4DFYA

Crystal structure of r194a mutant of camp-dependent protein kinase with unphosphorylated activation loop
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
337
structure length
310
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFATPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Structural basis for the regulation of protein kinase a by activation loop phosphorylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 94
structure length 310
sequence length 337
chains with identical sequence E
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfyA02
2HWPA 2B9FA 4IMYA 3NYXA 3CKWA 4DEHA 1PXIA 5AUVA 3RK5A 4F0FA 3R21A 1BI8A 1NVRA 4CCUA 3P79A 1MRUA 3B2WA 3OXZA 3R8MA 3TEIA 3HUBA 4N70A 3CIKA 3BV2A 4U42A 4EKKA 4RVKA 2JAVA 5M53A 3UZRA 3ROCA 5HZNA 5GIOE 2B55A 1Q8ZA 3CKXA 3PP1A 5HIBA 2ZM1A 4F7LA 2F4JA 3GP0A 4CRLA 2VX3A 4MK0A 4RJ8A 1Y6BA 3R8LA 3D7TA 3DCVA 4O96A 2UZVA 4F6WA 3UQFA 2PUPA 3NNWA 4E3CA 2CLQA 4FVPA 4PDOA 2HW6A 3AGMA 3NCZA 4IAFA 2JEDA 4I3ZA 4C57A 2P0CA 4OTGA 4CMUA 3QKMA 4O7SA 2UVZA 2JD5A 1T46A 2YCSA 4E4XA 1PXLA 1Y91A 2OJJA 3DKCA 3NLBA 2UVXA 3FLWA 4JX3A 5E8TA 2UZUE 2VWXA 3DBCA 4FL1A 3R9HA 1OL5A 5AP0A 5I5ZA 4MBJA 3COIA 2YM8A 3BYSA 3DK7A 4DG2E 3EN6A 3MFSA 1J91A 2QOKA 2BDFA 4JQEA 4GFGA 4JRNA 1BI7A 2I0HA 3FLQA 4ZZNA 4IH8A 3PG1A 4EK4A 4G3CA 2W1GA 3ZMMA 1XBAA 1OUKA 2UW0A 3AG9A 4BF2A 2CHLA 4YMJA 1DM2A 4TTHB 3PLAE 3TDWA 1OIQA 3MJ1A 5FM3A 1OIYA 4W8EA 3ZU7A 4I0SA 4QTBA 2BDWA 3C9WA 3GOKA 2C3JA 3W33A 3K2LA 1FMKA 1UU7A 4BCHA 4ITHA 1S9IA 2YERA 4IVBA 4IVDA 4IZ7A 4PPBA 2QD9A 2ZM3A 2O65A 3MN3A 4M7IA 4MD9E 2E9OA 3ORXA 4WIHA 5AV1A 4EEVA 1JAMA 1ZMVA 5M06A 4CZUA 3MVHA 4PPCA 4O86A 3DT1A 3G51A 3UQGA 3C5IA 1PY5A 4RSSA 3LFSA 2BFXA 2NRYA 3PTGA 3F5GA 3ANRA 4R7IA 5D12A 2VWZA 4RVMA 5EM5A 4QQ5A 4IC8A 1Q62A 4D5KA 2H9VA 2I0VA 3GUBA 2Y0AA 3NUUA 1OUYA 1JOWB 2QU5A 4EQCA 3PVUA 4X2NA 1BL6A 1U59A 4J52A 5E92A 4ERKA 4O7WA 3NNXA 3PZEA 4IB3A 2GDOA 4N0SA 2G2HA 2RF9A 2OIDA 3W2OA 4YTCA 2ITTA 3LXNA 2VO3A 4OBQA 2W06A 3PFQA 1PXNA 3ZEPA 2BUJA 2X8IA 4MAOA 3ZFMA 3NS9A 4I94A 2R3GA 3QUDA 4QMVA 5J9YA 1P4FA 3CCNA 4LGDA 5EW9A 1ZWSA 3T9TA 3KB7A 4I21A 3D94A 5CQUA 5ITAA 1E1XA 3NAXA 3LXLA 2WFYA 5D1JA 3L8VA 4ACGA 3FLSA 4MXYA 3O2MA 5DG5A 5CEQA 3W2CA 4BKJA 5IU2A 4HYIA 2JGZA 5KMOA 4RPVA 4A06A 3UDBA 5LMBA 5C1QB 4CEGA 3EQDA 1GOLA 4YHJA 3IECA 4BBEA 5L2TA 5HLPA 5AV3A 3FV8A 5CF5A 4YZ9A 4HZSA 4G9RA 2J0MB 4H05A 2QURA 5C4KA 4GRBA 4J53A 5DR2A 2Y9QA 3KXXA 3ZUUA 3ATTA 4NWMA 2JDOA 3IONA 4WOVA 2OG8A 3COKA 2B54A 5JRSA 5A9UA 2C0TA 1B39A 3OD6X 3HKOA 3NWWA 4IC7A 4ACMA 2SRCA 2X2LA 4R5YA 1FMOE 3FKNA 1PYEA 1XH6A 4S34A 2WMVA 4O1PA 2GQSA 4TL0A 2X8EA 3LW0A 3U6IA 4DH7A 3OOMA 3MFUA 5C8KA 3EYHA 4IANA 1REJA 3PUPA 3O8PA 3HV6A 3OY3A 3VHKA 5FUTA 4G5JA 2QKRA 3ORPA 4G3GA 4O82A 3DOGA 4IQ6A 4UMTA 2Z02A 4EHGA 2CJMA 3NAYA 3R7IA 4GIIA 3RZFA 5LMKC 2FYSA 1H1SA 1P5EA 5BPYA 2GNHA 3V5WA 3F5PA 4CNHA 1VYWA 3DTWA 3RALA 4IM3A 4PL3A 3C0IA 2WQEA 1NY3A 4RJ3A 3TKHA 2R3JA 3MIAA 1M7QA 2BPMA 2C6EA 5IA5A 1W83A 4DCEA 3DLZA 2JDRA 5C8MA 3RGFA 4UMRA 1OBGA 2G2IA 3D5WA 3FWQA 4NKSA 2IVSA 4EOIA 4O38A 3OW4A 3ZUTA 2CKOA 3I7CA 4FSQA 4JR3A 3R9OA 4A4LA 4AUAA 5L2WA 2OZAA 2X81A 3F7WA 2OF4A 3VBVA 2WKMA 5CLPA 4JJRA 3PA4A 3TKUA 1WBPA 2ETMA 4QPMA 4ACDA 1PMUA 4M14A 1W8CA 4MWIA 3UNKA 3SRVA 2WU7A 2XNBA 4D9UA 4QMNA 4QQJA 4I6BA 4ZY5A 2W1FA 3I60A 1R1WA 3CGFA 2FSTX 4YZDA 4LRJA 4BDHA 3VQHA 4DT9A 3PRFA 3IS5A 3BYVA 3SHEA 1DI9A 3OZ6A 5C03A 4EKLA 5CALA 3LXKA 2B0QA 2GS6A 4JS8A 2JIIA 5ETAA 1M7NA 2B9HA 4A9RA 2YISA 2PVNA 4ASDA 2LGCA 3F82A 3RPRA 4BRXA 4PNIA 5BMMA 2FVDA 2ITQA 3FZSA 1VJYA 2W9ZB 3BEGA 2GNJA 4LM5A 4OTPA 4CKRA 4FOCA 5J9LA 4IADA 1OKWA 2GHGA 4R3CA 4V0GA 4O0YA 2VTHA 1S9JA 2PVYA 1OBDA 4DE4A 3RNIA 3PG3A 3K3IA 1WZYA 4BCIA 1LR4A 3EN4A 3PZHA 1WMKA 5HLWA 3ENMA 4QMYA 2B9JA 3KU2A 2VTJA 4GK2A 5GINE 1GNGA 2WTVA 3FSKA 3HRCA 1XH8A 2F49A 3UMWA 2KULA 3DKFA 3PXQA 3VC4A 3OEZA 1IRKA 5EHYA 3BHVA 3MWUA 2ONLC 2X4ZA 3O71A 4L46A 5EYDA 3ZYAA 4J71A 1LUFA 1KE9A 1OGUA 5G6VA 1H0VA 2RFNA 4V05A 3OCBA 5FDPA 2LAVA 4FGRA 4Z9LA 4BKYA 2EWAA 3ZBXA 4C4JA 1BLXA 4KA3A 3NIZA 3T9IA 3ZFYA 3FAAA 1V0PA 3P7BA 3EQGA 4K77A 2VTSA 2YM4A 4GG7A 2WOTA 4L01A 3QALE 3SAYA 4JG8A 4DGMA 3ELJA 3OC1A 4FKLA 4XOZA 5AUZA 3FYKX 3POOA 1UU8A 5CYIA 4AWIA 4ALVA 4D2WA 2OIBA 5IQGA 3G15A 4X6QC 4XP0A 4FKUA 4CRSA 3KK8A 3TZMA 4FG7A 3BLQA 4GT3A 4GYIA 4U3YA 5KMMA 4PDYA 1CM8A 3LAUA 4RX5A 4CFVA 3BELA 1KWPA 5EDRA 2VTOA 3FMMA 3W8QA 4DH3A 3TNWA 1GZOA 2ITZA 2X2KA 4JVGA 1ATPE 1R39A 4TT7A 3QD4A 4E93A 5IUHA 4FTOA 5CENA 1ZOEA 4XV3A 4ITJA 5TF9A 4V04A 2XK4A 3A99A 1F3MC 4F9YA 4L8MA 3BE2A 2BHEA 3K3JA 4HVHA 1OI9A 4O0TA 3PXRA 3MH2A 3U4WA 1PMVA 3DPKA 1OL7A 3IG7A 4BR3A 3A61A 4ZTHA 3E8NA 5FXSA 3UNJA 4EL9A 5B7VA 2FB8A 2BDJA 4HYHA 3R7VA 4QTAA 1JSTA 1PXKA 2QLQA 3FPQA 3TIZA 4RRVA 2X6EA 3HA6A 3VS0A 4YLJA 3DB6A 3MIYA 4ZAUA 3NIEA 3CXWA 4X7QA 1JPAA 4OBPA 2PVRA 4OTIA 4L3LA 3WARA 3D5VA 2QHMA 2W0JA 2C6MA 2V62A 2YLEA 3PXFA 4U0IA 2XK9A 3RHXA 3TM0A 5EOLA 3DAKA 4EK3A 2ETRA 4BTJA 4OTHA 4GVAA 4FT5A 4XUFA 2X7GA 3HLLA 4GG5A 3E5AA 2QO2A 3F3WA 2WQBA 5IA1A 2BZKB 3L8XA 