4DFYA

Crystal structure of r194a mutant of camp-dependent protein kinase with unphosphorylated activation loop
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
337
structure length
310
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFATPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the regulation of protein kinase a by activation loop phosphorylation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 94
structure length 310
sequence length 337
chains with identical sequence E
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfyA02
3R9OA 4U79A 4QP7A 4G3EA 4AE9A 1H00A 3IW6A 2BAQA 5HO6A 2C4GA 3BU6A 2J6MA 2QO9A 3PG1A 4FZDB 4XV9A 1PXIA 3QL8A 4IADA 5D7AA 4FKIA 1VJYA 4K8AA 3RPSA 4FBXA 5I0BA 2SRCA 3KMWA 3RI1A 4CLIA 1Y6AA 3AC5A 4FSRA 4ZTLA 5FM2A 3VWAA 4CFUA 2YITA 3HL7A 3WZJA 5C4KA 3QRIA 3ZU7A 4LGGA 4NM5A 4UY9A 3R7YA 3R7VA 3LQ8A 4TL0A 2HY81 5KMNA 3CBLA 4FT7A 3LJ0A 3CD3A 5IA5A 4ZK5A 1JPAA 4EH6A 3B2WA 3VBTA 2X9FA 3SV0A 4CNHA 4XLVA 4TYIA 3N4TA 5AR7A 1XBCA 1BI8A 2GS6A 2RSVA 2IPXA 2OXXA 4WNPA 4C3RA 4IMYA 1NW1A 3BRBA 5EKNA 5EHYA 4M15A 1WBOA 2XKDA 4RFZA 2B55A 1WBNA 5ETCA 2XNGA 4HNIA 3TWJA 4BCGA 3AGMA 4F4PA 3LCDA 5C1QB 2C3LA 4FZFB 4C4IA 4QNYA 4BDFA 4YTFA 4QMTA 5H8EA 4IXPA 4YJPA 4NIFA 5I9XA 2R3PA 3KC3A 3M42A 4NSTA 4V0GB 2DWBA 5AP0A 5EK7A 4R7HA 4ANBA 5K5XA 3E92A 1ZRZA 1IAHA 4R7BA 4DT9A 3CC6A 4YMJA 3A7GA 3H4JA 3PRIA 4MF0A 4DEBA 3EZVA 4LMNA 4XV2A 5JFSA 5FXSA 2E9VA 3U8WA 5DVRA 3C7QA 1UNLA 4PDOA 2QOIA 4BIEA 1SZMA 5CSPA 3TNQB 4GCJA 4IWQA 2BRHA 3D94A 1JKLA 1HCKA 3HMOA 4BF2A 2X8IA 1SVGA 3KY2A 3R28A 2F7ZE 3QCXA 3QD0A 4FNYA 3QD3A 2XK4A 4FUYA 3GBZA 4FUXA 2JKMA 3U54A 1P4FA 3LFCA 2CN8A 3AQVA 2V7AA 5K4IA 1WVYA 3LKMA 1R39A 3QCSA 4W9XA 5HI2A 3QTRA 2PTKA 3UYSA 2IZUA 5L2WA 4FV7A 3OW4A 3S4QA 3EZRA 5E8WA 5LWMA 4P7EA 3OCGA 1H1RA 2AUHA 2R64A 3V01A 4XP3A 5IMEA 1LP4A 3PXFA 4FI1A 4EZ5A 4O6LA 3ZXTA 5JT2A 4O27B 2Y4PA 1YI4A 4PTCA 2ZM3A 4IZYA 4K9YA 2IW9A 1OKVA 3HV3A 4FKLA 3ERKA 4GH2A 3W33A 1ND4A 4L42A 2PL0A 3NW6A 5FDPA 1ZY4A 4U81A 5LMKA 3ZTXA 2ZM4A 4EUUA 3FI3A 5DR9A 4ZOGA 4ERKA 2OG8A 4W4VA 5B2LA 2NPQA 4G31A 2Y4IB 2QNJA 3RK5A 2O63A 1OKYA 2QONA 1RDQE 3LFAA 4L3JA 3UG2A 3ZEWA 4H3BA 2VX0A 2OSCA 5LVPA 5HNGA 5HO8A 1OKWA 4LL5A 1FVRA 3H9OA 4ZTMA 5GIPE 5IQIA 3KU2A 4DEAA 3I0OA 3NR9A 2PUNA 4EOIA 4FIIA 5HCXA 5D7VA 5CENA 4ZSGA 2UW7A 5IISA 2OXDA 5ETAA 2WZJA 3W32A 4IZAA 3H0YA 4EBWA 4YNOA 4D4YA 4BZNA 3Q2JA 2YHVA 1U5QA 4FGRA 4CMUA 1BI7A 4FTLA 3ORNA 2XNEA 3IGGA 2XVDA 3PJ2A 4DG2E 1H0VA 4UB7A 2X39A 5ICPA 2BPMA 4WG5A 4YNEA 2RG5A 5J7HA 3RWQA 3VF9A 3V5PA 1T45A 4DLIA 3L8SA 4BTJA 3D2KA 4FEWA 4KD1A 4QD6A 3U9CA 1DM2A 2C6LA 2ETRA 1DAYA 1M7NA 3DAJA 2HELA 3ETAA 3PSCA 3ZEPA 4BKZA 3UIXA 5L6PA 3NUYA 4B8LA 4EHVA 5HTIA 5EM5A 5BYLA 2C47A 4NH1A 2JITA 5FTGA 1P14A 2V55A 3PVWA 4FG8A 3UC4A 1CMKE 4O7LA 2YERA 5AV1A 3BHHA 4ITHA 4BDJA 2UW9A 1OVEA 4R8QA 4TNDA 3C4XA 3OWLA 4IVCA 2IWIA 4F9AA 2J9MA 4XOZA 4FV9A 4CYIA 3PXQA 4XEYA 5EYCA 2JKQA 3DJ5A 1OITA 1S9JA 2C68A 3KXHA 2R3GA 4J96A 1A9UA 4EWHA 4LG4A 4O0UA 3WZKA 4GV1A 2GFSA 4WG3A 4MVFA 2B4SB 1GZOA 1URWA 3VRZA 3DBFA 2ONLC 5ANGA 3KVXA 1Q24A 3PYYA 3UBDA 5JN2A 3FSKA 3R83A 2E2BA 2DQ7X 3FL5A 1MP8A 2V7OA 1T46A 4BY9E 4L46A 5FP6A 4DH5A 1DI8A 5DT0A 3UNJA 3JY9A 4MQ2A 3DAKA 3FV8A 4RVLA 2Y8OA 2YM8A 3AC1A 4OTGA 3UNKA 2QO2A 3N9XA 4GT4A 1GZ8A 4DH1A 4DBNA 3QF9A 4QQTA 4BDDA 2XJ0A 3OEFX 3DA6A 3MH3A 3QQLA 4FODA 2PULA 4ZZMA 