA 4ZSAA 3VW8A 1TQIA 1CDKA 3K3JA 3I0QA 3RK5A 5DLSA 5JT2A 4O1OA 5CVGA 1REKA 3UP7A 1SYKA 5IEXA 4L3LA 2C0OA 2XJ0A 3Q9ZA 3QD2B 2WTKB 5H3QA 3PPZA 4OAUC 3VF9A 2Z60A 3MY1A 3ZZWA 1Q61A 2B7AA 4RJ6A 4KSQA 3GU8A 2W1IA 3EFKA 3A8WA 2VNWA 3DBCA 1PYXA 3DAJA 3PPJA 3QQJA 4NIFA 4BI1A 5KMJA 4TZRA 1ZOGA 4NTSA 3HP5A 5IEYA 2R3OA 4IVDA 3F5UA 3PA5A 5M57A 1WMKA 4GFMA 5IQIA 2OJFE 3HECA 4KAOA 4S34A 1VYWA 3EQGA 4TN6A 1GZ8A 2NO3A 5C27A 4F1OA 5A4LA 4FSWA 4G17A 3SG8A 4NZWB 4XLIA 4IZYA 5A46A 4J99A 3RINA 4F1TA 1GY3A 2JBOA 3RZBA 4NH1A 2UZTA 1QL6A 4FVRA 4ZEGA 2VTTA 5KUPA 3NRMA 5CAPA 2HIWA 4ZP5A 2XZSA 3ODZX 5EHLA 4FV2A 3HV5A 2G01A 2WTVA 4QMSA 3DKCA 3R9NA 3FMJA 3U51A 3E7VA 3TJDA 2Y8OA 4FF8A 1O6YA 4RWJA 4S2ZA 4H36A 3LFFA 4RWLA 4G5PA 4XV1A 1M7QA 4AUAA 5C26A 4WNMA 5LMAA 3QA0A 1W82A 1T46A 3COMA 3JY0A 3SX9A 3ZRMA 5BYZA 5HBJA 2VV9A 3JS2A 5CEKA 3FY0A 4JR3A 3ZEPA 3NVMB 3BGQA 4G3FA 4IFCA 3RVGA 4FSNA 3QRIA 2BROA 1AGWA 1YRPA 3NUNA 4UZDA 1SVEA 1ZYSA 2WNTA 4A9YA 2J50A 4UYAA 4DG3E 3OMVA 2IN6A 4IAIA 2JFLA 3CR0A 3ZBFA 2PVJA 5IQDA 3VS4A 4FT5A 1OITA 1Y8YA 4ZSGA 3L9LA 3DKGA 3D5VA 1QPCA 3KRXA 4IAYA 5GJFA 4DFBA 2OZAB 3E3BX 3FZTA 1LPUA 5CEQA 2HZNA 5AP4A 3V6RA 3QCQA 3C4EA 3JUHA 3R9DA 2O8YA 4AGCA 4WNPA 5A54A 4TWPA 4RC4A 3P5KA 3LCTA 4KS7A 3W18A 2VWBA 2IVVA 5D12A 4IVBA 4J96A 2XK4A 3O7LD 1HCKA 2X7OA 4AG8A 1M2QA 4QNAA 1EH4A 2WMRA 3QQKA 3I4BA 3ANQA 4M3QA 1GIJA 3O50A 5BVKA 5JGDA 4E6AA 5CU2A 5E1SA 2R3GA 4GSBA 3ZDUA 3TIZA 2QOHA 2ZB1A 3CE3A 3GT8A 3QHRA 4L42A 2R9SA 5E4HA 5HIEA 4D1XA 1P4OA 2JFMA 4J95A 4ERKA 4PMSA 5DYJA 4HVSA 5IA0A 2WU7A 1E9HA 1Q99A 2WTKC 2Z7LA 4OBOA 2XK6A 4QP3A 4G31A 4FT7A 3ELJA 4GYIA 4AE6A 1OVEA 2XUUA 1Q5KA 3LM5A 2W1CA 3A7IA 4ANQA 2UZNA 4QRCA 5HG5A 5HLNA 4XBUA 4NK9A 4USEA 4MVFA 4XX9A 5E8WA 4FL1A 3KY2A 2R3RA 5L8JA 3VBYA 1JSTA 2VD5A 5LXMA 1XH4A 4XBRA 3IDPA 2A27A 5CU3A 1ZXEA 3FY2A 2ONLA 4V0GB 4NKAA 4YZBA 3OD6X 5F95A 4CMOA 3C0IA 3EL8A 4JIKA 3A4PA 4JG8A 3P4KA 5EOBA 4HNIA 3KXXA 4QMUA 3WILA 1WZYA 5JK3A 4LRKA 5EQYA 3MJ1A 4EOKA 1GZOA 2O0UA 3IECA 3RTPA 1XR1A 2X8IA 4IADA 4QMVA 5DA3A 3AGMA 4L7SA 2XKCA 2BZKB 4Z7GA 3QQFA 5EQEA 5HTBA 2PVKA 3NIZA 4IJ9A 3Q04A 3TZ8A 5J5SA 3OTVA 4I94A 2UVXA 2YFXA 3R9OA 2OF4A 2BRGA 4FKPA 4UEUA 3FMDA 4FZFB 1PF8A 3AT4A 2BZIB 5IUIA 2VTLA 3AMYA 3KA0A 4M68A 4EOIA 1FOTA 3BI6A 3I1AA 3GU7A 4ZJVA 5M4FA 3ZDIA 3ZXTA 3CGFA 3BU5A 3DQWA 4ITIA 2PK9A 4BKYA 1H1PA 3PZEA 4D28A 3TDVA 2PVNA 3C4CA 4IW0A 4HNFA 1XH8A 5LVPA 2CNQA 1ZRZA 3DB8A 2PUIA 1IRKA 3HV3A 3IW5A 3VS5A 2W1GA 2I7QA 3MYGA 2O63A 2WQOA 4KIKB 3SOCA 5HZNA 3HRCA 1K3AA 4PF4A 2UV2A 5TOZA 4A4LA 3TNQB 4C37A 2E9UA 4YJRA 5D7AA 4FTNA 5BVWA 5A14A 4L6QA 4YR8A 5J9ZA 2QR8A 2W4KA 4JBPA 3H30A 2PSQA 2VX3A 4O6EA 2HWOA 3BX5A 3UNJA 1IG1A 2UW3A 5CSWA 3ZFXA 4KIPA 3UZPA 4Z7HA 2C3KA 3FQEA 1XH9A 5E92A 3HA8A 5HU3A 4DFUA 2VX0A 2BPMA 2ZDTA 4II5A 5KKRC 3QFVA 4RC3A 2X39A 3MIYA 5CENA 5GJGA 3EYGA 2WMBA 3HUCA 4DFLA 4YO4A 3DAEA 1H4LA 4F7JA 3UPZA 4GIIA 4WHZA 3FE3A 4UALA 4M13A 4E1ZA 3O0GA 5E8TA 4EJNA 2QOKA 2GNHA 1PXKA 3GC8A 4DFXE 