5AV2A 2R3QA 4IIRA 5GZAA 2BVAA 2VWWA 3GXLA 3SX9A 1YVJA 3WILA 3P9JA 5HORA 4O7NA 2OXDA 2VU3A 4KRDA 5HE1A 3D7TB 4YR8A 2IVTA 1IAJA 5CWZA 2CDZA 2I0YA 3EQPA 4NUSA 5FEQA 4ZXTA 5IH4A 4FEUA 1PJKA 2JDVA 3RKBA 1Q8UA 5CI6A 5LCJA 4OBOA 3KVXA 3TTJA 4PMSA 2C0IA 5I9WA 5J7HA 1I44A 4DYMA 2F7EE 5DGZA 4RQVA 3FEGA 3EQRA 1JKSA 5EOBA 2WPAA 3SV0A 5HX8A 2XKFA 1TKIA 3QRJA 5AUUA 2XNEA 4QYEA 3QGWA 2C1AA 3LZBA 5T6KA 4E5WA 3ORTA 1IG1A 3MGYA 2WO6A 4AT3A 2YM7A 5A3XA 2C1BA 3PJ2A 3KVWA 3R2YA 4IX5A 4LGGA 5BQ0A 4WSYA 2B1PA 4DH5A 3HMNA 3O7LD 3TN8A 1M2QA 4GYGA 4TWPA 4XV2A 4BC6A 4QP9A 5J5SA 2YEXA 3Q52A 4MX9A 3TXOA 4Y5QA 2J50A 5EHLA 4GSBA 4O0SA 5I4NA 5JT2A 4A4OA 1VEBA 2ACXA 4JX7A 2BTRA 4AW5A 3BBTB 4IDTA 5CT0A 3RCJA 1H01A 2AC3A 4M12A 1JWHA 4EH9A 4FR4A 3WF5A 4I1ZA 4FSWA 3BGQA 4AW0A 2FGIA 3R7GA 3BLRA 1H00A 4IWQA 2YDJA 3WYXA 4AZEA 2JKQA 2PMOX 5F20A 4I5HA 4BDAA 4UMPA 2X9FA 3M2WA 5HLNA 3DDPA 1QPDA 2YDIA 1GIHA 4FKOA 4FODA 3UIUA 2UW8A 4IX4A 5ICPA 2Z7LA 3LFBA 3QKKA 4O27B 4ZLZA 3MB7A 2C4GA 4E1ZA 5IEYA 2BIYA 4FUYA 2BR1A 3ULIA 1Z57A 4XRLA 4A4XA 4LOPA 4EOQA 3ZM9A 2BROA 2H96A 4RMZA 3UGCA 3UG1A 4UN0C 4GFMA 5HCZA 1Q8YA 4EH3A 3QFVA 5ANEA 4C37A 4TWOA 5JFWA 4NW5A 3RINA 4FMQA 4LV5A 1W0XC 2XNOA 2V55A 4G3EA 3ETAA 5HOAA 3ZCLA 5BVWA 2XEZA 3BRBA 3QQJA 4J99A 2ZV7A 4TYJA 2J90A 4B9DA 4EK6A 3UOJA 4C2WA 4IE9A 5EKOA 3QZIA 2VO0A 3IK3A 3KFAA 3PXYA 4HGEA 4KBKA 5CU2A 3QHRA 3PXZA 4A7CA 4DEBA 4XH6A 3FXWA 4XBRA 2Z60A 1LP4A 3E8EA 4I6FA 2WOUA 3Q4ZA 4AZSA 3R6XA 4FIJA 3QA8A 1XBCA 2CGUA 5HG9A 4YPDA 1P2AA 3UO5A 3NYNA 5IQDA 5HNBA 3LFCA 2OJGA 3D15A 1QPEA 4EORA 3SXFA 3RWPA 4CYIA 2ZB0A 2JKOA 2CCIA 1M17A 2C5OA 3DBDA 4B8MA 2VTRA 4E7WA 1IEPA 3D5XA 3PE2A 3RTPA 1YDSE 3NCGA 2VX1A 1ZOGA 3KMWA 2ITOA 3IOKA 3VW8A 2WMTA 4BDCA 3BYMA 3R8PA 3UTOA 4BIDA 4XLVA 2R4BA 4G2FA 3H9RA 4FNXA 4GUBA 3IGGA 5EH0A 3WZUA 2YJRA 3C51A 3VBWA 3NW7A 2B52A 3OWKA 3PPJA 4GK3A 4ALWA 4QYFA 4HW7A 2ITWA 4X2GA 4L44A 4ZSLA 3ZSHA 4ZJVA 2HYYA 5AADA 5IF1A 3EYGA 3ZDUA 3F6XA 2WGJA 2JBOA 5LARA 4ZK5A 1H4LA 3P78A 4X2KA 5HU9A 3F9NA 1V1KA 4KB8A 4FSUA 3KRXA 3S1HA 1Z5MA 5HIEA 4U40A 4UEUA 4R3PA 3WZJA 5GJDA 3CR0A 4YHTA 4IZAA 1QPCA 3UPXA 5A4QA 3UQCA 2ITVA 2XMYA 4JBOA 4OGRA 4TWNA 2VWUA 4F09A 4I5MA 4C33A 2BZIB 4IDVA 1Y6AA 4AP7A 4AN3A 4UXLA 4YSMA 3FZ1A 4UV0A 5A14A 5IUIA 2CSNA 1KV2A 3QZGA 3GT8A 3LMHA 2XNNA 3DBEA 3EIDA 5D7AA 4ZS4A 3D5UA 2R0UA 2X8DA 2OZAB 3I6WA 2IZUA 3OFMA 2R3IA 1QPJA 4FV8A 4MYGA 1B6CB 1PF8A 4RJ7A 3NUXA 4IAKA 2P4IA 2XIYA 3QRKA 3P23A 4LG4A 2UZOA 4I0TA 4CMTA 2PVFA 3GB2A 3WF9A 5CTPA 4NEUA 3BZ3A 2X6DA 5EI8A 1SNUA 5I9YA 2R3KA 3UVQA 3ZRLA 3V8WA 3FHIA 4FT3A 4HCTA 5HVKA 4LL0A 2Q0NA 5DH3A 4FYNA 4TN6A 2W17A 2CNUA 5L2SA 5M09A 4C3PA 3EQIA 5IPJA 3S0OA 3W18A 5AFVA 3ZXTA 5JQ8A 2AUHA 2G9XA 3FQHA 4E6AA 4EH7A 4FTTA 3FY0A 4LV8A 3QQGA 5I9UA 4O6EA 3GQLA 4B4LA 3M1SA 2X0GA 2QONA 4H39A 3PPKA 2WU6A 4OW8A 4F4PA 4L45A 4V0GB 3FQEA 3RM7A 3W2QA 4FTKA 1YXSA 4Y8DA 4PX6A 5E8XA 3UP2A 4EUTA 3FKLA 4PDPA 3QUPA 4XBUA 4L43A 4TYIA 4BFMA 4DN5A 4EH6A 5J5TA 3DJ6A 5CS6A 3CQUA 4CD0A 4GVJA 4FIFA 4MQ2A 2O3PA 2O8YA 3QAME 5ANKA 4EOMA 2YIQA 5IA2A 4XX9A 2W5BA 5DIAA 4ACHA 3EQFA 5CAPA 3MVLA 4XV9A 2ZOQA 3WIKA 1H24A 4ENXA 3OHTA 3SVVA 2PE1A 3MY5A 4P5ZA 4FC0A 4XYFA 4AX8A 5KCVA 4QP3A 3PSDA 5DHJA 3F61A 4EYJA 2FUMA 2F2CB 1PRYA 4KIQA 1H1QA 4PNKA 5L6WL 1ZYDA 3VUHA 4DH1A 5F4NA 2EXMA 3SXRA 3Q9XA 1U5QA 4YLLA 5DNRA 4M84A 5IQAA 3F7ZA 5D41A 4U97A 4IX6A 3GBZA 5CXHA 5CZHA 3PVWA 4ANLA 1NW1A 4MH7A 1Y57A 3DB8A 3GU6A 3U9NA 3BLHA 1KE8A 1G5SA 2P2HA 3R22A 2XBJA 4G6NA 4TZRA 1YWVA 4CT1A 5DRBA 3D7ZA 3S2PA 2QOOA 3AD6A 1U54A 3MH0A 2OXXA 4PUZA 2J0LA 3A62A 4YC8A 4FTQA 4GH2A 3NUPA 4DEGA 5FEDA 5CAOA 1WBOA 2R3LA 3LIJA 4FKGA 5JFSA 3HEGA 4RBLA 1J7LA 3P0MA 2A19B 2RIOA 4O2PA 3NVMB 4XP3A 2WB8A 2QOBA 4O1OA 4WRSA 3HUCA 4ZIMA 5HIDA 3ALNA 2FH9A 1BX6A 2C3LA 3FQSA 4BCOA 3A60A 4YSJA 2HXQA 2O0UA 2J0IA 3O8TA 1PMNA 4IZYA 4J95A 4MCVA 4CV9A 5A46A 3L9MA 4RFZA 3K5VA 3PIYA 3BQCA 4DT8A 3LMIA 3I0QA 3NW6A 3VS3A 3ZC5A 1Q61A 3HX4A 3Q32A 4EH4A 3ZH8A 3BHHA 2VTTA 4EZ7A 3BCEA 1YQJA 3VS4A 5K5NA 1ZMWA 2ZYBA 4M68A 3SDJA 4O84A 2ERKA 3VBYA 3C13A 3OG7A 4XNEA 4AOIA 3C4FA 3IDBA 5EHOA 3PIZA 3PY1A 4CSVA 3QWKA 2ESMA 3OXIA 2BCJA 4KKGA 4L42A 5AMNA 4YTIA 4YGAA 3RHKA 4YJQA 4D1SA 4G16A 2WIPA 3KY2A 3VUIA 3EL7A 4TYGA 5AX3A 5D10A 5BVEA 3V01A 2F9GA 3C4ZA 3LE6A 4JAIA 4RIXA 3VJNA 1PXOA 3ID6C 5FWKK 4OAUC 4ORKA 2WXVA 4C36A 3ACKA 4AE6A 4BGQA 5HD4A 2YIWA 3ZOSA 2VD5A 3QX4A 5HU3A 4UMQA 4BDFA 5AAFA 1H26A 3A4OX 3DZQA 3IW6A 4HVIA 4EWQA 3C5UA 4RIOA 4YBJA 2YIRA 4KS7A 4CV8A 4TRLA 3ZRKA 1AGWA 5HO6A 3W16A 3VRYA 3DJ5A 4EH8A 1KV1A 2VZ6A 3CLYA 4FKTA 4I22A 3FXZA 2YZAA 3VNTA 1U5RA 3EQBA 4GCJA 1WBSA 3AC2A 4P4CA 5J9ZA 4O0VA 4YZNA 4D0WA 3DDQA 4HZRA 4KIOA 2P33A 3E63A 3R8UA 3ZBFA 1WVXA 3DK3A 3EKKA 4CTBA 2QO9A 2JIUA 3E8CA 4M97A 1O6YA 5E1EA 2F7XE 5ANDA 2W1EA 3GC0A 5KZIA 3GCSA 4L3PA 3D0EA 1AQ1A 1UVRA 2R2PA 4FG8A 4W4VA 4AA4A 3JY9A 5CAUA 4EOSA 2WMAA 1Q3DA 4TNDA 4ANMA 1XH5A 4HCVA 4WA9A 3HDNA 4WG5A 3G0FA 3L1SA 1A06A 1MP8A 5DBXA 4QMUA 5F94A 3CS9A 4DCAA 4YO6A 3D83A 4ANOA 3HMIA 4PL5A 5HO7A 5M55A 5DRDA 4NU1A 4BIEA 4JDIA 4U43A 3GFWA 