2QOQA 3UE4A 4YJTA 4AF3A 3QUPA 4RIWA 3ZM9A 4KKEA 3AMYA 3EWHA 2W1DA 3MVJA 4XRJA 3WZEA 4DINA 3WF5A 1CM8A 4TWPA 2R0IA 3HNGA 2X8DA 3L8VA 4P90A 4WNMA 3WE4A 3GFWA 2QR8A 4G3CA 3FLZA 4IEBA 4XHKB 4QMNA 4DFYA 1H8FA 1REJA 1XH6A 3QTWA 1QL6A 3L9PA 2W1ZA 4IIRA 4U80A 3DCVA 3G6GA 1RQQA 4BTKA 4D1XA 2WOUA 2UW4A 4AOJA 5AX9A 3GC7A 3DK3A 3PE2A 3V3VA 3AC3A 3E7VA 3JR1A 3SQQA 5AP2A 4ZSAA 2IZSA 4BCJA 4B4LA 3GU8A 4BGQA 2IZTA 3VUMA 3ELJA 1ERKA 2BDFA 4N0SA 5I9UA 5HX8A 3V5JA 3ZMMA 3E5AA 4AFEA 4FKVA 3DBQA 1KE6A 1TQIA 2GFCA 1PXKA 2WMXA 3BV3A 4BKJA 1DAWA 1OGUA 2X7GA 3PWDA 4U0IA 2WTCA 4R6VA 5AAFA 3E7OA 4L9IA 2ITYA 1Q4LA 1XQZA 2X81A 4XP0A 4ACHA 2XS0A 5AAEA 3AXWA 1KE7A 3WE8A 3SRVA 4ZJVA 3PJ3A 4G3DA 5AAGA 3UO4A 4DG0E 1YWVA 5J79A 4ANQA 4QP4A 2YCQA 4IM2A 1H07A 3RAWA 3ZO3A 3JS2A 5EI8A 3TNHA 2YIRA 3DOGA 3MV5A 3BX5A 3ODYX 5IQEA 3MW1A 3FAAA 4O7NA 4ITJA 4FVQA 3VUDA 4QRCA 4DC2A 3UTOA 5HTBA 3ZLXA 5CU0A 5C26A 3ATSA 3DXPA 4RX7A 4KAOA 2GMXA 4C3FA 2O0UA 3U4UA 4F64A 1YOJA 1BMKA 3HRBA 2FB8A 4JX7A 4NIFB 4QP9A 3S95A 4D5KA 2YAAA 4I0TA 4KRCA 2J7TA 1Y91A 4M84A 4GS6A 3NWWA 4JX3A 4U97A 5EHOA 5BVEA 1JKTA 1U46A 1VEBA 4BCPA 2A1AB 3C4CA 3Q3BA 4NU1A 5DRDA 4HVDA 2CKEA 4XX9A 3DDPA 1URCA 2G2FA 3ALOA 4TYHB 5M4CA 5HBHA 4D2PA 3A7FA 5IDNA 1J1CA 5DRBA 4USEA 3K3IA 2XIZA 2FSLX 3QA8A 4UYAA 4ANOA 4DEDA 2CCHA 4NUSA 3DTWA 4E20A 3VS0A 2R9SA 4JQEA 2BAKA 1WBTA 4AP7A 1BX6A 4FSWA 2ZM1A 4QTCA 4S32A 2ZJWA 4CV9A 2IO6A 3W2OA 4XG6A 3TXOA 1PF8A 3OY3A 2Z7RA 3R7GA 3ZCLA 2OW3A 3EFLA 3Q52A 3SGCA 5LOHA 2RFDA 4NL0A 5IEXA 4U9AA 3P7AA 3ENMA 3ORXA 4D1SA 3UPZA 2A27A 4PPCA 5BX0A 1YDTE 2VTSA 3G0FA 3QFVA 1F5QA 4IAIA 5FTQA 3R9NA 3VS7A 3SA0A 2LAVA 3QRTA 5FWKK 4ACMA 4CEGA 3MI9A 2WTIA 1W83A 4AW5A 5HE3A 4HVHA 3GVUA 5CTPA 3P0MA 4GFOA 4MYGA 4RQKA 5CQUA 4FKWA 1PXLA 3R71A 3GCQA 5AP1A 3QKMA 3AT2A 4JG8A 2CLXA 2QHMA 2EUFB 3OTUA 4TYGA 5CZHA 4YSMA 4RFYA 3WI6A 2BZJA 3DKGA 4CFWA 4DH7A 4O22A 3NAXA 3RWPA 5CF8A 5LXMA 4O7ZA 2HZNA 1B39A 1FMOE 3AD4A 3QA0A 2A0CX 3A8XA 4IB1A 4J71A 4Q5EA 5HG7A 4CLJA 2CNVA 3MGYA 4X2GA 2W4OA 5TO8A 3ULIA 4ALVA 1Y8YA 4BDCA 2JIIA 3IDPA 4NT4A 4ALWA 5CXZA 4O0YA 1YWRA 4FV8A 3B2TA 4JT3A 2PVNA 2Z8CA 3KK8A 5ANIA 3LCOA 5I9ZA 2UZEA 3ZLSA 4C59A 3AC8A 4QTDA 1AGWA 1JWHA 2YM7A 4X3FC 4BDEA 5A4CA 3DT1A 3R00A 3KRXA 4GMYA 1FPUA 5KMOA 1G3NA 2XKFA 4FICA 4JG6A 4M67A 3ITZA 3R1NA 4NKSA 4LOPA 3W55A 4NM0A 4X7QA 3I1AA 5LMKC 4RWLA 4CRLA 4AN2A 4ZTRA 4FTUA 1UKHA 2XIKA 1MRUA 4IAZA 4BDIA 4BC6A 4ZLZA 2X6EA 4EH5A 4HJOA 4ZLYA 3DNDA 3R7UA 3G5DA 3EN7A 3LLAA 3VC4A 3E93A 2X6DA 2XNNA 2PE2A 3R8MA 5I9WA 2C6MA 3PVBA 5AV2A 4UMQA 3VBYA 4M69A 5DNRA 1PJKA 4GFGA 3FXZA 3RVGA 4F1TA 1R3CA 2CKPA 4PMSA 4DFUA 4X6RA 3LFDA 3Q6UA 4L44A 5EYMA 4M66A 3FZOA 4JG7A 3IOPA 5EYDA 2ESMA 3QAME 4PDSA 3NMUF 2YA9A 4ZY5A 3NGAA 4F9WA 3W16A 3ANQA 2B9HA 4E4NA 3MVLA 5E8VA 3DS6A 4PP9A 4EK6A 2CJMA 4QYGA 2PK9A 4FIJA 3VJOA 1OIQA 2WO6A 3WYXA 4S34A 3UZRA 3MA3A 2WMSA 1GNGA 5M07A 2OZOA 3G2FA 5CY3A 3MY5A 3VQUA 4F9CA 5CS6A 3ZHPC 4DF3A 5G1XA 4LFIA 3RAIA 4G5JA 5CT7A 1SYKA 3ROYA 2OXYA 2UZLA 4XUFA 3VUIA 4C34A 4R3PA 4K0YA 3QTZA 4RIYA 1NVQA 3W18A 4K1BA 3EQPA 3E3BX 3VF8A 4QMZA 2YFXA 2UW8A 4RLLA 4AFJA 5BYYA 1Z57A 4FZ6A 4AA4A 5FP5A 3PSBA 4ZAUA 3I5NA 3NUAA 3NW5A 5BMSA 4DE4A 4DFLA 3RHKA 5AUUA 5L8JA 4USDA 4DHFA 4BR3A 3EQIA 5DPVA 3O51A 4B7TA 3EN9A 5IQBA 3CE3A 5GINE 2WMWA 1OL7A 2CGUA 2QU5A 2XJ1A 4UWYA 4BL1A 4ASZA 5DA3A 3Q60A 1R78A 3DZQA 2UW0A 4LOOA 4NZWB 4V01A 5AFVA 