4DFYA

Crystal structure of r194a mutant of camp-dependent protein kinase with unphosphorylated activation loop
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
337
structure length
310
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFATPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the regulation of protein kinase a by activation loop phosphorylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 94
structure length 310
sequence length 337
chains with identical sequence E
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfyA02
3R73A 5KKRB 4OTGA 4FKVA 3LLAA 1HOWA 2BDJA 1PXKA 3HYHA 4A4LA 4TN6A 4BZNA 4FSNA 5FTQA 4GJ3A 5K3YA 1Q99A 4CFXA 1MQBA 4EI4A 3V8SA 2XNPA 4YZBA 3UIUA 3LHJA 5J1WA 3BHUA 3ROYA 2X7FA 3O96A 3VUKA 4DA5A 3E8NA 4PV0A 3DS6A 3E63A 2RSVA 2O0UA 3IQ7A 4WIHA 4GCJA 4XUFA 3MJ1A 3EOCA 2C5NA 3IGGA 4I22A 5FBOA 5IEXA 4R6VA 4MQ2A 3MFUA 5AP7A 4FIHA 2IVSA 4NH1A 3FZOA 3PUPA 4AF3A 4PNKA 5HE2A 1ZWSA 3K2LA 4X2NA 5EHOA 2X0GA 3DLSA 4G3CA 1RE8A 4ZP5A 3R8UA 4AW2A 3G51A 4BDHA 5BVEA 4BGHA 2HZ4A 5B2KA 1XR1A 4DEGA 3N4TA 4XG8A 3QLGA 3ZM4A 2Z7LA 2GQGA 1B39A 3FPQA 3MJ2A 4AGDA 4N6ZA 5J9ZA 4O81A 3HP5A 4A9UA 4AA5A 3ZZWA 3V6RA 4UYNA 2WMTA 4O91A 4WT6A 5CXZA 4C34A 4EK6A 2R3LA 3SG9A 1YI4A 5DT4A 4JBQA 2VN9A 3R1SA 3W10A 4ZTQA 1R3CA 2FSLX 2X6EA 4YHTA 1P2AA 4F0GA 3DAJA 3GQLA 1B6CB 3OT8A 5HO8A 3UIBA 5E8YA 3QRIA 2FB8A 4XOZA 4M97A 3AXWA 3NNXA 4FSQA 3HX4A 1OVEA 3D7TB 3QXPA 5CASA 4EOLA 2G2HA 5DWRA 3F3TA 5DRDA 3FEGA 5CNOA 2YZAA 2X7GA 2IW6A 3IW8A 4HYIA 4M0YA 3JY9A 4D0XA 5EDRA 3EFLA 2YITA 1OMWA 3EQBA 3FWQA 3QLFA 4NTSA 1J7LA 2Z2WA 4O86A 3MVMA 5DR6A 3FUPA 5EM8A 3RPRA 4L9IA 2FVDA 4UZHA 2VO0A 5LWMA 3MY0A 5DBXA 3HAVA 3PXRA 2JFMA 4GL9A 4XEYA 2FH9A 2WQMA 4CRSA 3W2OA 5HVKA 2QURA 4O84A 3UQCA 2H9VA 4FIJA 4DT9A 4V01A 4F65A 5HHWA 3DBDA 3T9TA 2F2UA 4AG8A 4Y5HA 1OUKA 4U97A 5HE0A 5I9VA 3FMMA 2OH4A 5CAUA 4AFJA 3IGOA 4YZCA 3TM0A 4Y46A 5GHVA 3CC6A 2BHEA 4RIWA 3NUSA 2ITZA 4IC8A 3HV6A 4YJSA 4IDVA 5TO8A 4XLIA 2UW5A 3FAAA 4NCTA 2BFXA 2QU6A 3A7IA 4TT7A 2JKKA 5C03A 2XRWA 3M42A 4D4VA 3OCGA 4FT3A 3ZFYA 3WARA 2UZLA 4AW1A 4AT5A 4R7IA 2A4LA 5EHYA 2WFYA 3VUDA 4YJRA 2QOQA 5CXHA 2H34A 4XG7A 4ZTNA 2BKKA 1H1WA 4UYAA 4BVUA 2JGZA 4G9RA 5E8ZA 3K3JA 2LAVA 2QI8A 4YPDA 5HICA 1OPJA 2P0CA 4FTAA 3VJNA 3BYSA 4J99A 3OUKA 4UWCA 3PZHA 3VVHA 3KVXA 5CYIA 3Q9XA 5H8GA 3D5VA 4KIPA 4LV5A 1ZZ2A 3ZLYA 4ACCA 5CVGA 2CLXA 5EW8A 3F5UA 4GH2A 4OTWA 3ZM9A 5ANJA 5K5XA 3PSBA 4P5QA 4TYIA 4BIDA 1BI7A 5LMKA 4U3YA 2IW8A 5H3QA 1V1KA 3QGYA 4D4SA 2ZV2A 3QTRA 3O71A 4DG3E 5JT2A 3Q2MA 4KBKA 1UV5A 3OS3A 4PRJA 3R9OA 3UE4A 4Z16A 4FX3A 5BYLA 5M4IA 4FK3A 4MYGA 3WF7A 2ONLA 3NPCA 3IW5A 3VUIA 2QOFA 4FTCA 4FV5A 4L44A 5E8UA 5AUYA 2C3LA 4O7SA 4E20A 4CKIA 4YTFA 3MSSA 5DR2A 2WMQA 4FA2A 1APME 4MKCA 5EOBA 4AAAA 2XEZA 3GNIB 3OFMA 4W9WA 2OJGA 3PSCA 3ENMA 4RX8A 3PFQA 5M55A 4DYMA 3CSVA 2QG5A 3W33A 2HZ0A 2JAMA 4EOMA 4FUXA 4DT8A 4KNBA 2GMXA 4ZTMA 5CT0A 1K2PA 4ASXA 4C33A 5CZIA 2JDTA 5KO1A 4DEDA 5IQCA 5FM3A 3NYOA 4EQCA 3SOCA 2B9IA 1ZMWA 4HYUA 3TIZA 3U8WA 4MX9A 4QYHA 4E8AA 2PVJA 4YGAA 2GPHA 3COIA 4ENXA 3ZO2A 2GQSA 3F3ZA 3RCJA 2XJ1A 3MVLA 4WOVA 3MTLA 3NUUA 2PE1A 4C36A 4FE2A 1OPKA 4Y8DA 4AA4A 1G8SA 3NSZA 2JIIA 4B6LA 1WBOA 4X0MA 2VTQA 3R7UA 5M4CA 2XYUA 2BALA 3KN6A 3FI8A 3F3UA 3TNQB 5JKGA 2WTKB 3NR9A 2RF9A 4HVSA 4EK8A 3DZQA 4FL2A 2ZDUA 4ASEA 5KHWA 3LXLA 4G17A 4P90A 4EJ7A 3HL7A 4JBVA 1OI9A 2QOLA 3KMWA 1V0BA 3NYXA 3LFBA 3VUHA 4KIKA 4DH7A 2H96A 3GB2A 5M57A 3A4PA 3UO6A 2CKPA 4IVCA 5CSHA 2UW4A 2WTVA 2ZJWA 4GG5A 3PG3A 3V6SA 3TUDA 2Y6OA 3WIKA 3G9LX 4OTRA 3SXFA 4U9AA 1YXTA 2WTWA 5BVOA 5AV1A 5B7VA 2QO2A 2C3KA 3H10A 1OKYA 5D11A 1S9JA 4F6UA 4DITA 1IR3A 3QKKA 3H9OA 4FC0A 4P2KA 3PG1A 5KZ0A 1PMNA 2G2IA 4DCEA 4PPAA 4FEVA 4HYHA 4QYEA 4X6RA 3B2WA 4Q5EA 4U8ZA 2QD9A 4FV4A 5AIRA 1ZZLA 5EDPA 1V0PA 3ORIA 1DAYA 4PDOA 5DEYA 4PP9A 3TJCA 1YXSA 4O1PA 3FMKA 4O7YA 5ACBC 3BHVA 3DJ5A 1OL2A 1IASA 5IDPA 1NVRA 3A61A 5BVKA 4L7FA 3TNHA 3UYTA 4II5A 2R3HA 4XP0A 5KMMA 1H1PA 4I0SA 4C35A 5CEKA 3COHA 1TKIA 4FIIA 4FV9A 4XV1A 3Q53A 1YDTE 4Z9LA 2YM4A 5CTPA 5T3QA 4H1JA 1E9HA 3CCNA 3T9IA 1SNXA 1M52A 4O2PA 4WRGA 5KZIA 4NIFB 1QMZA 4YJUA 4G3DA 3TI1A 2B9HA 3QHWA 1H00A 4FTUA 4Q9SA 3D5UA 4GMYA 2UZNA 3CD3A 3C1XA 4C02A 2G2FA 3KL8A 4X2JA 5CAPA 2QNJA 3FLWA 1M2PA 4EH6A 1FVTA 1KE6A 3FL4A 5AR5A 4L46A 3WF9A 4GFMA 4USEA 3REPA 3RGFA 5FP6A 5L6OA 2Z02A 3JPVA 4I6BA 3F88A 2WIHA 4IZ7A 4X6QC 3QQUA 5E8WA 3KRXA 4QP1A 4L3LA 5AFVA 3QL8A 1PKDA 1T45A 3A2CA 3KFAA 5E1SA 4ZJVA 4EC8A 3HV3A 3R02A 3BQRA 3PJ1A 3AG9A 1H4LA 3BYUA 4NCTC 3LFQA 4NM5A 5LWNA 3C0GA 5JGBA 3BELA 5AR2A 4CFFA 3SDJA 3LCKA 3M11A 3FMNA 1PXJA 3Q4CA 3EFKA 4JT3A 3ZUUA 3V8WA 3BGZA 5BNJA 1Q24A 2YJRA 3Q3BA 4YTIA 5CAVA 1W84A 2V0DA 4QNYA 4NWMA 3F66A 4A07A 2XBJA 2H8HA 3JUHA 3C4FA 5HBEA 2X8DA 3BHHA 3A60A 5A4TA 3D2KA 4BCQA 1Q8TA 4ANNA 1ZYSA 5KMIA 2W1IA 3C50A 2X2MA 3AC1A 4FG9A 4W8EA 1JSTA 4U6RA 4WNKA 1EH4A 4XS2A 3RINA 2GDOA 4AOIA 4ZAUA 3DGKA 2O63A 3C4EA 4PTGA 4LRJA 1BYGA 3DPKA 2I6LA 3Q2JA 5LCJA 3O0GA 3FC1X 3LE6A 4F9BA 4YZMA 4FSRA 1Q8UA 4LYNA 3OXIA 2ITOA 2O3PA 2J51A 