2HY0A 4MF1A 5FP5A 2OJIA 2WEVA 3ZLXA 3BIZA 4ZZMA 3TNIA 5CEIA 4PP9A 2YIXA 3U6HA 2OJ9A 3DY7A 5DMZA 3GC9A 2VWVA 4C4IA 2YWVA 2I0EA 5BYYA 4GUEA 3EJ1A 3QRUA 3LXPA 3RAHA 5HBJA 4G3DA 3ZO3A 3OEFX 4GJ3A 3ROYA 1OPKA 5IQBA 3FI8A 4XG4A 4JAJA 3QTIA 5C27A 5I0BA 3EQCA 2RFSA 3CPCA 3GI3A 4C62A 4MXCA 3GGFA 4D4YA 3Q6WA 1SNXA 1IASA 4RQKA 1CMKE 4R5SA 4RJ4A 1JKTA 2Z2WA 3QCXA 3DS6A 3SQQA 2FA2A 4PWNA 5AIRA 4ZTRA 3E93A 3N51A 5EK7A 4U45A 4BCKA 1YI6A 5HICA 3ZUVA 3QF9A 2OLCA 5I9XA 3LJ0A 2DQ7X 4PRJA 5TT7A 2BMCA 4IXPA 2CMWA 4TWCA 5IH6A 4M69A 3V6RA 5AP3A 1GJOA 4RLKA 4G1WA 4F7SA 2ITYA 3FLNC 4NW6A 4E6QA 1E9HA 3MTFA 4G3FA 2YAKA 4JBQA 4ZTQA 3QHWA 2HELA 3ENHA 4IAZA 3EMGA 4JDHA 5EQEA 4OTDA 5GZ9A 4FSRA 3R28A 2P55A 4YLKA 5LVOA 2VTIA 5ANIA 2CGXA 4L68A 3LCDA 4XP2A 5HE0A 4OTQA 4FTRA 4YJTA 2PTKA 3PA3A 1IA8A 1RDQE 4F7JA 1L8TA 2R3RA 2CKEA 3O50A 4IM0A 4CXAA 3CY2A 3I6UA 4IBMA 5LVMA 4AFJA 3FMEA 4FZDB 4AN9A 2R7IA 5E7RA 4XG2A 3EFJA 4C3RA 4AA5A 4APPA 4D4RA 3M42A 4L7FA 3CC6A 3UVRA 3RJCA 5IQEA 2VWBA 4CLIA 5CU4A 3TTIA 2P3GX 4DGGA 3N4VA 2Y7JA 1YWNA 3Q60A 5EYCA 4U8ZA 3Q5IA 4F9WA 3MYGA 5FXRA 4Y5HA 3FMJA 3NEWA 4IFCA 3MBLA 4AW2A 3H4JA 5KX8A 5HX6A 5CSVA 4NM0A 4O7RA 3MJ2A 4MXXA 1R78A 3MY0A 2ZV2A 4YJSA 5L6OA 4BCGA 2EXEA 2GQRA 4BN1A 4FT9A 4F9AA 3TUCA 4XCUA 1GY3A 3HV7A 5HG7A 2W05A 5KZ0A 2JDSA 4BDBA 2JFMA 2IO6A 4RZWA 5LMAA 4H58A 4AGWA 4JDKA 3NNVA 3QQUA 4YNEA 4DFXE 4IHPA 1BMKA 5JFVA 1OMWA 3OCGA 2WTKB 2RKUA 3KC3A 4FVQA 5HD7A 3TV7A 4HPUE 1ZAOA 5LWNA 5L2IA 2H34A 4DTAA 2XKCA 1VR2A 3QUEA 4GEOA 4MBIA 3FDNA 3U8WA 5EW3A 1ZYSA 2GHMA 3FMHA 1XJDA 2JC6A 2PSQA 4BB4A 2QG5A 1ZZLA 3LMGA 4IVCA 2XK8A 5JN2A 1ZOHA 3WZEA 4JL9A 4NZWB 1OL1A 2RG6A 3LCTA 4ZTMA 4BICA 5J1WA 1IA9A 1TQMA 1BUHA 1PXPA 2PVLA 5LCKA 5HO8A 3EKNA 5AUWA 1V0OA 4E4MA 3GCVA 3LOKA 4FNWA 4UZHA 3EN7A 4I93A 2W1IA 1WCCA 2BRNA 2UW4A 1MQ4A 3QQLA 4BGHA 4CQEA 4BL1A 4KIKB 3OCSA 3JYAA 3KKVA 3GEQA 2WD1A 4UWCA 4D5HA 3NW5A 5FBNC 3VO3A 3KA0A 3FC1X 2Y6OA 1UWHA 4IJPA 4WHZA 3H0ZA 3O0GA 3ZO2A 3DXQA 3VJOA 1OITA 3I4BA 3ZS5A 4D2SA 1JVPP 4AXAA 5LVPA 1PMEA 3HMPA 4P7EA 4C38A 4F63A 1ZMUA 5CZIA 4EJ7A 2CPKE 4IWDA 1ZY4A 4FV1A 4YZMA 4F0IA 3WYYA 3E3BX 5BVKA 4U9AA 4LUDA 4QO9A 4D1XA 1PXJA 5KBRA 2QR7A 4ANQA 4IACA 1R3CA 5CVGA 4KUJA 4KD1A 4KNBA 3QZHA 3IW7A 4JLCA 4ALUA 1CKJA 5DPVA 2W1ZA 3KXGA 3PJ3A 2P2IA 4FKIA 1H0WA 4AOJA 1PKDA 4FT0A 5BUEA 2R64A 2W1CA 3H10A 3ANQA 4X21A 3FUPA 3FPMA 5FTQA 5TE0A 2XB7A 3MH3A 2NPQA 3Q4CA 4CG8A 2PK9A 4W4WA 3DTCA 1OL6A 5H9BA 3UO4A 3POZA 4FKPA 5IDPA 2W5AA 3ZONA 4O83A 2X7FA 5E1SA 5JQ5A 2OBJA 3DBFA 3WZDA 4JQ8A 5BYLA 1OZ1A 3EWHA 1MUOA 3E7OA 3A7FA 3VVHA 2VTMA 2GFCA 3DLSA 3PY0A 1U54B 3R63A 5L4QA 4KBAA 4XLIA 3VS6A 4JG6A 2YAAA 5ACBC 4CFXA 5BYZA 2CGWA 5FEEA 2FO0A 4G5PA 4FL2A 3I5ZA 4KBCA 4X0MA 3SLSA 3ULZA 5HBHA 5GHVA 3UG2A 3KN6A 4D9TA 3OMVA 4LRKA 3Q6UA 2WMBA 4PMMA 3EH9A 4RIWA 4I6QA 3O17A 2I40A 4WNPA 4QMZA 5HG5A 4PMPA 3MVMA 4QMMA 2YDKA 4BDEA 3CP9A 3SC1A 2QODA 3ZSIA 1ZYJA 3VUTA 5AP6A 4DAWA 4FTLA 4L00A 4X2FA 4JRVA 4A9UA 2BFYA 4WO5A 3KCFA 3KRJA 3SXSA 5CVFA 4R78A 3LQ5A 4IAAA 3JVRA 3UNZA 3L9PA 2IZSA 4BY9E 4ZS0A 4ASEA 2YLFA 4FVRA 3P86A 5EDPA 5DVRA 4RFYA 1OECA 1QL6A 4A9YA 2GPHA 4RZVA 5BUIA 5BVDA 2VO6A 4R6VA 4ITIA 3IDPA 1YDRE 2WTJA 4C4FA 4O0RA 2CN8A 1ZARA 4EHVA 1URCA 5T68A 4WG3A 5J95A 3BI6A 4E6CA 2OH4A 3R8ZA 5AAEA 4WT6A 2RL5A 3TIYA 4H1JA 5HEZA 4AN2A 4QMQA 2CLXA 2ZDUA 4RIXB 3VS2A 3NNUA 4BCNA 1A9UA 2GU8A 2VTAA 4KSQA 3ORLA 1SVEA 4KIPA 2XM9A 2WMUA 4Y46A 4U79A 5D9HA 4QP8A 4CYJA 4QNYA 4PTEA 4USDA 2C6DA 3RWQA 2YZLA 1OIRA 4K18A 3R83A 3A7HA 2VO7A 5JFXA 5L8LA 2G01A 3LHJA 3UODA 3BHTA 4PTGA 4H36A 2UZLA 5CQWA 4RJ5A 2C3KA 3THBA 1HCKA 4EC9A 2XIRA 2C0OA 2X9EA 3K5UA 4F99A 5DLSA 1UNLA 2WMQA 3C4XA 4MBLA 3R9NA 4C4EA 3I0OA 2DS1A 4OTRA 4UWBA 3UPZA 3A7GA 4C7TA 5IDNA 1WBVA 4AFEA 4BDKA 5M44A 2PMNX 4RWJA 3UOLA 3VW6A 3C4CA 5IA0A 2BIKB 2X1NA 3H30A 4U7ZA 1OIUA 4G6LA 5CXZA 1XO2B 2CGVA 5CU0A 1G8AA 4Y83A 2XNMA 3H9FA 4QTCA 4XS2A 5TO8A 4I5PA 3WF6A 2HENA 1OPLA 4XG9A 1YXVA 4AGUA 5GZ8A 4PTCA 1YXTA 4NM3A 4FKQA 4AQCA 4YZBA 4J96A 3GU4A 2Y4PA 2YWPA 3GC8A 5KHWA 3R1NA 3AMBA 2I6LA 5E9EA 4OT5A 3BWFA 4XG8A 3ATSA 3FI3A 4L7SA 4IFGA 1KOAA 5AJQA 2Q0BA 2QU6A 3EZRA 3FL5A 3AT2A 4DA5A 4ZOGA 1TVOA 1LEZA 2OF2A 4I5CA 1KOBA 4FTMA 3W8LA 3F69A 2XYUA 2RFEA 4F0GA 1STCE 4EOLA 4M13A 4I23A 1SVHA 2OU7A 4Q5HA 4YJRA 3NGAA 5DT0A 4EYMA 2CKPA 2UVYA 1H07A 2WHBA 4K33A 4WD5A 3GNIB 3FC2A 5C8NA 4O7VA 4EBVA 3ZSGA 4A9SA 5A54A 3GC7A 5ACKA 4BWPA 5CSXA 5JRQA 4UB7A 5L6PA 2R3NA 3KL8A 4L3JA 2GCDA 3VHEA 4M69B 5GNKA 3VUGA 3IW5A 1WBWA 3DFAA 2W99B 4JQ7A 1J7IA 5GIPE 2J7TA 2PE2A 4WNMA 5E8VA 3WBLA 2BILB 4HPTE 2HW7A 4RWKA 4DITA 3BV3A 3U4UA 4C02A 5LQFA 3QD0A 2WTKC 3Q2MA 5AR4A 2VX0A 4AA0A 3SA0A 3WE8A 2B9IA 2A2AA 4CTCA 4WUNA 3UIXA 3RP9A 5I9VA 4ZY6A 2B4SB 3K54A 2CN5A 3MA6A 2OH0E 3OS3A 3OY1A 2VNWA 3HV3A 3LM5A 1YOMA 3CTQA 3KMMA 3OWPA 2OJFE 3BWJA 2QHNA 3Q04A 4YJOA 5B0XA 1J1CA 3AC1A 3RMFA 1PW2A 3LLAA 4HNFA 1O6KA 2QNJA 2YM5A 4NFNA 4DGLC 3C0HA 4FV6A 4CT2A 4JIKA 3UO6A 4N6ZA 4FZFB 5C9CA 3ORMA 2W4JA 5DR6A 2YABA 1K3AA 2VNYA 3NX8A 5JSMA 5E8SA 1YXUA 2ITPA 2XUUA 4BI2A 4D55A 1WVYA 