4DFYA

Crystal structure of r194a mutant of camp-dependent protein kinase with unphosphorylated activation loop
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
337
structure length
310
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFATPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Structural basis for the regulation of protein kinase a by activation loop phosphorylation.
pubmed doi rcsb
source organism Mus musculus
total genus 94
structure length 310
sequence length 337
chains with identical sequence E
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfyA02
5AV3A 2QOLA 2UZOA 5CZHA 4C0TA 1XBBA 4KS7A 4WD5A 5DI1A 3GC9A 3CQUA 3QLGA 4ZS0A 5L6PA 2ZM4A 4JX7A 4WIHA 1IASA 2WOTA 4YR8A 2WQEA 5AR4A 2C6EA 3DJ6A 4FGBA 3GC7A 2BAJA 3MWUA 4GUBA 5F9EA 3ZM9A 1SVHA 4S32A 4JBVA 4HYSA 4J8NA 3MY0A 4CG9A 2Y7JA 5AWMA 4K9YA 5EK7A 4A4LA 5CF5A 3HLLA 4R6VA 2FSMX 3L9NA 4W4WA 4IH8A 3EWHA 3WZDA 2EU9A 3ZLXA 3BU3A 4AT4A 3TL8A 5TF9A 4AACA 3E8NA 4NCTC 4RFZA 3KXXA 3QCSA 4OTPA 4ANNA 4BBMA 5KKRC 3PXQA 4FEWA 3F7WA 3SW4A 5J1VA 5AAFA 3D2IA 2OH0E 2WMAA 5M4UA 4XV3A 4MTAA 3CGOA 4XG2A 4CFXA 2XNEA 3Q4CA 2J0MB 3KULA 3ITZA 1LUFA 1UNGA 4P90A 3CKXA 4HVIA 4MEDA 3OY1A 4ERWA 4PPAA 4AU8A 3IKAA 1IRKA 3QZHA 4F0IA 3IW7A 4BTMA 2WHBA 3CPBA 5J7HA 3R9OA 4FTCA 2B4SB 4KS8A 4YHTA 3V5QA 4EWHA 2J0LA 3QL8A 3V6RA 5IEVA 3ZRKA 4BCQA 4OAUC 3UMWA 5D11A 3IPHA 1DI8A 1FVRA 3EN9A 1F3MC 3BHUA 2O2UA 4OTQA 2HOGA 4WKQA 3WILA 4QTCA 2YIWA 2PHKA 4L6QA 3QALE 4RSSA 4DG2E 5JFSA 4DGLC 1APME 4X21A 2OSCA 4Z3VA 3RAHA 3MFUA 4C2VA 5BYZA 3O7LD 1BI7A 2X39A 3SOAA 5E8VA 5IQGA 2C1BA 4EHGA 2X4FA 2XB7A 2XK9A 3BYUA 3BZ3A 5I3RA 2YZLA 4JBOA 4M7IA 2BZHB 5AADA 4FVRA 3UGCA 4UXQA 5KZ0A 4NCTA 3O23A 2XRUA 4FV4A 2IG7A 4GYGA 3A99A 2VWVA 4XG8A 3VBYA 1LPUA 1MQBA 2JKMA 5AR5A 4I5PA 4QP4A 3UYTA 5C8NA 4JQEA 2WELA 4B9DA 4H3PA 4CQGA 4F70A 1FPUA 5HNGA 3FXWA 4TN6A 4HGSA 4QP8A 3QQFA 5EYKA 3VRYA 2J5EA 1KE7A 2GS6A 2W5BA 1PMNA 3FZSA 5JQ8A 1PHKA 4UX9A 4UWBA 5A9UA 4X6QC 2ITUA 1UNHA 3PIZA 4HGTA 2UZUE 2VTAA 4MCVA 1M52A 1NA7A 1OKVA 3KXHA 4GRBA 4Y83A 2WU7A 5BMMA 3WF9A 3RWPA 3MIYA 4OUCA 3TDWA 2QONA 2UZNA 4WRGA 4IX5A 4MXAA 4AOJA 5HBJA 4I20A 2YM6A 3HMIA 4AA4A 2H6DA 3KEXA 4DG0E 3G5DA 2Z7RA 3NNUA 4YJUA 4YJVA 3Q04A 4E4MA 5JH6A 2ZB0A 3LFDA 3O7LB 3D83A 4EH8A 2C3IB 4NH1A 5CT7A 4ITJA 4RX9A 3ORXA 2J0KA 4IVCA 4DFZE 3D5WA 4G3GA 2YCRA 4WOVA 3WYYA 3MBLA 3PY1A 5JKGA 4F9YA 4USEA 2PVNA 2C47A 2WKMA 3FWQA 4UYAA 3EFKA 3UODA 3ZLSA 4EH6A 4XS2A 4FSNA 3GU4A 2BZJA 2C30A 4FTRA 4JVGA 3Q3BA 2REIA 2W4JA 2F49A 3QKMA 3UVRA 2YHVA 2OGVA 2C6OA 4H3BA 3LFCA 4IW0A 5BUJA 4IM2A 4QP3A 5LXMA 1URWA 3RZBA 4U7ZA 3LXNA 5EQYA 2FVDA 2ITVA 4LOPA 5BUIA 4PDOA 4HYUA 2HZ0A 4F09A 2C6LA 4JIAA 4QMXA 3EQDA 3QUPA 4BN1A 4BR3A 4FSUA 4NUSA 4OTRA 5JFVA 5LOHA 4U0IA 4UBAA 4CVAA 2CKEA 4TYJA 4R78A 2JDTA 3AT4A 3MA6A 3OC1A 4KSQA 3BYVA 4FTQA 3KXGA 1S9IA 3C5UA 4GS6A 3FMMA 4NJDA 1YQJA 2JDSA 4AE6A 2GNLA 5CZIA 1VYWA 1KOBA 5CY3A 3NW6A 2QG5A 4FV7A 2VTHA 4F9AA 5ANGA 4MKCA 5L8LA 2C6MA 2OFUA 4EOQA 3MFSA 2FO0A 4E4LA 2I6LA 2OK1A 5CNOA 3AQVA 2VV9A 3N9XA 4GSBA 2ERZE 4IFCA 3LFEA 2IZTA 2XCHA 3I6UA 4PRJA 4XRJA 2O8YA 4YTHA 3ZFMA 3ZTXA 3LQ8A 4L44A 4ZOGA 3E8CA 5B7VA 3KK9A 2VRXA 5AUVA 4D2TA 3MY1A 3A7IA 3S0OA 1UWHA 3TZ7A 5KMOA 2I0HA 4FV5A 5KX8A 1J7IA 2Z60A 5D41A 3NUSA 5CANA 4Y85A 3FL5A 4BGQA 4FSZA 4FOBA 4IAYA 2R3GA 4XG3A 3TUBA 3BBWA 3N4TA 3Q96A 3W8QA 5HNBA 4CKRA 3GCVA 3JYAA 4C4FA 2WTDA 4KNBA 5AIKA 3ET7A 5FBOA 3FPMA 1J7UA 2ITTA 1HCKA 1YOJA 4FTIA 4TL0A 3VS2A 4DT9A 1O9UA 5EM6A 5KO1A 2NNWB 4ITIA 1Z9XA 5HTIA 3NAXA 3COIA 3NDMA 2GNIA 3FJQE 4NYEA 4I6FA 2C1AA 2NRUA 3EJ1A 5LCKA 1ZYSA 2AC3A 3IDPA 3UOLA 2RFSA 4R7IA 1OL1A 1WMKA 4E20A 1JLUE 3LAUA 1Q8TA 2FA2A 2G2HA 3D14A 5AA8A 4HCVA 4BDBA 2QD9A 4DCEA 2VX1A 3ZMMA 4IBMA 3C5IA 4YZCA 3C0GA 2HZ4A 4IFGA 4KIKB 1YHSA 3SD0A 2RFEA 2ZB1A 3EQPA 4J1RA 4ARKA 3BE9A 4DE4A 4EYMA 4C58A 2CGWA 5AP6A 4F1MA 2H8HA 4TZRA 4J71A 1FINA 2JFLA 3C9WA 3DS6A 1NVSA 5HD7A 3SRVA 3KN6A 5F95A 5L6WL 4UMUA 2DYLA 4MXZA 5DRBA 4QMNA 3KF4A 4BRXA 4QYGA 3DAKA 3IECA 3PIYA 4V0GA 3UQGA 2J51A 2VWUA 3NW7A 4UEUA 4DH8A 4TYHA 2Z7SA 3OEFX 1BMKA 3CSVA 1GIHA 1XKKA 4L01A 3A7JA 4QPSA 4U3YA 1BUHA 4IAKA 5FEEA 4MNEB 4XNEA 5K4IA 2ETRA 2V7AA 2YM5A 3ORMA 5M53A 3GNIB 4FSQA 3VUMA 3CR0A 4FKLA 3F5UA 3H4JA 3HMMA 5GHVA 3AD4A 5H3QA 4YNOA 4YO4A 4R7HA 5IA4A 3E8DA 3L9MA 3BGZA 4E6DA 1I44A 1K3AA 2BDWA 4OW8A 4XP3A 4BDIA 3GU7A 5JRSA 5CEMA 3QQUA 1T46A 4BZDA 2WTKB 4F7SA 1W84A 4NIFA 4W4VA 2YZAA 3RGFA 3UG2A 3B8QA 4IE9A 1PMUA 4CRLA 5EQPA 3LVPA 4YGAA 1ZYDA 3KB7A 3I60A 3OXIA 4XEYA 3NYXA 3IQ7A 2W96B 2WMRA 3VNTA 4I1ZA 3H9FA 2W5AA 3FLSA 4QQ5A 2OXDA 5IUIA 3V5LA 2WMUA 3WF6A 2E9PA 3EQGA 3KFAA 3PY3A 4BF2A 2GQRA 2ETMA 1YW2A 4I22A 4FG9A 4IWOA 5CQWA 5ANEA 5T68A 5JT2A 4KKHA 4I93A 4APPA 5J9LA 2EVAA 2WU6A 3U9CA 4EHEA 4BKJA 2OICA 3C1XA 4RVMA 5HX8A 3FMEA 1STCE 3MW1A 3O8TA 4LV5A 3V51A 4CT1A 4ZTRA 1K2PA 2O65A 2W4OA 3O0GA 5H8GA 4F6WA 4USDA 4E6AA 2ZV8A 3IG7A 4ZTMA 4X7QA 2XM9A 4M3QA 5FGKA 4IANA 4RWJA 4DFNA 5KUPA 3ZO1A 5FWKK 5L3AA 5EYMA 3E63A 2X2LA 3PPKA 2ITPA 4YPDA 3THBA 4DGMA 1R3CA 3L8PA 