3ZH8A 3F7WA 3R7EA 1AQ1A 2QG7A 3F9NA 2UW9A 4RIWB 3BE9A 2VGOA 4O6LA 1GY3A 4EOJA 2J90A 5IQDA 1YWVA 2JKOA 2XK8A 4HYSA 3NX8A 4TXCA 5GJFA 3FY0A 4S31A 4E73A 5A14A 3T3VA 2ZM3A 1A06A 2UW3A 4WKQA 3HRFA 1BX6A 4NKSA 4BKZA 3ORMA 1WBPA 2B55A 2R0IA 2W96B 3UG1A 3VS2A 5A4CA 5KMLA 5CAOA 4BCJA 4RWKA 4C0TA 3DXPA 4UWYA 4AZFA 3KGAA 2X39A 5CEOA 1QCFA 2IVTA 3FV8A 3MTFA 4O27B 4F08A 5HIEA 4DGGA 3QXOA 3KU2A 2DWBA 4IZYA 3BEAA 3BGPA 3D5XA 3OG7A 3P79A 4QTCA 4ALUA 4B7TA 2WMVA 2YJSA 1Z5MA 5FRIA 5C26A 4MXAA 4BCGA 3ZSGA 4HNIA 5EH0A 4FVPA 5GZAA 3OOMA 1KOBA 1ZXEA 5CU6A 1YWRA 4XNEA 5KBQA 3HLLA 3Q32A 4NW6A 3BE2A 4HPUE 3EQDA 2JFLA 3HVCA 1UNGA 1OIRA 2R3JA 4LOOA 4O0VA 4V05A 3ZUTA 3WF6A 3SRVB 3R00A 2WTIA 3QUEA 3PA3A 1GIIA 5A6OA 3LFAA 4CFNA 4M14A 1XH6A 3K5VA 5HX6A 3QTXA 3V51A 3H9FA 5FXQA 4BZOA 3RK7A 4FOCA 4IX3A 4JX3A 4AW5A 4I5CA 3GCUA 1H1SA 3EHAA 3FKNA 4AUAA 2YIWA 4ARKA 5A4QA 3NIZA 1JKKA 1XH7A 4P5ZA 3UTOA 5CNNA 3ZO3A 4UV0A 3SV0A 2JDOA 3FLNC 3SA0A 2PE2A 1Z9XA 4HPTE 5HBJA 3RK5A 1IRKA 1KE5A 5AP1A 5LMAA 2ZV7A 3QBNA 3PVUA 4N70A 1O6YA 4WO5A 1J7IA 1KE8A 4FBXA 2Y0AA 2EWAA 3LMIA 4YTHA 2HW7A 2C1BA 2OU7A 3OC1A 3MH0A 5IDNA 3W18A 2R3GA 4ZJIA 4X2FA 4JDKA 4NFMA 3PXFA 3SAYA 2BIYA 3K3IA 3ZC5A 5IH4A 1A9UA 4JRNA 3RAKA 3G0EA 3PLSA 1WBTA 4F9AA 3TL8A 3KF7A 4DG0E 4KA3A 4AZVA 2VX0A 5ETIA 2W9ZB 3NAXA 4GT3A 4O96A 4E4NA 3HGKA 5ETAA 3IDCA 4G6NA 2E9VA 4QMYA 3FMDA 2X6DA 4FZ7A 4FYOA 3RNIA 4FKSA 2O5KA 4XBRA 1BUHA 4TRLA 4C4FA 2IZUA 4R5SA 5AX3A 5F9EA 2ETKA 2VWBA 1ZYJA 5FDPA 3CS9A 2CNUA 2XKFA 5LARA 3I60A 4ID7A 2OXYA 5TT7A 4AOTA 4EQUA 4C2WA 2ZV9A 4ZK5A 1I44A 3R9RA 3RWQA 3FZSA 4AFEA 4QTAA 1CSNA 2OIBA 3DFAA 2YWVA 3MBLA 2WMAA 2XKEA 3WILA 2R7IA 4ASDA 3UOHA 2ZOQA 5ANKA 3QALE 4GK3A 4X2KA 4XV2A 4QNAA 4JAJA 5CI7A 5C8NA 4WBOA 3PVBA 2O2UA 3AMBA 4NSTA 5CSWA 3D5WA 3UQGA 4NM7A 3BHTA 2F49A 4LM5A 5AX9A 4FSWA 3CKXA 4L00A 1NVQA 4IX6A 3VHKA 4C38A 2HY0A 2FSTX 3ORNA 2OZOA 5EM5A 2YLEA 3VF9A 4EBWA 2XNOA 2BRGA 5BPYA 4DFZE 2R0UA 5TKDA 5AAGA 4IVDA 4WNMA 2OBJA 2C30A 1PHKA 2BKZA 1GIJA 2W0JA 2WMBA 3N9XA 3NEWA 4XG4A 1KWPA 5GZ9A 5CY3A 3VS1A 2UZTA 2CN8A 2XMYA 3P5KA 4O83A 1FINA 4BCKA 3NW7A 5GIPE 3E7VA 3FZTA 3EL8A 2X4FA 2YDJA 4FTIA 4YC6A 5HE1A 4BCIA 4BR3A 3VS3A 3LFSA 3ZOSA 4D2TA 4BBFA 3HAMA 3V5WA 2GCDA 4ITIA 5IEYA 4GRBA 4FMQA 4XG3A 3TXOA 4CKRA 3TZ9A 2OH0E 2J4ZA 3LXPA 4PNIA 3OW4A 3R30A 1QL6A 4X7QA 3QA0A 4JX7A 3OY3A 1OECA 3QX4A 3OEFX 3MIYA 3OBJA 4RFMA 1OZ1A 2ETMA 3Q4TA 4O21A 5DGZA 5ACKA 4ZLZA 4H05A 3KRLA 3OWPA 4QQJA 4KRCA 2C47A 2W1DA 3C51A 1OKVA 3ERKA 4J71A 2NRYA 4DH1A 4FG7A 1YOMA 1M2QA 3MFRA 3FMHA 4J96A 4QMZA 4DG2E 3NZ0A 4LMUA 4R5YA 5JFWA 5HCXA 2WO6A 3JY0A 5KBRA 3QD3A 4ZLOA 4GFGA 1LUFA 2VZ6A 4OBPA 1GZOA 2YDIA 4GYIA 4WNOA 1URWA 1YOJA 1YRPA 3IW6A 3UVRA 1ZARA 3PA4A 4HCUA 3N4UA 3CTHA 4DFNA 3GU7A 2G01A 2JDSA 4CG8A 1UWHA 3MY1A 4IVAA 3BV3A 3ID6C 3UOLA 3Q9YA 3UIMA 3OP5A 1I09A 4QMPA 5IH6A 3OOGA 3OXTA 4BDGA 4TL0A 4EKLA 5M51A 2PVMA 1CKJA 3FKLA 3QD2B 5IA1A 2WD1A 3BWJA 5EK7A 5DE2A 3FI3A 4E6QA 5BYYA 4RJ6A 3O7LB 4B99A 3KCKA 3NUYA 5JH6A 2JD5A 4WG4A 2YLFA 5T68A 4I4FA 4AE6A 3OMVA 4QYYA 5EW9A 4OT5A 3PTGA 3D14A 4M69B 3NCGA 1YOLA 4RC3A 3F5XA 2PWLA 3DV3A 4GV1A 4PX6A 2CGWA 2BZIB 2R9SA 2REIA 1U4DA 3EN4A 3QZHA 3UC3A 4GVAA 3BU6A 2ONLC 3QQFA 4PMMA 2BDFA 3VS5A 2J6MA 3EKNA 3DXQA 4LUDA 3TCPA 2I1MA 4FSZA 4CMTA 3S4QA 2P33A 4WD5A 3RALA 5CLPA 3MVJA 4MXXA 2XKCA 4FSYA 2PVHA 5JGDA 1U46A 4BWKA 4ZOGA 2Z7QA 4AU8A 2A2AA 2XIRA 3A62A 3GUBA 3DJ7A 4CEGA 5M56A 3QYWA 5HQ0A 4EH3A 4FYNA 2PE0A 4MNFA 1ZOHA 4GUEA 3P78A 4WUAA 4AZWA 1X8BA 1NW1A 5EG3A 2ESMA 2B53A 3KKVA 4WNPA 4O38A 3EN9A 2RFEA 4BBEA 3KULA 4XP2A 4BDIA 4DFXE 5H8EA 3VC4A 2FGIA 5LVMA 3AOXA 2QOKA 2W5BA 1PW2A 3TV7A 3MFSA 5CU2A 3UNZA 2YFXA 2WEIA 1WCCA 5FTGA 1Y57A 4I94A 4CFVA 2PTKA 3DU8A 2XM8A 1ZY4A 2NP8A 3AGMA 5HLPA 4EOSA 2CCHA 2ZM4A 4OTFA 4DFBA 4QQCA 3F3VA 1NY3A 4CYJA 4FTJA 4BCHA 2W1CA 3BPRA 2RKUA 4AN2A 5L6PA 2W05A 3C4ZA 2J0IA 1W0XC 3HMOA 4FKUA 1M7QA 2WHBA 3NW5A 2R4BA 4JI9A 4RZWA 4L68A 3RPOA 5L3AA 3KF4A 3AC4A 4FSMA 3MV5A 2W06A 5FQDC 3BU3A 2XB7A 2PZYA 2QOIA 1GJOA 2HIWA 5HEZA 4ERKA 4DE4A 3FZPA 3R83A 1DI8A 5EM7A 3PY3A 3VW8A 2JIVA 4FEUA 5FG8A 3RBWA 2YM5A 2ZM1A 3SC1A 4S32A 3ZBXA 4IEBA 2EXEA 3DNDA 3MGYA 4C3RA 3EH9A 4BCPA 1IAJA 5AR3A 2PUUA 4RSSA 5GINE 3W16A 3EQGA 3Q6UA 4IHPA 3QWKA 2UZEA 3EN7A 3CPCA 1PXOA 3P7AA 3QCYA 3QHRA 3DK3A 3MFTA 5HLWA 3HP2A 1UKHA 3TZMA 4YTCA 2J9MA 1Y8YA 4JNWA 4R3RA 2C6IA 3DNEA 1WBNA 5F95A 3R22A 4RX9A 2P55A 4I1ZA 4J1RA 4RBLA 5JFSA 3P0MA 3W2SA 2OSCA 5CF8A 5HLNA 2NNWB 1OL5A 2UUEA 3HDNA 4RX7A 4YURA 4N6YA 3QUDA 4AGWA 4RJ3A 3ET7A 4EUTA 5GIOE 3QTSA 2R64A 4DTKA 5IF1A 2E2BA 4J7BA 4KS7A 4BL1A 2ITWA 2JBOA 1WBVA 3C0IA 4KRDA 3HNGA 2DQ7X 4MXOA 3E7OA 2W1EA 1XH9A 1Q61A 1REJA 2BZKB 2R3PA 2YCRA 3SX9A 4CMUA 1PYEA 3ZEWA 2VTTA 5IA4A 2H6DA 4L42A 2GS2A 2QQ7A 3QRKA 4U3ZA 2CCIA 2I40A 4YO6A 1DAWA 2XJ0A 3ZLXA 4FTQA 4EHZA 5HI2A 5IKWA 4E5AX 5HOAA 4V0GA 2B9JA 4R3CA 1YXUA 2C5VA 2FA2A 2ERZE 2WEVA 3L9PA 2ITUA 2VTMA 1XWSA 2OXDA 3CIKA 2A1AB 1YKRA 5DHJA 5J5TA 1SYKA 4PWNA 4Q5HA 4DH5A 2RGPA 1Q4LA 3LM0A 4F9WA 4D55A 2YAAA 3D9VA 4LRKA 4H3PA 1JAMA 1SVHA 