4FTAA 5L2QA 3AC5A 1Q5KA 3I5NA 5LVLA 3S3IA 3VQUA 5CANA 4L53A 5HE3A 4Z16A 3F5UA 2ZMCA 4MXZA 2QC6A 3ZTXA 4BWKA 3JPVA 4II5A 4EJNA 4FKVA 2PWLA 4OUCA 2R3PA 5GJFA 4FG9A 2WTCA 5IA4A 2ITNA 4L6QA 4NFMA 1DAYA 2REIA 4F65A 3OTUA 5KNJA 2F7ZE 2V0DA 5BVNA 2PVKA 3TUBA 4FYOA 3IKAA 5A4CA 3QXPA 4BDIA 2XF0A 4Q9SA 4ZSEA 3OBGA 3TG1A 3DXPA 3P4KA 1ZRZA 4UWYA 2QOFA 4QP4A 5G1XA 5IH5A 3ZO1A 1WVWA 5DT4A 3LFDA 3AT3A 4I4EA 2IN6A 4TKSA 2HZIA 1KE5A 2UZWE 5TKDA 5TOZA 2QO7A 3F88A 3JY0A 5E8WA 5E91A 4UX9A 3AD5A 3I1AA 2BRGA 2XJ2A 4DTBA 4H3PA 4BCMA 3FXXA 4GK4A 5EDQA 3VBXA 4ENYA 4IAIA 4R3RA 3MPAA 4IM2A 4BDJA 3ORZA 3SD0A 3V5QA 1IR3A 1XKKA 4XG7A 2IWIA 4X3JA 4D2TA 4DLJA 1WBTA 4EH2A 3RM6A 5CF6A 2W1DA 3HRBA 3G6HA 2X4FA 1H25A 3V5TA 5CEKA 5JGBA 5KKRB 4DLIA 4XG6A 1JBPE 3LFAA 1EH4A 4XJ0A 1JSUA 4GU6A 1OPJA 5DOSA 5FD2A 3R8VA 3RCDA 4FEXA 4BBMA 3QTUA 3TJDA 4CLJA 3EN5A 1YHWA 4Y85A 4EBWA 5A6NA 1MQBA 3Q9WA 4Q9ZA 1WAKA 4USFA 2HY81 2VTNA 4W8DA 5CI7A 3G90X 5B2KA 5KUPA 2UZEA 4PPAA 3MTLA 4I6HA 5GJGA 2OSCA 2IJMA 5CSPA 3OF0A 4EQMA 3Q9YA 5B2LA 4KIKA 3HECA 4ZSGA 4GW8A 3DAJA 4QNAA 4GS6A 1ZYCA 1UKHA 4TYEA 5EKNA 2HK5A 3E8DA 1FOTA 4OTWA 3R9DA 3R71A 2GNLA 2WQOA 3EFWA 1WBNA 4ZSJA 4E4LA 1R0EA 5H2UA 3MPTA 3VS7A 3U55A 3HAVA 4AZTA 4D2RA 3BE9A 3LCKA 1MRVA 5TR6A 1YW2A 4F9BA 3P1AA 3F3VA 4W9XA 4R7BA 2NNWB 1JKKA 2PYWA 2QVSE 2C6IA 3D2IA 3W55A 2WQNA 4EONA 3E7VA 3I81A 3QYZA 4K8AA 5HVJA 1SVGA 2YACA 5HI2A 3V8TA 2UZNA 4QMTA 1REKA 4NCTA 4ANSA 4IWOA 3SW4A 2E9UA 4FZ7A 5HGIA 1FGKA 4RIWB 3G0EA 4FK3A 4WSQA 1M14A 1YI4A 3BQRA 3P7AA 3DNEA 4Z7HA 2UZDA 5CASA 2WEIA 5AP4A 2XVDA 2Y6MA 4RWLA 4C2VA 3VF9A 1JSVA 3O51A 5FTGA 3E88A 1XR1A 3HYHA 4HGTA 4EOPA 4O91A 3DNDA 1H28A 3BYOA 4BCFA 4D4SA 2EB3A 4E8AA 5K9IA 3OCTA 3C1XA 2OWBA 5KMLA 3LKMA 3UZTA 2OFUA 2J5EA 4FTIA 1XHAA 4ZJIA 1U46A 3OBJA 3RNYA 4DEAA 2JKKA 2OK1A 5IEXA 5AV0A 4HOKA 5DEYA 1FINA 3Q9ZA 1NVQA 4QP6A 5IEVA 3AC3A 3V5JA 2YCRA 3EZVA 3GU8A 4JXFA 4IJ9A 1YKRA 1YHSA 4X2JA 4ID7A 4JT3A 2VGPA 4HYSA 3M11A 5FLFA 2C5NA 3MPMA 4QTEA 1G8SA 2A27A 4HNIA 2JDTA 3DQXA 5IA3A 4FNZA 2ZAZA 4J8NA 1DS5A 2YFXA 3WIGA 3PLSA 3ZEWA 3VIDA 4FV5A 3VF8A 2PL0A 2QOCA 3FSFA 4Z3VA 3QCQA 3UZPA 5AAGA 3WZKA 1UV5A 3CD3A 4BGGA 3RZBA 3WI6A 3QWJA 4RG0A 4OAVB 4E5BA 2XIKA 3B8QA 3VWAA 5AV4A 2WELA 3CTJA 3TZ8A 3QQFA 4M0YA 3A4PA 2J9MA 2HZ4A 2V5QA 3U54A 1XH4A 2XK3A 1RQQA 1Q97A 4O21A 4WUAA 2FSLX 3L8PA 2R0IA 5A4EA 5K5XA 4QQTA 4EK5A 3UVPA 3DBQA 1QCFA 3UE4A 2R3HA 4B0GA 2ZM4A 4LOQA 4H3QA 4UYAA 2QKWB 3F3ZA 3RVGA 3F3UA 4JBVA 5LOHA 4DFBA 1H27A 3MFRA 2IVVA 4DEIA 4TNBA 3ORNA 5ANJA 3QX2A 5EYMA 4RX7A 4FEVA 5AR3A 2AC5A 4IWPA 2W96B 3GENA 1PYXA 4KKEA 4TPTA 3PWDA 2W9FB 1VZOA 3OP5A 4NL0A 4RA5A 4YJUA 3S95A 2J51A 3R1SA 5AR8A 4K11A 4RC2A 2YITA 3NYOA 5FTOA 5KMJA 3V3VA 4H1MA 1ND4A 3EN9A 5CEMA 3MI9A 4XG3A 2YM6A 5DFPA 4C34A 4GT4A 3QYWA 5E4HA 4FV4A 4FKJA 4ZJJA 1ZYLA 4EWHA 3RI1A 2UZBA 2EU9A 4JIAA 4BI0A 4PL4A 2J6MA 2VTQA 1QMZA 2QI8A 4NJ3A 5AA8A 3DFCB 5CAQA 3RAIA 3MVJA 4IZ5A 3R00A 1XBBA 3DKGA 2Z7SA 3R1YA 4NM5A 4QPSA 4A07A 4BTMA 5F9EA 4U6RA 4EI4A 3ZRMA 5KHXA 3FL4A 3W2PA 3PIXA 4DHFA 3TV6A 4QMWA 4QTDA 3N9XA 4PQNA 5FXQA 2ZVAA 4APCA 4CCBA 3TNHA 5EYKA 3OVVA 3AD4A 4D58A 3LFQA 2W7XA 2PMLX 2PUIA 4FE2A 4HYUA 3LPBA 4BCQA 3RPYA 5CEPA 4MF0A 2CNQA 2XKDA 4O0UA 5HBEA 4RGJA 2YHVA 5L8KA 2BAJA 2ZDTA 3LVPA 5AP2A 3KCKA 3TV4A 3UYTA 1YOJA 5A6OA 3R1QA 2JAMA 5AWMA 1RJBA 3D2KA 4AE9A 4QRCA 2JFLA 5IQFA 4LRMA 3P7CA 3FZRA 4IW0A 4LGHA 3TL8A 3U87A 4F1TA 2BTSA 2J5FA 2GHLA 1SMHA 3C7QA 4TYHA 3P5KA 3Q4TA 4N57A 5AIKA 2X7OA 2BHHA 1W84A 3QXOA 1FVTA 5HQ0A 4P2KA 5AP5A 3NPCA 3Q4UA 3KREA 4E6DA 2XK6A 2E9VA 4M3QA 3RBWA 3NSZA 3LQ3A 5M4FA 4CZYB 2VWIA 4C4GA 1UWJA 1OKZA 2VTPA 4NK9A 5BMSA 5CSWA 5D11A 2J2IB 5EFQA 4RIYA 5FM2A 1L3RE 5AP1A 5I3RA 4MVFA 3UC4A 4X3FA 3CSVA 4WNKA 3NMUF 1H1WA 5M4IA 5EI2A 3NYVA 4I20A 5BNJA 5LJJA 1DAWA 3G5DA 1GZKA 1H1PA 3DXNA 4AT4A 4F6SA 5EQPA 5C26A 1GZNA 2KTYA 2YN8A 2X39A 3FZPA 4RA4A 3W1FA 3E64A 4F1OA 4CVAA 3O23A 4RVTA 3WOWA 4U41A 3VS5A 3PPZA 2GFSA 4Q5EA 5AUXA 3CD8A 1FGIA 4LOOA 4LMNA 4MHAA 5HNGA 3NUAA 4Y72A 5JK3A 5FQDC 4XEYA 2ZV8A 4DGOA 3OWLA 1PXMA 1YDTE 3AMYA 3LFFA 5FRIA 4S2ZA 5F1ZA 5CVHA 5KKRC 4CZTA 4RFMA 1JQHA 3QLFA 2VGOA 3BYUA 3MW1A 3WF7A 2BAQA 2XJ0A 2C30A 5HVYA 2OICA 4N6YA 1K9AA 3QL8A 3T8OA 2AYPA 4L9IA 3GVUA 5BUJA 5AR7A 2UW6A 1OM1A 2HZ0A 4U44A 2FSMX 4B99A 4WRGA 5DE2A 3GCUA 2C5YA 3QTZA 4AGCA 5HCYA 3SW7A 2B7AA 4MWHA 5I9ZA 3GQIA 3PWYA 5EM7A 1UU9A 4FNYA 4YNOA 3LM0A 5CU6A 4DINA 4Z7GA 4R1YA 5DYJA 3H3CA 4AOTA 4F70A 2Y4IC 2WMWA 2V7OA 3CEKA 3OWJA 3V6SA 3VUKA 5K0XA 2GQGA 2XNGA 3DAEA 4B8LA 3KRLA 3ODZX 3DKOA 4S30A 4U3ZA 3LJ2A 2UW7A 2WMXA 3QU0A 1FBNA 3D9VA 2OI4X 2OKRA 5L3AA 2V22A 2JITA 2E2BA 1JLUE 3KK9A 3TZ9A 4BI1A 4HJOA 4FTNA 4O7LA 2WTIA 4ZZOA 3UC3A 3LFNA 2PULA 2QOHA 3MY1A 2XM8A 4YJVA 3HV4A 1H8FA 2OFVA 4OLIA 1XQZA 4FA2A 4YO4A 3W32A 4FV0A 4LUEA 4NIFB 4QMOA 1YHVA 4AZVA 5DI1A 3II5A 1B38A 3TUDA 4U80A 1O9UA 3CQWA 4QYHA 3KULA 1FQ1B 4GJ2A 4L52A 5FDXA 4J97A 2QOQA 4J8MA 1H1RA 2GTMA 2NP8A 4NTTA 5AR5A 3UBDA 4EC8A 1UNHA 3VN9A 4EH5A 5HTIA 3HL7A 4QOXA 3F5XA 4QMPA 4C35A 4G6OA 3F3TA 2XCKA 2R5TA 1Z9XA 2WMRA 