5E4HA 2QOHA 4AACA 2W4JA 2QC6A 3GOKA 3P1AA 4KUJA 3EN5A 4IWOA 3GU4A 3PG3A 4O86A 3NYVA 5CWZA 2P4IA 3FZRA 4PF4A 3F5XA 4YJUA 4FTJA 2BROA 4AX8A 3HUBA 3GGFA 5BVWA 2YABA 1BKXA 1FINA 2I6LA 3F3WA 4RIYB 4O0VA 2W5HA 4WKQA 4ZZNA 4FA2A 5ACBC 3KRWA 3NRMA 5CVHA 4HPUE 5F9EA 4XCUA 4JLCA 3P78A 3TNIA 3COHA 3ZYAA 2KULA 2WMTA 1FVTA 3DJ7A 3O8UA 5A9UA 3QZHA 2NP8A 2W99B 4ZMEA 3ALNA 3R8ZA 3C9WA 4M0YA 3BQCA 3V51A 2BRNA 2G2IA 3ZH8A 4YC6A 5HD4A 5K9IA 1H1WA 4YZ9A 4QP1A 2QHNA 2YIYA 4GYIA 3DKFA 4CFFA 3ROCA 3PLSA 4PDYA 4X2NA 3HMNA 3OP5A 3AMBA 3K5UA 4FT0A 1M2QA 4RA5A 4MXAA 3LMHA 5J9ZA 1OPLA 3D0EA 4AGUA 5A4QA 3NUSA 3W2QA 1X8BA 3HV4A 3PIZA 5JQ8A 4FE2A 1W0XC 3CQEA 2YM3A 5D12A 5D9HA 3BWJA 3QTXA 3A8WA 4GUBA 2W06A 4AN3A 3PLAE 1QCFA 3AOXA 3BIZA 4IM3A 2PVHA 4EOSA 4ID7A 1QPDA 4G9RA 4PL3A 2PUPA 2C0IA 4MBIA 3UVPA 5DLSA 4A06A 4CVAA 4XJ0A 4ASXA 3LFNA 4WA9A 5KMMA 5IQDA 4BTFA 4R5SA 3DDQA 4BCHA 5GZAA 3RINA 3L9LA 3IOKA 5E8XA 3CPCA 3V8TA 3MSSA 4PMPA 3BYUA 4IX6A 2GQGA 2JDSA 2RFEA 2WOTA 3VS5A 5GIOE 3F3VA 1H1QA 2R2PA 3KXZA 2JDOA 2JBPA 4GT3A 1W82A 2VU3A 3FKOA 2WGJA 3SW4A 2YWVA 5EDQA 5J9LA 2YEXA 1UU7A 3RPOA 3PVUA 4EH8A 4QMQA 4IC7A 4FTKA 4MK0A 4XBUA 4YO4A 2CNQA 3KMMA 2B7AA 2XZSA 4FKUA 2OH0E 2JAMA 4ZIMA 4AT5A 3GEQA 3DB8A 5KHXA 3PP0A 5AUZA 2UVXA 3PXYA 4R7IA 1Z5MA 5HKMA 3ZOSA 4BCIA 4FKJA 4GVAA 3HYHA 3Q5IA 4ENYA 4Y73A 3WYYA 3BBWA 4RJ8A 5DH3A 4ZSLA 4C2VA 2OF2A 3K2LA 2X9EA 3LM0A 4IX3A 4HYUA 2QCSA 5HU3A 2QODA 3G0EA 4DFXE 3E8NA 4O83A 3VS3A 1JKKA 3DLZA 3QQHA 4RSSA 2VTQA 5GZ8A 2F9GA 3NAYA 3QUDA 4TN6A 2W1IA 3UZPA 1F3MC 4UZDA 3OCTA 3GCUA 1PYEA 5AP6A 4EH7A 1W7HA 2NRYA 4FIGA 3RKBA 2C6TA 3MY0A 4KWPA 2HXQA 4U42A 4FTQA 2WMRA 1GIIA 2XIXA 3GC8A 4A4XA 3U9NA 4EOPA 2VO0A 1LEZA 5IQHA 5HTCA 4OAUC 1GOLA 3HP2A 5HESA 1PW2A 5IUIA 3ZFYA 4GIIA 4J98A 3MFSA 4F7LA 4IAYA 1PMUA 4MXXA 4R77A 3OG7A 4HCVA 4WBBB 2ZYBA 3FLYA 5CNOA 3DFCB 4Q9SA 4K18A 2XMYA 4FOBA 4TTHB 1OPJA 4XH6A 3ZC6A 4AN9A 5KNJA 4JI9A 1SVEA 4I41A 4QMUA 4G6NA 2YN8A 3ZM4A 3OFMA 4YHFA 2X1NA 3FDNA 3GU6A 5JZJA 2YIXA 1PHKA 4K77A 5CI6A 2QKWB 2XK9A 3H9RA 4BWXA 2VWBA 3PIXA 4U45A 4IQ6A 5LARA 4CG9A 5L2QA 3FBVA 4HPTE 3CTHA 1UV5A 4FTNA 2C5VA 3HV5A 1NVSA 4FKTA 2NNWB 3QTIA 5KCVA 1CDKA 4QTEA 4N57A 2IVSA 3A2CA 4FTIA 4NM7A 2YISA 1JBPE 2PYWA 5KZIA 5AUWA 3WOWA 2ITZA 3L8PA 4EH3A 4H39A 4EJNA 4BDKA 1UWJA 3GCPA 3TG1A 5EHLA 4XYFA 1W8CA 2FSTX 2XH5A 5F20A 2EU9A 5J8IA 4G3GA 4RWIA 1NVRA 2WQNA 3ACKA 3UOHA 5I9YA 2WKMA 3CSVA 4A07A 3BU5A 3TIYA 4AWIA 2FGIA 5TT7A 2DYLA 2B9JA 2HW7A 1CSNA 3A4OX 5C01A 3S0OA 4GKHA 3OROA 4IHPA 3SRVB 2CDZA 2W5AA 2J0KA 5C8NA 3Q5ZA 4IBMA 4E1ZA 3PWYA 3BGPA 4O38A 4RIXB 1WCCA 4XG4A 5FTOA 4FIHA 5JKGA 4H05A 4NYEA 2QLUA 3GU7A 2ITVA 4FEVA 2H8HA 4FTOA 3MFUA 4Z16A 5TOZA 2ERKA 4D4VA 3FQSA 4MWIA 2QOOA 3PPZA 1ZARA 4O91A 2B0QA 5AV0A 3TNWA 3DAEA 1YDSE 4EK4A 4F7NA 3GUBA 3D2IA 3IS5A 3UQCA 4KA3A 4GK4A 4FYOA 5HG5A 4JNWA 4RIXA 5JQ5A 3RM7A 3MJ2A 4O7TA 3B8QA 3TZ9A 5DEYA 1BLXA 3GCSA 1YOLA 3A62A 3TCPA 5CAOA 4GKIA 4O7RA 2X4ZA 4GG5A 3COIA 3TI1A 3GC9A 3S00A 2YM5A 4LUDA 3KMUA 3LFSA 3SKCA 1G8SA 4P5ZA 4XP2A 2G1TA 2YIWA 4RFMA 5E8ZA 3VIDA 4K2RA 1H26A 3FZPA 5KHWA 5LJJA 4YJQA 3DB6A 5DR6A 2WTJA 3O2MA 3HMIA 2F2UA 3SAYA 4O7YA 3ZO2A 3NLBA 1I44A 3K5VA 3R7IA 3EYHA 3VVHA 1R0PA 2J4ZA 1Y57A 4XG3A 3I6UA 4F70A 3PJ1A 4KIQA 3E62A 3DBCA 4DGGA 3G15A 4YTCA 3TUDA 3O8TA 4PL5A 4E6DA 2FH9A 2F7EE 2GCDA 5ETIA 4ZY4A 3LQ3A 5IH6A 2XK8A 2ITNA 3A7IA 3LJ2A 3T8OA 4YSJA 4EHEA 