3KVWA 4BICA 2OJ9A 4H39A 1DM2A 5HO7A 4NU1A 4E6CA 4EI4A 3FZRA 5K9IA 1TKIA 3BELA 4JXFA 2W1IA 5AX3A 3F5XA 3RAIA 5I0BA 3RZFA 3QRJA 1U5QA 2SRCA 2CHLA 2EWAA 2VZ6A 3ORPA 5DA3A 4PUZA 3OHTA 4AZVA 5HHWA 1O6LA 5HBEA 2EXCX 3FHIA 1UA2A 3P7CA 4BZNA 3AMAA 2VO7A 2EXMA 4F64A 3EH9A 4J99A 2C0OA 4U6RA 5IISA 2J90A 3KK8A 1W98A 4BIBA 2FSOX 1JNKA 4KBAA 4UWCA 3CPCA 5EI8A 4C2WA 4E3CA 3WZJA 1YI3A 3S95A 3R71A 4O0TA 3CLYA 3NYNA 3P23A 3TKHA 2R3RA 1FGKA 3NUUA 3CD8A 2X8IA 3IGGA 5D7AA 5HLPA 2VWXA 2RGPA 3CD3A 3LJ1A 3COMA 1VJYA 1H00A 2X8DA 3T9IA 2C69A 2VGOA 3MB6A 4YBJA 5DT3A 2A4LA 2Z7QA 3VS5A 4CYIA 5CSPA 4FSTA 1Q62A 4XHKB 5HCXA 4DITA 1H1RA 4L68A 4WNMA 2VTLA 4YHJA 1P2AA 5EHLA 3VF8A 5J1WA 5CF8A 2QR8A 4S30A 5FTQA 1V0OA 2IW8A 1BL7A 3TKIA 4PNIA 4ZSLA 4Y5QA 3PWYA 2PZIA 3OCTA 1OIQA 1M7NA 2WMVA 4ITHA 4XMOA 3ZO2A 3QKLA 4O81A 3LFSA 5TT7A 4JQ8A 3TV7A 3WF5A 3GU8A 5DT0A 4D55A 4XP2A 4MNFA 3ACJA 2Z2WA 4NEUA 1WBVA 4QMSA 2JIIA 3F6XA 4G1WA 4EQCA 4TW9A 3MGYA 5KE0A 4FKSA 3QC4A 5HO8A 3BIZA 1ERKA 2R2PA 2W4KA 3RBWA 2BDFA 4DEGA 4HVGA 5J9YA 3LQ3A 3JVRA 3PSDA 5C26A 3RPOA 4ANSA 3AT2A 4D2PA 4QQJA 4X2GA 2XBJA 1PMEA 4TY1A 5A54A 5IQBA 3D5UA 3RP9A 4F6UA 1OL5A 3PXRA 5J9ZA 4FI1A 3UIXA 3FZOA 4BI0A 3NPCA 1ATPE 2BAQA 3I4BA 2WEIA 4L45A 2R3JA 3I81A 2EB3A 4M15A 4OT6A 5G1XA 2QI8A 2PVRA 2XKDA 3JXWA 2YCSA 3MTLA 4AE9A 5DOSA 4BI2A 3F3VA 3LJ2A 4PX6A 2XNOA 5A4EA 2QVSE 4PMSA 3LW0A 5DLSA 3ENMA 4EOLA 3FI8A 4IC7A 3VN9A 5HG7A 5C01A 4AP7A 5FDPA 5L2TA 4RX8A 5HBHA 5DG5A 5GZAA 5EI2A 4EZ3A 3Q4ZA 4IMYA 1ZZLA 1PJKA 4CTBA 4JAJA 4UALA 3ZHPC 2VX3A 3OROA 3LCDA 3HRFA 4I92A 4OTHA 5CYIA 5EM5A 3UPZA 2HCKA 3NZ0A 5M4IA 2B7AA 4ENYA 3OMVA 3E7OA 2Y0AA 5DMZA 4QPMA 2FH9A 4WSQA 4ERKA 5A6NA 2PUNA 4BZOA 5M57A 3R30A 3IDBA 3TEIA 4QMTA 1WBOA 4O0YA 4BCJA 2BZIB 3CY3A 3E5AA 4QMWA 4EK8A 2HXQA 2J2IB 3FLZA 3I5ZA 5AJQA 3TZ8A 4DFXE 4GU9A 4RIYB 3QWKA 4IVDA 3BYOA 4I0TA 3NMUF 1B39A 2JKOA 3PA5A 3SV0A 4ZXTA 4MF1A 3GU6A 4M68A 3WF7A 4DGOA 5J5TA 4WSYA 4BDHA 3VUGA 3RI1A 3PVGA 5AP2A 4N57A 3ZUTA 1XBAA 2B1PA 1OL2A 2BILB 4IWQA 4RWLA 3VBQA 2PWLA 3R01A 4NTSA 4M69B 4O1PA 3SGCA 4HGLA 4ZIMA 3VW6A 1UU9A 4O7TA 5BVOA 5E1EA 5IA5A 2O3PA 3QTXA 4DLJA 1YXVA 1Q3DA 3EHAA 4BCMA 3EFJA 3KCFA 5A46A 5IQAA 2X0GA 2Q0BA 3K3JA 4AGCA 3BHVA 3HDMA 4M12A 4O0UA 5GNKA 3SDJA 5FTGA 3R21A 3FKOA 5CU3A 3QCXA 4O7VA 2VWIA 3V5TA 4K1BA 3PSCA 3R9HA 3HA6A 3C13A 4B8LA 1QMZA 3EYHA 3OZ6A 5EYDA 3MVHA 3DK6A 3R7OA 1SNUA 4AA0A 4FUYA 3NVMB 2P2IA 4HNFA 4RBLA 4UB7A 1A06A 2DQ7X 4FV3A 3DKCA 5DFPA 2PL0A 1V0PA 4YC3A 4RT7A 4C4IA 3BYMA 4A7CA 3OTVA 4MYGA 5TR6A 3SQQA 1U46A 3P7AA 3FYJX 5LMKC 1OIUA 5BVKA 4I6QA 3R8VA 3W8LA 4NW5A 4XV1A 3ZCLA 2C0TA 3UNJA 5GIPE 3IDCA 4QQCA 1REKA 1TVOA 4YURA 3NW5A 3F82A 3UQFA 3SHEA 2WIPA 3C4ZA 3HKOA 4F9BA 3DOGA 4RVKA 2QOCA 3HGKA 1SZMA 3QHWA 4J53A 3RK9A 1CDKA 4KKGA 4D4SA 4G5PA 3I1AA 3OEZA 3PXYA 5EDQA 5E8UA 2BRBA 2C5OA 1MUOA 2UW3A 2HAKA 4QTBA 5AR3A 4FTAA 3JY0A 4YUQA 3ZZEA 5IH4A 3DFAA 4O84A 2YM4A 1E9HA 5I9XA 4FOCA 5F20A 3RKBA 4AFEA 2HIWA 2A27A 4WNKA 3WYXA 4FYNA 2H34A 2C6IA 3NR9A 3H3CA 5CAOA 2GS2A 2J9MA 3LFNA 4UZDA 5E8SA 5HIBA 3ULZA 2IW9A 4BCFA 2VTNA 4BDCA 4D9TA 4WG3A 4DGNA 4EZ7A 5I3OA 3Q52A 3ERKA 3PDTA 3P86A 4DTKA 2OFVA 4ZZOA 2VNWA 4ZLYA 3BPRA 1O6YA 2BALA 5DWRA 1EH4A 3FMDA 4FVPA 3L9LA 4UV0A 2GFCA 3E3BX 4EJNA 5LMKA 4RIOA 2ZAZA 3NCGA 4CV8A 2XKCA 4IM0A 2YCFA 4DF3A 4L52A 3QQHA 4WNPA 3OS3A 3O51A 1UVRA 1YDRE 3FLWA 4BYJA 4HW7A 1WVYA 3CIKA 1BL6A 2YM8A 3ZUVA 1Q4LA 3QLFA 5HVKA 4EC9A 5AP3A 2VUWA 4HZRA 3DA6A 1CSNA 4C4EA 3Q9YA 1Q8YA 4C8BA 5B2KA 4CCBA 4ACGA 4EOSA 4BWXA 4EH7A 1Q41A 2FUMA 4FTNA 4AOTA 2R3PA 4AZEA 5KBQA 4IB5A 5IEYA 3R28A 5AP5A 4ALVA 2R3NA 4IC8A 1B6CB 2P4IA 2QOHA 3K5VA 4IAIA 4ASZA 4EL9A 4ZMEA 4QMPA 2ITZA 4BKYA 3PE1A 4NM7A 4ALWA 5FD2A 4FG7A 3LLTA 4TKSA 5AP0A 4F7JA 1XJDA 4XRLA 4BVUA 4LL0A 4EOPA 1YWRA 3LCTA 4YJSA 4CT2A 2GQSA 5ETIA 3HAVA 2C5XA 1UV5A 2IWIA 2W1GA 1LEZA 2XK7A 1MRUA 2XYUA 2EXEA 1UNLA 4N4SA 3HV5A 4L42A 2OG8A 4EOMA 4YTCA 4CFUA 4K18A 1CMKE 5CALA 3I7BA 4YZMA 3OUKA 5FDXA 4EH9A 2E9OA 3OWJA 3F66A 1OB3A 3HMOA 4F1OA 4HYHA 3IW6A 2XK8A 3AC3A 2YIYA 1GZ8A 3EB0A 3G9LX 4MWHA 4UXLA 4AQCA 4CMOA 4LI5A 5AEPA 1RQQA 5GZ8A 5C8MA 4ZTQA 1P5EA 4JDHA 4NJ3A 2BFXA 3UMXA 5CAVA 5ITAA 3DAJA 3ZFYA 3TN8A 2FSLX 2GPHA 1H25A 4XOYA 1U59A 3W55A 4RIXB 4F6SA 1UU3A 3RJCA 2R3MA 2W06A 5A4LA 2W1EA 5E90A 3F69A 5E8WA 3E62A 1BI8A 4L8MA 3BRBA 4DLIA 4E5AX 4OBPA 5FTOA 1JKTA 2HW7A 4WBOA 4AUAA 4GT4A 3VS4A 4M0YA 3QZIA 3QTIA 3ROYA 4EH3A 3PXZA 3QRIA 3DV3A 2P2HA 3OT8A 3ZDUA 1R0PA 1UKHA 4NT4A 3TNQB 3HYHA 2IW6A 3N51A 4KKEA 4R3CA 2ZOQA 4BDKA 4D2SA 2B55A 3DZOA 3D5VA 4K2RA 5E8TA 5AR7A 4GJ3A 4G3EA 5H9BA 4DH7A 3TACA 4D4VA 3QTWA 3D15A 4P4CA 4BFMA 2VTIA 4AT3A 4W8EA 2CKPA 3U4UA 4ZS4A 1RDQE 3MFRA 1QPEA 2OF2A 3D7TA 3O17A 4IIRA 3Q53A 3E93A 5JZJA 5FEDA 3ZC6A 1I09A 2BDJA 5AUYA 4DT8A 1OI9A 4IJ9A 5B0XA 5CX9A 4ACMA 3D9VA 3BHHA 3PFQA 3TNIA 4XV2A 2JDRA 4YSMA 4BBFA 1GZOA 4OLIA 3FQSA 4BY9E 1IG1A 3BEGA 3ELJA 4QMUA 2ACXA 2G15A 3P0MA 4L43A 5CXHA 1E1XA 1RE8A 3UP7A 2CN8A 4EOJA 1Q61A 3LFFA 3NUNA 3VS6A 3UYSA 1DS5A 3HX4A 4FYOA 3R73A 3U51A 5KMMA 4RJ5A 3QF9A 4DYMA 3EN7A 3WF8A 