3U9NA 2ZV8A 2EXCX 2WMSA 3AMAA 4XX9A 3B8QA 3DDPA 3ODYX 4Z7GA 3V5PA 3PZEA 5BQ0A 2RL5A 2EB3A 3GBZA 3NIEA 5E9EA 1PXLA 2JBPA 2WQEA 4EHVA 4IFGA 5AUTA 4APCA 4E6AA 5JZNA 2P2HA 3UNJA 4XP3A 4I4EA 4LGDA 3OCTA 2G15A 4RJ5A 1MRUA 3R28A 4IB5A 4NL0A 5I5ZA 2X2LA 1TVOA 3GCVA 4GFOA 4ZSAA 5ETCA 3NDMA 3AC3A 4FTLA 4QMVA 3OTUA 3R1YA 4PPBA 5AA8A 2CKQA 5E8TA 5JSMA 3BQCA 3W2PA 4DEBA 5ANIA 2J5FA 4ZSLA 1H01A 3F69A 1H0VA 2FUMA 2WTCA 4LL0A 5CI6A 4AGUA 4BCMA 2I7QA 3BBTB 2QR8A 1FBNA 2VWWA 4J8MA 5KMKA 3SKCA 2XS0A 1VJYA 3KRWA 3T8OA 2UZWE 3B2TA 3IG7A 5HG5A 1OIQA 2X9FA 4NIFA 4RA4A 5H9BA 3FSKA 4HOKA 5J5SA 2ACXA 4G1WA 1XHAA 3EL7A 5LMBA 1GZ8A 3EQCA 4OAUC 1M2RA 4RPVA 5E91A 4EYMA 3SD0A 4BRXA 2J0LA 1R1WA 5F4NA 3Q60A 4FTKA 3CQWA 3R9HA 4BYIA 4M67A 3Q6WA 4R77A 5IQIA 3SGCA 4FK6A 4DTBA 1V0OA 4DN5A 5C4KA 1YHSA 5L2QA 4DLIA 4F9YA 4IWPA 4JAIA 2R3OA 4G3GA 4RC4A 3UZTA 5TOZA 2C0IA 4PTEA 3SQQA 2QOBA 2PHKA 2BILB 1YXXA 2XK4A 3IOPA 3HV4A 3MH2A 4IAAA 4MD7E 4BYJA 4D2VA 4DEEA 4EOIA 1FVVA 4IE9A 4RJ7A 4BC6A 4TZRA 4U7ZA 4I5PA 1KV1A 5KMJA 1ATPE 3TV4A 2R3FA 1HCKA 3I5ZA 4MH7A 2W5AA 1H27A 2EVAA 3A7GA 4NT4A 1NA7A 4FG8A 4I0TA 4FT0A 5AV2A 2HZNA 4AACA 3D83A 3WF5A 4YUQA 4CT1A 2E9PA 5HG8A 5KUPA 4JR7A 4C8BA 4E93A 3RWPA 4O0XA 2CNVA 4LOPA 4FGBA 4QMWA 3JS2A 4WHZA 4FTMA 5AV4A 3KEXA 1VYWA 4FSTA 2QKRA 4L01A 4YNEA 2E9OA 5FLFA 4UB7A 3R2BA 4IH8A 2QHMA 5HTCA 2YIXA 4TWNA 5J7HA 2PVKA 3HUBA 4KD1A 3ZYAA 4C62A 3AC5A 3ZDIA 4PP7A 2BPMA 3AD6A 5B2LA 1ZMUA 4YBKA 4G2FA 3V8TA 4F1OA 2C6OA 2YM6A 4WSQA 2XEYA 4AE9A 4F0IA 3QTZA 4BCOA 4EHEA 5EKNA 4EHGA 3EFJA 5IMXA 2FSOX 4FIGA 4QMUA 4HW7A 4EZ7A 5CEQA 2YIYA 2C5OA 3CP9A 5FEEA 3BI6A 3G0FA 1OBGA 2EUFB 4FR4A 4F1TA 4NYEA 3DFCB 4WSYA 4NJDA 5EI2A 3UG2A 3QF9A 4EH5A 3QYZA 4EOQA 3I1AA 4U41A 1Q8YA 5IA5A 4RQKA 4IJPA 3FHRA 5I9UA 3ZBFA 4B8LA 2IN6A 4XLVA 3BLHA 3ZXZA 2CJMA 3OCBA 4CMOA 4DFUA 3QTUA 4O7RA 4NJ3A 5L6WL 5FD2A 4FKPA 3QCQA 4CSVA 4FL3A 2R3QA 5GJDA 5T6KA 2XUUA 2GTMA 5JEBA 3SOAA 3RHKA 3LCOA 2R3NA 2EU9A 1MUOA 4I23A 4IACA 3RZFA 3SW7A 4FEXA 3ZSHA 5DH3A 2NPQA 4BB4A 1PYXA 2C0OA 2UVYA 3U4WA 2XZSA 2YM3A 2GNGA 2XH5A 2CGUA 3OROA 5E8SA 5E4HA 2YISA 3L9NA 1LEZA 1H08A 3D15A 3NNVA 1U5RA 2RG6A 4KWPA 3R8MA 4EH4A 4GIIA 3UYSA 2CHLA 3KMMA 2YM8A 4I92A 4LQMA 4ONAA 4BDJA 3QQGA 4ANMA 3OWKA 3ACJA 3F7ZA 1J1BA 3FHIA 3LM5A 1GZKA 3NUPA 4ANBA 2EXMA 2OWBA 5DEWA 3P7CA 4BI2A 5M09A 4WUNA 3V04A 2C6EA 4JOAA 4RQVA 5CU4A 5L2IA 5HX8A 4BICA 4DTAA 4YJTA 1ZLTA 4EKKA 1SZMA 4HZSA 4JDJA 1GAGA 5DG5A 4CQEA 2VNWA 2WZJA 5KMOA 1ZYCA 3W55A 5M07A 4QP7A 4GU9A 4IWQA 2JC6A 4FSUA 3TJDA 2EB2A 2IG7A 2YCQA 3IO7A 3R01A 3C7QA 4ZXTA 4BI1A 3DBCA 3VBXA 1XBBA 3FYKX 4GK4A 2Z7RA 2WU7A 2WQBA 5KE0A 2WNTA 2V7OA 5DA3A 5EYDA 4D2RA 2B1PA 2Z7SA 3DAKA 5D7VA 4DBNA 3RVGA 4C4JA 2PVLA 3JXWA 2YM7A 1BL6A 4PDPA 3DTCA 3LIJA 3QWJA 2VUWA 3ZUVA 3AT2A 1URCA 5EKOA 3VAPA 3DTWA 4IZAA 4CV9A 2LGCA 3AC2A 5F94A 3I0QA 3IDBA 2XK7A 4FKIA 2P2IA 1G8AA 2C0TA 3EQFA 4ZEGA 1YWNA 5FDXA 3WE8A 4MNEA 3ZU7A 4B8MA 4DGLC 5BX0A 3TUCA 4DF3A 4I6HA 4RMZA 1ZYLA 4OR5A 4B9DA 5KHXA 4CQGA 4FVQA 4QMXA 2GTNA 2WOTA 1W82A 4EJNA 2YCSA 5CSPA 3MESA 5CU0A 4IW0A 5BYZA 3NVKI 3W2CA 4C4EA 4BDBA 1AD5A 2XM9A 3MH1A 2I0HA 2ITYA 1OUYA 3E5AA 3CQUA 5HD7A 3A7HA 3L8VA 4F09A 1NT2A 4JDHA 5HG7A 2W17A 3CY3A 2HAKA 5I9XA 4K2RA 3PIZA 5IG1A 4U0IA 3KMUA 3CJFA 4J95A 4E1ZA 4XG2A 3WZEA 4IM0A 4RJ8A 5I0BA 4UMTA 3I4BA 4ZZMA 1GZNA 1Y8GA 3E87A 4QMSA 4AOJA 2F7EE 2WTDA 5CQWA 4QQTA 1UU8A 2HYYA 2X8IA 5IUIA 3ZMMA 5DR9A 4QMOA 4OTQA 4EL9A 3BWFA 5M44A 4JVGA 4E26A 5EQYA 3TEIA 3K5UA 3PLAE 3QA8A 3M2WA 3PPZA 5HESA 4G6LA 5L2WA 1OBDA 4XBUA 3HMIA 5FXSA 3CKWA 3E88A 4CTBA 4AW0A 2PMOX 3GQIA 4BCFA 4BF2A 4QOXA 5EYCA 1BI8A 4DC2A 3LZBA 5G6VA 2BZHB 4LG4A 4W4YA 5AWMA 2Y6MA 5HIDA 5LVOA 3CTQA 4MXZA 3AD4A 5J7BA 3FMJA 5ANEA 1WVXA 3WZKA 5J9LA 4RLKA 4H3QA 4L53A 3E8CA 4E4XA 1JKLA 2PUNA 4QTEA 3HKOA 3ANRA 3O7LD 1OITA 3MA6A 3HRCA 4RWLA 5EFQA 3VUGA 5IA3A 3FDNA 3A4OX 3P86A 3G5DA 4ASZA 3QQLA 4RIYB 4F6WA 3D4QA 5K4JA 3AQVA 3BU5A 3OD6X 3LFNA 2HXQA 1Q8WA 3LFCA 3LFFA 2Y8OA 1XBCA 4L7SA 4EUUA 3LXKA 4AN3A 3EKKA 1PRYA 4FGRA 3COKA 2F4JA 3FSFA 2QODA 2YCFA 3ELJA 3Q9ZA 4LV8A 1E1VA 4BDFA 2UZDA 3I79A 5L8LA 1OKZA 3L8XA 4XRJA 3D7TA 4IAIA 3RM6A 5CEIA 3UGCA 4BGQA 5AEPA 2VWIA 4I6QA 4ANOA 4EZ3A 2GNIA 5AUUA 3VBYA 5M53A 2OF4A 5HBHA 4GJ2A 5J9YA 4AZEA 3DKCA 3LCTA 4EH7A 1K3AA 2A27A 2XBAA 3ZRKA 5L2TA 1JKTA 4LMNA 5HGIA 2O8YA 4UMUA 4KIQA 4R78A 1KSWA 3CGOA 3NYVA 4RC2A 3LW0A 2RFSA 3TWJA 4Y83A 1JOWB 3HRBA 2XVDA 2BAJA 2IVVA 2XCKA 3DLZA 4G34A 5CS6A 5AUXA 3ZSIA 5CANA 3PRIA 3QAME 5CEMA 2PPQA 3EQIA 1FMOE 3GFWA 4IIRA 2XIXA 4IWOA 4RZVA 4CZYB 3UPZA 5HO6A 4XYFA 3FI2A 3LJ0A 4J97A 3Q5IA 1U59A 2PMLX 5IQHA 2NRUA 4EWQA 5C8KA 3PIXA 3KC3A 3EQHA 5M4FA 3S2PA 3ZHPC 5GZ8A 1IEPA 4A9RA 4ALWA 3LFEA 4BGGA 4JQEA 1RJBA 2YN8A 4CTCA 2QOHA 4X3JA 4C57A 3NVMB 4TY1A 4EK5A 3LJ1A 4RG0A 5JQ5A 4DFYA 1PXIA 4C2VA 4ZY5A 5JMSA 4MXCA 4YZ9A 3JYAA 3WZDA 4ZSEA 2OO8X 4ZZNA 5F20A 1QPDA 3NYNA 4Z55A 1B38A 1XH8A 2NO3A 1ERKA 4GSBA 3D0EA 3I0OA 4L8MA 2JIUA 3R9NA 3S00A 3EN5A 3KY2A 3QD4A 2PSQA 3ENHA 3KQ7A 3R7OA 2PVYA 2WU6A 3VN9A 3G9NA 5DNRA 2IO6A 3TNWA 4K18A 5AUWA 