3CGOA 3RHXA 1OMWA 2HAKA 5L3AA 4BCQA 5FLFA 1F5QA 4X6RA 4AA4A 3PXZA 3QCSA 2VTMA 3MPTA 4PV0A 4YJPA 3RWPA 2PE1A 1Q41A 3CS9A 1ZZLA 4I21A 4FV0A 2P0CA 4F99A 2PVLA 3FXWA 5EG3A 5M08A 3GU6A 4CTCA 5FWKK 3G0EA 5AUWA 4PMPA 3ZH8A 1JVPP 3FV8A 3IDBA 3EQHA 3MH2A 2CSNA 5HCYA 3BWJA 1J1CA 2IPXA 3PE2A 5BVNA 4K2RA 4TYHA 4WIHA 4CTBA 4E4XA 4CT1A 2XNBA 2W96B 4GRBA 2IZRA 2JKMA 1JKLA 1Q8TA 3FZSA 3GCPA 4IZ7A 4DFNA 1JBPE 2XNOA 3OFMA 3DT1A 1KV1A 5T68A 2OKRA 3KF7A 3Q4UA 2PTKA 5CU6A 4EH3A 4EOQA 1ND4A 2QHNA 3QHWA 4JRVA 4PNIA 3VULA 4M84A 3PXQA 3E5AA 4GJ2A 3FXZA 5IU2A 3RNIA 4F1MA 3LXNA 3QYZA 4I4EA 4M69A 4BIDA 1YWRA 1AQ1A 2BDFA 3BV2A 4O7ZA 4ERWA 2IWIA 3PXYA 3VWAA 3CQEA 5CSPA 3QD3A 5AX9A 2WKMA 2GDOA 3R9RA 5EDQA 4DTAA 2PZ5A 2CMWA 2FSTX 1URWA 3OW3A 4NU1A 4R77A 4FOCA 1U4DA 3ENMA 3MPAA 2F57A 1BUHA 4EZ7A 4FKRA 4ASZA 3NNVA 3D94A 4W8DA 3EQFA 5FP5A 4EBWA 3MW1A 3IO7A 2FUMA 2ZM1A 4UMPA 3W32A 2GU8A 3LQ5A 4G3DA 3CD3A 3ZLSA 1WBNA 4MD9E 3F9NA 5HVYA 4QP8A 4E5WA 1TQMA 3Q52A 4U7ZA 1WVWA 3F7WA 1G8SA 3KB7A 4NCTC 2CDZA 3QZHA 3OEZA 4O27B 5F4NA 4CKIA 4QP2A 4AT4A 5HNIX 2F9GA 4GU9A 5TE0A 4DCEA 3Q9YA 2OG8A 4BDJA 5A6OA 2G2HA 4K11A 3F2NA 1PXOA 1XH7A 5GIPE 3A99A 3OWKA 3NZ0A 1YOMA 4FK6A 4HOKA 5CXHA 3VHKA 5CXZA 3EQDA 3V01A 5EW8A 3DKFA 5CT7A 3UOLA 4ZK5A 3MFTA 2XKDA 3OXTA 4WO5A 3P23A 3QTRA 4E73A 4LGGA 5FP6A 3SG9A 3F7ZA 4ITJA 2BKZA 3MESA 2XA4A 3A7GA 1FVRA 4EOSA 1LR4A 5BYYA 1WFCA 3PUPA 3ULZA 2C3JA 2JKKA 4GL9A 4FIHA 1XO2B 3SGCA 3D7TA 4F4PA 3W33A 3SC1A 3EFJA 3R6XA 1CTPE 4FIGA 5KBRA 4DE4A 1XKKA 4ANNA 2XH5A 2J6MA 4HYHA 4O0TA 1REJA 3V3VA 4AOTA 3FMLA 2UW9A 3R7UA 4NL0A 4OTIA 3QTIA 1PRYA 2FO0A 4C62A 4O86A 4EUUA 4MXOA 2YM4A 4PP9A 2VGPA 4X21A 4C4HA 2PL0A 2Z7SA 3FSKA 2OJ9A 4F9CA 5HU9A 5IZFA 4FZDB 3GQIA 1PYEA 3KK8A 4IB1A 3ERKA 2PUPA 1YWVA 4LOOA 2W4OA 1UU3A 2OO8X 3FLZA 3DOGA 5HOAA 3IK3A 4F6UA 5IMEA 4GIHA 3NYNA 4J1RA 4F7LA 4GK2A 4YZMA 4L7FA 2QLUA 3RMFA 1MRYA 1YXUA 4I0SA 5M07A 4AGUA 1KOAA 2C5XA 3E8NA 3R02A 4G3EA 2VGOA 4FT9A 1KE5A 1PY5A 2WMVA 5K3YA 3Q60A 4TTHB 3IOKA 3D5XA 5CVFA 3W1FA 1JLUE 5I4NA 3UP2A 1CKIA 2DWBA 5J9YA 3D2KA 5I9YA 5HEZA 3MWUA 2C5NA 2XNEA 4GKIA 4K0YA 2W1FA 3OC1A 3P1AA 4RLKA 3R7OA 2C1AA 5JFSA 1ZLTA 2ZAZA 3DFCB 4RIYA 4ZTLA 5LMKC 4MBJA 3CPCA 3TACA 5EHOA 3OVVA 4QYHA 5CEIA 2B4SB 3FC2A 2XCHA 2HY0A 3EQRA 4AT3A 1J7UA 4E20A 1OPKA 2IVTA 1G3NA 2JDRA 3R1NA 3TZMA 4HGLA 3UODA 2VWUA 3NAXA 4O0RA 3DK6A 4TNDA 1CM8A 2CGVA 5CT0A 5L2TA 2J5EA 2WMSA 3T3UA 2X9EA 2XNMA 4OT6A 4OTWA 3UG1A 4WG5A 3R22A 3KC3A 2JD5A 2PVHA 1YVJA 2F7EE 2V7AA 3MTLA 3P78A 2LAVA 2BRMA 4BGQA 5HX6A 1L3RE 3C5UA 2CGXA 4HGTA 4EYMA 4LOQA 1Q8YA 5DOSA 4RVLA 3S3IA 3PVGA 3ORNA 3S95A 3L8PA 5BVEA 2G2IA 1K9AA 3F5GA 4O2ZA 1JNKA 4FT0A 2X1NA 4F0GA 2C1BA 4FKUA 2VAGA 2W5BA 1Z5MA 4R3CA 4AGDA 3GU5A 4DAWA 5IUHA 2YLEA 4PPBA 5AP1A 4BIEA 1BMKA 4U45A 2BUJA 4X3JA 1Q8UA 1WVYA 4FBXA 5G1XA 2ZDUA 2A2AA 3NW5A 2JDSA 3QGWA 1YOJA 4F63A 1ZYLA 4F9WA 2XS0A 3F3VA 1OB3A 4RVTA 4TL0A 1MP8A 2QR7A 2CN5A 2A19B 4APCA 1DM2A 3W2OA 2DYLA 3RM7A 2Y4IB 3N51A 4YJQA 3FJQE 