2HCKA 1VYZA 4NM7A 1TQIA 2YCFA 3FY2A 4RC4A 5KMIA 3NR9A 4EOOA 4DTKA 1MRYA 3UOKA 4O22A 4FKSA 5AM6A 5EG3A 3FMLA 3LCSA 2H8HA 3DU8A 4MNEA 3G33A 3N4TA 3T3UA 4J7BA 4X6RA 4OTFA 3CJGA 3E62A 4LQMA 4F1MA 4FT7A 3DJ7A 3UJGA 4ERWA 3QBNA 4M15A 4EOJA 5AEPA 4IX3A 3EL8A 4BWXA 2WQMA 3R73A 2A4LA 2R9SA 2G2FA 4ZMEA 1CDKA 2JKMA 4BYIA 5AX9A 4BTKA 3PSBA 3KF7A 3R0TA 4FICA 3U9CA 4AU8A 4C58A 5T3QA 3QTWA 3R7YA 4DGNA 3OOGA 2XA4A 3VS1A 1TQPA 2BKZA 4M66A 4DG0E 5M51A 2J0KA 3F66A 1GZ8A 3E92A 3VRZA 3W2SA 5M56A 3MSSA 3O96A 3KGAA 4FKRA 4FV9A 5K0KA 4C3FA 2OIQA 1M2PA 1RW8A 4JG7A 3V5PA 3E3PA 2JBPA 4A9TA 3QTSA 4XV1A 3JVSA 5KO1A 5H8EA 3G9NA 1Q3WA 3HNGA 4FOBA 2W4OA 5AM7A 5H8GA 2QG7A 3VUMA 1SM2A 3KQ7A 3FBVA 5DEWA 1Q8WA 4TY1A 4Q2AA 4DFUA 5J8IA 3ZLWA 5HTBA 5JH6A 3PP0A 4GKIA 2XBAA 1Q24A 4GIHA 3FI4A 4QP7A 2XCHA 3BBWA 3IPHA 2EB2A 4J1RA 5HG8A 4JR7A 3ZXZA 5K4IA 1CKPA 4AZFA 5JZJA 1AD5A 2UV2A 1SYKA 4RLLA 4DH8A 3OT3A 4CFFA 4LI5A 4AT5A 3P08A 4OT6A 2HOGA 3AQVA 2V7AA 3FYJX 2W4KA 4FBXA 4GV1A 3HDMA 3A8WA 4FZAB 4WG4A 4E5AX 2IW8A 3SG9A 2C69A 1UNGA 3BX5A 3Q96A 4IB5A 4C59A 2WZJA 5A4TA 4BCJA 3O7LB 3FMDA 4PDSA 3EQHA 1NT2A 4FSMA 2WTWA 3DGKA 1F0QA 1Q41A 1YXXA 2ITXA 3IGOA 2A0CX 5HCXA 4KAOA 5IKWA 4YPSA 1GIIA 1UKIA 2PUUA 4HGSA 3QZFA 3HA8A 2WAJA 5IG1A 4YJPA 2IZTA 2RSVA 4P90A 3IDCA 5J87A 4CFNA 5CU3A 2W1HA 3AMAA 3R01A 4F9CA 1JNKA 1OB3A 2QR8A 3G9LX 1E1VA 2WNTA 4I4FA 5AR2A 1HOWA 2CNVA 4IB0A 3B8RA 1YI3A 4B7TA 2RGPA 1WFCA 4DBXA 5DA3A 2UW9A 5H8BA 5K3YA 1J3HA 3KRWA 3V5LA 5LMKA 3FI2A 4FTCA 3BU6A 5EW8A 5IQCA 4BYJA 3LQ8A 5EM8A 4V01A 4CKJA 4KINA 4ZLYA 2A1AB 5CT7A 2PVHA 3HMMA 3NZ0A 3N4UA 5HE2A 3QD3A 4YTFA 2FSOX 5FBOA 4D2PA 3H9OA 4UALA 3PJCA 3TWJA 2HZNA 2O5KA 4ONAA 3QCYA 2PUNA 5CNNA 2PZPA 2XIZA 2Y8OA 2CCHA 5CSHA 4FL3A 3G2FA 3FHRA 1P4OA 2G1TA 3JS2A 3RAWA 3ZZEA 4ACCA 4P5QA 1HCLA 1W98A 2PY3A 4S33A 4FTUA 3E87A 2UZTA 2XK7A 4G9CA 4D2VA 4MTAA 3HMOA 4J98A 1X8BA 2ZMDA 2PZ5A 4RWIA 4PMTA 3ACJA 5DWRA 2XS0A 4NYEA 3A7IA 4ZTLA 3PY3A 3OW3A 5AUYA 4FIGA 5CY3A 4DEEA 1KE6A 5DR9A 2GSFA 3IW8A 2O63A 4AZWA 5E8YA 2BALA 2RG5A 4NJDA 3LJ1A 4ZMFA 3COHA 3DQWA 3ZLSA 1BL7A 4CMOA 4MXAA 4EOKA 3PA5A 3F2NA 4K6ZA 4O7ZA 3UMXA 5ANGA 5KMNA 2C6LA 3MH1A 4ASXA 4ZSAA 3TT0A 2HWOA 4BZNA 1CTPE 1J1BA 3R9RA 3HZTA 1K2PA 5JZNA 4KSPA 2YM3A 4UY9A 3RPVA 4I92A 4FSTA 5BX0A 5JEBA 2C6OA 5LVNA 4FEQA 1RE8A 2QOLA 2IPXA 2XRWA 5J1VA 5EI6A 3ALOA 4Z55A 3QTQA 4S32A 3R7OA 1FVVA 1G3NA 4MKCA 4TXCA 5C01A 5H3QA 3TNPC 3R7UA 1NXKA 2GS2A 4IVAA 2BRBA 3AC4A 2ZB1A 4UXQA 4F7NA 3MDYA 4FV3A 4D1ZA 4XMOA 2XNPA 4G17A 3QRIA 5JMSA 1NA7A 4FI1A 2XP2A 2DYLA 3JUHA 4K9YA 1OL2A 4O2ZA 4GKHA 2ONLA 4IB1A 3T3VA 4DEDA 5KE0A 1ZY5A 2R3OA 3DK6A 4TYHB 3OUNB 1YOLA 4DBNA 5IQIA 2J0JA 3C4EA 2NRUA 4GU9A 2PMIA 2WMSA 2GTNA 4YC6A 4MD7E 2EUFB 4MNFA 4EHZA 4EZ3A 4EHEA 4QYGA 3CTHA 3RPSA 1SZMA 3RAKA 3SG8A 4QP2A 4FK6A 3TNQB 3QC9A 1ZLTA 4KRCA 1OKVA 3GCPA 1KUTA 2VRXA 3MFTA 5HTCA 3QGYA 4RIYB 2NO3A 4FSZA 4LMUA 4QT1A 4X3FB 3ERKA 3ZHPC 5ETCA 3DZOA 3UIMA 5IZFA 5K4JA 3QRTA 4UBAA 3C0GA 1UA2A 3ITZA 4WNOA 3FLYA 4AW1A 4DFZE 4DFYA 4W4XA 1NVSA 4D28A 3OT8A 4AS0A 2Z7QA 2XRUA 4C61A 2O64A 2XEYA 3HAMA 4EK8A 3EB0A 4YUQA 5L8JA 3B2TA 2PZRA 4HGLA 4LYNA 4K0YA 2CKQA 3Q2JA 5DT3A 3PJ8A 4R7HA 3V51A 5E90A 5IISA 1Y8YA 3KXHA 4FKWA 5HKMA 4EUUA 4FEWA 5HHWA 4G31A 3NUNA 4PF4A 2XYNA 3BHYA 2EVAA 5JKGA 4AACA 2OO8X 5B2MA 4QMLA 4WKQA 3LCOA 3DA6A 3UYSA 5M07A 4BZOA 5JGDA 2VWYA 3EHAA 4GFOA 2VTLA 4MQ1A 4O81A 4CG9A 3AT4A 4BZDA 3C50A 2BRMA 4FV2A 3D4QA 3QC4A 3WF8A 3ORKA 3ZC6A 3ODYX 3ET7A 2VN9A 3MS9A 4YBKA 2E9NA 3TACA 4O7YA 4CFMA 2BZHB 4XOYA 2I1MA 4GT5A 2RFDA 4KWPA 3SKCA 1LPUA 4RC3A 4AGDA 2OXYA 4YZCA 2ERZE 4S31A 3VULA 4PY1A 2OZOA 3IO7A 1XH9A 2C3IB 4BCPA 2PVJA 3H0YA 4FSYA 3VBQA 2G15A 2H6DA 1H08A 3ZM4A 3KRRA 5C4LA 2EXCX 4ZP5A 4FIIA 4DG3E 3HP2A 4ARKA 3OUKA 3DV3A 4LL5A 1OVEA 3LLTA 3AC8A 4EZ5A 3U6JA 4WBOA 2UW5A 2XH5A 3PXKA 5LXMA 4NT4A 2ITUA 3FKOA 4QQCA 5M08A 4NCTC 2F2UA 1PKGA 3KULB 4O7TA 1V0BA 3RK9A 2R3MA 1J7UA 2C5VA 2VAGA 4G34A 4GL9A 1BYGA 4ZTNA 4R8QA 4CKIA 3TJCA 4FUXA 4U81A 3UP7A 1URWA 5EQYA 3QA0A 5EM6A 4WBBB 4CFUA 3MESA 4JNWA 2BKKA 3MB6A 2VUWA 3HVCA 3CE3A 2PU8A 3PRIA 2UUEA 4O6LA 4DF3A 3F2AA 1ERKA 2GMXA 2YIYA 3KXZA 4D0XA 4MNEB 5IUGA 4BDDA 4HCUA 4CQGA 4XHKB 2O2UA 2R3FA 2ZV9A 3A7JA 3UIBA 4YJNA 5KBQA 4QMXA 2F57A 2R7BA 3I79A 2JLDA 4MEDA 3U51A 2HIWA 3R04A 3BKBA 4NIFA 1BKXA 5ETIA 4EQUA 2B53A 1CKIA 2WIHA 3GCQA 4C8BA 3TKIA 2QQ7A 4FV7A 2XKEA 4UMUA 1LEWA 5IMEA 1KE7A 3KN5A 3ORIA 3HV5A 3MA3A 3EFKA 4M8TA 3SOAA 3L9NA 3PVGA 4HVGA 5JGAA 3ZZWA 4CFWA 1OKYA 1PHKA 1I09A 2X2MA 3CJFA 3R2BA 4N4SA 3R30A 4F08A 4MD8E 3NUYA 4HVSA 3CPBA 4JBPA 4QP1A 4FZ6A 4GMYA 5M57A 4FIHA 4H3BA 3AGLA 4FF8A 3S4QA 3C4WA 3BU5A 3ZDIA 3EOCA 3FE3A 2Y4IB 4NKAA 2GNIA 4ZLOA 1KSWA 2OGVA 2PHKA 3PVBA 3FMKA 3QQHA 3NUSA 2XZSA 1W7HA 2XJ1A 4KS8A 3HP5A 4AAAA 4BTFA 3SRVB 3NVKI 1YWRA 2DUVA 3F2RA 2WTDA 4HVDA 5IMXA 4E4NA 3OXTA 2BAKA 3KMUA 1GAGA 4BVUA 1XWSA 1CSNA 4U5JA 3TDVA 3LFEA 4RVLA 3W10A 2QOIA 3NRMA 4QPAA 4TW9A 4UYNA 1ZZ2A 2C47A 5CF4A 4BBFA 3R02A 2E9PA 3HRFA 2C6KA 2C68A 2PZIA 1YRPA 5J79A 4Y73A 3FMNA 4KKHA 1JKLA 3I7BA 4JI9A 4BHNA 1W82A 