2RG5A 2JDVA 5HVYA 4ANLA 1KUTA 1MP8A 1WVWA 2B54A 2QOOA 4FV0A 3R8VA 1REKA 4DBXA 3GENA 2GNLA 3QZFA 4GUBA 4OAVB 4O82A 1Y6AA 2WTKC 5K4IA 4EBVA 3OTVA 3MDYA 2ITVA 3AD5A 4ZJJA 5J8IA 5TE0A 2JDRA 5AIKA 3U51A 2Z8CA 3NUXA 1K9AA 4QYFA 5FTOA 3R7YA 2Y4IB 5J95A 1IA9A 4BIBA 2PL0A 3ANQA 1O6KA 2CGVA 4W4VA 3MPMA 2V5QA 3PE2A 4JL9A 4E4MA 5BVNA 2VX3A 5HVJA 3UO5A 5AV3A 4PL4A 4I21A 1Z57A 2OXXA 3CTJA 4WG3A 4BTFA 2C6TA 3A7JA 4OT6A 4FV1A 4R3PA 3S3IA 4PMTA 4DHFA 4EWHA 2B52A 4IADA 1LEWA 3RAIA 5HTIA 3RZBA 2O65A 3PVGA 3RAWA 3ZS5A 3POZA 5TR6A 3RHXA 4ITJA 4OBOA 5ANDA 3K54A 3DB8A 3FI4A 4YJPA 3QTIA 4BDEA 4QMQA 4YR8A 3V5TA 2PUIA 4IB1A 4TYHA 4H39A 3S0OA 3TDWA 3OXZA 4BBMA 3P1AA 1NVSA 3FMEA 2BROA 4DGNA 4I24A 4IBMA 2ZB1A 4U81A 5AV0A 5AUZA 3G15A 3TDVA 4E5WA 3RNYA 3MB7A 3F61A 2AC5A 2DUVA 2OIQA 3OY1A 3TKUA 1FGKA 1YHVA 4PDYA 4XJ0A 3ZLWA 4F63A 3G33A 4GKIA 3DY7A 4MD9E 5D41A 1H25A 4O7WA 4CZUA 4LRMA 3WBLA 3C5UA 4KB8A 4UALA 3DT1A 3ALNA 4GU6A 1SVEA 4FV7A 1WMKA 4HGLA 4YZNA 1BLXA 3GU8A 3TUBA 3F3WA 3CQEA 3BX5A 4QQ5A 4IZ5A 3BV2A 3VF8A 4RIYA 4O22A 3KVWA 4C3FA 3Q04A 3OWLA 5AJQA 4AZTA 4JG7A 1WAKA 4KKHA 3TIYA 4CT2A 4R1VA 5HCZA 3WZUA 5K0XA 3LQ8A 3G6GA 1MQ4A 2YDKA 3MIAA 4KIKB 4Z7HA 4C59A 3IS5A 5LJJA 4BY9E 3GFEA 3VULA 4CXAA 2UW6A 2OZAB 1YDRE 5AAEA 4JQ7A 4RWJA 1M7NA 1UWJA 3OT3A 1FQ1B 2OFUA 5AR7A 3VBVA 5HNIX 5HU9A 4IFCA 2FSMX 2IJMA 1W83A 3EMGA 3HDMA 3QQHA 4Y5QA 3TN8A 4D58A 4F7SA 2HENA 1H0WA 3EB0A 4EOKA 3ATSA 4GVJA 3CPBA 1U54B 4QO9A 4HNFA 1YHWA 4RIOA 1PMUA 3QC4A 2OICA 4M8TA 2VNYA 3RPSA 2UZUE 4HGTA 4IXPA 4KIOA 1GIHA 1XO2B 2UVXA 3TT0A 3TZ7A 4NU1A 2IZSA 3ZC6A 3HMNA 5I3RA 4FZDB 3GVUA 3VUTA 1SNUA 4IVBA 4H1MA 4G16A 4RIXA 5IUHA 2WQOA 3R2YA 4IB0A 1YVJA 4XV9A 4D9TA 1U54A 1UNLA 5BMMA 2OKRA 4IX5A 5HO7A 1RW8A 5CVFA 5EI8A 4UX9A 4YHFA 4AXAA 3QQKA 4UMQA 1JBPE 4J52A 4CFMA 1PY5A 2ZVAA 3MWUA 3ULZA 3ZONA 2B4SB 2GS6A 3Q4ZA 3W8LA 1AGWA 2UZOA 4MF1A 2YEXA 4TNBA 3A99A 4QRCA 5D7AA 2XIZA 3QUPA 4GG7A 2RFNA 4YO4A 1KV2A 1O9UA 4L52A 4DEHA 4JG6A 3VUMA 1CTPE 5JQ8A 4YZDA 4D2WA 5K5NA 1U5QA 4QMMA 3WI6A 4MF0A 2X8EA 4PUZA 1LP4A 4FT5A 4H36A 2Y4PA 1Y6BA 3OW3A 3P08A 4S30A 4BKJA 4QP8A 5F1ZA 4CFUA 1ND4A 3ATTA 2VO6A 5IA0A 3UP7A 1F3MC 3VIDA 4EQMA 3EIDA 2BFYA 4HCTA 4F6SA 4CYIA 3QQJA 5AR8A 3RPVA 3PP1A 2W99B 5IQGA 4MAOA 4UXQA 2WTJA 3H30A 3UMXA 4FIEA 3RM7A 3WZJA 5I9YA 1H24A 5AR4A 3DQWA 4O7VA 1XH4A 5BUIA 4C61A 5AP3A 4G31A 4RFYA 2WAJA 2PZRA 4U5JA 5JFVA 4O0RA 4ZMFA 4YSMA 4D1ZA 4K77A 5CF6A 1J1CA 2VTNA 5IMEA 4NUSA 4TWCA 4FKGA 4DH3A 4YPSA 4DEIA 2I0EA 3PWDA 4JG8A 4MQ1A 5C1QB 2VAGA 3ORPA 4FV3A 1ZAOA 5E8VA 1W7HA 2QC6A 4FKWA 3UZPA 5JN2A 4ACHA 4C4HA 5BVWA 5LVNA 1YXVA 2BDWA 4D5HA 2AYPA 4JRVA 2QCSA 4TWOA 4TYEA 4O7NA 1OIYA 5CENA 3VS4A 3P23A 1T46A 2OZAA 1IA8A 1Q97A 2ITXA 2JKMA 3F5GA 1SVGA 3QCSA 4GIHA 2GNJA 4FOBA 4MXYA 3NRMA 4BTKA 2CKEA 4FV2A 5E1EA 4CGAA 2JLDA 2WPAA 3NNUA 3DBQA 1TQIA 3VRYA 3BZ3A 3KXHA 5KCVA 3AC8A 3F5PA 4G6OA 4KAOA 4O7TA 3NMUF 3R7GA 4O7ZA 2C6MA 3NWWA 3FQEA 3LLTA 4JXFA 5FUTA 2CLQA 3VW6A 4FUYA 1YDSE 1W98A 4FTNA 4QMTA 4D9UA 4CD0A 5EQPA 4K8AA 4DCAA 2OFVA 3GC8A 4G9CA 2SRCA 2W4JA 5LMKC 3FXZA 4YLKA 4HGEA 4X3FC 5FEQA 3IONA 4L45A 4FKOA 1PF8A 2X81A 4D4YA 1DS5A 4FTTA 5CF4A 4IAYA 3SXSA 3DA6A 4RVMA 5HKMA 1XQZA 3R6XA 3R63A 2VWXA 4AWIA 4ZLYA 1QPCA 4GS6A 1R0PA 1CKIA 2WELA 4RJ4A 3NS9A 4J8NA 5KX8A 3LMGA 4IDTA 4UWBA 1PMVA 4Z3VA 2IW9A 2O64A 1JSUA 2HXLA 3BIZA 4FZFB 4G3FA 4FNYA 4NK9A 1UU9A 1P14A 4X2GA 4XG9A 4YJVA 3TNIA 4E4LA 4ACMA 5KMNA 3FKOA 4I5MA 4ZTHA 3SRVA 2VTIA 4GKHA 3NNWA 3D7ZA 3O8PA 4NTTA 3UODA 5AADA 1L8TA 4J98A 2RFDA 3BYVA 1UU7A 5BUJA 5FXRA 3LJ2A 3DXNA 3P4KA 2YWPA 4FI1A 1ZRZA 2GSFA 3OUNB 3VBQA 1WZYA 3DBFA 3R8ZA 3P7BA 4DAWA 2CSNA 3VS6A 3D2IA 2WXVA 2W1FA 1LR4A 4BTMA 4XG6A 5LQFA 2XK6A 3POOA 4D1XA 2BTRA 3PPJA 3ORTA 1TQMA 4KBAA 2BAQA 2J2IB 2VU3A 3FC2A 5DT0A 4YC8A 1UU3A 3I6WA 4IAFA 4BWXA 4K9YA 4O0YA 5A3XA 4X21A 3VS7A 4JBPA 5C01A 3V5LA 3PE1A 1FPUA 2AC3A 5H8BA 3FPMA 2W1GA 2E9NA 2UW0A 4U80A 4QPMA 4PTCA 4PF4A 4CLIA 4YU2A 5HORA 1HCLA 1OGUA 2J5EA 5DFPA 5E8XA 4ZZOA 5HD4A 5IQEA 5IISA 3KXGA 2VTRA 2J0MB 4Y85A 2XP2A 2BRBA 4U44A 4AS0A 1J91A 4V0GB 2OG8A 2WB8A 2OF2A 3TACA 1JQHA 3VQUA 2GU8A 3QKLA 4RRVA 2OIDA 2OJIA 2GHLA 2A19B 2J50A 4YBJA 2W4KA 4S34A 4ZTSA 5D10A 2V22A 3L9MA 4LOQA 4M66A 4AA0A 3BCEA 2G1TA 3BRBA 4ENYA 4EONA 3KXNA 2VGPA 3GU4A 3IKAA 4TYHB 3QC9A 4O6EA 5B0XA 2CKOA 3KULB 4RA5A 2X4ZA 3ZO4A 1XJDA 2B0QA 4MVFA 4K6ZA 3HMMA 3ZFMA 5DIAA 3BYMA 4EC9A 4EEVA 3V3VA 3FL5A 5LCKA 3W2RA 3KXXA 4FT7A 5AUVA 1SMHA 4NM3A 3GC9A 4OBQA 5HG9A 4MNEB 3DK7A 4G3EA 2HCKA 4LI5A 4B4LA 5LOHA 3N51A 2HELA 5JZJA 3PDTA 5IEVA 5ANGA 4R7BA 3R21A 3ZZEA 3D94A 5IUGA 4F7NA 3UOJA 3W32A 2X1NA 4EK4A 3HUCA 4IANA 4TKSA 1PXMA 5AP5A 3COMA 4HZRA 3SG8A 3C4CA 2GHMA 4I93A 3I6UA 5ANOA 4Q9ZA 1OL1A 4GT4A 1H28A 3WYYA 4PL5A 4QP2A 5A6NA 2HK5A 3R04A 2IWIA 3CEKA 5I3OA 3NLBA 3TZ8A 3LMHA 1RDQE 1WBSA 4N0SA 5IU2A 4YSJA 4S33A 1KE9A 3QCXA 1QPJA 5GNKA 4BDAA 4FF8A 4HCVA 3P9JA 4RIXB 5BVFA 3DZOA 2VTLA 3RKBA 3TG1A 1UNHA 3I7CA 3NAYA 2ITQA 3LCSA 2X2KA 2VV9A 5LXMA 4ANSA 2PUPA 3UQFA 4I6FA 2PVFA 2FYSA 2HWOA 3OZ6A 3R7IA 3QD0A 3EYHA 1OL6A 