4HZSA 4BY9E 2HCKA 2IZSA 5L2WA 3FLWA 5EI2A 4M97A 4E5BA 1PXNA 2XK8A 3MPMA 5HE1A 3HMOA 1R1WA 3HA6A 4I23A 5I9UA 1YI4A 4W9WA 3LFEA 2VWIA 5A4CA 3GNIB 3QF9A 3R8PA 4A7CA 2IJMA 5DRDA 4Y83A 3OY3A 3NDMA 3UZRA 2PUUA 5E1EA 2YERA 3O51A 3UYSA 4CCUA 4ZOGA 2UW6A 4WBBB 1P2AA 4JS8A 2RFDA 4BDKA 2JIVA 5DN3A 1F0QA 5AR2A 4TRLA 2C6LA 4NFNA 2J0MB 3EOCA 2Y9QA 4C0TA 3D4QA 5J87A 3BEAA 5AAFA 4BTKA 4O0WA 1STCE 1U54B 2F7ZE 4C33A 3F3WA 2ITVA 3NYXA 2NPQA 4R5SA 4FKJA 2UZLA 2QU5A 3KCFA 4AN9A 4UWYA 5CQUA 3VS6A 4AXAA 1H1SA 5HCXA 3HX4A 3R1QA 4ASXA 1VJYA 3ZSGA 3BYOA 3ORXA 4QTDA 4XJ0A 4CVAA 3SXFA 4YZDA 2XIYA 1MQ4A 4QD6A 3RCDA 3AD4A 4XOZA 2NP8A 2OFUA 5AUZA 2C3IB 4RSSA 5C8NA 3WZDA 3AC4A 3Q32A 3R7YA 1OUYA 2YCQA 4JAJA 1JPAA 1YW2A 2HY81 2R0UA 4CGAA 4FNXA 1KE8A 4IX5A 5H8EA 1YQJA 4LYNA 5DPVA 4EOMA 4UMUA 5JN2A 4C8BA 5BQ0A 2XB7A 4CSVA 3PIYA 5H8BA 5K0XA 1H25A 2BR1A 3KRWA 5J95A 5L2SA 2VTIA 4NKSA 3ZUTA 2HXQA 4OLIA 4Y73A 5EYDA 5AV4A 4EH7A 5E9EA 3AXWA 3C4WA 3JY9A 1WBOA 3PSDA 3K5UA 5FG8A 1CKJA 3C4ZA 3VRZA 1SNUA 2X6DA 3BHYA 3I81A 2YLFA 2GS2A 1A06A 4ZLOA 3ZO3A 3BHTA 2XP2A 2JIUA 3GU4A 1H24A 4APPA 1OPJA 3VBWA 1BI7A 5HNGA 5D1JA 2C6OA 5F9EA 3E7OA 4IM2A 4ORKA 1DS5A 3VBXA 2OF2A 2R3FA 3QQLA 4FYNA 3NGAA 5IH6A 4D4YA 1H08A 4FEXA 5AA9A 4CYIA 4JBQA 2C3LA 1F3MC 4L3PA 4DH3A 4BDHA 2R4BA 1R78A 5JGAA 3AC5A 1HCLA 4BDGA 3FUPA 2PVRA 5EK7A 4BRXA 4DEHA 2C30A 5IA3A 4U6RA 4P5QA 5GZ8A 2QKWB 3NNWA 4EK8A 2YJRA 5CLPA 4CV8A 3RK7A 4F9AA 4YUQA 1U46A 4J52A 3V6SA 3D5WA 3PIXA 2FGIA 3HL7A 4LGDA 5DFPA 3RGFA 4YMJA 2WB8A 4A07A 1KE9A 4AGWA 2Y4IC 3ZEWA 4DEBA 1TVOA 1YKRA 4QTAA 4AW2A 4EK5A 4XP2A 4NWMA 3U4UA 1KWPA 5IQAA 4FG7A 5KMIA 3PJ1A 4B4LA 5D41A 3DCVA 4FTIA 3ZO2A 5E8XA 3QTQA 5J7HA 1YXXA 2UW8A 4FSMA 3T8OA 1SMHA 5ANJA 2W5HA 3KCKA 3P08A 1JKSA 5JH6A 3ATSA 3TN8A 5D9HA 3P7BA 5K0KA 3W2CA 4HZRA 4XV2A 3R8LA 5L4QA 2GS7A 2GNIA 3M2WA 3CPBA 3ZLYA 2BFXA 3LM0A 5CTPA 4FNZA 3QGYA 4WA9A 4BCFA 4BWXA 3TUDA 2IW6A 2YA9A 2O2UA 4IJPA 3C0HA 4D2TA 3E63A 2WOTA 2BALA 5D10A 4OR5A 2C6DA 3PJCA 3O8TA 3ZYAA 3EFLA 3GXLA 3R28A 4FICA 4QP9A 4RIXB 3Q2JA 2LGCA 4YJVA 1H01A 1H1WA 3V51A 3LFBA 4O2PA 5TF9A 5KHXA 1Y6BA 4ZTRA 3GGFA 5CAOA 2YIYA 5GHVA 5AP2A 4CEGA 4QMQA 4P5ZA 5HORA 3L8VA 5I9ZA 4QP7A 3VRYA 1R0EA 4EONA 4E4LA 3V04A 3QZIA 1UNHA 4YSMA 2GMXA 3FKNA 3G6HA 4TYEA 3MY5A 4ZZNA 2RFSA 3ZBXA 4N57A 2QC6A 3KRLA 2OSCA 3L1SA 4L52A 3TEIA 2X4FA 4FL2A 5AIKA 4K18A 4D4VA 2GQRA 3NYOA 3D15A 4RFYA 4DYMA 2QURA 3RHKA 1H1QA 4BCIA 3ZCLA 1PMVA 3UVRA 5CY3A 5A9UA 4WBOA 4NUSA 4XHKB 2UZVA 3IG7A 2I1MA 3BYSA 4KIOA 4BDCA 4O7TA 4RX9A 4C58A 4O81A 3IONA 1OM1A 3UVQA 4IFGA 3OWJA 1CKPA 3PA4A 2YEXA 1Q97A 2W1ZA 1GZNA 4XLVA 2ETKA 3R00A 4BZDA 3AD5A 3RPRA 4C2WA 3MVMA 5L2IA 3GENA 3MS9A 3VUKA 1ZMWA 2QOLA 4YTCA 3BE2A 3JXWA 4D4RA 3GP0A 2BKKA 3LIJA 1GZKA 2BIKB 3Q6UA 4L3JA 3SOAA 4BC6A 3HDMA 4EEVA 5IQFA 4IWPA 1XH5A 4JG6A 5I3OA 4FX3A 3E92A 4YTIA 4O7NA 1YWNA 4XUFA 4X3FB 5EM8A 5C4KA 1PXMA 4QTEA 2W5AA 3UQFA 3LCSA 2GNGA 4ACCA 4F6SA 4AW5A 3NNXA 2IO6A 4PMMA 5EFQA 2UW4A 2V62A 5HIBA 