4C0TA 4ZTSA 5LWMA 3KEXA 1M2RA 3QCSA 2YA9A 4YP8A 3QD2B 5E8ZA 3QTXA 3R7EA 4FTJA 2C5XA 1UU3A 1P14A 3JXWA 3CGOA 3TI1A 3WE4A 4ASZA 5CEOA 3CY3A 3GU5A 1FPUA 4MXOA 3IQ7A 3CQEA 1IAHA 4E73A 1APME 1Q99A 1U4DA 2IW9A 3QQKA 2W5HA 3VAPA 2OW3A 4FGBA 1GIJA 4NSTA 3VBTA 2JIVA 5HNIX 5M4CA 3BHUA 4O0XA 2XIXA 4CGAA 4QD6A 4PP7A 5CF8A 4E26A 4NTSA 1R0PA 3QTRA 3W2RA 2IVUA 2PPQA 4AG8A 2UW3A 4RT7A 4I24A 4OR5A 3BEAA 4USEA 2PZYA 4AF3A 5IQHA 4UZDA 4XRJA 3GFEA 4DFNA 3G6GA 2HAKA 4B6LA 1M52A 2I7QA 3KF4A 4QYYA 3PYYA 4DFLA 2Z8CA 4BIBA 3FZTA 4DC2A 2IW6A 4K1BA 4BHZA 3IW4A 3IOPA 3OTVA 5AUTA 2IG7A 3FZOA 3QKLA 3PSCA 5D7VA 5FG8A 2GNFA 1O6LA 5ETFA 3FJQE 3Q5ZA 3L9LA 3S00A 2GS7A 4K2RA 3HGKA 4BKZA 2HXLA 2BZJA 4M67A 4F64A 4FSNA 4Y95A 4YU2A 3AOXA 3Q3BA 4ANNA 3QLGA 3A8XA 1Q4LA 4D4VA 2Z7RA 4I41A 5BVOA 4C4HA 3SOCA 5CX9A 3GU7A 4L67A 4W4YA 3RPOA 4YC3A 2GNGA 4KABA 2YCQA 2QLUA 2J4ZA 2Q83A 3PDTA 3AXWA 3V04A 2BRHA 3V8SA 1F5QA 3OROA 2ZJWA 4LFIA 4RX9A 4E20A 3VUDA 5AA9A 4O0WA 4JOAA 2YJSA 3ZFXA 4M0ZA 5CAVA 4RJ6A 3TCPA 1Y8GA 5HESA 3RK7A 3NDMA 5KMKA 3TZ7A 3BGPA 4ZY4A 3BGZA 2IZRA 3A2CA 4RX8A 3EFLA 4X3FC 3PJ1A 4PV0A 5AP7A 2PVMA 5I3OA 4QMSA 4ZEGA 2VV9A 3SGCA 5E8UA 3ZO4A 3MV5A 3L8SA 2C6TA 3Q53A 3D14A 3JR1A 3GOPA 3FLZA 3REPA 4JDJA 4R1VA 4F6UA 4YURA 5F95A 5ANOA 4NH1A 4FIEA 4YHFA 4YTHA 1DI8A 3BPRA 5J7BA 5FP6A 1FVRA 4I0RA 4IAYA 1T45A 4IEBA 4W9WA 4R77A 2DWBA 5A4LA 5BVFA 2PE0A 1ZXEA 3ZLYA 2QCSA 3UOHA 5M4UA 5FGKA 5CNOA 2ETKA 1Q8TA 3CBLA 1XH7A 3O8UA 4FX3A 1A48A 3KXNA 3KXMA 3PE1A 3COMA 5DN3A 3BU3A 4ANBA 4BDGA
chains in the Genus database with same CATH superfamily
2HWPA 2B9FA 4IMYA 3NYXA 3CKWA 4DEHA 1PXIA 5AUVA 3RK5A 4F0FA 3R21A 1BI8A 1NVRA 4CCUA 3P79A 1MRUA 3B2WA 3OXZA 3R8MA 3TEIA 3HUBA 4N70A 3CIKA 3BV2A 4U42A 4EKKA 4RVKA 2JAVA 5M53A 3UZRA 3ROCA 5HZNA 5GIOE 2B55A 1Q8ZA 3CKXA 3PP1A 5HIBA 2ZM1A 4F7LA 2F4JA 3GP0A 4CRLA 3W0OA 2VX3A 4MK0A 4RJ8A 1Y6BA 3R8LA 3D7TA 3DCVA 4O96A 2UZVA 4F6WA 3UQFA 2PUPA 3NNWA 4E3CA 2CLQA 4FVPA 4PDOA 2HW6A 1G8KA 3AGMA 3NCZA 4IAFA 2JEDA 4I3ZA 4C57A 2P0CA 4OTGA 4CMUA 3QKMA 4O7SA 2UVZA 2JD5A 1T46A 2YCSA 4E4XA 1PXLA 1Y91A 2OJJA 3DKCA 3NLBA 2UVXA 3FLWA 4JX3A 5E8TA 2UZUE 2VWXA 3DBCA 4FL1A 3R9HA 1OL5A 5AP0A 5I5ZA 4MBJA 3COIA 2YM8A 3BYSA 3DK7A 4DG2E 3EN6A 3MFSA 1J91A 2QOKA 2BDFA 4JQEA 4GFGA 4JRNA 3W0NA 1BI7A 2I0HA 3FLQA 4ZZNA 4IH8A 3PG1A 4EK4A 4G3CA 2W1GA 3ZMMA 1XBAA 1OUKA 2UW0A 3AG9A 4BF2A 2CHLA 4YMJA 1DM2A 4TTHB 3PLAE 3TDWA 1OIQA 3MJ1A 5FM3A 1OIYA 4W8EA 3ZU7A 4I0SA 4QTBA 2BDWA 3C9WA 3GOKA 2C3JA 3W33A 3K2LA 1FMKA 1UU7A 4BCHA 4ITHA 1S9IA 2YERA 4IVBA 4IVDA 4IZ7A 4PPBA 2QD9A 2ZM3A 2O65A 3MN3A 4M7IA 4MD9E 2E9OA 3ORXA 4WIHA 5AV1A 4EEVA 1JAMA 1ZMVA 5M06A 4CZUA 3MVHA 4PPCA 4O86A 3DT1A 3G51A 3UQGA 3C5IA 1PY5A 4RSSA 3LFSA 2BFXA 2NRYA 3PTGA 3F5GA 3ANRA 4R7IA 5D12A 2VWZA 4RVMA 5EM5A 4QQ5A 4IC8A 1Q62A 4D5KA 2H9VA 2I0VA 3GUBA 2Y0AA 3NUUA 1OUYA 1JOWB 2QU5A 4EQCA 3PVUA 4X2NA 1BL6A 1U59A 4J52A 5E92A 4ERKA 4O7WA 3NNXA 3PZEA 4IB3A 2GDOA 4N0SA 2G2HA 2RF9A 2OIDA 3W2OA 4YTCA 2ITTA 3LXNA 2VO3A 4OBQA 2W06A 3PFQA 1PXNA 3ZEPA 2BUJA 2X8IA 4MAOA 3ZFMA 3NS9A 4I94A 2R3GA 3QUDA 4QMVA 5J9YA 1P4FA 3CCNA 4LGDA 5EW9A 1ZWSA 3T9TA 3KB7A 4I21A 3D94A 5CQUA 5ITAA 1E1XA 3NAXA 3LXLA 2WFYA 5D1JA 3L8VA 4ACGA 3FLSA 4MXYA 3O2MA 5DG5A 5CEQA 3W2CA 4BKJA 5IU2A 4HYIA 2JGZA 5KMOA 4RPVA 4A06A 3UDBA 5LMBA 5C1QB 4CEGA 3EQDA 1GOLA 4YHJA 3IECA 4BBEA 5L2TA 5HLPA 5AV3A 3FV8A 5CF5A 4YZ9A 4HZSA 4G9RA 2J0MB 4H05A 2QURA 5C4KA 4GRBA 4J53A 5DR2A 2Y9QA 3KXXA 3ZUUA 3ATTA 4NWMA 2JDOA 3IONA 4WOVA 2OG8A 3COKA 2B54A 5JRSA 5A9UA 2C0TA 1B39A 3OD6X 3HKOA 3NWWA 4IC7A 4ACMA 2SRCA 2X2LA 4R5YA 1FMOE 3FKNA 1PYEA 1XH6A 4S34A 4AAYA 2WMVA 4O1PA 2GQSA 4TL0A 2X8EA 3LW0A 3U6IA 4DH7A 3OOMA 3MFUA 5C8KA 3EYHA 4IANA 1REJA 3PUPA 3O8PA 3HV6A 3OY3A 3VHKA 5FUTA 4G5JA 2QKRA 3ORPA 4G3GA 4O82A 3DOGA 4IQ6A 4UMTA 2Z02A 4EHGA 2CJMA 3NAYA 3R7IA 4GIIA 3RZFA 5LMKC 2FYSA 1H1SA 1P5EA 5BPYA 2GNHA 3V5WA 3F5PA 4CNHA 1VYWA 3DTWA 3RALA 4IM3A 4PL3A 3C0IA 2WQEA 1NY3A 4RJ3A 3TKHA 2R3JA 3MIAA 1M7QA 2BPMA 2C6EA 5IA5A 1W83A 4DCEA 3DLZA 2JDRA 5C8MA 3RGFA 4UMRA 1OBGA 2G2IA 3D5WA 3FWQA 4NKSA 2IVSA 4EOIA 4O38A 3OW4A 3ZUTA 2CKOA 3I7CA 4FSQA 4JR3A 3R9OA 4A4LA 4AUAA 3AKLA 5L2WA 2OZAA 2X81A 3F7WA 2OF4A 3VBVA 2WKMA 5CLPA 4JJRA 3PA4A 3TKUA 1WBPA 2ETMA 4QPMA 4ACDA 1PMUA 4M14A 1W8CA 4MWIA 3UNKA 3SRVA 2WU7A 2XNBA 4D9UA 4QMNA 4QQJA 4I6BA 4ZY5A 2W1FA 3I60A 1R1WA 3CGFA 2FSTX 4YZDA 4LRJA 4BDHA 3VQHA 4DT9A 3PRFA 3IS5A 3BYVA 3SHEA 1DI9A 3OZ6A 5C03A 4EKLA 5CALA 3LXKA 2B0QA 2GS6A 4JS8A 2JIIA 5ETAA 1M7NA 2B9HA 4A9RA 2YISA 2PVNA 4ASDA 2LGCA 3F82A 3RPRA 4BRXA 4PNIA 5BMMA 2FVDA 2ITQA 3FZSA 1VJYA 2W9ZB 3BEGA 2GNJA 4LM5A 4OTPA 4CKRA 4FOCA 5J9LA 4IADA 1OKWA 2GHGA 4R3CA 4V0GA 4O0YA 2VTHA 1S9JA 2PVYA 1OBDA 4DE4A 3RNIA 3PG3A 3K3IA 1WZYA 4BCIA 1LR4A 3EN4A 3PZHA 1WMKA 5HLWA 3ENMA 4QMYA 2B9JA 3KU2A 2VTJA 4GK2A 5GINE 1GNGA 2WTVA 3FSKA 3HRCA 1XH8A 2F49A 3UMWA 2KULA 3DKFA 3PXQA 3VC4A 3OEZA 1IRKA 5EHYA 3BHVA 3MWUA 2ONLC 2X4ZA 3O71A 4L46A 5EYDA 3ZYAA 4J71A 1LUFA 1KE9A 1OGUA 5G6VA 1H0VA 2RFNA 4V05A 3OCBA 5FDPA 2LAVA 4FGRA 4Z9LA 4BKYA 