2OJFE 3GI3A 3R0TA 3F6XA 2QO7A 2W9FB 2PMNX 3E93A 3HMPA 4I5HA 5IPJA 4OLIA 4PMPA 1Q62A 3RMFA 5I4NA 4KUJA 2PU8A 3CR0A 2Y9QA 2GNHA 2OJJA 2P3GX 2Y4IC 5AP4A 3TKIA 2DYLA 3CXWA 4D0WA 4QD6A 4QMNA 4FEWA 3L1SA 2XYNA 1KOAA 3EQRA 3NCZA 5CALA 2G9XA 5ITAA 1PJKA 4E6CA 3LKMA 5M06A 3A7FA 3U54A 4MEDA 4L67A 4JS8A 5AP0A 1A48A 2R2PA 2QLQA 4W9XA 2ZMDA 2XCHA 4FKQA 3WE4A 2W7XA 5L8KA 3I81A 3JVSA 2HY81 4UMPA 3G90X 3PJ3A 4YLJA 4ITHA 1DM2A 5AA9A 1UKIA 2XJ2A 3GU6A 4KS8A 2B9FA 3O50A 4IMYA 4TTHB 5EYKA 3V01A 4WBBB 5E90A 3GXLA 4YC3A 4BTJA 4U79A 3HV7A 3VQHA 4AZSA 3U55A 3H0ZA 3QTWA 2VD5A 3F2NA 4GYGA 4LL5A 3AT4A 5FM2A 4NZWB 4DGOA 3HZTA 3PSDA 3CJGA 4YLLA 1JSVA 3QU0A 2W4OA 3PY1A 4YP8A 2CN5A 5K0KA 3ACKA 3FZ1A 1LPUA 4AP7A 3RJCA 4F0FA 3QGWA 4UMRA 2BTSA 3MB6A 4XHKB 3OWJA 5GJGA 5M08A 4UXLA 5DRBA 2C3IB 4QT1A 3HECA 4ZMEA 2V62A 3MS9A 1MRYA 2F7ZE 3BBWA 5FEDA 2VRXA 4AX8A 2BZJA 3H4JA 3MYGA 4FKJA 5IA2A 3ETAA 3HA6A 3FYJX 3VRZA 1PXPA 4M84A 3QZIA 3R9DA 4EK3A 3DK6A 3HEGA 3CBLA 4C7TA 5LVPA 2I0YA 3GU5A 4WA9A 3M1SA 5CX9A 3ORXA 5FWKK 3S1HA 4FIFA 1DI9A 4FZ6A 4XH6A 4ZSJA 4QMLA 3PXYA 1WVYA 3LXNA 4IWDA 4ZTLA 4ZIMA 1UA2A 2QKWB 4ZSGA 1WFCA 5E92A 2QLUA 2PMIA 3ALOA 3F2AA 4M3QA 5JRSA 4RWIA 3TTIA 1VEBA 1RQQA 3BLQA 3OHTA 2ZMCA 4OW8A 1JPAA 2WGJA 3GOKA 2YACA 4HVIA 4FNXA 4R1YA 5AM7A 3QRTA 3FXXA 4C4GA 3QKMA 5EOLA 4TYJA 1H8FA 4W4XA 4IAZA 4K11A 2C1AA 2IZRA 2XNEA 4MBJA 2VX1A 4Q2AA 3RCDA 2WOUA 2HW6A 2QONA 3DKOA 4Y72A 1Y91A 4ANQA 4E5BA 3KREA 2ETRA 4V04A 3L9LA 2VWZA 3OBGA 3MW1A 2E9UA 3L8SA 2X7OA 2BCJA 4BZDA 2XIYA 4KKGA 1VZOA 3PRFA 5EHLA 3O8UA 3UBDA 3UP2A 2W5HA 3WIGA 5AM6A 3BYOA 4BI0A 3O2MA 5C4LA 4O0WA 5EDQA 3QTQA 3CD8A 2PY3A 1H26A 4F7LA 3T3UA 3V5JA 3AMYA 4JBOA 3EWHA 3UZRA 3MA3A 2Q83A 3LVPA 4QYGA 2C6KA 4D4RA 3CE3A 1JLUE 3FJQE 4O2ZA 2VWYA 2VTAA 3VO3A 3SLSA 1FOTA 3C0HA 1ZY5A 4ZY4A 4K33A 4K0YA 4M13A 3UPXA 3ORKA 5EM6A 4EH8A 3GOPA 4O0UA 5FBNC 1JKSA 2YABA 2J7TA 4GEOA 5L8JA 4C4IA 1GOLA 4MK0A 2CGXA 4U40A 2YZLA 4O7LA 2ITPA 4UN0C 3PY0A 3SW4A 3IOKA 2BRNA 3Q96A 3R71A 3GT8A 3HV5A 4KABA 5A54A 5KNJA 5HNGA 2CNQA 2PZPA 3QZGA 3UJGA 4E7WA 3AT3A 2XNGA 3W8QA 2WMWA 5AP6A 2QU5A 3VBWA 3LQ3A 3VJOA 4UEUA 3I7BA 2BIKB 3LPBA 1JVPP 2ZAZA 3KXZA 3KK9A 2UW8A 2WKMA 2BRMA 4FTRA 3II5A 4F4PA 4M12A 4TYGA 4USFA 1R39A 4IC7A 2BRHA 2W1ZA 2VO7A 2J0KA 4PMSA 2YA9A 3DKGA 3G6HA 3OF0A 4FV6A 3THBA 2C3JA 3EZVA 3QX2A 4X3FB 1FMKA 4TNDA 4RVTA 4DEAA 4CLJA 1CM8A 2VTPA 4H3BA 5EI6A 4M69A 2OK1A 1FVRA 3KB7A 4M15A 3GGFA 1F0QA 1R78A 4FT9A 2XK3A 3BGQA 3UIXA 2ERKA 2OW3A 4BIEA 3MY5A 4RGJA 4H58A 3GC0A 3KRJA 4QTDA 5IZFA 5IQBA 4MHAA 2Z60A 2HOGA 4A9TA 3UVQA 3TV6A 4EZ5A 2GQRA 4RX5A 4JDIA 1NXKA 4QP6A 3E62A 2V55A 5FP5A 3JVRA 5EYMA 5ICPA 2YHVA 3IW7A 4IQ6A 2OI4X 3ZLSA 1OKWA 5M4UA 4N57A 4HGSA 4I3ZA 3U9CA 3ITZA 4BFMA 3EZRA 4BKYA 2PULA 3E8DA 4LGGA 4F9CA 3GEQA 1CMKE 3Q4UA 2R3IA 1E1XA 3FZRA 4BHNA 4MD8E 2BUJA 3W2QA 2JEDA 5CZHA 3PXKA 3ZRLA 4I20A 3U6JA 1JWHA 2VO3A 4L3PA 4CCUA 1CDKA 5FGKA 3PJCA 4E3CA 5CF5A 5JGAA 3KCFA 4CFWA 3JR1A 4C58A 2GS7A 2BR1A 3VWAA 4ORKA 4F7JA 1FGIA 1W8CA 3ODZX 2OJ9A 3PXZA 2KULA 3PP0A 4BHZA 2F9GA 3DJ6A 1IG1A 1PMEA 2IZTA 3KRRA 4OTDA 4QP3A 4FL1A 3WF8A 3C4XA 2A0CX 4APPA 4CG9A 2C6LA 3NUNA 3BEGA 4DLJA 3ORZA 3A8XA 3U6HA 1P4FA 3RK9A 3ZDUA 5HNBA 4HVGA 4EH9A 2VTSA 3ROCA 3ZRMA 5EW3A 3G2FA 2CPKE 3FQHA 3LAUA 3PVWA 3VS0A 5HE3A 3LCDA 3RAHA 2DS1A 4YJOA 3UDBA 2WMXA 5TF9A 4FV8A 2Y7JA 4X3FA 5L4QA 2C5XA 4F70A 2F7XE 3WYXA 3I5NA 4BDDA 4FZAB 2XNMA 2XIKA 2PVRA 3E64A 4CVAA 3F2RA 3C9WA 3H9RA 3PXQA 4N4SA 5CAQA 4XOYA 3S95A 5I9WA 2YIQA 3DCVA 4TW9A 2FO0A 4O0SA 4U45A 5DPVA 4M68A 4C3PA 4CZTA 3R1QA 3E92A 2W1HA 4P7EA 4RLLA 5DYJA 4XCUA 4DGMA 4EYJA 2KTYA 5HCYA 4KINA 1UVRA 3IW4A 4JLCA 4R8QA 5CEPA 3MN3A 1OM1A 2VTHA 3QFVA 2ITTA 2R7BA 1O6LA 2OGVA 4YJQA 4KSQA 4KBCA 4FKRA 3DOGA 4A9YA 4ERWA 3O8TA 5LVLA 4P4CA 4CNHA 4DINA 1QPEA 3RPYA 4E6DA 4LGHA 3BKBA 3GP0A 2XNNA 1G5SA 4L43A 5C27A 5B2MA 4IJ9A 2HZIA 4XMOA 4CV8A 2QOCA 2ITNA 3DBEA 2UZBA 1OIUA 2XF0A 1P5EA 2OLCA 4UBAA 5BVDA 3KK8A 2XK9A 4IX4A 4ZY6A 2GNFA 2PZ5A 2PZIA 3IECA 5AP2A 2YIRA 5HU3A 4QTBA 4BDCA 3EYGA 2B7AA 4XRLA 4Y95A 1TQPA 5CVHA 3UNKA 4EOPA 5J1VA 2X9EA 3U87A 3N4VA 3IDPA 5I9ZA 3EFWA 3OCSA 4OTPA 4G5PA 5A9UA 2C5YA 4PL3A 5CSVA 4DH8A 3DKFA 3MPTA 5IH5A 3PJ2A 4IB3A 3UO4A 2Q0NA 4PY1A 1GNGA 4AGCA 2JAVA 3VNTA 3V5QA 4CCBA 2F57A 2RIOA 3GCSA 4O0TA 5JFXA 2XRUA 1PXNA 2CMWA 4JIKA 4GK2A 3U4UA 3ULIA 2GFCA 3E3PA 4M7IA 2F2CB 5L2SA 5D9HA 3QRJA 5AMNA 1Q41A 5E7RA 4OGRA 5C8MA 3DAEA 3SVVA 2R3KA 1OL7A 3A8WA 3IPHA 2WQNA 4KKEA 4MWHA 4NFNA 5EQEA 5AAFA 3FLZA 2XKDA 3TTJA 4F1MA 2YAKA 1CKPA 1M17A 4ZS0A 3H3CA 4EORA 2QVSE 5BMSA 4D2PA 3PWYA 3ZO1A 1H1QA 4FKLA 4QP9A 5G1XA 4GT5A 2JKQA 1WBWA 2XNBA 3CGFA 4DFLA 2R3RA 1M14A 4B0GA 4S2ZA 1BL7A 3FLQA 3C13A 4LUEA 3UOKA 2BAKA 2PYWA 3UVPA 4FNWA 2CDZA 3FY2A 4A4OA 1PKGA 3ORLA 5D12A 5HTBA 4D5KA 3KA0A 1BMKA 3FLSA 2QR7A 4MBLA 5JK3A 5DN3A 4EH2A 3NGAA 5KKRC 3C5IA 3FMLA 4FICA 4ALVA 3R8PA 2WMUA 3L8PA 3OEZA 4L3JA 3VBTA 4A7CA 2GHGA 3DQXA 3DB6A 1VR2A 5A4LA 4ZTRA 3AGLA 2XA4A 3GCQA 4TWPA 4FEQA 3MPAA 4QPAA 4NKAA 4IM2A 4K1BA 1BKXA 1STCE 3KN5A 4ACGA 3MI9A 2PVNA 2C68A 4PQNA 