1H28A 3WE8A 2ZM4A 3C4FA 1JSVA 2YM3A 4FV4A 5JGBA 4XRJA 1YOLA 2RFEA 1ZY5A 4FV5A 3CKWA 3PIZA 3WIGA 5L2QA 3SXRA 2OXDA 3O7LB 3Q2MA 5GIOE 5HTIA 4I6HA 3R8ZA 3UVPA 4HVDA 4RA5A 5FRIA 3EQBA 2GSFA 2QKRA 3R73A 4ACMA 1M2RA 4JL9A 3P79A 1U5QA 2RL5A 2J0KA 5AM6A 4EZ5A 5DVRA 4BTFA 3OCBA 4GEOA 4F70A 5ITAA 4Z3VA 2GHMA 3CXWA 2O64A 2XYNA 4BCNA 3FBVA 2BZJA 2VO6A 3ZUVA 3TZ7A 5HE3A 5DRBA 5HVJA 5LJJA 3PDTA 4ZTNA 2B9FA 4IX4A 4ZMFA 4MXYA 2J90A 3FZPA 3QCYA 3QX4A 5JEBA 1U59A 5HICA 3G9NA 5BNJA 2GFCA 4EH9A 3ORZA 4RBLA 4FOBA 1P14A 5AR7A 5FQDC 4DITA 4FZAB 5JFVA 2C6MA 4TWOA 2PZRA 3PJ2A 5AUUA 3CTJA 4U80A 5DGZA 4M14A 3NAYA 5IUGA 2XIZA 3B2TA 3VC4A 1H07A 2GS6A 2WMTA 3OOMA 3PXFA 2OIDA 3ZONA 4YBJA 4QT1A 3DJ7A 4YPDA 4E7WA 4F9BA 1BL7A 3TI1A 4BHZA 5FEEA 3UYTA 3COIA 3CTQA 5M55A 5GNKA 2CCIA 3NUYA 1Y57A 4NM5A 4OUCA 4QMOA 4L45A 1J91A 1YI6A 3O8UA 3IW4A 3W2SA 5K9IA 4YGAA 4EC8A 4WSYA 4ZTMA 2B52A 2IVSA 2W17A 4QQJA 3EIDA 4JX3A 1S9JA 4U42A 4YU2A 2OZAA 5A4QA 4D5KA 3VS1A 4DC2A 1GIHA 3U6IA 2X9FA 4JQ7A 3W8LA 2VWXA 2XIKA 1KOBA 1SZMA 3TTJA 4EK6A 5KNJA 3HVCA 4ZY6A 4ZS0A 4JQEA 3CD8A 2ESMA 5CALA 1KUTA 5C4LA 4IWDA 2BZHB 4FTQA 4HW7A 4R3RA 4F0FA 4C35A 1YHSA 1UV5A 3LFQA 4ZJIA 4FL3A 1JSUA 3FPMA 3VBQA 3C50A 4LGHA 3IS5A 1IA9A 2JKQA 4FC0A 2BFYA 2X2KA 5LOHA 4ZS4A 3SKCA 3QRTA 3QXPA 4FTJA 2DQ7X
chains in the Genus database with same CATH superfamily
3A7HA 2P3GX 5DI1A 4MTAA 3PG1A 2QOCA 4IANA 4X3FC 4IAZA 3TXOA 4QQ5A 2DUVA 4I41A 4FTUA 3SA0A 5FTOA 3U6JA 3NEWA 2VTNA 2PU8A 4L8MA 5CI7A 3IQ7A 3EKKA 5DR6A 3R30A 5A3XA 5ANGA 2R3JA 5AR8A 5JFXA 3DB6A 1H27A 3DXNA 2H6DA 3QALE 4RJ8A 5HIDA 4ZZMA 4E6DA 1SM2A 4O1PA 2PVYA 4FKGA 4EL9A 4ACGA 2EXEA 5TO8A 3DK3A 4G9CA 5IQEA 1DAYA 3Q3BA 4FK3A 4AZSA 4UXLA 3QC4A 2EB3A 2ZMCA 3PLSA 4IIRA 5AJQA 4FMQA 2YM8A 4I6FA 3UO6A 3ZRKA 3MTFA 4AFJA 4PDPA 5G6VA 2OICA 3TG1A 4HVGA 3F3UA 5M53A 2PYWA 5BX0A 2RFNA 4OTHA 4NW5A 5HD7A 4U9AA 2CKQA 4D2VA 4DH5A 4FGRA 3BGPA 2YN8A 5KBQA 4EQMA 2VWVA 4JOAA 4QTCA 4V0GA 3WF9A 3HAVA 4OTGA 5BUEA 2XCKA 3A2CA 2HZ0A 3BEGA 3K54A 5LVNA 2NNWB 3C0GA 2PMLX 1GOLA 2EVAA 2WIHA 3UDTA 3D0EA 2W05A 5JRQA 2OU7A 2HW7A 3HV7A 4UMQA 4ZSEA 4AOJA 2GTNA 4KSPA 3QYWA 3ROCA 4D55A 4XP3A 1OKVA 5IF1A 3K2LA 5EYKA 1UU7A 1PKDA 3PZHA 4FTRA 1OZ1A 3C51A 1OKZA 3LCOA 4R1VA 4C57A 3Q4CA 3MGYA 4WUNA 3PTGA 2B54A 3EZVA 3OZ6A 5H2UA 5BMMA 5CSHA 4CFUA 2JDTA 4FIIA 1ZYDA 3I7BA 4UN0C 2VNYA 4IH8A 1WBVA 2GCDA 3TUBA 3U54A 1Q3WA 3QQHA 2JDVA 4E26A 1ZMUA 3QL8A 4PL3A 4BVUA 4CXAA 4BCMA 2ITWA 3E3PA 2OIBA 1PXLA 2CGUA 3VBTA 5I0BA 2OJIA 3LKMA 4QYGA 4YNEA 1XMMA 4TW9A 1NVRA 2ZV9A 3OY1A 5ETAA 4RFMA 4ZTQA 4KS8A 4MKCA 3NS9A 4KIKA 1G5SA 2XYUA 1OIYA 4EH2A 4UZHA 4J97A 3VUIA 4XG6A 4CLIA 3NR9A 5J1VA 3KMMA 4OTPA 2HXLA 4NCTA 1GNGA 3EQPA 4XOYA 4ZZOA 4K33A 3LCKA 1UNLA 1YXVA 3EWHA 3PSCA 2UW5A 2X2LA 2QOFA 3LFNA 4CNHA 4FEQA 3UMXA 3FEGA 2WO6A 4MBLA 3CY3A 2W1DA 3H9RA 1PXIA 4L01A 2I0YA 5JZJA 2Z7QA 3BQRA 3FZOA 1V0PA 3SRVB 4HYUA 1P4FA 3RPVA 4LI5A 2WQMA 5TR6A 5A4EA 2BILB 2C0TA 4GS6A 4QO9A 3UNZA 4C7TA 2ITQA 2JDOA 