2EWAA 3ZBXA 4C4JA 1BLXA 4KA3A 3NIZA 3T9IA 3ZFYA 3FAAA 1V0PA 3P7BA 3EQGA 4K77A 2VTSA 2YM4A 4GG7A 2WOTA 4L01A 3QALE 3SAYA 4JG8A 4DGMA 4O4FA 3ELJA 3OC1A 4FKLA 4XOZA 4O4BB 5AUZA 3FYKX 3POOA 1UU8A 5CYIA 4AWIA 4ALVA 4D2WA 2OIBA 5IQGA 3G15A 4X6QC 4XP0A 4FKUA 4CRSA 3KK8A 3TZMA 4FG7A 3BLQA 4GT3A 4GYIA 4U3YA 5KMMA 4PDYA 1CM8A 3LAUA 4RX5A 4CFVA 3BELA 1KWPA 5EDRA 2VTOA 3FMMA 3W8QA 4DH3A 3TNWA 1GZOA 2ITZA 2X2KA 4JVGA 1ATPE 1R39A 4TT7A 3QD4A 4E93A 5IUHA 4LV7A 4FTOA 5CENA 1ZOEA 4XV3A 4ITJA 5TF9A 4V04A 2XK4A 3A99A 1F3MC 4F9YA 4L8MA 3BE2A 2BHEA 3K3JA 4HVHA 1OI9A 4O0TA 3PXRA 3MH2A 3U4WA 1PMVA 3DPKA 1OL7A 3IG7A 4BR3A 3A61A 4ZTHA 3E8NA 5FXSA 3UNJA 4EL9A 5B7VA 2FB8A 2BDJA 4HYHA 3R7VA 4QTAA 1JSTA 1PXKA 2QLQA 3FPQA 3TIZA 4RRVA 2X6EA 3HA6A 3VS0A 4YLJA 3DB6A 3MIYA 4ZAUA 3NIEA 3CXWA 4X7QA 1JPAA 4OBPA 2PVRA 4OTIA 4L3LA 3WARA 3D5VA 2QHMA 2W0JA 2C6MA 2V62A 2YLEA 3PXFA 4U0IA 2XK9A 3RHXA 3TM0A 5EOLA 3DAKA 4EK3A 2ETRA 4BTJA 4OTHA 4GVAA 4FT5A 4XUFA 2X7GA 3HLLA 4GG5A 3E5AA 2QO2A 3F3WA 2WQBA 5IA1A 2BZKB 3L8XA 5AV2A 2R3QA 4IIRA 5GZAA 2BVAA 2VWWA 3GXLA 3SX9A 1YVJA 3WILA 3P9JA 5HORA 4O7NA 2OXDA 2VU3A 4KRDA 5HE1A 3D7TB 4YR8A 2IVTA 1IAJA 5CWZA 2CDZA 2I0YA 3EQPA 4NUSA 5FEQA 4ZXTA 5IH4A 4FEUA 1PJKA 2JDVA 3RKBA 1Q8UA 5CI6A 5LCJA 4OBOA 3KVXA 3TTJA 4PMSA 2C0IA 5I9WA 4AXEA 5J7HA 1I44A 4DYMA 2F7EE 5DGZA 4RQVA 3FEGA 3EQRA 1JKSA 5EOBA 2WPAA 3SV0A 5HX8A 2XKFA 1TKIA 3QRJA 5AUUA 2XNEA 4QYEA 3QGWA 2C1AA 3LZBA 5T6KA 4E5WA 3ORTA 1IG1A 3MGYA 2WO6A 4AT3A 2YM7A 5A3XA 2C1BA 3PJ2A 3KVWA 3R2YA 4IX5A 4LGGA 5BQ0A 4WSYA 2B1PA 4DH5A 3HMNA 3O7LD 3TN8A 1M2QA 4GYGA 4TWPA 4XV2A 4BC6A 4QP9A 5J5SA 2YEXA 3Q52A 4MX9A 3TXOA 4Y5QA 2J50A 5EHLA 4GSBA 4O0SA 5I4NA 5JT2A 4A4OA 3W0MA 1VEBA 2ACXA 4JX7A 2BTRA 4AW5A 3BBTB 4IDTA 5CT0A 3RCJA 1H01A 2AC3A 4M12A 1JWHA 4EH9A 4FR4A 3WF5A 4I1ZA 4FSWA 3BGQA 4AW0A 2FGIA 3R7GA 3BLRA 1H00A 4IWQA 2YDJA 3WYXA 4AZEA 2JKQA 2PMOX 5F20A 4I5HA 4BDAA 4UMPA 2X9FA 3M2WA 5HLNA 4F78A 3DDPA 1QPDA 2YDIA 1GIHA 4FKOA 4FODA 3UIUA 2UW8A 4IX4A 5ICPA 2Z7LA 3LFBA 3QKKA 4O27B 4ZLZA 3MB7A 2C4GA 4E1ZA 5IEYA 2BIYA 4FUYA 2BR1A 3ULIA 1Z57A 4XRLA 4A4XA 4LOPA 2X0OA 4EOQA 3ZM9A 2BROA 2H96A 4RMZA 3UGCA 3UG1A 4UN0C 4GFMA 5HCZA 1Q8YA 4EH3A 4AXFA 3QFVA 5ANEA 4C37A 4TWOA 5JFWA 4NW5A 3RINA 4FMQA 4LV5A 1W0XC 2XNOA 2V55A 4G3EA 3ETAA 5HOAA 3ZCLA 5BVWA 2XEZA 3BRBA 3QQJA 4J99A 2ZV7A 4TYJA 2J90A 4B9DA 4EK6A 3UOJA 4C2WA 4IE9A 5EKOA 3QZIA 2VO0A 3IK3A 3KFAA 3PXYA 4HGEA 4KBKA 5CU2A 3NFFB 3QHRA 3PXZA 4A7CA 1TZDA 4DEBA 4XH6A 3FXWA 4XBRA 2Z60A 1LP4A 3E8EA 4I6FA 2WOUA 3Q4ZA 4AZSA 3R6XA 4FIJA 3QA8A 1XBCA 2CGUA 5HG9A 4YPDA 1P2AA 3UO5A 3NYNA 5IQDA 5HNBA 3LFCA 2OJGA 3D15A 1QPEA 4EORA 3SXFA 3RWPA 4CYIA 2ZB0A 2JKOA 2CCIA 1M17A 2C5OA 3DBDA 4B8MA 2VTRA 4E7WA 1IEPA 3D5XA 3PE2A 3RTPA 1YDSE 3NCGA 2VX1A 1ZOGA 3KMWA 2ITOA 3IOKA 3VW8A 2WMTA 4BDCA 3BYMA 3R8PA 3UTOA 4BIDA 4XLVA 2R4BA 4G2FA 3H9RA 4FNXA 4GUBA 3IGGA 5EH0A 3WZUA 2YJRA 3C51A 3VBWA 3NW7A 2B52A 3OWKA 3PPJA 4GK3A 4ALWA 4QYFA 4HW7A 2ITWA 4X2GA 4L44A 4ZSLA 3ZSHA 4ZJVA 2HYYA 5AADA 5IF1A 3EYGA 3ZDUA 3F6XA 2WGJA 2XALA 2JBOA 5LARA 4ZK5A 1H4LA 3P78A 4X2KA 5HU9A 4O4EA 3F9NA 1V1KA 4KB8A 4FSUA 3KRXA 3S1HA 1Z5MA 5HIEA 4U40A 4UEUA 4R3PA 3WZJA 5GJDA 3CR0A 4YHTA 4IZAA 1QPCA 3UPXA 5A4QA 3UQCA 2ITVA 2XMYA 4JBOA 4OGRA 4TWNA 2VWUA 4F09A 4I5MA 4C33A 2BZIB 4IDVA 1Y6AA 4AP7A 4AN3A 4UXLA 4YSMA 3FZ1A 4UV0A 5A14A 5IUIA 2CSNA 1KV2A 3QZGA 3GT8A 3LMHA 2XNNA 3DBEA 3EIDA 5D7AA 4ZS4A 3D5UA 2R0UA 2X8DA 2OZAB 3I6WA 2IZUA 3OFMA 2R3IA 1QPJA 4FV8A 4MYGA 1B6CB 1PF8A 4RJ7A 3NUXA 4IAKA 2P4IA 2XIYA 3QRKA 3P23A 4LG4A 2UZOA 4I0TA 4CMTA 2PVFA 3GB2A 3WF9A 5CTPA 4NEUA 3BZ3A 2X6DA 5EI8A 1SNUA 5I9YA 2R3KA 3UVQA 3ZRLA 3V8WA 3FHIA 4FT3A 4HCTA 5HVKA 4LL0A 2Q0NA 5DH3A 4FYNA 4TN6A 2W17A 2CNUA 5L2SA 5M09A 4C3PA 3EQIA 5IPJA 3S0OA 3W18A 5AFVA 3ZXTA 5JQ8A 2AUHA 2G9XA 3FQHA 4E6AA 4EH7A 4FTTA 3FY0A 4LV8A 3QQGA 5I9UA 4O6EA 3GQLA 4B4LA 3M1SA 2X0GA 2QONA 4H39A 3PPKA 2WU6A 4OW8A 4F4PA 4L45A 4V0GB 3FQEA 3RM7A 3W2QA 4FTKA 1YXSA 4Y8DA 4PX6A 5E8XA 3UP2A 4EUTA 3FKLA 4PDPA 3QUPA 4XBUA 3O5AA 4L43A 4TYIA 4BFMA 4DN5A 4EH6A 5J5TA 3DJ6A 5CS6A 3CQUA 4CD0A 4GVJA 4FIFA 4MQ2A 2O3PA 2O8YA 3QAME 5ANKA 4EOMA 2YIQA 5IA2A 4XX9A 2W5BA 5DIAA 4ACHA 3EQFA 5CAPA 3MVLA 4XV9A 2ZOQA 3WIKA 1H24A 4ENXA 3OHTA 3SVVA 2PE1A 3MY5A 4P5ZA 4FC0A 4XYFA 4AX8A 5KCVA 4QP3A 3PSDA 5DHJA 3F61A 4EYJA 2FUMA 2F2CB 1PRYA 4KIQA 1H1QA 4PNKA 5L6WL 4DHZA 1ZYDA 3VUHA 4DH1A 5F4NA 2EXMA 3SXRA 3Q9XA 1U5QA 4YLLA 5DNRA 4M84A 5IQAA 3F7ZA 5D41A 4U97A 4IX6A 3GBZA 5CXHA 5CZHA 3PVWA 4ANLA 1NW1A 4MH7A 1Y57A 3DB8A 3GU6A 3U9NA 3BLHA 1KE8A 1G5SA 2P2HA 3R22A 2XBJA 4G6NA 4TZRA 1YWVA 4CT1A 5DRBA 3D7ZA 3S2PA 2QOOA 3AD6A 1U54A 1W2DA 3MH0A 2OXXA 4PUZA 2J0LA 3A62A 4YC8A 2XAMA 4FTQA 4GH2A 3NUPA 4DEGA 5FEDA 5CAOA 1WBOA 2R3LA 3LIJA 4FKGA 5JFSA 3HEGA 4RBLA 1J7LA 3P0MA 2A19B 2RIOA 4O2PA 3NVMB 4XP3A 2WB8A 2QOBA 4O1OA 4WRSA 3HUCA 4ZIMA 5HIDA 3ALNA 2FH9A 1BX6A 2C3LA 3FQSA 4BCOA 3A60A 4YSJA 2HXQA 2O0UA 2J0IA 3O8TA 1PMNA 4IZYA 4J95A 4MCVA 4CV9A 5A46A 3L9MA 4RFZA 3K5VA 3PIYA 3BQCA 4DT8A 3LMIA 3I0QA 3NW6A 3VS3A 3ZC5A 1Q61A 