5JRQA 5BUEA 4LFIA 4D2SA 4IAKA 4USDA 5DVRA 3FXWA 3NW6A 4O1OA 4AT3A 3OVVA 3Q9WA 1G3NA 1J3HA 4R7HA 4RT7A 2BVAA 3O23A 4CRLA 4JR3A 4QP4A 4IM3A 2JITA 3EQPA 3PYYA 4U43A 5DLSA 3ZFXA 4YMJA 3O17A 3ZTXA 1ZOGA 4D1SA 3E3BX 4WG5A 5CT7A 5HIBA 1H1RA 3TKHA 4Y73A 3R8LA 3CLYA 5HZNA 2HWPA 4TPTA 4CKJA 4C37A 1OB3A 1SM2A 2VWVA 2ZDTA 3RP9A 5J79A 4GW8A 4U42A 1JNKA 1J7UA 1Q3DA 1F5QA 4OTIA 1IAHA 3SXRA 2WIPA 4AQCA 4A06A 5DMZA 2AUHA 3IK3A 4FTOA 4RVLA 3PIYA 4JQ8A 3KXMA 4HJOA 1Q5KA 1YQJA 4JIAA 1S9IA 5CSXA 4A4XA 3MH3A 3U6IA 3QRUA 3TNPC 2V7AA 3C4WA 5DOSA 4MBIA 1YW2A 3RTPA 4ZS4A 2VTJA 5C9CA 3LOKA 4D28A 4I0RA 1Q8ZA 2UW7A 4YJNA 1XH5A 4KSPA 2UVZA 2IVUA 4J53A 3UMWA 2P4IA 5J87A 5CQUA 1XBAA 4JJRA 4BN1A 3PPKA 4UZDA 4WRSA 3B8RA 3LQ5A 4G5JA 4EOOA 4I41A 4FODA 3NUAA 5A4EA 5DT3A 5ETFA 3R1NA 4F99A 3FQSA 3Q5ZA 2VWUA 4RFZA 4M0ZA 1VYZA 3DDQA 3F82A 1XKKA 4BWPA 3ZEPA 1Q3WA 5DI1A 3O51A 3FLYA 5IQAA 3SHEA 2PK9A 3CY2A 1ZOEA 4XV3A 3ZCLA 3HA8A 3EJ1A 2C69A 4PDSA 3H0YA 4A9SA 3LFDA 1KE7A 5CWZA 4FKTA 4W8DA 3WOWA 4AT4A 2QHNA 2BMCA 3EN6A 2UV2A 2BHHA 2GFSA 4F64A 3RI1A 4NW5A 4AN9A 1YI3A 4MCVA 2VTOA 3VHEA 2YERA 1L3RE 5IQFA 2J0JA 1P4OA 4NEUA 3FBVA 3GCPA 2Q0BA 3BLRA 4OTHA 5A46A 3Q52A 4FNZA 4PPCA 1MRVA 4W4WA 4QPSA 4YNOA 2C6DA 3UC4A 4HVDA 5K9IA 4ACDA 4BCNA 4BDKA 2ZB0A 4RVKA 5H2UA 2IPXA 2WMRA 4FVRA 2C4GA 5CU3A 2QO9A 2UZVA 3E8EA 4NM0A 3BHYA 3W1FA 3FE3A 1R0EA 3R7VA 2R5TA 2I0VA 4YHJA 4MWIA 4L6QA 1ZYDA 3ZXTA 5D1JA 1YI6A 3GC7A 3PJ8A 2R3MA 3PA5A 4HVHA 1ZMVA 3MVHA 1H07A 2ZYBA 4OUCA 4UY9A 4MTAA 1OPLA
chains in the Genus database with same CATH superfamily
3R73A 5KKRB 4OTGA 4FKVA 3LLAA 1HOWA 2BDJA 1PXKA 3HYHA 4A4LA 4TN6A 4BZNA 4FSNA 5FTQA 4GJ3A 5K3YA 1Q99A 4CFXA 1MQBA 4EI4A 3V8SA 2XNPA 4YZBA 3UIUA 3LHJA 5J1WA 3BHUA 3ROYA 2X7FA 3O96A 3VUKA 4DA5A 2XALA 3E8NA 4PV0A 3DS6A 3E63A 2RSVA 2O0UA 3IQ7A 4WIHA 4GCJA 4XUFA 3MJ1A 3EOCA 2C5NA 3IGGA 4I22A 5FBOA 5IEXA 4R6VA 4MQ2A 3MFUA 5AP7A 4FIHA 2IVSA 3W0OA 4NH1A 3FZOA 3PUPA 4AF3A 4PNKA 5HE2A 1ZWSA 3K2LA 4X2NA 5EHOA 2X0GA 3DLSA 4G3CA 1RE8A 4ZP5A 3R8UA 4AW2A 3G51A 4BDHA 5BVEA 4BGHA 2HZ4A 5B2KA 1XR1A 4DEGA 3N4TA 4XG8A 3QLGA 3ZM4A 2Z7LA 2GQGA 1B39A 3FPQA 3MJ2A 4AGDA 2X0PA 4N6ZA 5J9ZA 4O81A 3HP5A 4A9UA 4AA5A 3ZZWA 3V6RA 3AKLA 4UYNA 2WMTA 4O91A 4WT6A 5CXZA 4C34A 4EK6A 2R3LA 3SG9A 1YI4A 5DT4A 4JBQA 2VN9A 3R1SA 3W10A 4ZTQA 1R3CA 2FSLX 2X6EA 4YHTA 1P2AA 4F0GA 3DAJA 3GQLA 1B6CB 3OT8A 5HO8A 3UIBA 5E8YA 3QRIA 2FB8A 4XOZA 4M97A 3AXWA 3NNXA 4FSQA 3HX4A 1OVEA 3D7TB 3QXPA 5CASA 4EOLA 2G2HA 5DWRA 3F3TA 5DRDA 3FEGA 5CNOA 2YZAA 2X7GA 2IW6A 3IW8A 4HYIA 2IF8A 4M0YA 3JY9A 4D0XA 5EDRA 3EFLA 2YITA 1OMWA 3EQBA 3FWQA 3QLFA 4NTSA 1J7LA 2Z2WA 4O86A 3MVMA 5DR6A 3FUPA 5EM8A 3RPRA 4L9IA 2FVDA 4UZHA 2VO0A 5LWMA 3MY0A 5DBXA 3HAVA 3PXRA 2JFMA 4GL9A 4XEYA 2FH9A 2WQMA 4CRSA 3W2OA 5HVKA 2QURA 4O84A 3UQCA 2H9VA 4FIJA 4DT9A 4V01A 4F65A 5HHWA 3DBDA 3T9TA 2F2UA 4AG8A 4Y5HA 1OUKA 4U97A 5HE0A 5I9VA 3FMMA 2OH4A 5CAUA 4AFJA 3IGOA 4YZCA 3TM0A 4Y46A 5GHVA 3CC6A 2BHEA 1ST4A 4RIWA 3NUSA 2ITZA 4IC8A 3HV6A 4YJSA 4IDVA 5TO8A 4XLIA 2UW5A 3FAAA 4NCTA 2BFXA 2QU6A 3A7IA 4TT7A 2JKKA 5C03A 2XRWA 3M42A 4D4VA 3OCGA 4FT3A 3ZFYA 3WARA 2UZLA 4AW1A 4AT5A 4R7IA 2A4LA 5EHYA 2WFYA 3VUDA 4YJRA 2QOQA 5CXHA 2H34A 4XG7A 4ZTNA 2BKKA 1H1WA 4UYAA 4BVUA 2JGZA 4G9RA 5E8ZA 3K3JA 2LAVA 2QI8A 4YPDA 5HICA 1OPJA 2P0CA 4FTAA 3VJNA 3BYSA 4J99A 3OUKA 4UWCA 3PZHA 3VVHA 3KVXA 5CYIA 3Q9XA 5H8GA 3D5VA 4KIPA 4LV5A 1ZZ2A 3ZLYA 4ACCA 5CVGA 2CLXA 5EW8A 3F5UA 4GH2A 4OTWA 3ZM9A 5ANJA 5K5XA 3PSBA 4P5QA 4TYIA 4BIDA 1BI7A 5LMKA 4U3YA 2IW8A 5H3QA 1V1KA 3QGYA 4D4SA 2ZV2A 3QTRA 3O71A 4DG3E 5JT2A 3Q2MA 4KBKA 1UV5A 3OS3A 4PRJA 3R9OA 3UE4A 4Z16A 4FX3A 5BYLA 5M4IA 4FK3A 4MYGA 3WF7A 2ONLA 3NPCA 3IW5A 3VUIA 2QOFA 4FTCA 4FV5A 4L44A 5E8UA 5AUYA 2C3LA 4O7SA 4E20A 4CKIA 4YTFA 3MSSA 5DR2A 2WMQA 4FA2A 1APME 4MKCA 5EOBA 4AAAA 2XEZA 3GNIB 3OFMA 4W9WA 2OJGA 3PSCA 3ENMA 4RX8A 3PFQA 5M55A 4DYMA 3CSVA 2QG5A 3W33A 2HZ0A 2JAMA 4EOMA 4FUXA 4DT8A 4KNBA 2GMXA 4ZTMA 5CT0A 1K2PA 4ASXA 4C33A 5CZIA 2JDTA 5KO1A 4DEDA 5IQCA 5FM3A 3NYOA 4EQCA 3SOCA 2B9IA 1ZMWA 4HYUA 3TIZA 3U8WA 4MX9A 4QYHA 4E8AA 2PVJA 4YGAA 2GPHA 3COIA 4ENXA 3ZO2A 2GQSA 3F3ZA 3RCJA 2XJ1A 3MVLA 4WOVA 3MTLA 3NUUA 2PE1A 4C36A 4FE2A 1OPKA 4Y8DA 4AA4A 1G8SA 3NSZA 2JIIA 4B6LA 1WBOA 4X0MA 2VTQA 3R7UA 5M4CA 2XYUA 2BALA 3KN6A 3FI8A 3F3UA 3TNQB 5JKGA 2WTKB 3NR9A 2RF9A 4HVSA 4EK8A 3DZQA 4FL2A 2ZDUA 4ASEA 5KHWA 3LXLA 4G17A 4P90A 4BJJB 4EJ7A 3HL7A 4JBVA 1OI9A 2QOLA 3KMWA 1V0BA 3NYXA 3LFBA 3VUHA 4KIKA 4DH7A 2H96A 3GB2A 5M57A 3A4PA 3UO6A 2CKPA 4IVCA 5CSHA 2UW4A 2WTVA 2ZJWA 4GG5A 3PG3A 3V6SA 3TUDA 2Y6OA 3WIKA 3G9LX 4OTRA 3SXFA 4U9AA 1YXTA 2WTWA 5BVOA 5AV1A 5B7VA 2QO2A 2C3KA 3H10A 1OKYA 5D11A 1S9JA 4F6UA 4DITA 1IR3A 3QKKA 3H9OA 4FC0A 4P2KA 3PG1A 5KZ0A 1PMNA 2G2IA 4DCEA 4PPAA 4O4EA 4HYHA 4QYEA 4X6RA 4FEVA 3B2WA 4Q5EA 4U8ZA 2QD9A 4FV4A 5AIRA 1ZZLA 5EDPA 1V0PA 3ORIA 1DAYA 4PDOA 5DEYA 4PP9A 3TJCA 1YXSA 4O1PA 3FMKA 4O7YA 5ACBC 3BHVA 3DJ5A 1OL2A 1IASA 5IDPA 1NVRA 3A61A 5BVKA 4L7FA 3TNHA 3UYTA 4II5A 2R3HA 4XP0A 5KMMA 4DHIB 1H1PA 4I0SA 4C35A 5CEKA 3COHA 