4FKVA 5GZ9A 5AR3A 2NRYA 4AA0A 4MQ1A 3TT0A 4ITHA 5FD2A 1IAHA 3LJ1A 1PMEA 2R7BA 2WQNA 3DLZA 3RNYA 3ZXZA 5L6OA 1ZYJA 3TIYA 4GCJA 4BBFA 4YZ9A 2EB2A 1BYGA 2BDWA 3LLTA 3KU2A 3OEFX 3RAIA 3G2FA 1ZARA 4G9RA 4RGJA 3W2QA 2UZUE 3VJOA 4EC9A 2ITYA 3QKLA 3G6GA 5AP3A 2C6KA 4DLIA 5BPYA 4CKRA 2ZVAA 3OUKA 3DLSA 5KZIA 2E9VA 2W4JA 3HV6A 3OW4A 4GFGA 4GKHA 5HCZA 2WTWA 4BYIA 5M56A 2EXCX 5LQFA 2WIPA 1FMOE 3DZQA 5CQWA 5DR9A 5H9BA 4H05A 3ET7A 5I9XA 3E8DA 3IW6A 3I5ZA 5AP7A 4HJOA 1UU8A 3CTHA 1B38A 3HMMA 4GFOA 2BAJA 4G2FA 3NYVA 4Q5EA 5FXQA 1WAKA 5AIRA 1Q3DA 2JITA 4FTKA 3R21A 3GB2A 4JQ8A 4GU6A 2B1PA 4LQMA 4NJ3A 3RP9A 4E93A 2ITTA 3ZC5A 5ETCA 2ZV8A 3RKBA 2VTOA 1OBGA 2J7TA 2X0PA 3I5NA 5CEMA 1XQZA 2YDKA 4IB3A 3V5LA 5B7VA 5ETIA 4LL5A 3ZLWA 5CANA 3GC7A 4GUEA 2GNFA 1IAJA 2UZOA 4TXCA 4W4WA 5LMKA 4TYIA 4E4NA 2CLXA 5KCVA 3FLSA 4QMMA 1ZYCA 4EOLA 1R39A 1JQHA 1R0PA 1W2DA 3JPVA 3LPBA 5L6WL 2XARA 3HDNA 3CKXA 4GJ3A 5AWMA 3VS3A 3JYAA 1XWSA 3LQ8A 4MNEB 4B0GA 3OOGA 3ZLXA 4QOXA 2XMYA 3Q5IA 4MEDA 4FV9A 1U5RA 4C3FA 4CQGA 3QQGA 4W4VA 2XBAA 2JEDA 3FLNC 1PJKA 2ITNA 4PY1A 4DHIB 3QZGA 1Y91A 2V22A 5J9LA 2C47A 3I79A 4CZYB 3HMIA 2EWAA 3KQ7A 2PMOX 5E8YA 3FPQA 5IA4A 4Q9ZA 5AA8A 4I1ZA 2J0LA 2ZFYA 1J1BA 3CCNA 3T9IA 3ROYA 2XM9A 4FRFA 4GK3A 4AA5A 3S00A 2ZM3A 4O0XA 3LXKA 1LEWA 2R3HA 1IASA 4AOIA 3UZTA 3ZO4A 5F20A 4RQVA 1KSWA 2BRHA 1O9UA 2YIRA 2AUHA 2A1AB 2PZIA 3H9OA 3V8SA 4FSUA 3OTUA 2YHVA 2SRCA 3G51A 3GOKA 3HLLA 3KFAA 3KMUA 4F08A 1M7NA 2R7IA 4FGBA 5CSXA 4ACHA 3R71A 4CMUA 2YACA 3KVXA 1IA8A 2WMWA 3RZFA 4I24A 3FL5A 4EKLA 2Z7RA 3EN4A 2PZYA 3LHJA 2C5OA 4BKZA 5M4UA 3BBWA 4UX9A 4J53A 5AV2A 4GV1A 4R78A 4B8MA 3OHTA 4EKKA 3FMMA 5AUYA 3BKBA 2ZYBA 3EQIA 4WNKA 4KABA 2AYPA 4HPUE 2VWWA 4M67A 4ANMA 1G8JA 2YWVA 3RALA 1PW2A 3TJCA 5T3QA 3H9FA 3I6UA 3NCZA 3ZUUA 3QLFA 2HZIA 3KKVA 3DK7A 4DH1A 1E1XA 5CI6A 2BTSA 2JAMA 3P7CA 2QOIA 4Y72A 4U3ZA 5CNOA 3TTIA 4DLJA 3F66A 3OP5A 4DGGA 4JLCA 4WKQA 2YAKA 5F1ZA 3ZO1A 2JBPA 3BWFA 3FQHA 1FVVA 1QPJA 4PDSA 1XBCA 3R8MA 3EFWA 3HGKA 3UIMA 3FLYA 5AAGA 5CEPA 4OAVB 4IBMA 5HLWA 2UZBA 3BU6A 3UOJA 3W0SA 4C36A 3P7AA 3EN6A 3DBEA 4NSTA 3VUMA 4QQTA 1XMLA 3GBZA 5CYIA 4PMTA 4BHNA 3KGAA 5D7VA 3VHEA 3FAAA 2J51A 3F5XA 3ORLA 4RMZA 4S32A 2QOQA 2ZV7A 4O7LA 1J3HA 3Q4ZA 3RPYA 3KEXA 2PPQA 2NRUA 2WELA 1A48A 1FPUA 2VO0A 4K9YA 4B7TA 4CV9A 4AXDA 2ZJWA 3E87A 2R64A 3M42A 5CX9A 4MUQA 2WOUA 3LXLA 4JDJA 4J8NA 4EHGA 4LG4A 4ZJJA 3E62A 3FYJX 3SW7A 1VZOA 3CQWA 4W9XA 3PLAE 5KHWA 5J7BA 3H0YA 2B55A 5ANKA 2RG6A 1B39A 4XMOA 4YC3A 2CNVA 3LJ2A 3DQXA 1APME 2XK9A 3TKHA 3DV3A 3ZRLA 3MH3A 2P4IA 3T9TA 3UDZA 4MX9A 3BYMA 2WEVA 2X4ZA 2YDIA 4Q2AA 4FKWA 4G1WA 3MSSA 3PXKA 4J8MA 5C9CA 4F7SA 3KULB 3LJ0A 5IA5A 4BWPA 5T6KA 3II5A 4H1JA 4YLLA 4KUJA 4GYGA 4AQKA 3ORTA 3POZA 4PPAA 4I5MA 4ASEA 1KE6A 3ZFMA 4J7BA 4Y8DA 2BMCA 2W0JA 3ORKA 5ACBC 5CF8A 3BHHA 2WTDA 3TWJA 5FTGA 3QKKA 4PUZA 3UJGA 4LRJA 2Y7JA 4QTBA 4KBCA 2H96A 2ZV2A 2GHLA 3C1XA 3MV5A 4NEUA 4B9DA 4O7VA 4L68A 3QRUA 4I0TA 4C2VA 4HYSA 3U8WA 4EK3A 5KMMA 1UKIA 1UU9A 