1OUYA 4UALA 2GTMA 4II5A 3U6IA 4RWJA 2R7BA 3ZONA 3RJCA 5LWNA 4FK3A 3BLRA 3ET7A 1MQ4A 1B38A 4IW0A 4MD7E 3REPA 2J0IA 3PA5A 3H10A 3ZSGA 5L8KA 1PKDA 3RHXA 4HW7A 3FEGA 3ZLYA 4QYHA 5HX6A 3FXXA 1DI9A 4Z3VA 3PA3A 3EFKA 4P2KA 3E8DA 2R7IA 4CZTA 4FV5A 3F3ZA 1BL6A 3G9NA 5JH6A 3C5UA 4ONAA 3VW6A 1H01A 3EOCA 1SNXA 2VTAA 3BGZA 5FQDC 4F6WA 4EK3A 2XRWA 4CFVA 4FEQA 2O2UA 4IAAA 2HZ0A 3VUHA 2BZKB 2CSNA 1WBVA 1IA8A 4ZSEA 2JFMA 3DBEA 1JSUA 3UNZA 1H1PA 4A4OA 4YJVA 4HGTA 4W9WA 2XK3A 4PPBA 5JGBA 4BI0A 2GU8A 2OH4A 3VO3A 4OAVB 3LCKA 4CTCA 3FWQA 4WRGA 4YPDA 3BPRA 4P4CA 2J2IB 2B52A 5DEWA 5IQAA 3BELA 4QMSA 2PVJA 3T3UA 4EQCA 2GSFA 1JLUE 1W98A 4F9BA 5DOSA 2O64A 3MYGA 3VBWA 2UW3A 4GIHA 4EOOA 4C35A 3BYVA 4AW0A 5AM6A 2BIYA 4S33A 4M7IA 3HDMA 3MY1A 2RFNA 3KXGA 3RCJA 4NJDA 2HCKA 2C3IB 4NK9A 3AG9A 1WFCA 1XH5A 3I60A 2F49A 3TIZA 4L00A 4AW1A 5L2TA 5HZNA 3NDMA 5IKWA 3CPBA 1UKIA 3PTGA 3AD6A 5LMAA 2Z7QA 5IF1A 2XM8A 3BKBA 4M13A 3SG9A 3LMGA 4RIOA 4BHNA 2XM9A 2OWBA 4AS0A 5L8LA 4BRXA 3P9JA 3I79A 5KO1A 4G2FA 2J5FA 5AV4A 2WTVA 4JBVA 4ZEGA 3OVVA 1JNKA 4KKHA 3ZRKA 3OCBA 1EH4A 4FTTA 3HA6A 4A9RA 2R3QA 4FNWA 5F1ZA 2Y9QA 3CTJA 5TR6A 2YWPA 5BVKA 4Z55A 2BILB 2CGVA 1QMZA 3MPTA 3N51A 2HK5A 5IEVA 5BYZA 4E93A 3QU0A 3RAKA 2QU6A 5T3QA 5E8UA 3AD5A 5KMLA 3RPRA 3MESA 3GU5A 3DPKA 2C5OA 2P2HA 3CGFA 2HXLA 4KSQA 5IDPA 3QTUA 5HVKA 4L52A 2VN9A 3O23A 4IJPA 4GRBA 5ANJA 4HYIA 4MNEA 2JEDA 3NPCA 4IB0A 3MIYA 3TACA 4YU2A 2Z60A 3EKKA 2F7XE 4F7JA 4BCFA 4ZY6A 1PY5A 4KS8A 4RMZA 5EKOA 3MH0A 4QQCA 2WHBA 4FSTA 2V22A 5CASA 2JGZA 3DGKA 1O9UA 4U7ZA 1OI9A 3L9MA 2B53A 5JRQA 2IN6A 2RKUA 1ZYLA 3WARA 3PFQA 4YR8A 3SVVA 4QO9A 2WQBA 2QURA 5AEPA 3NCGA 4G1WA 3OWPA 3HUCA 3UQGA 5J1WA 4ACDA 3HMPA 4PY1A 1YKRA 2BDWA 3EQRA 4EZ3A 4F0GA 2YZAA 4CMTA 3N4UA 2W1HA 3BI6A 3H9FA 1YXTA 2OIBA 5FRIA 5A46A 1Q99A 5A4TA 2XK6A 2UZNA 3QC9A 3SLSA 3P86A 1LR4A 3GB2A 4HNFA 2CKQA 3V5LA 2X4FA 3DK7A 4XMOA 3RTPA 4BBMA 5JGDA 2O65A 5EM6A 3P4KA 4UMRA 5EW9A 2R3OA 5IH5A 3QGWA 5AP7A 2ITUA 3Q4ZA 2F57A 3QHWA 1IG1A 4W8DA 5EW3A 4D58A 3TM0A 4W4XA 4PRJA 3BQRA 4AUAA 5HORA 4BCQA 5EM8A 4JQ7A 5C4LA 2OO8X 4AXAA 3LXKA 2VX1A 5CU3A 4EKKA 3LCSA 3ZRLA 3AC4A 1KE8A 2VWUA 1HOWA 4QMPA 1FQ1B 1PMVA 4G3FA 5CVGA 5BPYA 3EMGA 4TKSA 5E91A 3W2CA 4UN0C 3DQXA 2Q83A 1V0BA 3OBJA 3ZFMA 4JIAA 3UC3A 4I0RA 4C4HA 4L3LA 4BIDA 1OB3A 5D11A 3T9IA 3U6JA 3TJDA 4RZVA 1YVJA 3VW8A 2C1AA 1GJOA 2XNPA 1M2PA 4I5HA 4PWNA 4I20A 4CFXA 2YM4A 2IG7A 2YLEA 3GI3A 5AA8A 1JKSA 1Q61A 2PUUA 3O0GA 3WILA 3QQJA 4QP2A 2VWVA 2YM6A 3QX2A 2QOFA 4YHTA 3KVWA 4I1ZA 2HWPA 3UQFA 4Z7HA 1JOWB 1VR2A 4NTSA 4BICA 4PNKA 4CRSA 4EWQA 4YC3A 1IRKA 3W10A 3BCEA 4EOQA 2VTMA 3O50A 1Q5KA 3BHVA 2VX3A 5HLPA 4ZS4A 3RBWA 3KA0A 3Q4CA 4F9YA 4EH9A 3IDBA 3QRUA 4QQ5A 2WB8A 2QOBA 3FYKX 4DCAA 3E8EA 4FTMA 2ITXA 4NCTA 4ZTSA 4TWOA 5M57A 5HD7A 2WTKB 4X21A 4DGNA 3PIYA 5F94A 1GY3A 3QC4A 4CFNA 2J0JA 2PVRA 3L8XA 2C6KA 3LXNA 4FKRA 3U55A 3C4WA 5JRSA 5G6VA 5M4IA 1J3HA 4KIKA 2PVMA 4I6QA 4JDKA 2BTSA 3DK6A 4GUEA 4WHZA 1ZXEA 2I1MA 2WQOA 3EQCA 5FDXA 4YJNA 5AA9A 4W4WA 1IR3A 4FSZA 5BQ0A 5HIBA 3PXZA 3R73A 3ZLWA 3OC1A 3B8RA 4QPSA 2VNYA 4PUZA 4WG4A 3PZHA 4FV1A 5EQYA 2VGOA 4WRSA 3QGYA 4L68A 4NM3A 2XEYA 3BE9A 3VS6A 4L8MA 2JIVA 4NTTA 4C57A 4XS2A 4OLIA 4FR4A 3E64A 3PUPA 4KBAA 4QP8A 5KZ0A 1WBWA 3SG8A 4KS7A 1Q3DA 4XG8A 5HVYA 4DTBA 4BCMA 2PPQA 2YCRA 2IVTA 2R3KA 2FYSA 2HZ4A 2IZRA 3QYZA 1UWHA 3UOKA 4MXCA 4W8EA 2JKKA 4DGOA 5IUHA 3D5XA 2G9XA 