1TKIA 4FIIA 4FV9A 4XV1A 3Q53A 1YDTE 4Z9LA 2YM4A 5CTPA 5T3QA 4H1JA 4QDVA 1E9HA 3CCNA 3T9IA 1SNXA 1M52A 4O2PA 4WRGA 5KZIA 4NIFB 1QMZA 4YJUA 4G3DA 3TI1A 2B9HA 3QHWA 1H00A 4FTUA 4Q9SA 3D5UA 4GMYA 2UZNA 3CD3A 3C1XA 4C02A 2G2FA 3KL8A 4X2JA 5CAPA 2QNJA 3FLWA 1M2PA 4EH6A 1FVTA 1KE6A 3FL4A 5AR5A 4L46A 3WF9A 4GFMA 4USEA 3REPA 3RGFA 5FP6A 5L6OA 2Z02A 3JPVA 4I6BA 3F88A 2WIHA 4IZ7A 4X6QC 3QQUA 5E8WA 3KRXA 4QP1A 4L3LA 5AFVA 3QL8A 1PKDA 1T45A 3A2CA 3KFAA 5E1SA 4ZJVA 4EC8A 1W2CA 3HV3A 3R02A 3BQRA 3PJ1A 3AG9A 1H4LA 3BYUA 4NCTC 3LFQA 4NM5A 5LWNA 3C0GA 5JGBA 3BELA 5AR2A 4CFFA 3SDJA 3LCKA 3M11A 3FMNA 1PXJA 3Q4CA 3EFKA 4JT3A 3ZUUA 3V8WA 3BGZA 5BNJA 1Q24A 2YJRA 3Q3BA 4YTIA 5CAVA 1W84A 2V0DA 4QNYA 4NWMA 3F66A 4A07A 2XBJA 2H8HA 3JUHA 3C4FA 5HBEA 2X8DA 3BHHA 3A60A 5A4TA 3D2KA 4BCQA 1Q8TA 4ANNA 1ZYSA 5KMIA 2W1IA 3C50A 2X2MA 3AC1A 4FG9A 4W8EA 1JSTA 4U6RA 4WNKA 1EH4A 4XS2A 3RINA 2GDOA 4AOIA 4ZAUA 3DGKA 2O63A 3C4EA 4PTGA 4LRJA 1BYGA 3DPKA 2I6LA 3Q2JA 5LCJA 3O0GA 3FC1X 3LE6A 4F9BA 4YZMA 4O4CA 4FSRA 1Q8UA 4LYNA 3OXIA 2ITOA 2O3PA 2J51A 3ZH8A 3F7WA 3R7EA 1AQ1A 2QG7A 3F9NA 2UW9A 4RIWB 3BE9A 2VGOA 4O6LA 1GY3A 4EOJA 2J90A 5IQDA 1YWVA 2JKOA 2XK8A 4HYSA 3NX8A 4TXCA 5GJFA 3FY0A 4S31A 4E73A 5A14A 3T3VA 2ZM3A 1A06A 2UW3A 4WKQA 3HRFA 1BX6A 4NKSA 4BKZA 3ORMA 1WBPA 2B55A 2R0IA 2W96B 3UG1A 3VS2A 5A4CA 5KMLA 5CAOA 4BCJA 4RWKA 4C0TA 3DXPA 4UWYA 4AZFA 3KGAA 2X39A 5CEOA 1QCFA 2IVTA 3FV8A 3MTFA 4O27B 4F08A 5HIEA 4DGGA 3QXOA 3KU2A 2DWBA 4IZYA 3BEAA 3BGPA 3D5XA 3OG7A 3P79A 4QTCA 4ALUA 4B7TA 2WMVA 2YJSA 1Z5MA 5FRIA 2AEGA 5C26A 4MXAA 4BCGA 3ZSGA 4HNIA 5EH0A 4FVPA 5GZAA 3OOMA 1KOBA 1ZXEA 5CU6A 1YWRA 4XNEA 5KBQA 3HLLA 3Q32A 4NW6A 3BE2A 4HPUE 4MUQA 3EQDA 2JFLA 3HVCA 1UNGA 1OIRA 2R3JA 4LOOA 4O0VA 4V05A 3ZUTA 3WF6A 3SRVB 3R00A 2WTIA 3QUEA 3PA3A 1GIIA 5A6OA 3LFAA 4CFNA 4M14A 1XH6A 3K5VA 5HX6A 3QTXA 3V51A 3H9FA 5FXQA 4BZOA 3RK7A 4FOCA 4IX3A 4JX3A 4AW5A 4I5CA 3GCUA 1H1SA 3EHAA 3FKNA 4AUAA 2YIWA 4ARKA 5A4QA 3NIZA 1JKKA 1XH7A 4P5ZA 3UTOA 5CNNA 3ZO3A 4UV0A 3SV0A 2JDOA 3FLNC 3SA0A 2PE2A 4I6LA 1Z9XA 4HPTE 5HBJA 3RK5A 1IRKA 1KE5A 5AP1A 5LMAA 2ZV7A 3QBNA 3PVUA 4N70A 1O6YA 4WO5A 1J7IA 1KE8A 4FBXA 2Y0AA 2EWAA 3LMIA 4YTHA 2HW7A 2C1BA 2OU7A 3OC1A 3MH0A 5IDNA 3W18A 2R3GA 4ZJIA 4X2FA 4JDKA 4NFMA 3PXFA 3SAYA 2BIYA 3K3IA 3ZC5A 5IH4A 1A9UA 4JRNA 3RAKA 3G0EA 3PLSA 1WBTA 4F9AA 3TL8A 3KF7A 4DG0E 4KA3A 4AZVA 2VX0A 5ETIA 2W9ZB 3NAXA 4GT3A 4O96A 4E4NA 3HGKA 5ETAA 3IDCA 4G6NA 2E9VA 4QMYA 3FMDA 2X6DA 4FZ7A 4FYOA 3RNIA 4FKSA 2O5KA 4XBRA 1BUHA 4TRLA 4C4FA 2IZUA 4R5SA 5AX3A 5F9EA 2ETKA 2VWBA 1ZYJA 5FDPA 3CS9A 3W0SA 2CNUA 2XKFA 5LARA 3I60A 4ID7A 2OXYA 5TT7A 4AOTA 4EQUA 4C2WA 2ZV9A 4ZK5A 1I44A 3R9RA 3RWQA 3FZSA 4AFEA 4QTAA 1CSNA 2OIBA 3DFAA 2YWVA 1XMLA 3MBLA 2WMAA 2XKEA 3WILA 2R7IA 4ASDA 3UOHA 2ZOQA 5ANKA 3QALE 4GK3A 4X2KA 4XV2A 4QNAA 4JAJA 5CI7A 5C8NA 4WBOA 3PVBA 2O2UA 3AMBA 4NSTA 5CSWA 3D5WA 3UQGA 4NM7A 3BHTA 2F49A 4LM5A 5AX9A 4FSWA 3CKXA 4L00A 1NVQA 4IX6A 3VHKA 4C38A 2HY0A 2FSTX 3ORNA 2OZOA 5EM5A 2YLEA 3VF9A 4EBWA 2XNOA 2BRGA 5BPYA 4DFZE 2R0UA 5TKDA 5AAGA 4IVDA 4WNMA 2OBJA 2C30A 1PHKA 2BKZA 1GIJA 2W0JA 2WMBA 3N9XA 3NEWA 4XG4A 1KWPA 5GZ9A 5CY3A 3VS1A 2UZTA 2CN8A 2XMYA 3P5KA 4O83A 1FINA 4BCKA 3NW7A 5GIPE 2XAOA 3E7VA 3FZTA 3EL8A 2X4FA 2YDJA 4FTIA 4YC6A 5HE1A 4BCIA 4BR3A 3VS3A 3LFSA 3ZOSA 4D2TA 4BBFA 3HAMA 3V5WA 2GCDA 4ITIA 5IEYA 4GRBA 4FMQA 4XG3A 3TXOA 4CKRA 3TZ9A 2OH0E 2J4ZA 3LXPA 4PNIA 3OW4A 3R30A 1QL6A 4X7QA 3QA0A 4JX7A 3OY3A 1OECA 3QX4A 3OEFX 3MIYA 3OBJA 4RFMA 1OZ1A 2ETMA 3Q4TA 4O21A 5DGZA 5ACKA 4ZLZA 4H05A 3KRLA 3OWPA 3PUFC 4QQJA 4KRCA 2C47A 2W1DA 3C51A 1OKVA 3ERKA 4J71A 2NRYA 4DH1A 3UDSA 4FG7A 1YOMA 4DHZA 1M2QA 3MFRA 3FMHA 4J96A 4QMZA 4DG2E 3NZ0A 4LMUA 4R5YA 5JFWA 5HCXA 2WO6A 3JY0A 5KBRA 3QD3A 4ZLOA 4GFGA 1LUFA 2VZ6A 4OBPA 1GZOA 2YDIA 4GYIA 4WNOA 1URWA 1YOJA 1YRPA 3IW6A 3UVRA 1ZARA 3PA4A 4HCUA 3N4UA 3CTHA 4DFNA 3GU7A 2G01A 2JDSA 4CG8A 1UWHA 3MY1A 4IVAA 3BV3A 3ID6C 3UOLA 3Q9YA 3UIMA 3OP5A 1I09A 4QMPA 5IH6A 3ML1A 3OOGA 3OXTA 4BDGA 4TL0A 4EKLA 5M51A 3UDTA 2PVMA 1CKJA 3FKLA 3QD2B 5IA1A 2WD1A 3BWJA 5EK7A 5DE2A 3FI3A 4E6QA 5BYYA 4RJ6A 3O7LB 4B99A 3KCKA 3NUYA 5JH6A 2JD5A 4LDTA 4AQKA 4WG4A 2YLFA 5T68A 4I4FA 4AE6A 3OMVA 4QYYA 5EW9A 4OT5A 3PTGA 3D14A 4M69B 3NCGA 1YOLA 4RC3A 3F5XA 2PWLA 3DV3A 4GV1A 4PX6A 2CGWA 2BZIB 2R9SA 2REIA 1U4DA 3EN4A 3QZHA 3UC3A 4GVAA 3BU6A 2ONLC 3QQFA 4PMMA 2BDFA 3VS5A 2J6MA 3EKNA 3DXQA 4AXDA 4LUDA 3TCPA 2I1MA 4FSZA 4CMTA 3S4QA 2P33A 4WD5A 3RALA 3W0QA 5CLPA 3MVJA 4MXXA 2XKCA 4FSYA 2PVHA 5JGDA 1U46A 4BWKA 4ZOGA 2Z7QA 4AU8A 2A2AA 2XIRA 3A62A 3GUBA 3DJ7A 4CEGA 5M56A 3QYWA 5HQ0A 4EH3A 4FYNA 2PE0A 4MNFA 1ZOHA 4GUEA 3P78A 4WUAA 4AZWA 1X8BA 1NW1A 5EG3A 2ESMA 2B53A 3KKVA 4WNPA 4O38A 3EN9A 2RFEA 4BBEA 2ZFYA 3KULA 4XP2A 4BDIA 4DFXE 5H8EA 3VC4A 2FGIA 5LVMA 3AOXA 2QOKA 2W5BA 1PW2A 3TV7A 3MFSA 5CU2A 3UNZA 2YFXA 2WEIA 4FRFA 1WCCA 5FTGA 1Y57A 4I94A 4CFVA 2PTKA 3P5JC 4DHJA 3DU8A 2XM8A 1ZY4A 2NP8A 3AGMA 5HLPA 4EOSA 2CCHA 2ZM4A 4OTFA 2XANA 4QQCA 4DFBA 3F3VA 1NY3A 4CYJA 4FTJA 4BCHA 2W1CA 3BPRA 2RKUA 4AN2A 5L6PA 