5LVMA 5IUHA 1W0XC 4WNOA 5CASA 5E8YA 4R8QA 3R1YA 4J8MA 3ZSIA 2O5KA 1XO2B 2W1CA 4O91A 4EK6A 4H58A 4ZLZA 3KGAA 5HVYA 3OOMA 3RHKA 2PK9A 3DDQA 2VX0A 2W1HA 3GCPA 3HVCA 5ETAA 3HAMA 1IA8A 4A9TA 1JKSA 4PTCA 4YZ9A 3RTPA 4F1TA 5M08A 4ASDA 4I4EA 2KTYA 3CTJA 4GK3A 4GU6A 3QXPA 4APCA 4LOQA 4GL9A 4XOZA 3SW7A 2C6TA 2F2UA 2CNQA 4Q5HA 2X9FA 3W2PA 2OIQA 2VTRA 3LLAA 5AAGA 4FT0A 2PUUA 3F88A 4I0SA 3HZTA 4FL1A 4CZUA 3QBNA 3W2SA 4O0XA 4DN5A 4FIHA 4O7RA 4IVAA 4RWKA 3DXNA 3QA8A 4AZWA 4EKLA 4IHPA 4L9IA 4CCUA 3QCYA 3G51A 3QYWA 2JGZA 2BVAA 2XKEA 5M44A 2CSNA 5D10A 2GNGA 2Y4IB 4FV9A 3D7ZA 5FLFA 3V6SA 4BIDA 4JBQA 1U54A 2RF9A 3I7CA 3QUEA 4FKOA 2QLQA 5CF4A 3P4KA 4QYYA 3FEGA 5FQDC 4YLLA 4KRCA 4EUUA 3PLAE 2WMTA 4P2KA 1WVWA 2ITNA 5HOAA 4BDJA 3WIKA 4II5A 2R3KA 1ZOHA 3S2PA 4MHAA 2PVLA 2WTWA 3A61A 4TWCA 2X6DA 3EIDA 5CENA 4DTAA 5EFQA 2RG6A 2VTTA 3FMNA 4FKIA 4IWPA 4D2VA 4FV0A 3H9RA 4D0XA 4FTOA 4AW2A 1XWSA 2C3LA 4EYJA 1JWHA 4U42A 2R0IA 3KA0A 4IADA 4JQ7A 2VTSA 4G3FA 3O8PA 4PDSA 3TNHA 4N6YA 4EK5A 3FI2A 4C62A 1M2PA 2W99B 5BNJA 4RG0A 1YOMA 5LJJA 5JZNA 2UVYA 1YXSA 5IF1A 5DR2A 4TXCA 3A60A 1Q8ZA 1R1WA 4GKHA 1CM8A 3RMFA 3LCKA 2J0IA 3FLYA 2XRWA 3CJGA 5AP4A 4ZTHA 5I9VA 2WQOA 2ZJWA 5HKMA 5E7RA 3I6WA 3O50A 4EQMA 3DLZA 3C7QA 3IONA 4JG7A 4XUFA 2WB8A 1H26A 2QLUA 3MY5A 4TWOA 4HVDA 2YDKA 5BX0A 4BBEA 3KMWA 3ORLA 4DFUA 2X6EA 2BHEA 2X7OA 3F5GA 4MH7A 2J7TA 5IDNA 2YAKA 5HCZA 2QU6A 4GFOA 5HEZA 4FGRA 2R3QA 2W17A 3CXWA 2VTMA 4GUEA 5EOBA 2FGIA 3AD5A 5FBNC 5HESA 1M7QA 4XJ0A 3KVXA 1OPLA 4GEOA 2X9EA 3Q60A 1M2RA 5HGIA 3FBVA 2PVMA 4FUXA 4K11A 1NY3A 1TQPA 4BTFA 3UZTA 5FP5A 3DKFA 4QNAA 3QX2A 1WFCA 4U80A 4YHFA 4WHZA 3BWFA 4EK4A 4P5ZA 5JRQA 3UP2A 3VF9A 2PSQA 4ASXA 3G0FA 5IZFA 3F3ZA 4AXAA 5HTBA 5LWMA 1YXUA 4IX6A 4U44A 4BCKA 4FNYA 4O1OA 2OO8X 3NGAA 4XG6A 1YHVA 2AC5A 3RPYA 2R4BA 1Y57A 3GQIA 1PKDA 3LFAA 5IEXA 5E9EA 3HECA 1W8CA 4DFYA 3R7GA 3A8WA 3I79A 4EWQA 4H1JA 2RFDA 5CLPA 5CXZA 3VHEA 1WBNA 3D94A 4FKVA 3TIZA 5KHWA 5IQEA 4PPCA 2YLEA 4FR4A 4JBPA 2OLCA 2XYNA 1H28A 1KE8A 5J7BA 1H24A 5CVGA 4BDFA 1ZYCA 4GKIA 3ULIA 2WTIA 5CEQA 3LFQA 3K2LA 4I6HA 3HEGA 2XMYA 2JAMA 5EKOA 3C0HA 3GU5A 1WBTA 3VWAA 3ZXZA 3Q9ZA 2ONLC 4ONAA 3QCQA 1YWNA 4A9YA 5IU2A 5DR6A 3LPBA 4I6BA 4WA9A 3ZRMA 2HWOA 3AC2A 3EQFA 1U4DA 4ZTNA 3AD6A 3FE3A 4G6NA 4JAIA 2OIBA 1H8FA 2VTPA 2OZOA 1ZARA 4NM5A 4G16A 5BQ0A 4FIFA 4DHFA 2XK4A 3QHRA 1FMKA 4JL9A 3ROCA 1GY3A 4ID7A 1LP4A 5FM2A 2XH5A 4R77A 2W1ZA 3CEKA 3G33A 4KABA 2JDVA 2FYSA 2ZM1A 3AGMA 5AA9A 4FNWA 1XH4A 4O6LA 2OH4A 3F7ZA 2CGVA 3FC2A 3LOKA 3DK3A 2C4GA 4J98A 3EQBA 4C34A 2QR7A 3GB2A 2XNBA 2F7ZE 4A07A 1A9UA 4IJPA 4U8ZA 5J79A 2GNJA 3Q5ZA 3MB7A 4X3FC 3UNKA 5LVNA 5HG8A 1A48A 3DKOA 3ZEPA 2PMLX 5FG8A 3S4QA 2ETKA 1PXOA 3ZM4A 1P4FA 4BCNA 2ONLA 4M0ZA 3OW3A 1YXXA 4Y95A 5HZNA 5LWNA 3R2YA 3BV3A 2GHMA 3R1SA 2F7EE 4HYIA 3QAME 3JUHA 4MXYA 2R64A 3EOCA 4LRMA 4RVLA 4FSYA 1LR4A 3R04A 5A4QA 3SA0A 4D2WA 3AC4A 4D0WA 4LUDA 4C57A 3C51A 4EH2A 3MS9A 5A14A 3DJ5A 3PE2A 4YPSA 3GCSA 2X81A 4W4YA 4CRSA 4U79A 4GFMA 4TYEA 4WUAA 2RKUA 5GJGA 5KMIA 2OXYA 2F57A 3I0OA 4RJ6A 4PP7A 3QX4A 5J95A 5CU0A 3CP9A 2PTKA 4FZAB 4RVTA 3F3WA 3MJ1A 3VUHA 4IB1A 3KULB 4PL4A 5ANKA 5LVLA 4O0SA 4FKPA 4RC2A 3PYYA 4JOAA 4OT5A 5LVPA 3LCSA 3B2WA 4FKGA 4FK6A 3A7GA 3H0YA 3QTRA 4XP0A 3TI1A 2G9XA 2VWYA 3AOXA 2R7IA 1GZNA 2HZIA 2OXXA 5FEQA 2X4ZA 2C68A 4G5JA 3WZUA 4X3FA 4I41A 5KCVA 2BZKB 1IAHA 5FXRA 4D1ZA 3NEWA 4RJ4A 3QUDA 3NLBA 3GENA 2JDOA 4O6EA 4ANBA 4GMYA 4FA2A 5IUGA 1MP8A 3E3PA 1Y91A 1ND4A 1KV2A 4YLJA 1Y8YA 4FZDB 5E4HA 3JVSA 1VYZA 5T3QA 4BI1A 5CT0A 1REJA 2QOBA 4DBXA 3PXKA 3PJ1A 3ZEWA 1ZRZA 1ZXEA 3GGFA 4X2JA 3TNPC 2XCKA 5IQDA 1OKYA 4ZJJA 4ZZMA 2BROA 4D4RA 5ANJA 5KKRB 4CMUA 3KY2A 1HCLA 1DI9A 1WCCA 4AT5A 4B99A 3ZLYA 4TYIA 3ORNA 5M07A 1GZKA 2H96A 3LMGA 1YHWA 4CZYB 4S2ZA 2YFXA 2XJ2A 4G3DA 4I21A 4IZAA 3QRTA 5GJFA 2YJSA 2QKWB 5AUWA 3ZSHA 3OFMA 3A62A 3TKUA 2VTOA 3Q2JA 5C27A 2PE1A 5D12A 5EW8A 3P79A 5CEPA 2PZYA 3DKGA 4CFMA 5BPYA 5AR2A 2NP8A 3DXQA 3VQHA 4LGGA 4F7LA 4LGDA 5I9WA 5M4FA 4L67A 3LMHA 4I0RA 5DGZA 3JY9A 1Q24A 2C5VA 3WZKA 2CPKE 1FMOE 3VS0A 5IPJA 3FZPA 1BLXA 3CKWA 3VQUA 4EORA 1NT2A 4FV2A 3DBEA 5KBRA 1QPJA 5DHJA 3QD2B 4I24A 4M13A 5D9HA 4E26A 4KAOA 2WNTA 4RIWA 4Z7HA 4U81A 3BHTA 4AW5A 5L4QA 1S9JA 4HOKA 4N6ZA 3IW4A 4F4PA 5CI6A 5E8ZA 2ZM3A 3FI3A 4JLCA 5DN3A 5I9UA 4PMTA 4XLVA 3TWJA 3RM7A 4RRVA 3FMKA 5AIRA 1NVRA 1ZYLA 4QP9A 2BHHA 4JDKA 5AP1A 4C3FA 4FKUA 3F9NA 4DCAA 4QMZA 2QU5A 3Q2MA 5L8KA 4CKIA 2G01A 1OVEA 2HYYA 5CI7A 4ACHA 3HV3A 4R3PA 3OWLA 4V01A 4H05A 1KE6A 1BX6A 2GTMA 3GOPA 3HUBA 3MVMA 3PA3A 4HPTE 3U9NA 4DEEA 2PE0A 4YJOA 2YDJA 5DH3A 4CD0A 5BVNA 4OTIA 3GCUA 3VUKA 1AD5A 3SLSA 3LMIA 4GK2A 5TE0A 3CQWA 4DC2A 1OL6A 3PUPA 2PZPA 4GYIA 2CJMA 3BQRA 4JRVA 5HE3A 4K77A 3O96A 2YLFA 3LIJA 3R8MA 4GK4A 3ANRA 1YXTA 3MVLA 2Q0NA 3KRXA 4YLKA 3TCPA 4EKKA 3DCVA 3A2CA 4YP8A 3PJCA 3RPSA 3QRUA 4ZY5A 2WTVA 3P9JA 4LL5A 3RPVA 4JIKA 4K6ZA 3SOCA 1IA9A 3A8XA 2XKFA 4HGEA 4NSTA 2PZRA 2YM7A 3DBFA 3EMGA 4FF8A 2J5FA 3W2CA 4YJQA 4C38A 3MH0A 3BU6A 3OP5A 3K3IA 1VR2A 3DB8A 3BU5A 1IEPA 4GH2A 4X2KA 2GNHA 1ZMVA 4MD8E 3OF0A 2OWBA 