1QPEA 4ACDA 5L6PA 3KMWA 4D2PA 3O96A 3TNHA 4C61A 4FE2A 3KL8A 3DGKA 4LV8A 4RZVA 5GJDA 5HBHA 3SXSA 1W7HA 2BAKA 3NLBA 5CU0A 4ZLZA 4ZTSA 3EQCA 5JKGA 4JIAA 2ETRA 4G3CA 5HKMA 3KN6A 3W0OA 1H00A 5ANDA 5LWNA 3FMHA 1L8TA 1UWJA 2YISA 3I60A 3OT8A 1WVXA 5IEVA 2E9PA 2W99B 4BCGA 2R3LA 5I5ZA 2FA2A 3ZSHA 2BRNA 2CGWA 4KWPA 4KA3A 4QPSA 3MBLA 4TYJA 3AC1A 2OIQA 3FMNA 4RIWB 4V05A 1UVRA 4EORA 4DBXA 1M14A 1Q24A 4YTHA 4FTCA 3BL9A 1SVHA 4HCVA 3WOWA 4ENXA 2X8DA 4DEAA 2FH9A 1YXTA 3LE6A 4TYGA 2FYSA 4D2WA 3AT3A 5LARA 1FBNA 5HG8A 4PDYA 4RWIA 4XG9A 2CJMA 5ANOA 5L8LA 5C8KA 5KMLA 2C69A 3DXPA 5E8VA 3FLQA 4I6QA 4E6QA 2OBJA 4Y95A 2W06A 1U54A 3Q4TA 5F94A 2PY3A 4GVJA 1FQ1B 3TCPA 1SVGA 3ZHPC 5AV1A 2G1TA 2ACXA 4DF3A 5AEPA 4EBVA 2ITOA 4YPSA 3ZM9A 3FDNA 1NY3A 3H4JA 3LFCA 3U9CA 4CLJA 4O0UA 2Q83A 3BGZA 5BMSA 4IAKA 4WOVA 3L8SA 5DEYA 3KK9A 5HBEA 4BI2A 5C03A 2E9NA 3NVKI 2YDJA 3KXMA 4FTMA 4R3PA 3UPXA 3O5AA 2WGJA 5FDXA 1YHWA 3TZ9A 4IC7A 4CCBA 2QU6A 2VTPA 5A6NA 3DBQA 3P0MA 1TQPA 3Q96A 2OK1A 1DAWA 3QUPA 4NM7A 2C6IA 3F2AA 1ERKA 4YSJA 3EN7A 3EN9A 5TT7A 4AF3A 4C59A 5KE0A 3PWDA 3R0TA 4C4IA 3PSBA 5EOLA 4EK4A 3NW7A 5FM2A 4DFZE 3FWQA 4HGEA 4PPCA 3NUAA 4EYJA 2UZWE 3Q53A 5JZNA 2JAVA 2GNJA 4G5JA 1UA2A 4XV3A 5AP5A 4EH4A 4LDTA 3MVHA 2X8EA 3HV4A 4S31A 3GCSA 2YWPA 1JKKA 4KD1A 4LV5A 1NXKA 1OPLA 3T3VA 2QO7A 2VWZA 4I22A 4PWNA 4IXPA 5HLPA 3UGCA 2WD1A 1BL6A 4UWBA 4D1ZA 2HELA 4IZAA 4I5PA 3U55A 1PXPA 3BPRA 4N6ZA 4DEDA 5CF4A 2R3NA 3FI8A 4MQ2A 2OXYA 3OROA 1FINA 3RPOA 1FGKA 4ALUA 3UO4A 3F2RA 3DAKA 3Q5ZA 1OUKA 2B9HA 2XNPA 4KKHA 4ZIMA 3UIUA 3PVBA 1ZOEA 1NVSA 4KKEA 3HZTA 4Y46A 5AR5A 4U43A 4YNOA 4RJ5A 1OBDA 4G6OA 4MXXA 4FZ6A 2OXXA 2PZPA 3FI2A 2OJJA 4BKJA 2QO2A 4LUEA 1BI8A 4MHAA 2PVMA 2I0EA 5EHYA 3ZTXA 3P9JA 2WTJA 3A7FA 4M7IA 4NFMA 2QD9A 3V5PA 3IPHA 5HHWA 2QONA 3OG7A 4AN2A 3LMHA 3LMGA 1LUFA 4IAAA 2B9JA 3OS3A 4CZUA 4FEUA 4QP6A 3AT2A 3BLQA 1RE8A 4C4JA 2Y6OA 4FKQA 3RI1A 3FQSA 2BCJA 1PMUA 2XJ1A 1W98A 3DU8A 3KF4A 3OCSA 4U40A 4ENYA 5IDPA 2P2HA 1W83A 2UW0A 4AP7A 4AZEA 3DDPA 1ZOHA 2PMIA 3F61A 1Y6AA 4L00A 3UDBA 3E93A 4F65A 4BJJB 3WZUA 3NPCA 2IF8A 5K5NA 2Q0BA 1URCA 3Q9XA 4RJ4A 2PE2A 3ACJA 4PL5A 1KV2A 5B2MA 2IG7A 4N6YA 3PFQA 4H1MA 4ASDA 3AKLA 1GIIA 4XNEA 4FTAA 4MBIA 3E64A 4FEWA 3NX8A 4O38A 2HOGA 2XEZA 4QP1A 5KMNA 4YJOA 5CF6A 4B99A 2I40A 3CBLA 5EI6A 3O17A 4LM5A 4QNYA 3RAHA 4NIFB 2IW9A 4C02A 2XRUA 2IW8A 5CEOA 3ACKA 4BDIA 4JXFA 4L9IA 4DFYA 4UMRA 3CC6A 4NT4A 4RIXA 4HVIA 5IQGA 2WMQA 2WZJA 3CQUA 5LCJA 3K3IA 4N70A 2F49A 3TNWA 3BQCA 4UV0A 3W2RA 5IMXA 3BU3A 3DTWA 3Q9WA 2FSOX 4E5AX 3HRBA 4MD7E 4AQCA 3A8XA 3ML1A 1XBAA 2DS1A 4DGMA 1PMNA 3H0ZA 2F7XE 1XJDA 3H3CA 4DG2E 2WAJA 1RJBA 3DNDA 5IG1A 4JDKA 2QQ7A 3W2PA 2W7XA 2UVZA 4HCUA 2YCSA 4FR4A 5EYCA 4LL0A 4CD0A 5IISA 4V01A 4XYFA 4BZOA 3TM0A 2OWBA 2RG5A 4IVAA 4J98A 1TKIA 5FTQA 5JQ5A 4I5CA 2RSVA 4OBPA 4XRLA 5LCKA 4DTBA 2UZEA 4CZTA 1T45A 2CKOA 4WT6A 3WIKA 4MD8E 4LFIA 1M17A 4EHZA 4MXAA 2XK7A 2VWYA 3U9NA 4CYJA 3F69A 4GT3A 3BHVA 2OH0E 3A60A 2C68A 1PKGA 3GEQA 