2W05A 3C4ZA 2J0IA 1W0XC 3HMOA 4FKUA 1M7QA 2WHBA 3NW5A 2R4BA 4JI9A 4RZWA 4L68A 3RPOA 5L3AA 3KF4A 3AC4A 4FSMA 3MV5A 2W06A 5FQDC 3BU3A 2XB7A 2PZYA 2QOIA 1GJOA 2HIWA 5HEZA 4ERKA 4DE4A 3FZPA 3R83A 1DI8A 5EM7A 3PY3A 3VW8A 2JIVA 4FEUA 5FG8A 3RBWA 2YM5A 2ZM1A 3SC1A 4S32A 3ZBXA 4IEBA 2EXEA 3DNDA 3MGYA 4C3RA 3EH9A 4BCPA 1IAJA 5AR3A 2PUUA 4RSSA 3W0PA 5GINE 3W16A 3EQGA 3Q6UA 4IHPA 3QWKA 2UZEA 3EN7A 3CPCA 1PXOA 3P7AA 3QCYA 3QHRA 3DK3A 3MFTA 5HLWA 1OGYA 3HP2A 1UKHA 3TZMA 4YTCA 2J9MA 1Y8YA 4JNWA 4R3RA 2C6IA 3DNEA 1WBNA 5F95A 3R22A 4RX9A 2P55A 4I1ZA 4J1RA 4RBLA 5JFSA 3P0MA 3W2SA 2OSCA 5CF8A 5HLNA 2NNWB 4AAYA 1OL5A 1W2DA 2UUEA 3HDNA 4RX7A 4YURA 4N6YA 3QUDA 4AGWA 4RJ3A 3ET7A 4EUTA 5GIOE 3QTSA 2R64A 4DTKA 5IF1A 2E2BA 4J7BA 4KS7A 4BL1A 2ITWA 2JBOA 1WBVA 3C0IA 4KRDA 3HNGA 2DQ7X 4MXOA 3E7OA 2W1EA 1XH9A 1Q61A 1REJA 2BZKB 2R3PA 2YCRA 3SX9A 4CMUA 1PYEA 3ZEWA 2VTTA 5IA4A 2H6DA 4L42A 2GS2A 2QQ7A 3QRKA 1TZDA 2CCIA 2I40A 4U3ZA 1DAWA 2XJ0A 4YO6A 4FTQA 3ZLXA 5HI2A 5IKWA 4E5AX 5HOAA 4V0GA 2B9JA 4R3CA 1YXUA 2C5VA 2FA2A 2ERZE 2WEVA 3L9PA 2ITUA 2VTMA 1XWSA 2OXDA 3CIKA 2A1AB 1YKRA 5DHJA 5J5TA 1SYKA 4PWNA 4Q5HA 4DH5A 2XAMA 2RGPA 1Q4LA 3LM0A 4F9WA 4D55A 2YAAA 3D9VA 4LRKA 4H3PA 1JAMA 1SVHA 3U9NA 2ZV8A 2EXCX 2WMSA 3AMAA 4XX9A 3B8QA 3DDPA 3ODYX 4Z7GA 3V5PA 3PZEA 5BQ0A 4O4DA 2RL5A 2EB3A 3GBZA 3NIEA 5E9EA 1PXLA 2JBPA 2WQEA 4O4FA 4EHVA 4IFGA 5AUTA 4APCA 4E6AA 5JZNA 2P2HA 3UNJA 4XP3A 4I4EA 4LGDA 3OCTA 2G15A 4RJ5A 1MRUA 3R28A 4IB5A 4NL0A 5I5ZA 2X2LA 1TVOA 3GCVA 4GFOA 4ZSAA 5ETCA 3NDMA 3AC3A 4FTLA 4QMVA 3OTUA 3R1YA 4PPBA 5AA8A 2CKQA 5E8TA 5JSMA 3BQCA 3W2PA 4DEBA 5ANIA 2J5FA 4ZSLA 1H01A 3F69A 1H0VA 2FUMA 2WTCA 4LL0A 5CI6A 4AGUA 4BCMA 2I7QA 3BBTB 2QR8A 1FBNA 2VWWA 4J8MA 5KMKA 3SKCA 2XS0A 1VJYA 4AXEA 3KRWA 3T8OA 2UZWE 3B2TA 3IG7A 5HG5A 1OIQA 2X9FA 4NIFA 4RA4A 5H9BA 3FSKA 4HOKA 5J5SA 2ACXA 4G1WA 1XHAA 3EL7A 5LMBA 1GZ8A 3EQCA 4OAUC 1M2RA 4RPVA 5E91A 4EYMA 3SD0A 4BRXA 2J0LA 1R1WA 5F4NA 3Q60A 4FTKA 3CQWA 3R9HA 4BYIA 4M67A 3Q6WA 4R77A 5IQIA 3SGCA 4FK6A 4AXFA 1V0OA 4DN5A 4DTBA 1YHSA 5L2QA 4DLIA 4F9YA 4IWPA 5BV3A 4JAIA 2R3OA 4G3GA 4RC4A 3UZTA 5TOZA 2C0IA 4PTEA 3SQQA 2QOBA 2PHKA 2BILB 1YXXA 2XK4A 3IOPA 3HV4A 3MH2A 4IAAA 4MD7E 4BYJA 4D2VA 4DEEA 4EOIA 1FVVA 4IE9A 4RJ7A 4BC6A 4TZRA 4U7ZA 4I5PA 1KV1A 5KMJA 1ATPE 3TV4A 2R3FA 1HCKA 3I5ZA 4MH7A 2W5AA 1H27A 2EVAA 3A7GA 4NT4A 1NA7A 4FG8A 4I0TA 4FT0A 5AV2A 2HZNA 4AACA 3D83A 3WF5A 4YUQA 4CT1A 2E9PA 5HG8A 5KUPA 4JR7A 4C8BA 4E93A 3RWPA 4O0XA 2CNVA 4LOPA 4FGBA 4QMWA 3JS2A 4WHZA 4FTMA 5AV4A 3KEXA 1VYWA 4FSTA 2QKRA 4L01A 4YNEA 2E9OA 5FLFA 4UB7A 3R2BA 4IH8A 2QHMA 5HTCA 2YIXA 4TWNA 5J7HA 2PVKA 3HUBA 4KD1A 3ZYAA 4C62A 3AC5A 3ZDIA 4PP7A 2BPMA 3AD6A 5B2LA 1ZMUA 4YBKA 4G2FA 3V8TA 4F1OA 2C6OA 2YM6A 4WSQA 2XEYA 4AE9A 4F0IA 3QTZA 4BCOA 4EHEA 5EKNA 4EHGA 3EFJA 5IMXA 2FSOX 4FIGA 4QMUA 4HW7A 4EZ7A 5CEQA 2YIYA 2C5OA 3CP9A 5FEEA 3BI6A 3G0FA 1OBGA 2EUFB 4FR4A 4F1TA 4NYEA 3DFCB 4WSYA 4NJDA 5EI2A 3UG2A 3QF9A 4EH5A 3QYZA 4EOQA 3I1AA 4U41A 1Q8YA 5IA5A 4RQKA 4IJPA 3FHRA 5I9UA 3ZBFA 4B8LA 2IN6A 4XLVA 3BLHA 3ZXZA 2CJMA 3OCBA 4CMOA 4DFUA 3QTUA 4O7RA 4NJ3A 5L6WL 5FD2A 4FKPA 3QCQA 4CSVA 4FL3A 2R3QA 5GJDA 5T6KA 2XUUA 2GTMA 5JEBA 3SOAA 3RHKA 3LCOA 2R3NA 2EU9A 1MUOA 4I23A 4IACA 3RZFA 3SW7A 4FEXA 3ZSHA 5DH3A 2NPQA 4BB4A 1PYXA 2C0OA 2UVYA 3U4WA 2XZSA 2YM3A 2GNGA 2XH5A 2CGUA 3OROA 5E8SA 5E4HA 2YISA 3L9NA 1LEZA 1H08A 3D15A 3NNVA 1U5RA 2RG6A 4KWPA 3R8MA 4EH4A 4GIIA 3UYSA 2CHLA 3KMMA 2YM8A 4I92A 4LQMA 4ONAA 4BDJA 3QQGA 4ANMA 3OWKA 3ACJA 3F7ZA 1J1BA 3FHIA 3LM5A 1GZKA 3NUPA 4ANBA 2EXMA 2OWBA 5DEWA 3P7CA 4BI2A 5M09A 4WUNA 3V04A 2C6EA 4JOAA 4RQVA 5CU4A 5L2IA 5HX8A 4BICA 4DTAA 4YJTA 1ZLTA 4EKKA 1SZMA 4HZSA 4JDJA 1GAGA 5DG5A 4CQEA 2VNWA 2WZJA 5KMOA 1ZYCA 3W55A 5M07A 4QP7A 4GU9A 4IWQA 2JC6A 4FSUA 3TJDA 2EB2A 2IG7A 2YCQA 3IO7A 3R01A 3C7QA 4ZXTA 4BI1A 3DBCA 3VBXA 4DDGA 1XBBA 3FYKX 4GK4A 2Z7RA 2WU7A 2WQBA 5KE0A 2WNTA 2V7OA 5DA3A 5EYDA 4D2RA 3W0NA 2B1PA 2Z7SA 3DAKA 5D7VA 4DBNA 3RVGA 4C4JA 2PVLA 3JXWA 2YM7A 1BL6A 4PDPA 3DTCA 3LIJA 3QWJA 2VUWA 3ZUVA 3AT2A 1URCA 5EKOA 3VAPA 3DTWA 4IZAA 4CV9A 2LGCA 3AC2A 5F94A 3I0QA 3IDBA 2XK7A 4FKIA 2P2IA 1G8AA 2C0TA 3EQFA 4ZEGA 1YWNA 5FDXA 3WE8A 4MNEA 3ZU7A 4B8MA 4DGLC 5BX0A 1W2FA 3TUCA 4DF3A 4I6HA 4RMZA 1ZYLA 4OR5A 4B9DA 5KHXA 4CQGA 4FVQA 4QMXA 2GTNA 2WOTA 1W82A 4EJNA 2YCSA 5CSPA 3MESA 5CU0A 4IW0A 5BYZA 3NVKI 3W2CA 4C4EA 4BDBA 2IEWA 1AD5A 2XM9A 3MH1A 2I0HA 2ITYA 1OUYA 3E5AA 3CQUA 5HD7A 3A7HA 3L8VA 4F09A 1NT2A 4JDHA 5HG7A 2W17A 3CY3A 2HAKA 5I9XA 4K2RA 3PIZA 5IG1A 4U0IA 3KMUA 3CJFA 4J95A 4E1ZA 4XG2A 3WZEA 4IM0A 4RJ8A 5I0BA 4UMTA 3I4BA 4ZZMA 1GZNA 1Y8GA 3E87A 4QMSA 4AOJA 2F7EE 2WTDA 5CQWA 4QQTA 1UU8A 2HYYA 2X8IA 5IUIA 3ZMMA 5DR9A 4QMOA 4OTQA 4EL9A 3BWFA 5M44A 4JVGA 4E26A 5EQYA 3TEIA 3K5UA 3PLAE 3QA8A 3M2WA 3PPZA 5HESA 4G6LA 5L2WA 1OBDA 4XBUA 3HMIA 5FXSA 3CKWA 3E88A 4CTBA 4AW0A 3PFYA 2PMOX 3GQIA 4BCFA 4BF2A 4QOXA 5EYCA 1BI8A 4DC2A 3LZBA 5G6VA 2BZHB 4LG4A 4W4YA 5AWMA 2Y6MA 5HIDA 5LVOA 3CTQA 4MXZA 3AD4A 4F78A 5J7BA 3FMJA 5ANEA 1WVXA 3WZKA 5J9LA 4RLKA 4H3QA 4L53A 3E8C