3IOPA 2QC6A 3V5JA 4C4HA 4ZK5A 2O64A 2A0CX 4U45A 5EM8A 2VTQA 5GZ9A 3W18A 4A06A 5AUTA 4UYNA 4QPAA 4IDVA 4YZNA 1JVPP 4YJTA 4CLIA 3NSZA 4RGJA 3EKNA 1H1SA 4O0RA 3TUDA 2YIRA 4J97A 4UN0C 3QFVA 2CGUA 2G1TA 3DBDA 4RA5A 5CU2A 2Z8CA 4KRDA 3DTCA 3I5NA 2FB8A 5CEIA 2XEZA 3ORIA 2R3FA 4KIOA 4FTLA 4FX3A 4MXOA 3O2MA 4QOXA 4O7YA 2YACA 3KL8A 2R7BA 4BCGA 3PWDA 2PU8A 2A1AB 2JIVA 3FXZA 3H10A 3Q4TA 5CEOA 2JC6A 1ZZ2A 3OTUA 4K8AA 4BKZA 3HRBA 3PJ8A 4D5HA 4IACA 3QQLA 1OZ1A 2CLQA 2IPXA 5IQIA 3TM0A 4NKSA 4LQMA 3IW5A 3SXFA 1H08A 1OL7A 5J87A 2W0JA 3C4WA 4ZP5A 3QD4A 4M97A 3DFCB 4D4YA 2WGJA 2W9FB 3HP2A 3LQ5A 3OW4A 3OWPA 4KWPA 3FSFA 1TQMA 3HMNA 3M1SA 4FNXA 4O86A 2UZBA 4RLKA 4MD7E 1G8AA 3QGWA 3LJ0A 3KXZA 4HCUA 2J4ZA 4CSVA 3U87A 4XBRA 1M17A 5F4NA 2BIYA 3B8RA 3GXLA 2BRNA 3L1SA 4D2RA 4EK3A 4QMLA 3BWJA 5M51A 2E9NA 1SVEA 3KKVA 2CKQA 5LARA 3SRVB 3A7HA 2GS7A 2X2MA 1OPKA 3FXXA 3KQ7A 1H0WA 5DIAA 3W16A 5KHXA 1JOWB 4AN9A 4KBKA 3MH3A 4QYHA 4V0GB 2Y4PA 2JIUA 4Y5HA 3LE6A 1VEBA 2J0JA 4KD1A 2B9HA 2V0DA 5AP7A 3UO6A 2XF0A 3BLHA 3R63A 5ETCA 3ORKA 2JBOA 4TYHB 3NUAA 2JLDA 2PE2A 4O7LA 4BC6A 3H9OA 1Z5MA 5HCYA 4TWNA 4LMUA 3IOKA 3QTZA 3GBZA 1OUKA 5E8XA 4YZDA 1GNGA 4DBNA 3UOJA 4UMTA 3TIYA 3N4UA 3VRZA 3FZ1A 1JSVA 1UWJA 2WQNA 3B2TA 3ATTA 3D0EA 3R22A 2LAVA 3QRKA 3AMBA 2PVHA 4OR5A 1X8BA 3UIUA 2CKOA 1ZY4A 4ORKA 2WMXA 3OD6X 4O82A 3BHYA 4KB8A 3UPXA 2UW9A 2ITOA 3L8XA 3DZQA 3T9TA 3VS1A 4NIFB 5TO8A 5BMSA 5HX6A 1W7HA 2WEVA 4PMPA 3V5WA 2PZ5A 4F08A 3QD0A 3PG1A 2JKQA 3TXOA 3EKKA 4AX8A 1U5RA 4RA4A 4HVSA 4BDDA 3QKKA 2CMWA 2ZVAA 3CJFA 3GUBA 3ZUUA 5CU4A 4CZTA 3FDNA 5E92A 2JD5A 1QPDA 3CS9A 3G9NA 5ANOA 3VBVA 2ZV2A 1FGIA 3G2FA 4FZFB 2ZMCA 4NL0A 5K0XA 2I0EA 3O8UA 4FTUA 3ZOSA 2ITYA 2AYPA 3GI3A 3DTWA 3L8VA 3W2OA 3KF7A 3UVPA 2V7OA 4GFGA 5CSWA 2B9FA 3E88A 1L8TA 4BYIA 2PVKA 2YIQA 1OBGA 3GFWA 3VJOA 3BGQA 4YZBA 4XX9A 1W82A 3R7IA 5BVDA 3TZMA 3EZVA 4ZJIA 4LM5A 4MBIA 5BYLA 2CCHA 1XQZA 2GDOA 3MV5A 1UU8A 2AUHA 4AW0A 4FV6A 2W9ZB 3CBLA 1CTPE 3POZA 4IVBA 3KU2A 1JKKA 3ACKA 4IZ5A 4S31A 3FKLA 4WBBB 4Z7GA 4C3PA 3ZS5A 2I0VA 4FK3A 4AAAA 4KUJA 5H2UA 2IZRA 3LHJA 5DT4A 1G8SA 3GT8A 1KE9A 3ZU7A 3UE4A 1JPAA 3R9NA 3OXZA 3MA3A 3TT0A 5HI2A 3KCKA 4RLLA 1H4LA 5JGDA 3WOWA 3IGOA 2PUIA 1R0EA 2BTSA 3UO4A 3L9PA 3QU0A 2F2CB 5F1ZA 4C35A 2BMCA 5D1JA 2YDIA 3ZYAA 4DAWA 1T45A 4ZSJA 2PYWA 1GIIA 5EDPA 2OBJA 4TPTA 1ZMUA 2BTRA 3OT3A 3OUNB 4N0SA 1PMVA 3VS7A 5JQ5A 3PP1A 3GP0A 4UMQA 4YO6A 3NWWA 3R6XA 1OPJA 4W8DA 4UWYA 5LMAA 4FKQA 1Y6AA 3FI4A 3GCQA 3MYGA 4WG4A 1VZOA 4PDPA 4D1SA 3OCBA 2YISA 4EHZA 3FUPA 3T8OA 4IZ7A 4PMMA 4QP1A 3NCZA 3EN5A 2XBAA 2F4JA 1WVXA 2E2BA 2UW6A 3FQEA 2HELA 2X2KA 2OJJA 2QHNA 4GT5A 3G6GA 5C03A 5C4KA 3VBXA 3PJ2A 3MTFA 3NUYA 4HZSA 3F3UA 3VUTA 5BVFA 3VHKA 3AC5A 5JMSA 3AXWA 3QTSA 2VAGA 2WFYA 4O38A 3KMUA 2CN5A 1P14A 4EOOA 4O7NA 3F2RA 3DBQA 1PXMA 2CDZA 2Y8OA 4G3CA 4GCJA 4IX4A 4PL3A 4AG8A 2VU3A 1ZYJA 3O71A 2XK3A 3OG7A 3ZZWA 4AN2A 3OBJA 4O0WA 3FY0A 2QO7A 3UG1A 2GTNA 3Q6UA 2I0YA 4BDAA 2UUEA 1J7LA 2WTKC 1KWPA 2IVUA 4YJRA 4BCHA 1H07A 5EKNA 4KIKA 2W5HA 3HV6A 3UVQA 4A9SA 3ANQA 4BIEA 3DAEA 3LFBA 3OWKA 4NWMA 5AR8A 4EONA 5HD4A 2R3LA 2VNYA 4C59A 2PPQA 3SG9A 5JK3A 4C4JA 5J5SA 5CSVA 4RC3A 1Z57A 4YTFA 1M14A 3PG3A 3G6HA 3PZEA 1J1BA 3LZBA 1YDSE 3FC1X 2IO6A 4PDYA 4QTEA 2GHGA 3EN4A 4DEIA 2GMXA 3ALOA 3S1HA 5FRIA 4A4OA 3ZFXA 4JNWA 3SAYA 4E1ZA 4CNHA 4RJ8A 3PVBA 3M11A 4F99A 1KUTA 3ORTA 1HOWA 3MH1A 5CSHA 2QOOA 3R9DA 4MNEA 4ALUA 3ZDIA 4PTGA 5E91A 3UBDA 2CGXA 3WIGA 4A9RA 2QOKA 3FL4A 4DTBA 1R39A 2YM3A 5IA1A 1SYKA 3M42A 3GVUA 3QA0A 2IVVA 1PY5A 1H1PA 1YVJA 4IQ6A 3V01A 1WZYA 2VD5A 3EQRA 2IVTA 3NRMA 4O2ZA 4I5HA 2VTJA 4HPUE 4RX7A 5IQHA 5JGBA 1XBCA 4QMMA 2UZVA 3V8TA 2EUFB 4QQTA 5A4TA 4QMVA 4H3QA 5AUXA 3VVHA 4QTDA 2XNMA 4RZWA 3ZBXA 2OJGA 2IN6A 3LCOA 5CAQA 4S33A 2NPQA 4KSPA 2YA9A 5I5ZA 2NRYA 4FMQA 4FEQA 1H01A 5M06A 4FZ7A 1JAMA 5JFWA 2ZDTA 1JSUA 5CS6A 3BI6A 4FODA 4V04A 4BWPA 4MXXA 3OOGA 3R8ZA 3WE4A 2W7XA 1JQHA 3KREA 1SM2A 4RZVA 2YAAA 4DFLA 2YJRA 3QZGA 4EOIA 2BKKA 2XNGA 2R3HA 2E9VA 2XM8A 3ZC5A 1J91A 4CFFA 2UV2A 4WRSA 2DWBA 4FL2A 3RNYA 5CVFA 4B8MA 4DFBA 2XIZA 3C50A 5IQCA 5DRDA 4F9WA 4MQ2A 3S00A 1CKIA 3D5XA 4YMJA 1UU7A 5H8BA 3RINA 4ZAUA 1K9AA 5A4CA 2PY3A 3BYSA 3LM0A 4C02A 2OZAB 3C0IA 2YEXA 4J95A 2PVYA 3QXOA 4ZJVA 4AZTA 5CAPA 3TZ9A 3ATSA 1OIRA 3HL7A 4Q9ZA 4BTJA 4JI9A 3A4PA 5IH6A 4B7TA 3AMYA 2XVDA 1F5QA 4LFIA 3ODZX 2VWWA 5DNRA 2QOQA 4USFA 4M14A 3ZSGA 3CCNA 4ZLOA 1ZOGA 4FSMA 2ESMA 4O22A 2UZLA 3QC9A 4E5BA 2PVJA 4FTMA 4NZWB 2YN8A 5DEYA 5HLNA 4DEBA 2F7XE 4CKJA 4FT9A 3RAWA 4QNYA 5ICPA 3EFWA 3AC8A 5I4NA 2QOFA 1JKLA 1GJOA 1UKIA 1ZY5A 3UZPA 3WI6A 4IAZA 2R3IA 2PUPA 2W05A 2ZV7A 4LG4A 3CTQA 1PF8A 2C0IA 2VWZA 2QO9A 5EQEA 3EN6A 3FPQA 3POOA 4L46A 5BVWA 4ZY4A 4YSJA 3QGYA 2PMNX 2YIXA 3PLSA 4U9AA 4ZSGA 3F2NA 5AUZA 2XIXA 4R3RA 4ZSAA 5LVOA 4TNDA 3C4EA 4FKJA 4UZHA 2I1MA 3TDVA 2QCSA 2BCJA 3C4XA 3TJDA 4RQVA 3S3IA 4LMNA 4A4XA 3VULA 3MFTA 3H0ZA 1QCFA 2F9GA 4PNKA 3RK7A 1H1WA 3V8WA 3KC3A 3NUPA 4Z16A 3PTGA 4DEHA 4YJNA 3TG1A 1BKXA 4F0GA 4MVFA 5L6OA 4GT3A 5DEWA 1Q8WA 4XYFA 3VIDA 2WZJA 3COKA 3G90X 4UY9A 2RL5A 3C4CA 