3GXLA 3BE2A 3P08A 4C33A 4LUEA 1VYWA 3DY7A 3Q9ZA 3RK9A 4EYJA 5L4QA 3LQ5A 3CEKA 1KOAA 4JJRA 4OTPA 4UYNA 5FXRA 4L53A 4F63A 2VAGA 4X3JA 4BFMA 3ZUVA 3D7TB 1V0OA 2Q0NA 3QTSA 5EM7A 4AGCA 5BVFA 3PPJA 4A9YA 5IU2A 5IA3A 3RGFA 4MNFA 4ZP5A 1YXSA 4UBAA 4YTHA 4D28A 2BFYA 2C6EA 3NSZA 5KX8A 4FEXA 4DG3E 5CYIA 3OMVA 2EXEA 4IM0A 5C8MA 4B6LA 4M68A 3RZBA 5DI1A 4RJ6A 4QMMA 4BDHA 5KMKA 4R78A 2PHKA 4WD5A 3ZBFA 4X2FA 4G9CA 4TXCA 4JVGA 3OT3A 3D4QA 4NJ3A 1J7IA 2ZV2A 4AZVA 2Z02A 3MB6A 4XOYA 4MCVA 1SVHA 2RFSA 4IVAA 2YDJA 3RM6A 4MD8E 2AC5A 2GNJA 5HBEA 1J7UA 4H36A 3EQHA 4KABA 4X2JA 3TTJA 5EG3A 4CYJA 2OJJA 2P3GX 4DBXA 3S3IA 4DFBA 2P55A 3BZ3A 4JIKA 4M69B 3AGLA 3PJ8A 2WAJA 4Y8DA 5HO7A 5IH4A 4GJ3A 3FMDA 3FSFA 4OTQA 4D2WA 4WNKA 3SDJA 2ZAZA 3UIMA 4FIFA 1Y8GA 4IVDA 2V5QA 3D7ZA 3OTVA 3LOKA 3C5IA 3RNIA 2WIHA 3E63A 3F5PA 3EB0A 4MWHA 4AOTA 3NNVA 4QP6A 3UDBA 4F0IA 5HEZA 2PVFA 4G5PA 4OR5A 5BVNA 2JDVA 4LV8A 4EK5A 4FV3A 4AE6A 4M97A 4C38A 4MTAA 4FKSA 1UNGA 5FM3A 3I5ZA 3POOA 4TW9A 2I7QA 2DS1A 4JXFA 4TY1A 1U59A 4Z7GA 3GQLA 3LW0A 2YLFA 3Q32A 1FVVA 3VS1A 1ZYDA 4E4MA 4ASDA 3G9LX 4J8NA 3T9TA 4XG7A 3ID6C 3H30A 3IECA 4TWCA 4KIOA 2W17A 3OBGA 3PDTA 1OL1A 3MFRA 4E6CA 4X6QC 3CY2A 3LFFA 4JL9A 4AT3A 4MF1A 4D1ZA 3NX8A 4IFGA 2PMOX 4IB5A 1W84A 3BYOA 4ZTQA 1UNHA 5HNBA 4ZLOA 1V0PA 3HMMA 3SW7A 2R3RA 3F6XA 4PX6A 4FT9A 1KOBA 4M12A 4DLJA 2ZV8A 3EN4A 3JPVA 3FI4A 3M1SA 1ZYJA 4OTFA 3D83A 4J97A 4UWCA 3U51A 1BYGA 1E1VA 2AYPA 2JIUA 2PVKA 3F7WA 3HKOA 4YLLA 4E73A 5HQ0A 5HNIX 1J1BA 2OJGA 4U44A 3CKWA 4EZ7A 4FSYA 4UMUA 2C5YA 4RRVA 5ANDA 4Y5HA 4EK8A 3MH1A 3QRKA 2I0HA 3BLQA 3C50A 3LFBA 4LGHA 4UXLA 2J90A 3D5UA 5I5ZA 5A14A 4G17A 1U4DA 3WF9A 3CJFA 2I0VA 4DTKA 4FC0A 4BGHA 2W5BA 1O6YA 2OK1A 4FL3A 4I4FA 4C02A 2R3FA 5B0XA 1A48A 3AT3A 2EXCX 2RIOA 5E8TA 3TKHA 2WTWA 4HOKA 4AZFA 3KRJA 3C51A 3HV7A 2W0JA 4RJ3A 1PXPA 4JAJA 3PE1A 4O0TA 3AMAA 3HRCA 4D0WA 4MQ1A 2HY0A 2HYYA 2VTLA 5B2MA 2WIPA 5AUYA 2ZV7A 4D2RA 5E9EA 1G5SA 5E8YA 3EQBA 4YZNA 4F99A 3SOCA 3HVCA 3VS2A 3QWKA 2HAKA 2JKOA 3ZSIA 3QQKA 3KXXA 3KXNA 5ANOA 4BDGA 1XO2B 1M2RA 2XIRA 3I0QA 4F6UA 4DEEA 4ZS0A 3OD6X 4UMPA 5IG1A 4QP3A 4U3YA 1R0EA 5CU6A 4DEGA 2W1GA 4O21A 2W1FA 5KMIA 1JAMA 3FMNA 4UWBA 2ERZE 4PV0A 4D4RA 4WUAA 4EYMA 5CAVA 3IONA 4FV2A 3SXFA 3HECA 3CGOA 3DU8A 3KCKA 2XKCA 4CCBA 3ZO4A 5A54A 1MRYA 1M14A 1PXJA 2PMNX 4L7FA 3RCDA 4ANNA 5IQGA 2PSQA 4I93A 5AP3A 5HLNA 1Q8WA 4XV3A 5M53A 3O7LD 3OCSA 4H1MA 4JBPA 3QKLA 4MEDA 2ITOA 5FBOA 4JR7A 3ZC5A 1PXOA 3NUUA 3GT8A 4OT5A 3TDWA 2UZWE 3A7JA 4S2ZA 4IFCA 1UA2A 4Y95A 4U6RA 4BBFA 4FTCA 1SM2A 5D41A 1FMKA 3CJGA 2GQSA 4IH8A 3VAPA 4EI4A 1PYXA 2A4LA 4LRJA 4JDIA 3IO7A 3OY1A 2A19B 2BRMA 4N4SA 2VTNA 4FOCA 5FEQA 2RF9A 4IB3A 1OL5A 5HG8A 4QNAA 3MBLA 4N6YA 4RX5A 2NRUA 1H25A 3FHIA 5DR2A 4AZSA 4CXAA 2DUVA 4YO6A 5M55A 4D55A 4LRKA 4OTRA 3FLSA 3FY2A 3ORPA 2VTJA 5E90A 5DE2A 1HCLA 3PA4A 4ZMFA 1XBBA 2VD5A 4DITA 4RPVA 5JFVA 4EBVA 5CEOA 3MPAA 3R7EA 5LCKA 5IA0A 5CAQA 4HGEA 2HIWA 3F2NA 1XJDA 3FPQA 4D9UA 1K2PA 3ORLA 3QHRA 2EB3A 3HZTA 5CT0A 3UG1A 4DEIA 5EI2A 4ZTHA 3FI2A 1UU8A 5BUJA 2GS2A 2J51A 5AJQA 4FGBA 4EJ7A 1OUKA 2C0TA 3F5UA 5AIRA 4AZEA 2BZIB 4TZRA 5TKDA 1Q8YA 4UEUA 2UVYA 4CT2A 4BGGA 3FJQE 3KF7A 4HVGA 4B9DA 4PNIA 3CLYA 3R9HA 4B0GA 4CT1A 4EHGA 3U4WA 5K0KA 4JRVA 4GU9A 4DFZE 2IVUA 3FMLA 3PVGA 4DA5A 3OHTA 3NEWA 3JUHA 4PTEA 1P2AA 2F4JA 4BHZA 3DXQA 4DFNA 4FSNA 5AADA 3EFWA 4GFMA 3ORIA 4QT1A 4BWKA 4E7WA 2BKZA 4BBEA 