3HX4A 3Q32A 4MUQA 4EH4A 3ZH8A 3BHHA 2VTTA 4EZ7A 3BCEA 1YQJA 3VS4A 5K5NA 1ZMWA 2ZYBA 4M68A 3SDJA 4O84A 2ERKA 3VBYA 3C13A 3OG7A 4XNEA 4AOIA 3C4FA 3IDBA 5EHOA 3PIZA 3PY1A 4CSVA 3QWKA 2ESMA 3OXIA 2BCJA 4KKGA 4L42A 5AMNA 4YTIA 4YGAA 3RHKA 4YJQA 4D1SA 4G16A 2WIPA 3KY2A 3VUIA 3EL7A 4TYGA 5AX3A 5D10A 5BVEA 3V01A 2F9GA 3C4ZA 3LE6A 4JAIA 4RIXA 3VJNA 1PXOA 3ID6C 5FWKK 4OAUC 4ORKA 2WXVA 4C36A 3ACKA 4AE6A 4BGQA 5HD4A 2YIWA 3ZOSA 2VD5A 3QX4A 5HU3A 4UMQA 4BDFA 5AAFA 1H26A 3A4OX 2IF8A 3DZQA 3IW6A 4HVIA 4EWQA 3C5UA 4RIOA 4YBJA 2YIRA 4KS7A 4CV8A 4TRLA 3ZRKA 1AGWA 5HO6A 3W16A 3VRYA 3DJ5A 4EH8A 1KV1A 2VZ6A 3CLYA 4FKTA 4I22A 3FXZA 2YZAA 3VNTA 1U5RA 3EQBA 4GCJA 1WBSA 3AC2A 4P4CA 5J9ZA 4O0VA 4YZNA 4D0WA 3DDQA 4HZRA 4KIOA 2P33A 3E63A 3R8UA 3ZBFA 1WVXA 3DK3A 3EKKA 4CTBA 2QO9A 2JIUA 3E8CA 4M97A 1O6YA 5E1EA 2F7XE 5ANDA 2W1EA 3GC0A 5KZIA 3GCSA 4L3PA 3D0EA 1AQ1A 1UVRA 2R2PA 4FG8A 4W4VA 4AA4A 3JY9A 5CAUA 4EOSA 2WMAA 1XMMA 1Q3DA 4TNDA 4ANMA 4DHJA 1XH5A 4HCVA 4WA9A 3HDNA 4WG5A 3G0FA 3L1SA 1A06A 1MP8A 5DBXA 4QMUA 5F94A 3CS9A 4DCAA 4YO6A 3D83A 4ANOA 3HMIA 4PL5A 5HO7A 5M55A 5DRDA 4NU1A 4BIEA 4JDIA 4U43A 3GFWA 2HY0A 4MF1A 5FP5A 2OJIA 2WEVA 3ZLXA 3BIZA 4ZZMA 3TNIA 5CEIA 4PP9A 2YIXA 3U6HA 2OJ9A 3DY7A 5DMZA 4AXDA 3GC9A 2VWVA 4C4IA 2YWVA 2I0EA 5BYYA 4GUEA 3EJ1A 3QRUA 3LXPA 3RAHA 5HBJA 4G3DA 3ZO3A 3OEFX 4GJ3A 3ROYA 1OPKA 5IQBA 3FI8A 4XG4A 4JAJA 3QTIA 5C27A 5I0BA 3EQCA 2RFSA 3CPCA 3GI3A 4C62A 4MXCA 3GGFA 4D4YA 3Q6WA 1SNXA 1IASA 4RQKA 1CMKE 4R5SA 4RJ4A 1JKTA 2Z2WA 3QCXA 3DS6A 3SQQA 2FA2A 4PWNA 5AIRA 4ZTRA 3E93A 3N51A 5EK7A 4U45A 4BCKA 1YI6A 5HICA 3ZUVA 3QF9A 2OLCA 5I9XA 3LJ0A 2DQ7X 4PRJA 5TT7A 2BMCA 4IXPA 2CMWA 4TWCA 5IH6A 4M69A 3V6RA 5AP3A 1GJOA 4RLKA 4G1WA 4F7SA 2ITYA 3FLNC 4NW6A 4E6QA 1E9HA 3MTFA 4G3FA 2YAKA 4JBQA 4ZTQA 3QHWA 2HELA 3ENHA 4IAZA 3EMGA 4JDHA 5EQEA 4OTDA 5GZ9A 4FSRA 3R28A 2P55A 4YLKA 5LVOA 2VTIA 5ANIA 2CGXA 4L68A 3LCDA 4XP2A 5HE0A 4OTQA 4FTRA 4YJTA 2XAOA 2PTKA 3PA3A 1IA8A 1RDQE 4F7JA 1L8TA 2R3RA 2CKEA 3O50A 4IM0A 4CXAA 3CY2A 3I6UA 4IBMA 5LVMA 4AFJA 3FMEA 4FZDB 4AN9A 2R7IA 5E7RA 4XG2A 3EFJA 4C3RA 4AA5A 4APPA 4D4RA 3M42A 4L7FA 3CC6A 3UVRA 3RJCA 5IQEA 2VWBA 4CLIA 5CU4A 3TTIA 2P3GX 4DGGA 3N4VA 2Y7JA 1YWNA 3Q60A 5EYCA 4U8ZA 3Q5IA 4F9WA 3MYGA 5FXRA 4Y5HA 3FMJA 3NEWA 4IFCA 3MBLA 4AW2A 3H4JA 5KX8A 5HX6A 5CSVA 4NM0A 1G8JA 4O7RA 3MJ2A 4MXXA 1R78A 3MY0A 2ZV2A 4YJSA 5L6OA 4BCGA 2EXEA 2GQRA 4BN1A 4FT9A 4F9AA 3TUCA 4XCUA 1GY3A 3HV7A 5HG7A 2W05A 5KZ0A 2JDSA 4BDBA 2JFMA 2IO6A 4RZWA 5LMAA 4H58A 1VLRA 4AGWA 4JDKA 3NNVA 3QQUA 4YNEA 4DFXE 4IHPA 1BMKA 5JFVA 1OMWA 3OCGA 2WTKB 2RKUA 3KC3A 4FVQA 5HD7A 3TV7A 4HPUE 1ZAOA 5LWNA 5L2IA 2H34A 4DTAA 2XKCA 1VR2A 3QUEA 4GEOA 4MBIA 3FDNA 3U8WA 5EW3A 1ZYSA 2GHMA 3FMHA 1XJDA 2JC6A 2PSQA 4BB4A 2QG5A 1ZZLA 3LMGA 4IVCA 2XK8A 5JN2A 1ZOHA 3WZEA 4JL9A 4NZWB 1OL1A 2RG6A 3LCTA 4ZTMA 3P5JC 4BICA 5J1WA 1IA9A 1TQMA 1BUHA 1PXPA 2PVLA 5LCKA 5HO8A 3EKNA 5AUWA 1V0OA 4E4MA 3GCVA 3LOKA 4FNWA 4UZHA 3EN7A 4I93A 2W1IA 1WCCA 2BRNA 2UW4A 1MQ4A 3QQLA 4BGHA 4CQEA 4BL1A 4KIKB 3OCSA 3JYAA 3KKVA 3GEQA 2WD1A 4UWCA 4D5HA 3NW5A 5FBNC 3VO3A 3KA0A 3FC1X 2Y6OA 1UWHA 4IJPA 4O4DA 4WHZA 3H0ZA 3O0GA 3ZO2A 3DXQA 3VJOA 1OITA 3I4BA 3ZS5A 4D2SA 1JVPP 4AXAA 5LVPA 1PMEA 3HMPA 4P7EA 4C38A 4F63A 1ZMUA 5CZIA 4EJ7A 2CPKE 4IWDA 1ZY4A 4FV1A 4YZMA 4F0IA 3WYYA 3E3BX 5BVKA 4U9AA 4LUDA 4QO9A 4D1XA 1PXJA 5KBRA 2QR7A 4ANQA 4IACA 1R3CA 5CVGA 4KUJA 4KD1A 4KNBA 3QZHA 3IW7A 1TFFA 4JLCA 4ALUA 1CKJA 5DPVA 2W1ZA 3KXGA 3PJ3A 2P2IA 4FKIA 1H0WA 4AOJA 1PKDA 4FT0A 5BUEA 2R64A 2W1CA 3H10A 3ANQA 4X21A 3FUPA 3FPMA 5FTQA 5TE0A 2XB7A 3MH3A 2NPQA 3Q4CA 4CG8A 2PK9A 4W4WA 3DTCA 1OL6A 2ZFYA 5H9BA 3UO4A 3POZA 4FKPA 5IDPA 2W5AA 3ZONA 4O83A 2X7FA 5E1SA 5JQ5A 2OBJA 3DBFA 3WZDA 4JQ8A 5BYLA 1OZ1A 3EWHA 1MUOA 3E7OA 3A7FA 3VVHA 2VTMA 2GFCA 3DLSA 3PY0A 1U54B 3R63A 5L4QA 4KBAA 4XLIA 3VS6A 4JG6A 2YAAA 5ACBC 4CFXA 5BYZA 2CGWA 5FEEA 2FO0A 4G5PA 2X0QA 3I5ZA 4FL2A 4KBCA 4X0MA 3SLSA 5HBHA 3ULZA 5GHVA 3UG2A 3KN6A 4D9TA 3OMVA 4LRKA 3Q6UA 2WMBA 4PMMA 3EH9A 4RIWA 4I6QA 3O17A 2I40A 4WNPA 4QMZA 5HG5A 4PMPA 3MVMA 4QMMA 2YDKA 4BDEA 3CP9A 3SC1A 2QODA 3ZSIA 1ZYJA 3VUTA 5AP6A 4DAWA 4FTLA 4L00A 4X2FA 4JRVA 4A9UA 2BFYA 4WO5A 3KCFA 3KRJA 3SXSA 5CVFA 4R78A 3LQ5A 4IAAA 3JVRA 3UNZA 3L9PA 2IZSA 4BY9E 4ZS0A 4ASEA 2YLFA 4FVRA 3P86A 5EDPA 5DVRA 4RFYA 1OECA 1QL6A 4A9YA 2GPHA 4RZVA 5BUIA 5BVDA 2VO6A 4R6VA 4ITIA 3IDPA 1YDRE 2WTJA 4C4FA 4O0RA 2CN8A 1ZARA 4EHVA 1URCA 5T68A 4WG3A 5J95A 3BI6A 4E6CA 1ST0A 2OH4A 3R8ZA 5AAEA 4WT6A 2RL5A 3TIYA 4H1JA 5HEZA 4AN2A 4QMQA 2CLXA 2ZDUA 4RIXB 3VS2A 3NNUA 4BCNA 1A9UA 2GU8A 2VTAA 4KSQA 3ORLA 1SVEA 4KIPA 2XM9A 2WMUA 4Y46A 4U79A 5D9HA 4QP8A 4CYJA 4QNYA 4FRFA 4PTEA 2C6DA 4USDA 3RWQA 2YZLA 1OIRA 4K18A 3R83A 3A7HA 2VO7A 5JFXA 5L8LA 2G01A 3LHJA 3UODA 3BHTA 4PTGA 4H36A 2UZLA 5CQWA 4RJ5A 2C3KA 3THBA 1HCKA 4EC9A 2XIRA 2C0OA 2X9EA 3K5UA 4F99A 5DLSA 1UNLA 2WMQA 3C4XA 4MBLA 3R9NA 4C4EA 3I0OA 2DS1A 4OTRA 4UWBA 3UPZA 3A7GA 4C7TA 5IDNA 1WBVA 4AFEA 4BDKA 5M44A 2PMNX 4RWJA 3UOLA 3VW6A 3C4CA 5IA0A 2BIKB 2X1NA 3H30A 4U7ZA 1OIUA 4G6LA 5CXZA