3Q4UA 2P0CA 5B2MA 4CGAA 2WXVA 4WG5A 2RG5A 2RFNA 3NS9A 2Z7LA 3PRFA 4PPBA 4FV1A 5DE2A 5HE0A 4FIGA 3HMPA 2BRGA 1E1VA 2QG7A 4FTKA 4GW8A 1GOLA 3LXLA 4C36A 1G5SA 5A3XA 5KMNA 4HCTA 3GC0A 1Q3WA 3OCGA 3R8LA 4IWDA 3VBWA 5BYYA 1YWVA 4XV9A 1PKGA 4RWIA 4HJOA 2BPMA 5GINE 3UZRA 2CNUA 2UZWE 3LXKA 1IR3A 1ZLTA 2HY81 3E64A 2YWVA 4IEBA 2BKZA 2BAKA 4R1VA 4QRCA 4E6QA 1PRYA 1GAGA 2UZEA 5HU3A 4ZTSA 2OF4A 2CCIA 4GIHA 2E9UA 5J8IA 4BCIA 3A7FA 3RCDA 5HTCA 4PTEA 4S34A 3ID6C 5M4CA 3IK3A 4OTGA 1AGWA 3FLNC 3GC8A 3PZHA 5BVEA 4AFJA 4I4FA 2H9VA 2JKKA 4LYNA 5G6VA 1XH8A 4PY1A 4ZSEA 3CTHA 1J3HA 4FTJA 2UW4A 4G6LA 4Q9SA 1YRPA 4ZY6A 4CV9A 4FICA 2WTJA 4JR3A 1PXPA 4J52A 4QD6A 5DYJA 5AM7A 4O7ZA 1OITA 3VUDA 2B0QA 1XHAA 3PY0A 4PQNA 3N4VA 4L7SA 3OBGA 4XBUA 4EBVA 3V5PA 4IAFA 1NW1A 3SX9A 1FBNA 2V62A 5EDRA 4EH4A 3NAYA 3SXRA 1PXLA 1FVTA 4MBLA 1Y6BA 2WQMA 3PIXA 4RIYA 5FM3A 3HRCA 4GJ2A 5KNJA 1NVQA 2XS0A 3F2AA 5ETFA 2C3KA 1WBWA 2X1NA 4MXCA 4OGRA 4ANQA 3QQKA 5CQUA 3CQEA 4O83A 4WO5A 4BDGA 3DQXA 4TRLA 4F63A 4IAAA 3LKMA 1MQ4A 4M69A 4C37A 1XH7A 2B54A 3AGLA 3RPRA 4Y8DA 4KIQA 3KXNA 3BGPA 2UW5A 3TNWA 5HICA 5IA3A 4G2FA 3GQLA 3U6IA 1SMHA 2Y6MA 1YKRA 2XNNA 4EZ5A 4XG7A 4D58A 4DEAA 2FSTX 4QT1A 4PV0A 3RM6A 4RFMA 3DDPA 2UW8A 4YC6A 4BB4A 5ANIA 3U55A 3R9RA 3D7TB 4YJPA 3RAKA 2UZDA 2R0UA 4BGGA 3HNGA 1KOAA 1J1CA 3U8WA 1H27A 4FT3A 3HV4A 3G15A 1QL6A 2Q83A 5HU9A 1JBPE 3HUCA 3QTUA 4FL3A 3CE3A 5C1QB 1PW2A 5AX9A 2O0UA 3VJNA 5IQFA 4RJ7A 4AN3A 1YI4A 4E4NA 3UC4A 4GVAA 2I40A 4O2PA 2GQGA 4RFYA 5B2LA 1YOLA 3T3UA 5LMBA 4FV8A 3MDYA 4FKRA 2B9IA 3FKNA 5AAEA 4CMTA 3SVVA 5A6OA 5AUUA 5AV1A 4BDEA 5C8KA 3BKBA 1OGUA 5C9CA 3SC1A 3REPA 2C6DA 3R7UA 3EZRA 3UOHA 4IM3A 3COHA 3P5KA 5TKDA 1KE5A 3DNEA 3DU8A 3MH2A 2PULA 5HIEA 5CAUA 3E92A 3UIBA 3R1QA 4AF3A 5CF6A 2C3JA 2JAVA 1PXJA 4X2FA 4K0YA 4RPVA 5ANDA 5M56A 1H0VA 3PJ3A 2HENA 3K54A 3BBTB 5ACKA 4NFMA 3W32A 3JPVA 5DVRA 3RK5A 4E8AA 1OIYA 4IX3A 4CXAA 4CFWA 2ZYBA 4JG6A 4CG8A 3EQIA 4CQEA 5FUTA 5TOZA 4G31A 2ITXA 3R8UA 4AZFA 5HNIX 3BLQA 2XIYA 5HVJA 3RALA 2BR1A 4KA3A 1PXIA 3UC3A 3NNWA 4JR7A 4Z9LA 4U5JA 3KRRA 4M66A 3EFLA 3FY2A 3M2WA 4R5SA 4M84A 5EW9A 3VO3A 1YI6A 2G2FA 3NYOA 4GG7A 4QO9A 3ZONA 1IAJA 4QP2A 5EG3A 5K0KA 1U54B 5EYCA 4Y46A 3UNZA 4DG3E 1OKWA 2RSVA 2CLXA 3TUCA 4E93A 4QMQA 3SG8A 4F0FA 3P7BA 4TNBA 3CC6A 4AGDA 4JS8A 5DR9A 4NFNA 3W33A 4F9CA 4HNIA 5I9YA 4QYEA 2WMSA 4EOKA 3GFEA 4FNZA 2BRHA 2IZUA 2YCQA 4AA5A 3FV8A 4D1XA 5EM7A 4JJRA 4X3JA 4IB0A 3OCSA 3L8SA 1DAYA 3R7YA 3W10A 4EQUA 3NNVA 3VS3A 2OJFE 4NTTA 4MF0A 2XZSA 1OM1A 4FG8A 2Y9QA 3Q9XA 2C5NA 4NK9A 4CFVA 4OTFA 2G2IA 3QD3A 4TYGA 3PP0A 3NVKI 3T3VA 5CU6A 2GHLA 4XH6A 5JFXA 4L3JA 4H1MA 1XH6A 2WD1A 5HE2A 5AFVA 2QKRA 3OXTA 5AMNA 3MI9A 2V5QA 3PVWA 4LRKA 4TWPA 3R7EA 2DS1A 2OJIA 2Y6OA 2QODA 4OBQA 4FSWA 5IKWA 3PRIA 3R00A 4JX3A 4O7SA 4AWIA 1RJBA 4LRJA 4LGHA 5EOLA 3MPMA 3Q5IA 2BUJA 2IVSA 5EHOA 4BHZA 4EJ7A 3KN5A 4O27B 4CTCA 3JR1A 3FQHA 2A19B 4PL5A 4RMZA 3CY2A 2OI4X 5JN2A 4LUEA 3PPJA 5DBXA 3ETAA 2J6MA 5IMXA 3W2RA 4FVQA 4X0MA 4I3ZA 2WAJA 4MX9A 2B9JA 2UW7A 3ZO4A 2GSFA 1P4OA 3U6JA 4GIIA 3F61A 3Q32A 4GV1A 2YERA 2ZMDA 5ACBC 4BCPA 1SVGA 2GCDA 4RIXA 3BEAA 3DPKA 3RVGA 2QURA 1WAKA 1NXKA 3MPAA 1PXKA 1OECA 4FSRA 3R7VA 4L3LA 4NW6A 5EHYA 4F65A 4E7WA 5IMEA 1RW8A 2YABA 3DBCA 5L2QA 3HV7A 4OTWA 4XG4A 4XG9A 1WBPA 3TJCA 2OIDA 4U41A 4TT7A 3V04A 3R8PA 2HWPA 3KRJA 4FIEA 5BUEA 1YDTE 3TTIA 2V55A 3PSBA 2HW6A 4IZYA 4L00A 2OW3A 3MVJA 3RWQA 4W9WA 5M55A 3IW8A 3U4WA 3EQHA 2C5YA 4CFNA 5L2SA 3QYZA 4IXPA 4FE2A 4TTHB 5JGAA 3OVVA 3RNIA 5L2WA 4AZSA 4C3RA 4G6OA 1DAWA 3NX8A 2LGCA 2HY0A 2XJ1A 3GEQA 3V8SA 2W1DA 3WE8A 3PPZA 3MJ2A 4QYFA 2UVZA 4QMYA 4N70A 4H36A 2VWBA 4I94A 3TV4A 3UJGA 4FBXA 2ITQA 4GVJA 4JG8A 4G9CA 4I23A 4RC4A 4R5YA 4G9RA 2CNVA 5HORA 5FXQA 4Z55A 2X7FA 4DEDA 1M2QA 3LM5A 5CSXA 5CTPA 5IDPA 4FIIA 1OBDA 2Y4IC 3DB6A 5D7VA 3U6HA 3QQJA 3WARA 3EYGA 4X6RA 1OMWA 4O7WA 3E8EA 1V0BA 4R7BA 3FMLA 2VGPA 3PVUA 4BL1A 3UQCA 4D5KA 2UVXA 4G34A 5E1SA 3VW8A 4Y72A 3D4QA 4Y73A 5EW3A 5DPVA 3W2QA 5K3YA 4L7FA 3AT3A 5HG5A 3GOKA 2JBPA 4QMOA 3U54A 4O0VA 4NM3A 3NNXA 5HQ0A 3TV6A 5H8EA 3EQCA 3HDNA 3KRLA 2XUUA 3R1NA 2ITWA 4QP6A 4WT6A 3V3VA 3VUIA 3MPTA 3Q9WA 2QNJA 4JRNA 4AOIA 5JSMA 3FZTA 4AS0A 4CLJA 4NKAA 3DXPA 3BE2A 5KMLA 1H1QA 3P1AA 2XK6A 3R02A 4B6LA 2I7QA 2HXLA 1ZOEA 1Q5KA 2HK5A 4KINA 3ZO3A 3TTJA 1GIJA 4WUNA 4BHNA 5K5XA 4ZEGA 4FC0A 4L53A 5HLWA 4FZ6A 2NO3A 4YTIA 4B0GA 3MSSA 1OUYA 3FSKA 4QTAA 4QP7A 2XNPA 4J7BA 5IG1A 2YITA 4ASEA 3BCEA 5GIOE 3BX5A 3F5PA 5HO6A 4AGUA 2OZAA 3KMMA 4CEGA 4YBKA 2QQ7A 4KIPA 2X8EA 2X7GA 4O21A 4ANLA 1LEWA 4LV8A 4FEVA 4ACDA 3MESA 4V05A 2GNFA 2Z02A 3MIAA 4U40A 3D2KA 3SXSA 1V1KA 3E7VA 4O96A 4FEUA 4D9UA 5AV4A 3PXFA 4MAOA 2UW0A 4FTTA 2VO6A 4FT5A 4P5QA 2V22A 1Y8GA 4EBWA 3VC4A 2JEDA 4OBOA 5EH0A 4AGWA 1ZWSA 2OU7A 5IH5A 4YC8A 5HIDA 1Q99A 1O6KA 4EH5A 5K4JA 2JFMA 1CKPA 3DQWA 3IO7A 5AM6A 3BLRA 4C61A 2XP2A 3LXPA 5IA2A 3Q6WA 2W1FA 2YWPA 4DH3A 3CGFA 4C7TA 3H30A 3DT1A 4ANMA 5AV2A 2P3GX 3DK7A 2P55A 2WQBA 4ANOA 4X3FB 4E4XA 3VAPA 5CNNA 4PWNA 2IJMA 2WMWA 3NUXA 5CEKA 3QTQA 2XEYA 4EEVA 5CVHA 2B53A 1F0QA 1QPCA 3QZFA 