1S9IA 2BIKB 2Z7SA 3FUPA 4GJ2A 4QPAA 3SXRA 3V5WA 3BEGA 5J5SA 1YQJA 1Q8TA 4I0SA 5M51A 5AR2A 4YC8A 3G51A 5GJDA 1SNUA 3EFJA 2VZ6A 3FYJX 4X3FA 5FD2A 2CGXA 5M4UA 2HW6A 4DAWA 4EORA 4AQCA 3KRRA 1XH8A 3QD4A 4K11A 4PL4A 4JDJA 1M7QA 3GOPA 1CTPE 1ZY5A 4U43A 2G2HA 4BN1A 1JVPP 1QPJA 2ZV9A 2YDKA 5AUXA 3UIBA 5H8GA 4FV4A 5DFPA 5E7RA 4R1VA 3V8SA 4FL1A 4N6ZA 4I5PA 3TZ7A 3LJ1A 3MH2A 4YZDA 5ETFA 2YACA 4CD0A 4E5AX 5BVDA 1YXUA 3JXWA 1WAKA 3P7CA 5E8SA 3RMFA 2RGPA 3VN9A 5A4LA 2WNTA 4A7CA 1CKJA 4O82A 1Q3WA 1YRPA 5AR8A 4O2ZA 3BYMA 5CU2A 5IA1A 4UXQA 4H1JA 5DYJA 1ZOEA 3KF4A 1MRVA 3JYAA 1GIJA 3N4VA 5EYKA 3Q6WA 2FUMA 4FMQA 3ANRA 1STCE 2ZDUA 2VTPA 4RX9A 2I0YA 1O6LA 4GVJA 3SD0A 4O0XA 5JGAA 2OLCA 4BCKA 1RE8A 2QVSE 5GNKA 4TYEA 4CG8A 4RX8A 2OZAA 3ZDIA 5JK3A 3OZ6A 5FGKA 5A6NA 3UPXA 2FA2A 3QWJA 1ZMWA 1A06A 3ZUUA 2VWZA 4HCTA 4YHJA 5CU4A 2QO7A 5BMMA 5CSXA 3UODA 4F6SA 1Q97A 2C30A 4QMXA 4NFNA 4NKAA 3QD2B 4WIHA 3R8LA 2VV9A 5J7BA 2C6DA 3NIEA 5F4NA 5IZFA 4H58A 1JSVA 4C58A 5HVJA 1XH7A 2VTOA 5ITAA 4QPMA 3EHAA 5LCJA 3F5GA 3OOGA 2QKRA 4FIEA 1ZYSA 4I5MA 4MBLA 1K3AA 4TPTA 5L6WL 3UP7A 5DT3A 2OFVA 1U54B 2JDRA 4KIKB 4ZSJA 5LVNA 3IPHA 3IG7A 4KINA 2XNBA 5HE0A 5KE0A 3R2BA 3KN6A 2Y6OA 5HG9A 5T68A 4U8ZA 4WUNA 3WBLA 4ZTNA 2ZMCA 4FNXA 4O7WA 1WBSA 2VTHA 3W8QA 5DT4A 3JVRA 1OECA 2GS7A 3VBQA 1OM1A 5AV3A 4MAOA 2Y4IC 3FLQA 3W8LA 4GW8A 3UO6A 1LEWA 1JSTA 4QYFA 1LUFA 3C1XA 3ODZX 2J5EA 5J87A 2E9PA 2R0UA 2BALA 2Z7LA 4GT5A 2XBJA 3O71A 3EIDA 3OW3A 4BZOA 3JY0A 5DIAA 4JBQA 4ACCA 4BCNA 5L6OA 2OICA 4OTHA 4C4GA 4BZDA 1YHVA 3C0IA 3QALE 3HP5A 4O6EA 4EQUA 1OBGA 3DNEA 4EL9A 2G15A 2IJMA 4USFA 5M09A 4OW8A 3F9NA 4FT3A 4CV8A 3RZFA 3MIAA 2XCKA 4R1YA 3QZGA 4U3ZA 5FEDA 1OMWA 4C4FA 2YDIA 2J50A 2B9IA 3P7BA 3A60A 5CEIA 4D5HA 4HGSA 4E8AA 3D9VA 3MVHA 1MUOA 3QZFA 2XUUA 4CQEA 4DYMA 2WEVA 1U54A 4FL2A 4MD9E 4OT6A 3KGAA 3EL8A 5FUTA 3MWUA 1SMHA 4PMTA 5TE0A 3COMA 3UIUA 3W1FA 3CKXA 2OF4A 3QQFA 4FSUA 1E9HA 4I4EA 2XKEA 4O1PA 3HA8A 3LLTA 3TN8A 4BDBA 1P5EA 3AT4A 2JFLA 3E8CA 4XG2A 4EOKA 2IW6A 4M14A 5DBXA 2GNIA 3EKNA 4I24A 3ATTA 2C3JA 4NW5A 1WZYA 4YZBA 4B8MA 1H28A 1K9AA 3D5VA 5KUPA 5GZ9A 2GDOA 1OIYA 4IANA 4LQMA 5M08A 5CALA 4DH3A 4HYHA 4QQJA 4C2WA 1IEPA 1TQPA 4ENXA 4C62A 3V6RA 4MX9A 3FZ1A 3FHRA 3I6WA 4ZJJA 2PE0A 1XKKA 2WU7A 3QXPA 5JSMA 3L1SA 3OXTA 1OKZA 3NNWA 5H2UA 4C3PA 4HVIA 3NNUA 2OJFE 4EHZA 4Y85A 2VWWA 5IEYA 4EQMA 4R3RA 3TKUA 3TKIA 5DHJA 2R3MA 3UMXA 4C37A 5KBRA 3PPKA 5M06A 3TEIA 3C13A 1ZMVA 4IX4A 1Q41A 3LXPA 3MJ1A 5FG8A 3GNIB 4DEHA 4YLJA 4O7SA 4WBOA 4YGAA 2VO3A 3LMIA 3QQUA 3NS9A 4MXYA 4AAAA 4RC3A 4RJ4A 1WVXA 2BDJA 2UZTA 4Y72A 1WVWA 2XIYA 3H0ZA 3HDNA 3VBVA 3UOLA 2YCSA 4J99A 5IA4A 1UU9A 2OI4X 2E9UA 2C1BA 3R22A 5DGZA 5KKRC 4R3CA 1QPEA 4FSQA 3KKVA 3LAUA 4PDPA 4OBPA 1VZOA 2ZOQA 2ETMA 5HE1A 4G6OA 5BUIA 4WT6A 3PZEA 4J8MA 4WO5A 3OT8A 3BLHA 4DCEA 3KRLA 5AP4A 5DN3A 2VTIA 2XNMA 4QYEA 3NUNA 3W2RA 3Q4UA 3D5WA 5GJGA 5I9VA 5HCZA 3K54A 3VRYA 4AOIA 4AZWA 3CQUA 4M3QA 3FC2A 4CSVA 2CCIA 3U6HA 2QOKA 3A7HA 5AM7A 4BIBA 3P79A 4E5WA 2OJ9A 4LL0A 2XBAA 4XG9A 3QCYA 2ONLA 4ZZOA 4MXZA 2OIQA 3LZBA 4MHAA 2BVAA 4KBCA 4D2SA 4L6QA 4QMOA 2EXMA 3A4PA 4LGDA 5ACKA 4BCOA 4MKCA 5AP5A 2WELA 1CKPA 4I3ZA 4YUQA 5EOLA 2OFUA 4LV5A 1RJBA 4CKJA 5KMJA 3Q9WA 2VRXA 2J0LA 4FKOA 2H6DA 3W2PA 3F82A 1OIRA 2QR7A 4GK2A 5C8KA 4IDVA 2NO3A 4Y83A 4S30A 3C4EA 5TF9A 3C0GA 3R1SA 3UYTA 4EONA 4FT5A 4O2PA 4G16A 3SX9A 3VUKA 4I6FA 3CS9A 1J91A 4ALUA 2FSOX 