5AP6A 3AC3A 5AUXA 5I3RA 5LVMA 3BIZA 2VTSA 2VZ6A 3POOA 4GK4A 4X2NA 4TWCA 3BELA 4XH6A 4C3PA 5EKOA 5CAQA 4ZSLA 4ALVA 3M11A 4CFNA 4O83A 3AC2A 4A4OA 5AX3A 4O22A 3WZKA 4YBKA 3FMEA 4BF2A 1CMKE 4X3FA 1P5EA 4GVAA 5ETFA 4EOJA 3BHUA 4FIFA 5BVFA 2XBJA 4PTGA 2CLQA 5C1QB 1TZDA 2F2CB 4H58A 2X81A 4YHTA 5AUVA 5CS6A 4FA2A 5FUTA 3E8CA 3ID6C 3U6HA 3OWLA 3ZFYA 3NUPA 3SV0A 4FSYA 2OFVA 4UXQA 4H3PA 3DDQA 3LFAA 4ZAUA 3N4TA 4PTEA 2AEGA 3NCGA 5DR2A 4H39A 3WARA 4C38A 2JKOA 3PPKA 3WF8A 4JT3A 4LOPA 2VTHA 3ETAA 4BCPA 4ZXTA 4U3YA 4P90A 2B0QA 1M52A 2QI8A 4O6LA 4UYNA 4NTTA 2RGPA 5E7RA 5B0XA 1VYZA 4HYIA 4USDA 4ZY5A 4XG3A 4WG4A 2QCSA 3R04A 4KINA 4X2FA 4BTMA 3IGGA 4H3QA 5AM7A 4U44A 4D2RA 2WTIA 4EHEA 4IWQA 2J2IB 2OJGA 2VUWA 4OTFA 2J0JA 3A7JA 3R01A 3VAPA 4XV9A 2I0HA 4GG7A 5IA2A 3VQHA 3PJ3A 3LVPA 3QTZA 2QO9A 4GH2A 4TT7A 5E8SA 4U0IA 3ODYX 1UKHA 5FBOA 3RPSA 3LZBA 4A9RA 2OGVA 3IKAA 4ANBA 4LV7A 4LRMA 3QC9A 5AV3A 4F7NA 2XKFA 5IPJA 4C34A 3QTUA 4ALWA 4FI1A 4X2JA 3FC1X 5CVHA 4AW1A 4O21A 1GJOA 3ZMMA 2YITA 3I0OA 2Q0NA 4TY1A 3D5UA 3C9WA 4MK0A 2YZAA 3A4OX 4MXCA 1YDRE 5KKRB 1H0WA 4B6LA 3MFSA 5FM3A 5E91A 2QG5A 3COHA 1OIQA 2B53A 2EUFB 3LFDA 1NA7A 3ZC6A 4Y5QA 2V7OA 3MH1A 1YDTE 4UB7A 4OTQA 2XM8A 4CRLA 4YURA 3ZSIA 2BAQA 5HE2A 4EQUA 3QD0A 4PRJA 3RBWA 4C4EA 3SLSA 4FNWA 2WMAA 3EMGA 3G5DA 3V5WA 5KX8A 4YP8A 3ZU7A 1YHVA 5B2LA 3AD6A 5DH3A 1Y8GA 3NWWA 2P55A 4E8AA 5I9VA 5E8UA 3A62A 3NMUF 3MJ2A 4K77A 1NT2A 1WBTA 4EZ3A 4W4XA 4EJ7A 4QYFA 1FGIA 3AQVA 2J0IA 2UW7A 4DT9A 4EOPA 2YJSA 1VR2A 1LP4A 3PUFC 2YIXA 1W8CA 3EYHA 4AN3A 1YXSA 2GTMA 5AR4A 2XVDA 3BLRA 5DEWA 4KKGA 3RCJA 3IDCA 4A4XA 4A9SA 4D1SA 3QTXA 3UNKA 3HAMA 4KNBA 2UZDA 5FGKA 4OT5A 5CAVA 5J1WA 3TDWA 2X7FA 3HRFA 5ACKA 4AFEA 3FZRA 5EW9A 5LVLA 4KRCA 4ZLYA 4IDVA 5JSMA 3UQCA 3VUTA 5AFVA 2VTQA 3SVVA 4AXEA 4MH7A 2AC3A 4BCJA 3D83A 2QODA 4O4FA 5CSVA 2V55A 5KMOA 4FIEA 2IEWA 3TNIA 3NFFB 4YC6A 5JQ8A 4DT8A 4EH5A 3BE9A 4M66A 4LMUA 2JC6A 2WMXA 3QTWA 4H3BA 4HCTA 1I44A 2REIA 2YAAA 3DKOA 3TL8A 2ITUA 4I0RA 1Q4LA 4A9TA 4YJTA 2PVFA 1H8FA 2GPHA 3HP2A 4M15A 4O4DA 3S4QA 3OXZA 3UOHA 3FZ1A 4WG3A 3VO3A 4BL1A 4DCAA 4F78A 5GINE 3PA3A 3AOXA 4I20A 2RIOA 1YI3A 2VN9A 3KXHA 4IB0A 3GFEA 4R1YA 4Y5HA 3PP0A 3PXRA 3VUDA 1G8AA 3E8EA 4ANOA 4I93A 2H9VA 4BYJA 2ERKA 3FL4A 4IVCA 4XG8A 4KIQA 2VU3A 4ZTHA 3MB6A 4QMYA 3PY0A 2WEIA 3HUBA 3SD0A 4YZCA 2OH4A 3R1SA 4YJUA 2XKEA 3EN5A 4IDTA 4MWHA 4CT2A 3R83A 3O23A 2IZUA 4ZSJA 3SHEA 4AACA 3OCGA 1ZZ2A 3H10A 4YC8A 2IZTA 3N9XA 4PL4A 3QWJA 1XHAA 2X2MA 3SDJA 3SAYA 1OL7A 4RFZA 3LLAA 4EH8A 5LWMA 2PUNA 2J4ZA 3SQQA 2Y6MA 2FB8A 1MRVA 1AD5A 5ICPA 3E88A 3VUGA 4K8AA 1FVTA 4LUDA 3W10A 2I6LA 4QMLA 4R8QA 4BGHA 3G9LX 5HX8A 3K5VA 4OGRA 4RX7A 3WZJA 2QG7A 5BVDA 3QAME 4IAFA 2VRXA 1I09A 4RVMA 2H34A 4A06A 2CKPA 1PHKA 2OZOA 3L9NA 4O91A 4O0YA 3LCDA 3EHAA 1QMZA 3UC4A 4CFMA 5CF5A 2CPKE 4ARKA 3QBNA 5HG7A 5FBNC 3KXGA 3RK9A 3WYXA 1DI8A 4AZVA 3ZS5A 1WBSA 2O65A 4P4CA 5J5TA 4NYEA 4FSRA 4TYHB 5M44A 1H0VA 3UE4A 2WFYA 4M8TA 4PNKA 2ONLC 4BDBA 4DBNA 1OGYA 