3UIMA 4IB3A 1ZMWA 5GJDA 3P78A 4E73A 2XIRA 4RX5A 3FMHA 3MN3A 3P08A 4XLIA 3NYVA 2VO0A 4Q2AA 2PMIA 3AG9A 3A4OX 2DUVA 2UZTA 4FIJA 3BV2A 4JT3A 4M8TA 4D28A 1Q97A 4MQ1A 4RJ3A 5LQFA 4HVHA 3II5A 2C6KA 3F3TA 4BTKA 3EL8A 2WMBA 1G3NA 1AQ1A 5F94A 5EI6A 1W83A 4U3ZA 1XH9A 2XA4A 3IS5A 5KZIA 4DH5A 3ODYX 4K33A 4ZTLA 4XCUA 2JITA 4W4XA 2EB2A 3SKCA 4JDJA 4ENXA 4FKTA 4F7NA 1TQIA 3NIEA 4U97A 4BWKA 3E87A 5KMJA 1MRVA 2HZNA 3DLSA 3HP5A 3ZXTA 4R1YA 1FVVA 1B38A 2IZSA 2R3OA 4M67A 3ZBFA 1OKZA 2XIKA 3DGKA 5L2IA 3WBLA 3KRWA 2WO6A 3KXMA 2ERKA 3R0TA 4FKWA 1FOTA 4FT7A 4MD9E 4UMRA 2PMOX 3R2BA 2ZDUA 3ENHA 4L3PA 5FP6A 5L8JA 3OY3A 5I9ZA 3NIZA 5KMKA 1KV1A 4EC8A 2QO2A 4MBJA 2ZV9A 4E5WA 3DY7A 2R5TA 3QWJA 4GG5A 1SNXA 2J50A 2OKRA 4YNEA 4PP9A 5HG9A 2BIKB 5K5NA 2WTCA 1URCA 4LOOA 4RQKA 4P7EA 4MK0A 3ORZA 3UDBA 2KULA 1MRYA 3FYKX 3FLQA 4W9XA 1XR1A 5HE1A 3ZRLA 4CYJA 4DH1A 4ZZNA 1Q8UA 2RIOA 4RIWB 1CKJA 1PYXA 2QOIA 3K5UA 4ZMFA 4YU2A 3FAAA 5JEBA 4IDTA 3DJ7A 3ALNA 3ZLWA 3EL7A 5LCJA 3I0QA 2BRMA 4DA5A 5AV0A 2GU8A 3VBTA 4I5MA 4BCOA 5IA0A 4A9UA 4DINA 3PA4A 4X2NA 2WMQA 1FQ1B 2WIHA 3BQCA 4MWIA 4Q5EA 3RCJA 4I5CA 3HA8A 4G17A 4ACCA 2VN9A 2A2AA 3DNDA 2GFSA 2BFYA 4EUTA 1PYEA 1WBSA 4DGGA 2O63A 2B52A 2WPAA 2R9SA 3R83A 3UO5A 2VO3A 3UOKA 2P33A 5T6KA 4EHVA 1JSTA 5FXSA 2QHMA 1PXNA 3AC1A 3RHXA 3UTOA 2WOUA 3W1FA 3WZEA 5M09A 4PF4A 1KSWA 1BYGA 2XJ0A 1ZAOA 4NM0A 4U43A 4FEXA 1R78A 3JS2A 4C4GA 4BGHA 4KBCA 2PVFA 4AW1A 4C33A 4OAVB 5C4LA 4JDIA 3G0EA 1XH5A 4UMPA 3C4FA 3QQGA 3FHRA 4OTDA 3ZH8A 3FMJA 4J96A 5CWZA 4B4LA 1L3RE
chains in the Genus database with same CATH superfamily
5AV3A 2QOLA 2UZOA 5CZHA 4C0TA 1XBBA 4KS7A 4WD5A 5DI1A 3GC9A 3CQUA 3QLGA 4ZS0A 5L6PA 5LMBA 2ZM4A 4JX7A 4WIHA 1IASA 2WOTA 4YR8A 2WQEA 5AR4A 2C6EA 3DJ6A 4FGBA 5IQGA 3GC7A 2BAJA 3MWUA 4GUBA 5F9EA 3ZM9A 1SVHA 4S32A 4JBVA 4HYSA 4J8NA 3MY0A 4CG9A 2Y7JA 5AWMA 4K9YA 5EK7A 4A4LA 5CF5A 3HLLA 4R6VA 2FSMX 3L9NA 4W4WA 4IH8A 3EWHA 3WZDA 2EU9A 3ZLXA 3BU3A 4AT4A 3TL8A 5TF9A 4AACA 3E8NA 4NCTC 4RFZA 3KXXA 3QCSA 4OTPA 4ANNA 4BBMA 5KKRC 3PXQA 4FEWA 3F7WA 3SW4A 5J1VA 5AAFA 3PFYA 3D2IA 2OH0E 2WMAA 5M4UA 4XV3A 4MTAA 3CGOA 4XG2A 4CFXA 2XNEA 2XAMA 3Q4CA 2J0MB 3KULA 3ITZA 1LUFA 1UNGA 4P90A 3CKXA 4HVIA 4MEDA 3OY1A 4ERWA 4PPAA 4AU8A 3IKAA 1IRKA 3QZHA 4F0IA 3IW7A 4BTMA 2WHBA 3CPBA 5J7HA 3R9OA 4FTCA 2B4SB 4KS8A 4YHTA 3V5QA 4EWHA 2J0LA 3QL8A 3V6RA 5IEVA 3ZRKA 4BCQA 4OAUC 3UMWA 5D11A 3IPHA 1DI8A 1FVRA 3EN9A 1F3MC 3BHUA 2O2UA 4OTQA 2HOGA 4WKQA 3WILA 4QTCA 2YIWA 2PHKA 4L6QA 3QALE 4RSSA 4DG2E 5JFSA 4DGLC 1APME 4X21A 2OSCA 4Z3VA 3RAHA 3MFUA 4C2VA 5BYZA 3O7LD 1BI7A 2X39A 3SOAA 5E8VA 4I6LA 2C1BA 4EHGA 2X4FA 2XB7A 2XK9A 3BYUA 3BZ3A 5I3RA 2YZLA 4JBOA 4M7IA 2BZHB 5AADA 4FVRA 3UGCA 4UXQA 5KZ0A 4NCTA 3O23A 2XRUA 4FV4A 2IG7A 4GYGA 3A99A 2VWVA 4XG8A 3VBYA 1LPUA 1MQBA 2JKMA 5AR5A 4I5PA 4QP4A 3UYTA 5C8NA 4JQEA 2WELA 4B9DA 4H3PA 4CQGA 4F70A 1FPUA 5HNGA 3FXWA 4TN6A 4HGSA 4QP8A 3QQFA 5EYKA 3VRYA 2J5EA 1KE7A 2GS6A 2W5BA 1PMNA 3FZSA 5JQ8A 1PHKA 4UX9A 4UWBA 5A9UA 4X6QC 2ITUA 1UNHA 3PIZA 4HGTA 2UZUE 2VTAA 4MCVA 1M52A 1NA7A 1OKVA 3KXHA 4GRBA 4Y83A 2WU7A 5BMMA 3WF9A 3RWPA 3MIYA 4OUCA 3TDWA 2QONA 2UZNA 4WRGA 4IX5A 3UDSA 4MXAA 4AOJA 5HBJA 4I20A 2YM6A 3HMIA 4AA4A 2H6DA 3KEXA 4DG0E 3G5DA 2Z7RA 3NNUA 4YJUA 4YJVA 3Q04A 4E4MA 5JH6A 2ZB0A 3LFDA 3O7LB 3D83A 4EH8A 2C3IB 4NH1A 5CT7A 4ITJA 4RX9A 3ORXA 2J0KA 4IVCA 4DFZE 3D5WA 4G3GA 2YCRA 4WOVA 3WYYA 3MBLA 3PY1A 5JKGA 4F9YA 4USEA 2PVNA 2C47A 2WKMA 3FWQA 4UYAA 3EFKA 3UODA 3ZLSA 4EH6A 4XS2A 4FSNA 3GU4A 2BZJA 2C30A 4FTRA 4JVGA 3Q3BA 2REIA 2W4JA 2F49A 3QKMA 3UVRA 2YHVA 2OGVA 2C6OA 4H3BA 3LFCA 4IW0A 2XAOA 5BUJA 4IM2A 4QP3A 5LXMA 1URWA 3RZBA 4U7ZA 3LXNA 4MUQA 5EQYA 2FVDA 2ITVA 4LOPA 5BUIA 4PDOA 4HYUA 2HZ0A 4F09A 2C6LA 4JIAA 4QMXA 3EQDA 3QUPA 4BN1A 4BR3A 4FSUA 4NUSA 4OTRA 5JFVA 5LOHA 4U0IA 4UBAA 4CVAA 2CKEA 4TYJA 4R78A 2JDTA 3AT4A 3MA6A 3OC1A 4KSQA 3BYVA 4FTQA 3KXGA 1S9IA 3C5UA 4GS6A 3FMMA 4NJDA 1YQJA 2JDSA 4AE6A 2GNLA 5CZIA 4FJVA 1VYWA 1KOBA 5CY3A 3NW6A 2QG5A 4FV7A 2VTHA 4F9AA 5ANGA 4MKCA 5L8LA 2C6MA 2OFUA 4EOQA 1XMLA 3MFSA 2FO0A 4E4LA 2I6LA 2OK1A 5CNOA 3AQVA 2VV9A 3N9XA 4GSBA 2ERZE 4IFCA 3LFEA 2IZTA 2XCHA 3I6UA 4PRJA 4XRJA 2O8YA 4YTHA 3ZFMA 3ZTXA 3LQ8A 4L44A 4ZOGA 3E8CA 5B7VA 3KK9A 2VRXA 5AUVA 4D2TA 3MY1A 3A7IA 3S0OA 1UWHA 3TZ7A 5KMOA 2I0HA 4FV5A 5KX8A 1J7IA 2Z60A 5D41A 3NUSA 5CANA 4Y85A 3FL5A 4BGQA 4FSZA 4FOBA 4IAYA 2R3GA 4XG3A 3TUBA 3BBWA 3N4TA 3Q96A 3W8QA 5HNBA 4CKRA 3GCVA 3JYAA 4C4FA 2WTDA 4KNBA 5AIKA 3ET7A 5FBOA 3FPMA 1J7UA 2ITTA 1HCKA 1YOJA 4FTIA 4TL0A 3VS2A 4DT9A 1O9UA 5EM6A 5KO1A 2NNWB 4ITIA 1Z9XA 5HTIA 3NAXA 3COIA 3NDMA 2GNIA 2X0QA 3FJQE 4NYEA 4I6FA 2C1AA 2NRUA 3EJ1A 5LCKA 1ZYSA 2AC3A 3IDPA 3UOLA 2RFSA 4R7IA 1OL1A 1WMKA 4E20A 1JLUE 3LAUA 1Q8TA 2FA2A 2G2HA 3D14A 5AA8A 4HCVA 4BDBA 2QD9A 4DCEA 2VX1A 3ZMMA 4IBMA 3C5IA 4YZCA 3C0GA 2HZ4A 4IFGA 4KIKB 1YHSA 3SD0A 2RFEA 2ZB1A 3EQPA 4J1RA 4ARKA 3BE9A 4DE4A 4EYMA 4C58A 2CGWA 5AP6A 4F1MA 2H8HA 4TZRA 4J71A 1FINA 2JFLA 3C9WA 3DS6A 1NVSA 5HD7A 3SRVA 3KN6A 5F95A 5L6WL 4UMUA 2DYLA 4MXZA 5DRBA 4QMNA 3KF4A 4BRXA 4QYGA 3DAKA 