3CY3A 5AX3A 3I7CA 4PTGA 5HOAA 4V0GA 3NVMB 1H0WA 2XK7A 1KE5A 3HRFA 5EFQA 1KV1A 1YI3A 2P2IA 3CIKA 1H24A 5D10A 3EH9A 3BHYA 3ZFXA 2YZLA 3P23A 2YIQA 5CEKA 3ZDUA 3THBA 3DFAA 1NA7A 3FQEA 3VNTA 4FKQA 3HX4A 4D2TA 2VWXA 4RIWB 5HU9A 4GG7A 2FO0A 1OL2A 4KRDA 2W05A 5IUGA 1IA9A 3HGKA 2CLQA 1UVRA 2EVAA 2BHHA 2VO6A 4WOVA 4QYYA 1ATPE 3V04A 3PRFA 4DN5A 3F2RA 5EH0A 1REKA 4FVPA 4XBRA 5CAPA 1OPKA 3NYNA 3HAVA 2GHGA 3R9RA 1ZAOA 2V0DA 3MS9A 3ACJA 3G33A 5L2IA 5C27A 3LIJA 3R0TA 3EQFA 4RZWA 1FGKA 2W1CA 4RLKA 4BWPA 3SHEA 3EL7A 1ZLTA 4RG0A 3ZUTA 1H27A 3BWFA 4FZAB 5M56A 1G8AA 1PMNA 3ZZEA 4EOJA 3V5QA 1E1XA 4I92A 3GENA 3I4BA 3QBNA 4FVRA 3U87A 2WMAA 4O0RA 4CTBA 2WQMA 4L3PA 3IGOA 5M44A 5KBQA 2OIDA 2ITWA 2OKRA 4J1RA 3Q2MA 3FMMA 3UZTA 4YZMA 5AMNA 3EQDA 3IDCA 4KBKA 3RP9A 4APPA 3R1QA 4FV6A 1YHWA 5CEMA 1ZMUA 1P4OA 3BEAA 5FXQA 4CKRA 1Q62A 5B2KA 4AGDA 5K0XA 2JD5A 1AD5A 2C6OA 2UZOA 3FY0A 4KNBA 5AR3A 2UV2A 1GAGA 5F95A 3WF8A 2OZAB 3MDYA 2YCFA 2WFYA 3CXWA 5J5TA 2X0GA 4O7VA 4OTWA 3S1HA 2X2LA 4I5CA 5CVFA 1AQ1A 2JLDA 3VHEA 4F0FA 4L67A 4JQ8A 5AIKA 3F69A 3G6HA 3R01A 1KUTA 3TNPC 2XCHA 4OBOA 4PQNA 4P5QA 2JBOA 4XRLA 4W4YA 1YOMA 3DQWA 3F88A 4WSYA 5H3QA 1F0QA 5IPJA 3OEZA 2XNOA 4PMMA 3BGQA 4HYSA 4UZHA 3R6XA 4UMTA 2GNGA 3FXWA 3UJGA 2CMWA 3P5KA 2QG7A 3II5A 3WF7A 3EJ1A 5LVMA 2UW6A 1IASA 3KULB 3QRJA 4JDHA 4NW6A 5CSWA 2X7FA 3TJCA 1GZNA 4HVSA 5LQFA 2VGPA 2E9OA 3KN5A 2A2AA 4J52A 2UZBA 3R21A 3V6SA 4A4LA 3FE3A 4IE9A 2I0EA 5EQPA 3ZXZA 5JMSA 3G90X 2UVZA 2VWYA 3MN3A 4TYHA 1QPCA 4YP8A 4NCTC 3UVRA 1O6KA 3HLLA 4I21A 4KB8A 4ANLA 2PVLA 1L3RE 4EUTA 3NNXA 3TV6A 5KKRB 4J53A 5FBNC 3VUGA 4FK6A 1YWNA 1ZZLA 3F61A 3FLNC 4YJOA 3R7OA 2R5TA 5HICA 4IWPA 4G6LA 4IZ5A 3IQ7A 2BUJA 3W2SA 5CAUA 3MA6A 5T6KA 5CEPA 4HCUA 2XF0A 3ORKA 3OWJA 4LYNA 3V5TA 2VO7A 3IW5A 4X3FB 2QG5A 2YJRA 3R02A 4RA4A 2Y7JA 3EN6A 4H3PA 5AR4A 3VQHA 2WTKC 3UP2A 1RW8A 3FMEA 2W7XA 3OXIA 5EW8A 2WTDA 2BCJA 2QLQA 2CKOA 2OGVA 4Y5QA 4ANMA 4BI2A 4DH8A 4E4XA 4H3QA 1ZZ2A 2VTTA 3D15A 5GHVA 5HBJA 3V8WA 1VYZA 4X2KA 4EH2A 3GC0A 4F7SA 2WXVA 2JAVA 2ITQA 4G34A 5J95A 5CXHA 2R3JA 4TRLA 5J1VA 4YPSA 4JRNA 1YHSA 4O0SA 3M2WA 4GSBA 4PPAA 3T3VA 4IJ9A 2VNWA 4APCA 4D4SA 5I3OA 3E87A 3GQIA 3OUNB 3PJCA 5E1EA 2G01A 4YTIA 3I7BA 4I23A 3VJNA 1H08A 2H34A 3MTLA 1M17A 3ZRMA 4QTAA 4A9UA 4FV0A 3DJ6A 2KTYA 3O17A 4Q2AA 4RT7A 4L43A 4F08A 1WBPA 5A3XA 3QLGA 3PSDA 4OTDA 3NVKI 3QCQA 4C7TA 1Q8ZA 3ZS5A 1KV2A 4AW2A 2WQEA 4UX9A 1M52A 3UGCA 1YXXA 4C61A 4ARKA 2O3PA 2WD1A 3KL8A 4ACGA 1FBNA 3BYSA 3FL4A 4LM5A 5IQCA 2QD9A 5CANA 4IX5A 2UZUE 1I09A 1FGIA 3DV3A 4WNOA 2BAJA 4RBLA 4RQVA 4EOMA 4YZCA 4BKYA 4LOQA 3QKKA 4FX3A 4O96A 5A6OA 2PMIA 3R30A 3CR0A 2P0CA 2UZVA 3CD8A 3H3CA 4CMOA 1NXKA 3QXOA 3L9NA 1J7LA 4DTAA 3Q9YA 2PU8A 5M4FA 2XB7A 2PVYA 4LI5A 5EDPA 3Q96A 1XWSA 3WF6A 4FTRA 1H4LA 2BR1A 2BRBA 2REIA 4IC8A 4MNEB 5FLFA 2H9VA 5IMXA 2ZVAA 3IW4A 5C9CA 4A9SA 5DWRA 2W1EA 1OIUA 3RPVA 4OTIA 1L8TA 4S31A 2GTNA 4RC4A 4EEVA 4BVUA 2AC3A 4C4EA 1PMEA 3PXRA 5BNJA 2JDTA 3A61A 3LHJA 3Q53A 2RL5A 2GHMA 2IVVA 4KSPA 3E3PA 2GHLA 3A99A 2W96B 3MFTA 4RVTA 5K5NA 5AR5A 2QOLA 3KK9A 3ULZA 2R3HA 1JQHA 4YBKA 4YBJA 3CQWA 3MPMA 5GJFA 4JS8A 2WPAA 3QTQA 1GZKA 1NT2A 4DGLC 3KXMA 4BDAA 5H9BA 3ZO1A 3PY1A 3VHKA 4BI1A 1OL6A 3QLFA 2W9FB 4O1OA 2WMQA 3PY0A 5C03A 3NIZA 3MTFA 5BVOA 3R63A 2RG6A 4U41A 3UVQA 2UZDA 4L01A 4E5BA 4FKPA 4E3CA 3BHTA 3FMKA 5CNNA 3WIKA 5CSVA 3KQ7A 3Q04A 3ZSHA 3VULA 1V1KA 3CTQA 4QMWA 