4QMWA 4D0WA 4BI0A 3R8UA 2C0IA 1XH6A 2AC5A 3MI9A 4IM3A 4JJRA 3AGLA 3F3TA 3QD4A 3FSFA 4CRSA 2CN8A 4QPAA 2YCRA 5HESA 1OL1A 3UIXA 3ORMA 2A0CX 2X0GA 4UY9A 3RWQA 3VQUA 3WF5A 3OCTA 3VNTA 4U8ZA 2OLCA 4IQ6A 3CJGA 3W55A 2Z8CA 3THBA 1WBWA 3W16A 3VS7A 4EWQA 5CWZA 4JBVA 3AMBA 4IX6A 2ITZA 3AG9A 2PE0A 4AW0A 3IW8A 5A4TA 2W9ZB 1K2PA 4M69B 2YM7A 3V8WA 2Z2WA 3KRJA 5IQCA 3VW6A 1ST0A 4CG8A 3V5TA 4YTFA 2GHGA 2C5VA 3ULIA 5M06A 3QQUA 3FKOA 3DBFA 3G90X 2GFSA 5EH0A 4JMQA 3GVUA 5K5XA 4C4GA 2C4GA 4U41A 5FEDA 4O82A 2FSLX 4OTDA 4Q9SA 3IW7A 2BIYA 4RX5A 3SRVA 4WRGA 4QDEA 2F2UA 4JDIA 3LXPA 4Z16A 1VEBA 5DE2A 3HKOA 1UWHA 3KXZA 3ZM4A 3ENHA 4R7IA 3O71A 3WF7A 4CQEA 4PDOA 2QLQA 2UVYA 3FHRA 2YIQA 4DGOA 3ALOA 3L9MA 2ZOQA 4AZWA 3U87A 4FIJA 2QOBA 2YM5A 4RC2A 5EYMA 3V8TA 4BIBA 3BLHA 4BBMA 2V0DA 4DEIA 5M4IA 4FKSA 1Z57A 2OI4X 5FEQA 3LAUA 4NW6A 4TWNA 3R8VA 5EW3A 4DHFA 5IDNA 2EU9A 5LMBA 4FT3A 4BB4A 5EQPA 3LFSA 3DXQA 3KREA 3NIEA 4E4MA 5CU4A 2G15A 3ZZEA 1OIRA 3L9PA 3OF0A 4NM0A 4JI9A 2YABA 3JR1A 1KE7A 3W0NA 4EQCA 4G6NA 4BDDA 3EJ1A 5ANIA 5KO1A 1ZMVA 5CASA 1O6LA 2R0IA 4FKTA 3REPA 4G3GA 4F6WA 4BCKA 4QMTA 2G2FA 3HMNA 2BDJA 5E90A 4AS0A 4K6ZA 4FV3A 3LQ3A 1Q62A 3JVRA 3UC3A 2C6EA 2R3PA 3ORIA 3PRFA 3ALNA 5IH4A 4IB5A 4JNWA 1R3CA 3FI4A 4KBAA 5DT0A 3BV3A 4O7WA 4D0XA 3N4UA 5KMKA 3PVUA 4L53A 2VTAA 4R7BA 2W1EA 3D7TB 2YZLA 4RVKA 2IVUA 3QUEA 1ATPE 2BTRA 1O6KA 1W84A 1BLXA 1OKYA 2FSMX 3FI3A 4QPMA 5BYLA 1OGUA 2Y0AA 2V5QA 4MYGA 3LW0A 2XRWA 5DIAA 4F0IA 3DZOA 2HW6A 1Z9XA 2ETMA 1LEZA 3L8XA 4UMTA 4BGGA 4G34A 3B2WA 4XG2A 3F6XA 4X0MA 4DEEA 2XIXA 4EOOA 3QLGA 1DI9A 5M09A 3EKNA 2XK3A 4L44A 4QQCA 2C5YA 2WQBA 3MVJA 5DWRA 1V0BA 2WXVA 4ANSA 3R7EA 1NVQA 3OWPA 4EHVA 3MFRA 3R7IA 4IM0A 4DHZA 3WBLA 4MNEA 3VVHA 4E6CA 4O0SA 1J7LA 4DINA 4FV8A 2X6EA 4FKOA 4W4YA 5CZHA 1BKXA 3KRRA 4GMYA 4G6LA 5KZ0A 3CSVA 4A9UA 3GUBA 3EL7A 4FUYA 4IEBA 4GT5A 3WF6A 3D2IA 5IH5A 3S1HA 4M12A 4TKSA 4XCUA 2XALA 3R2BA 1IR3A 3RAKA 5AADA 4JG7A 3U4WA 3MA6A 2P2IA 4FODA 3QUDA 2WU6A 2XAMA 4P2KA 1RQQA 3GCUA 4RIYB 2VO3A 3ORPA 4E3CA 4XG7A 2KULA 3NSZA 4JR7A 4RZWA 3FKLA 3OBJA 3N4VA 3G0FA 3PY1A 4JDHA 5J79A 3LOKA 4HGSA 1ZY4A 1V1KA 2A4LA 4MF0A 4RX8A 5DHJA 4Z55A 4IACA 3R7GA 5EI8A 5JFWA 4QMNA 4R7HA 3R7VA 4L46A 3W0QA 1Q8ZA 2HENA 2R5TA 5HGIA 3ITZA 3VF8A 4O96A 4AAAA 2R3QA 1SNXA 2E9OA 3F3ZA 4MXZA 4KBKA 3BBTB 3QA8A 4ID7A 4XEYA 4D58A 2EXMA 3TV6A 1H1RA 3PWYA 2O5KA 3C7QA 3F5PA 3MIAA 5I9WA 1J7IA 3PJ8A 1IEPA 2XEYA 4YJNA 1OI9A 3A61A 4N4SA 4RWKA 4J71A 4LMNA 3WYYA 4FZ7A 3DPKA 3F88A 4RQKA 5EM7A 4DG0E 3UOKA 3PE1A 4O7RA 4GT4A 5FXSA 3GFWA 5DNRA 1B6CB 1A9UA 3EH9A 4DH8A 4F64A 1V0OA 5EM5A 4FG8A 4BR3A 2ZB0A 1W0XC 5EM6A 4BCHA 2Z02A 1H26A 3DNEA 1RW8A 4OBQA 3QU0A 4X6QC 3PFYA 2WMUA 2JIIA 3GCQA 4D2SA 3I6WA 3O2MA 3IGOA 2ERZE 2PMNX 4IX3A 2YCFA 5CNNA 4USFA 4FSZA 4M0YA 4JX7A 2HZ4A 4FTTA 3W0MA 3VJNA 3MA3A 5EDPA 1W2FA 2GNLA 4QMXA 5AUTA 2H8HA 4O84A 4OW8A 2J9MA 3QX2A 2ITPA 3JVSA 5AAEA 2BHEA 2R3KA 4GUBA 4MCVA 4O7SA 4AZTA 5IA1A 3AMAA 1QPDA 5EDRA 3QRKA 4BDAA 3RM6A 3DA6A