3IECA 3PIYA 4V0GA 3UQGA 1ST0A 2J51A 2VWUA 3NW7A 4UEUA 4DH8A 4TYHA 2Z7SA 3OEFX 1BMKA 3CSVA 1GIHA 1XKKA 4L01A 3A7JA 4QPSA 4U3YA 1BUHA 4IAKA 5FEEA 4MNEB 4XNEA 5K4IA 2ETRA 2V7AA 2YM5A 3ORMA 5M53A 3GNIB 4FSQA 3VUMA 3CR0A 4FKLA 3F5UA 3H4JA 3HMMA 5GHVA 3AD4A 5H3QA 4YNOA 4YO4A 4R7HA 5IA4A 3E8DA 3L9MA 3BGZA 4E6DA 1I44A 1K3AA 2BDWA 4OW8A 4XP3A 4BDIA 3GU7A 5JRSA 5CEMA 3QQUA 1T46A 4BZDA 2WTKB 4F7SA 1W84A 4NIFA 4W4VA 2YZAA 3RGFA 3UG2A 3B8QA 4IE9A 1PMUA 4CRLA 5EQPA 3LVPA 4YGAA 1ZYDA 3KB7A 3I60A 3OXIA 4XEYA 3NYXA 3IQ7A 2W96B 2WMRA 3VNTA 4I1ZA 3H9FA 2W5AA 3FLSA 4QQ5A 2OXDA 5IUIA 3V5LA 2WMUA 3WF6A 2E9PA 3EQGA 3KFAA 3PY3A 4BF2A 2GQRA 3UDZA 2ETMA 1YW2A 4I22A 4FG9A 4IWOA 5CQWA 5ANEA 5T68A 5JT2A 4KKHA 4I93A 4APPA 5J9LA 2EVAA 2WU6A 3U9CA 4EHEA 4BKJA 2OICA 3C1XA 4RVMA 5HX8A 3FMEA 1STCE 3MW1A 3O8TA 4LV5A 3V51A 4CT1A 4ZTRA 1K2PA 2O65A 2W4OA 3O0GA 5H8GA 4F6WA 2AQXA 4USDA 4E6AA 2ZV8A 3IG7A 4ZTMA 4X7QA 2XM9A 4M3QA 5FGKA 4IANA 4RWJA 4DFNA 5KUPA 3ZO1A 5FWKK 5L3AA 5EYMA 3E63A 2X2LA 3PPKA 2ITPA 4YPDA 3THBA 4DGMA 1R3CA 3L8PA 3KVWA 4BICA 2OJ9A 4H39A 1DM2A 5HO7A 4NU1A 4E6CA 4EI4A 3FZRA 5K9IA 1TKIA 3BELA 4JXFA 2W1IA 5AX3A 3F5XA 3RAIA 5I0BA 3RZFA 3QRJA 1U5QA 2SRCA 2CHLA 2EWAA 2VZ6A 3ORPA 5DA3A 4PUZA 3OHTA 4AZVA 5HHWA 1O6LA 5HBEA 2EXCX 3FHIA 1UA2A 3P7CA 4BZNA 3AMAA 2VO7A 2EXMA 4F64A 3EH9A 4J99A 2C0OA 4U6RA 5IISA 2J90A 3KK8A 1W98A 4BIBA 2FSOX 1JNKA 4KBAA 4UWCA 3CPCA 5EI8A 4C2WA 4E3CA 3WZJA 1YI3A 3S95A 3R71A 4O0TA 3CLYA 3KIOC 3NYNA 3P23A 3TKHA 2R3RA 1FGKA 3NUUA 3CD8A 2X8IA 3IGGA 5D7AA 5HLPA 2VWXA 2RGPA 3CD3A 3LJ1A 3COMA 1VJYA 1H00A 2X8DA 3T9IA 2C69A 2VGOA 3MB6A 4YBJA 5DT3A 2A4LA 2Z7QA 3VS5A 4CYIA 5CSPA 3AKLA 4FSTA 1Q62A 4XHKB 5HCXA 4DITA 1H1RA 4L68A 4WNMA 2VTLA 4YHJA 1P2AA 5EHLA 3VF8A 5J1WA 5CF8A 2QR8A 4S30A 5FTQA 1V0OA 2IW8A 1BL7A 3TKIA 1ST4A 4PNIA 4ZSLA 3BL7A 4Y5QA 3PWYA 2PZIA 3OCTA 1OIQA 1M7NA 2WMVA 4ITHA 4XMOA 3ZO2A 3QKLA 4O81A 3LFSA 5TT7A 4JQ8A 3TV7A 3WF5A 3GU8A 5DT0A 4D55A 4XP2A 4MNFA 3ACJA 2Z2WA 4NEUA 1WBVA 4QMSA 2JIIA 2X0OA 3F6XA 4G1WA 4EQCA 4TW9A 3MGYA 5KE0A 4FKSA 3QC4A 5HO8A 3BIZA 1ERKA 2R2PA 2W4KA 3RBWA 2BDFA 4DEGA 4HVGA 5J9YA 3LQ3A 3JVRA 3PSDA 5C26A 3RPOA 4ANSA 3AT2A 4D2PA 4QQJA 4X2GA 2XBJA 1PMEA 4TY1A 5A54A 5IQBA 3D5UA 3RP9A 4F6UA 1OL5A 3PXRA 5J9ZA 4FI1A 3UIXA 3FZOA 4BI0A 3NPCA 1ATPE 2BAQA 3I4BA 2WEIA 4L45A 2R3JA 3I81A 2EB3A 4M15A 4OT6A 5G1XA 2QI8A 2PVRA 2XKDA 3JXWA 2YCSA 3MTLA 4AE9A 5DOSA 4BI2A 3F3VA 3LJ2A 4PX6A 2XNOA 5A4EA 2QVSE 1TFFA 3NFFB 4PMSA 3LW0A 5DLSA 3ENMA 4EOLA 3FI8A 4IC7A 3VN9A 5HG7A 5C01A 4AP7A 5FDPA 5L2TA 4RX8A 5HBHA 5DG5A 5GZAA 5EI2A 4EZ3A 3Q4ZA 4IMYA 1ZZLA 1PJKA 4CTBA 4JAJA 4UALA 3ZHPC 2VX3A 3OROA 3LCDA 3HRFA 4I92A 4OTHA 5CYIA 5EM5A 3UPZA 2HCKA 3NZ0A 5M4IA 2B7AA 4ENYA 3OMVA 3E7OA 2Y0AA 5DMZA 4QPMA 2FH9A 4WSQA 4ERKA 5A6NA 3PUFC 2PUNA 4BZOA 5M57A 3R30A 3IDBA 3TEIA 4QMTA 1WBOA 4O0YA 4BCJA 2BZIB 3CY3A 3E5AA 4QMWA 4EK8A 2HXQA 2J2IB 3FLZA 3I5ZA 5AJQA 3TZ8A 4DFXE 4GU9A 4RIYB 3QWKA 4IVDA 3BYOA 4I0TA 4QDEA 3NMUF 1B39A 2JKOA 3PA5A 3SV0A 4ZXTA 4MF1A 3GU6A 4M68A 3WF7A 4DGOA 5J5TA 4WSYA 4BDHA 3VUGA 3RI1A 3PVGA 5AP2A 4N57A 4BJJB 3ZUTA 1XBAA 2B1PA 1OL2A 2BILB 4IWQA 4RWLA 3VBQA 2PWLA 3R01A 4NTSA 4M69B 4O1PA 3SGCA 4HGLA 4ZIMA 3VW6A 1UU9A 4O7TA 5BVOA 5E1EA 5IA5A 2O3PA 3QTXA 4DLJA 1YXVA 1Q3DA 3EHAA 4BCMA 3EFJA 3KCFA 5A46A 5IQAA 2X0GA 2Q0BA 3K3JA 4AGCA 3BHVA 3HDMA 4M12A 4O0UA 5GNKA 3SDJA 5FTGA 3R21A 3FKOA 5CU3A 3QCXA 4O7VA 2VWIA 3V5TA 4K1BA 3PSCA 3R9HA 3HA6A 3C13A 4B8LA 1QMZA 3EYHA 3OZ6A 5EYDA 3MVHA 3DK6A 3R7OA 1SNUA 4AA0A 4FUYA 3NVMB 2P2IA 4HNFA 4RBLA 4UB7A 1A06A 2DQ7X 4FV3A 3DKCA 5DFPA 2PL0A 1V0PA 4YC3A 4RT7A 4C4IA 3BYMA 4A7CA 3OTVA 4MYGA 5TR6A 3SQQA 1U46A 3P7AA 3FYJX 5LMKC 1OIUA 5BVKA 4I6QA 3R8VA 3W8LA 4NW5A 4XV1A 3ZCLA 3O5AA 2C0TA 3UNJA 5GIPE 3IDCA 4QQCA 1REKA 1TVOA 4YURA 3NW5A 3F82A 3UQFA 3SHEA 2WIPA 3C4ZA 3HKOA 4F9BA 3DOGA 4RVKA 2QOCA 3HGKA 1SZMA 3QHWA 4J53A 3RK9A 1CDKA 4KKGA 4D4SA 4G5PA 3I1AA 3OEZA 3PXYA 1TZDA 5E8UA 2BRBA 2C5OA 1MUOA 2UW3A 5EDQA 2HAKA 4QTBA 5AR3A 4FTAA 3JY0A 4YUQA 3ZZEA 5IH4A 3DFAA 4O84A 2YM4A 1E9HA 5I9XA 4FOCA 5F20A 3RKBA 4AFEA 2HIWA 2A27A 4WNKA 3WYXA 4FYNA 2H34A 2C6IA 3NR9A 3H3CA 5CAOA 2GS2A 2J9MA 3LFNA 4UZDA 5E8SA 5HIBA 3ULZA 2IW9A 4BCFA 2VTNA 4BDCA 4D9TA 4WG3A 4DGNA 4EZ7A 5I3OA 3Q52A 3ERKA 3PDTA 3P86A 4DTKA 2OFVA 4ZZOA 2VNWA 4ZLYA 3BPRA 1O6YA 2BALA 5DWRA 1EH4A 3FMDA 4FVPA 3L9LA 4UV0A 2GFCA 3E3BX 4EJNA 5LMKA 4RIOA 2ZAZA 3NCGA 4CV8A 2XKCA 4IM0A 2YCFA 4DF3A 4L52A 3QQHA 4WNPA 3OS3A 3O51A 1UVRA 1YDRE 3FLWA 4BYJA 4HW7A 1WVYA 3CIKA 1BL6A 2YM8A 3ZUVA 1Q4LA 3QLFA 5HVKA 4EC9A 5AP3A 2VUWA 4HZRA 3DA6A 1CSNA 4C4EA 3Q9YA 1Q8YA 4C8BA 5B2KA 4CCBA 4ACGA 4EOSA 4BWXA 4EH7A 1Q41A 2FUMA 4FTNA 4AOTA 2R3PA 4AZEA 5KBQA 4IB5A 5IEYA 3R28A 5AP5A 4ALVA 2R3NA 4IC8A 1B6CB 2P4IA 2QOHA 3K5VA 4IAIA 4ASZA 4EL9A 4ZMEA 2X0PA 2ITZA 4QMPA 4BKYA 3PE1A 4NM7A 4ALWA 5FD2A 4FG7A 3LLTA 4TKSA 5AP0A 4F7JA 1XJDA 4XRLA 4BVUA 4LL0A 4EOPA 1YWRA 3LCTA 4YJSA 4CT2A 2GQSA 5ETIA 3HAVA 2C5XA 1UV5A 2IWIA 2W1GA 1LEZA 2XK7A 1MRUA 2XYUA 2EXEA 1UNLA 4N4SA 3HV5A 4L42A 2ZFYA 2OG8A 4EOMA 4YTCA 4CFUA 4K18A 1CMKE 5CALA 3I7BA 4YZMA 3OUKA 5FDXA 4EH9A 2E9OA 3OWJA 3F66A 3W0SA 1OB3A 3HMOA 4F1OA 4HYHA 3IW6A 2XK8A 3AC3A 2YIYA 1GZ8A 3EB0A 3G9LX 4MWHA 4UXLA 4AQCA 4CMOA 4LI5A 5AEPA 1RQQA 5GZ8A 5C8MA 4ZTQA 1P5EA 4JDHA 4NJ3A 2BFXA 3UMXA 5CAVA 5ITAA 3DAJA 3ZFYA 3TN8A 2FSLX 2GPHA 1H25A 4XOYA 1U59A 3W55A 4RIXB 4F6SA 1UU3A 3RJCA 2R3MA 2W06A 5A4LA 2W1EA 5E90A 3F69A 5E8WA 3E62A 1BI8A 4L8MA 3BRBA 4FRFA 4DLIA 4E5AX 4OBPA 5FTOA 1JKTA 2HW7A 4WBOA 4AUAA 4GT4A 3VS4A 4M0YA 3QZIA 3QTIA 3ROYA 4EH3A 3PXZA 3QRIA 3DV3A 4O4DA 2P2HA 3OT8A 3ZDUA 1R0PA 1UKHA 4NT4A 3TNQB 3HYHA 2IW6A 3N51A 4KKEA 4R3CA 2ZOQA 4BDKA 4D2SA 2B55A 3DZOA 3D5VA 4K2RA 5E8TA 5AR7A 4GJ3A 4G3EA 5H9BA 4DH7A 3TACA 4D4VA 3QTWA 3D15A 4P4CA 4BFMA 2VTIA 4AT3A 4W8EA 2CKPA 3U4UA 4ZS4A 1RDQE 3MFRA 1QPEA 2OF2A 3D7TA 3O17A 4IIRA 3Q53A 3E93A 5JZJA 5FEDA 3ZC6A 1I09A 2BDJA 5AUYA 4DT8A 1OI9A 4IJ9A 5B0XA 5CX9A 4ACMA 3D9VA 3BHHA 3PFQA 3TNIA 4XV2A 2JDRA 4YSMA 4BBFA 1GZOA 4OLIA 3FQSA 4BY9E 1IG1A 3BEGA 3ELJA 4QMUA 2ACXA 2G15A 3P0MA 4L43A 5CXHA 1E1XA 1RE8A 3UP7A 2CN8A 4EOJA 1Q61A 3LFFA 4AXFA 3NUNA 3VS6A 3UYSA 1DS5A 3HX4A 4FYOA 3R73A 3U51A 5KMMA 2XALA 4RJ5A 3QF9A 4DYMA 3EN7A 3WF8A 5LVMA 5IUHA 1W0XC 4WNOA 5CASA 5E8YA 4R8QA 3R1YA 4J8MA 3ZSIA 3VONA 2O5KA 1XO2B 2W1CA 4O91A 4EK6A 4H58A 4ZLZA 3KGAA 5HVYA 3OOMA 3RHKA 2PK9A 3DDQA 2VX0A 2W1HA 3GCPA 3HVCA 5ETAA 3HAMA 1IA8A 4A9TA 1JKSA 4PTCA 4YZ9A 3RTPA 4F1TA 5M08A 4ASDA 4I4EA 2KTYA 3CTJA 4GK3A 4GU6A 3QXPA 4APCA 4LOQA 4GL9A 4XOZA 3SW7A 2C6TA 2F2UA 2CNQA 4Q5HA 2X9FA 3W2PA 2OIQA 2VTRA 3LLAA 5AAGA 4FT0A 2PUUA 3F88A 4I0SA 3HZTA 4FL1A 4CZUA 3QBNA 3W2SA 4O0XA 4DN5A 4FIHA 4O7RA 4IVAA 4RWKA 3DXNA 3QA8A 4AZWA 4EKLA 4IHPA 4L9IA 4CCUA 3QCYA 3G51A 3QYWA 2JGZA 2BVAA 2XKEA 5M44A 2CSNA 5D10A 2GNGA 2Y4IB 4FV9A 3D7ZA 5FLFA 3V6SA 4BIDA 4JBQA 1U54A 2RF9A 3I7CA 3QUEA 4FKOA 2QLQA 5CF4A 3P4KA 4QYYA 3FEGA 5FQDC 4YLLA 4KRCA 4EUUA 3PLAE 2WMTA 4P2KA 1WVWA 2ITNA 5HOAA 4BDJA 3WIKA 4II5A 2R3KA 1ZOHA 3S2PA 4MHAA 2PVLA 2WTWA 3A61A 4TWCA 2X6DA 3EIDA 5CENA 4DTAA 5EFQA 2RG6A 2VTTA 3FMNA 4FKIA 4IWPA 4D2VA 4FV0A 3H9RA 4D0XA 4FTOA 4AW2A 1XWSA 2C3LA 4EYJA 1JWHA 4U42A 2R0IA 3KA0A 4IADA 4JQ7A 2VTSA 4G3FA 3O8PA 4PDSA 3TNHA 4N6YA 4EK5A 3FI2A 4C62A 1M2PA 2W99B 5BNJA 4RG0A 1YOMA 5LJJA 5JZNA 2UVYA 1YXSA 5IF1A 5DR2A 4TXCA 3A60A 1Q8ZA 1R1WA 4GKHA 1CM8A 3RMFA 3LCKA 2J0IA 3FLYA 2XRWA 3CJGA 5AP4A 4ZTHA 5I9VA 2WQOA 2ZJWA 5HKMA 5E7RA 3I6WA 3O50A 4EQMA 3DLZA 3C7QA 3IONA 4JG7A 4XUFA 2WB8A 1H26A 2QLUA 3MY5A 4TWOA 4HVDA 2YDKA 5BX0A 4BBEA 3KMWA 3ORLA 4DFUA 2X6EA 2BHEA 2X7OA 3F5GA 4MH7A 2J7TA 5IDNA 2YAKA 5HCZA 2QU6A 4GFOA 5HEZA 4FGRA 2R3QA 2W17A 3CXWA 2VTMA 4GUEA 5EOBA 2FGIA 3AD5A 5FBNC 5HESA 1M7QA 4XJ0A 3KVXA 1OPLA 4GEOA 2X9EA 4DDGA 3Q60A 2AEGA 1M2RA 5HGIA 3FBVA 2PVMA 4FUXA 4K11A 1NY3A 1TQPA 4BTFA 3UZTA 5FP5A 3DKFA 4QNAA 3QX2A 1WFCA 4U80A 4YHFA 4WHZA 3BWFA 4EK4A 4P5ZA 5JRQA 3W0OA 3UP2A 3VF9A 2PSQA 4ASXA 3G0FA 5IZFA 3F3ZA 4AXAA 5HTBA 5LWMA 1YXUA 4IX6A 4U44A 4BCKA 4FNYA 4O1OA 2OO8X 3NGAA 4XG6A 1YHVA 2AC5A 3RPYA 2R4BA 1Y57A 3GQIA 1PKDA 3LFAA 5IEXA 5E9EA 3HECA 1W8CA 4DFYA 3R7GA 3A8WA 3I79A 4EWQA 4H1JA 2RFDA 5CLPA 5CXZA 3VHEA 1WBNA 3D94A 4FKVA 3TIZA 5KHWA 5IQEA 4PPCA 2YLEA 4FR4A 4JBPA 2OLCA 2XYNA 1H28A 1KE8A 5J7BA 1H24A 5CVGA 4BDFA 1ZYCA 4GKIA 3ULIA 2WTIA 5CEQA 3LFQA 3K2LA 4I6HA 3HEGA 1VLRA 2XMYA 2JAMA 5EKOA 3C0HA 3GU5A 1WBTA 3VWAA 3ZXZA 3Q9ZA 2ONLC 4ONAA 3QCQA 1YWNA 4A9YA 5IU2A 5DR6A 3LPBA 4I6BA 4WA9A 3ZRMA 2HWOA 3AC2A 3EQFA 1U4DA 4ZTNA 3AD6A 3FE3A 4G6NA 4JAIA 2OIBA 1H8FA 2VTPA 2OZOA 1ZARA 4NM5A 4G16A 5BQ0A 4FIFA 4DHFA 2XK4A 3QHRA 1FMKA 4JL9A 3ROCA 1GY3A 4ID7A 1LP4A 5FM2A 2XH5A 4R77A 2W1ZA 3CEKA 3G33A 4KABA 2JDVA 2FYSA 2ZM1A 3AGMA 5AA9A 4FNWA 5BV3A 1XH4A 4O6LA 2OH4A 3F7ZA 2CGVA 4JMQA 3FC2A 3LOKA 3DK3A 2C4GA 4J98A 3EQBA 4C34A 2QR7A 3GB2A 2XNBA 2F7ZE 4A07A 1A9UA 4IJPA 4U8ZA 5J79A 2GNJA 3Q5ZA 3MB7A 4X3FC 3UNKA 5LVNA 5HG8A 1A48A 3DKOA 3ZEPA 2PMLX 5FG8A 3S4QA 2ETKA 1PXOA 3ZM4A 1P4FA 4BCNA 2ONLA 4M0ZA 3OW3A 1YXXA 4Y95A 5HZNA 5LWNA 3R2YA 3BV3A 2GHMA 3R1SA 2F7EE 4HYIA 3QAME 3JUHA 4MXYA 2R64A 3EOCA 4LRMA 4RVLA 4FSYA 1LR4A 3R04A 5A4QA 3SA0A 4AQKA 4D2WA 3AC4A 4D0WA 4LUDA 4C57A 3C51A 4EH2A 3MS9A 5A14A 3DJ5A 3PE2A 4YPSA 3GCSA 2X81A 4W4YA 4CRSA 4U79A 4GFMA 4TYEA 4WUAA 2RKUA 5GJGA 5KMIA 2OXYA 2F57A 3I0OA 4RJ6A 4PP7A 3QX4A 5J95A 5CU0A 3CP9A 2PTKA 4FZAB 4RVTA 3F3WA 3MJ1A 3VUHA 4IB1A 3KULB 4PL4A 5ANKA 5LVLA 4O0SA 4FKPA 4RC2A 3PYYA 4JOAA 4OT5A 5LVPA 3LCSA 3B2WA 4FKGA 4FK6A 3A7GA 3NFGB 3H0YA 3QTRA 4XP0A 3TI1A 2G9XA 2VWYA 3AOXA 2R7IA 1GZNA 2HZIA 2OXXA 5FEQA 2X4ZA 2C68A 4G5JA 3WZUA 4X3FA 4I41A 5KCVA 2BZKB 1IAHA 5FXRA 4D1ZA 3NEWA 4RJ4A 3QUDA 3NLBA 3GENA 2JDOA 4O6EA 4ANBA 4GMYA 4FA2A 5IUGA 1MP8A 3E3PA 1Y91A 1ND4A 1KV2A 4YLJA 1Y8YA 4FZDB 5E4HA 3JVSA 1VYZA 5T3QA 4BI1A 5CT0A 1REJA 2QOBA 4DBXA 3PXKA 3PJ1A 3ZEWA 1ZRZA 1ZXEA 3GGFA 4X2JA 3TNPC 2XCKA 5IQDA 1OKYA 4ZJJA 4ZZMA 2BROA 4D4RA 5ANJA 5KKRB 4CMUA 1XMMA 3KY2A 1HCLA 1DI9A 1WCCA 4AT5A 4B99A 3ZLYA 4TYIA 3ORNA 5M07A 1GZKA 2H96A 3LMGA 1YHWA 4CZYB 4S2ZA 2YFXA 2XJ2A 4G3DA 4I21A 4IZAA 3QRTA 5GJFA 2YJSA 2QKWB