1PXMA 3NZ0A 5D1JA 4RVMA 3LCTA 3LPBA 2C0OA 4NFMA 4OUCA 5ANKA 3KREA 2XEZA 2PE1A 2R4BA 3HAMA 3Q9XA 2W9ZB 3IW8A 2X8EA 2PZYA 2CNUA 4RGJA 2C6IA 4CGAA 2WEIA 1TVOA 4JR3A 2UUEA 3FMJA 4IVBA 1NY3A 5DG5A 5I3RA 3DKCA 3ORZA 4YJSA 3IKAA 3DTCA 2FVDA 3QX4A 4FG7A 4AZTA 4IACA 5A4EA 1BUHA 2CPKE 3CCNA 4FKGA 2VWIA 2WU6A 1KE9A 5CZIA 4GEOA 4IAKA 4V05A 2W4KA 5B7VA 5K3YA 1OZ1A 3PP1A 1WMKA 4F1MA 4QMVA 2BKKA 4I6BA 4Y46A 2ACXA 3C0HA 3FC1X 2QI8A 5LVOA 5FEEA 4JBOA 2CHLA 3BBTB 3FLWA 2OBJA 4UV0A 3F3TA 5HGIA 5CEQA 3FZSA 2XYNA 3C4ZA 3RPYA 4I22A 1KWPA 1PKGA 2X2KA 2C5XA 2B54A 5H8BA 2WMBA 4L7SA 3F66A 2B1PA 3WIGA 4CQGA 4F65A 2VUWA 1YDRE 1XH4A 3FPMA 2ZB1A 1YXVA 2ETKA 3LM5A 5JFWA 4EH4A 2R3LA 2C69A 4XNEA 2O5KA 4B99A 2LGCA 1XH9A 1H1SA 1XHAA 2C5NA 1XBAA 2ITPA 3O7LB 3FKLA 4D9TA 3R2YA 4F1OA 2H96A 2BHEA 1IAJA 4OGRA 3PY3A 4KIPA 5HHWA 3TDVA 3UOJA 3WZDA 2I40A 3ORTA 4J95A 4EC9A 1MQBA 3R8VA 1BL7A 3GCVA 2R3IA 2PWLA 2F2CB 2X2MA 4QMYA 2Y6MA 3R8UA 5JFXA 2Z2WA 4D0XA 3ENHA 3FI8A 2ITTA 3WZUA 4CZYB 1PXNA 1DS5A 3NCZA 2YAKA 5EI6A 3ZBXA 4O0WA 1U5RA 3BU3A 3S2PA 3PXKA 4EKLA 3GP0A 4PP7A 2ZB0A 4Z9LA 4ITIA 3BHUA 1Y6BA 2GNHA 2P33A 3KFAA 4FYNA 4AG8A 5AUTA 5CF4A 4J7BA 3DBDA 3SOAA 4JOAA 3DXNA 3R8PA 5CF6A 2BZHB 4FZ7A 4CKIA 2WMUA 5CX9A 3TV7A 2JC6A 4AU8A 2XA4A 2BRGA 4IWDA 4CZUA 4GK3A 5LMBA 4IZ7A 3DLSA 1FOTA 1ZOGA 3SXSA 1R1WA 4D2VA 5IQFA 2HWOA 4HZSA 2YJSA 3RAHA 4E6AA 1LPUA 3EQGA 4E6QA 2XYUA 2E9NA 2PMLX 2IW8A 3R9DA 4I6HA 3D7TA 4R5YA 5CLPA 5CQWA 4N70A 3POZA 4HZRA 4U40A 4ANSA 5CI7A 4K6ZA 3RNYA 3VBXA 4V04A 4QMLA 4XV1A 2QOCA 4FSMA 2UW5A 2XJ2A 2XP2A 4CCUA 4WSQA 3R04A 4FG9A 4TWNA 4NEUA 3KCFA 3I81A 4MXOA 3SC1A 2CGWA 1TQMA 4AGWA 2GNFA 2V62A 3OS3A 3F3UA 3O96A 3QZIA 4BB4A 5DMZA 5CF5A 1Z9XA 3VS4A 3R1YA 4Q5HA 2BMCA 5IA2A 2GQRA 5HIDA 3NUPA 4TYJA 5I4NA 5L3AA 2EWAA 3D14A 4EC8A 3CP9A 4C0TA 3QQGA 2PZIA 2WMVA 5EDRA 3KEXA 1KSWA 2VTRA 1CKIA 3JVSA 4RVKA 3C4FA 3OWKA 4OBQA 3VUTA 2BTRA 5HE2A 4AT4A 3F2AA 4AA0A 4C36A 3LXLA 1ZYCA 4C4JA 3FKNA 3FZTA 4GYGA 2PY3A 5AUVA 3BV2A 3UO5A 3MVMA 3NW7A 2J0MB 3IK3A 3KB7A 5E92A 4ZJIA 3QUEA 4KKGA 5EQEA 1B6CB 3HV6A 4JAIA 4RJ7A 5EOBA 2PZPA 4HGLA 4YURA 5J9YA 3M11A 4AA5A 1XR1A 4GL9A 4FEUA 3LFQA 4M8TA 1ZOHA 3O8PA 4YJRA 2QQ7A 2ZDTA 4BYJA 4O81A 1YI6A 3NYOA 5HLWA 4E4LA 2Y0AA 4FTAA 2HOGA 3ORMA 2EB2A 1APME 2PZRA 3HEGA 4QOXA 3TZ8A 5BUEA 2PUIA 4XLIA 4RJ5A 3DKOA 2XRUA 4YLKA 4E26A 2HZIA 1YW2A 4RWKA 4Q9ZA 4ERWA 4NWMA 3AC2A 2OJIA 3K3JA 4L45A 4C8BA 5K4JA 4FF8A 3TV4A 2BFXA 1UU3A 4CFMA 4TT7A 5CSHA 2R3NA 3FQHA 5HCYA 3TUCA 4IDTA 4MBJA 5E1SA 5LVLA 3RK7A 5JZNA 4BTMA 4F09A 3OXZA 4MH7A 4ASEA 3KULA 3OUKA 2X7OA 4X0MA 3IW7A 4A9TA 2OU7A 4O84A 4DGMA 3OOMA 2CN5A 4LMUA 1PRYA 3DZOA 3OF0A 4TNBA 2HENA 4U5JA 3TL8A 3EYGA 4I94A 3NUXA 5HIEA 5JEBA 3Q4TA 4RC2A 5AWMA 5L2SA 3GFEA 2Q0BA 3LVPA 2B9FA 4FNZA 2GPHA 4ZXTA 3UMWA 3ZZWA 3TT0A 2FSMX 2O8YA 3F7ZA 3TUBA 4K33A 4BYIA 3LE6A 3LFEA 1Q8UA 3TZMA 2C3KA 2PZ5A 3RALA 2ZMDA 3E88A 3QYWA 1OBDA 3FMHA 4LRMA 4DT8A 1ZWSA 3TTIA 3COKA 3MB7A 4ORKA 2GNLA 1GIHA 4GU6A 4M0ZA 4QTBA 1TKIA 4EOLA 3NYXA 4IAFA 5ANEA
chains in the Genus database with same CATH superfamily
3R9OA 4U79A 4QP7A 4G3EA 4AE9A 1H00A 3IW6A 2BAQA 5HO6A 2C4GA 3BU6A 2J6MA 2QO9A 3PG1A 4FZDB 4XV9A 1PXIA 3QL8A 4IADA 5D7AA 4FKIA 1VJYA 4K8AA 3RPSA 4FBXA 5I0BA 2SRCA 3KMWA 3RI1A 4CLIA 1Y6AA 3AC5A 4FSRA 4ZTLA 5FM2A 3VWAA 4CFUA 2YITA 3HL7A 3WZJA 5C4KA 3QRIA 3ZU7A 4LGGA 4NM5A 4UY9A 3R7YA 3R7VA 3LQ8A 4TL0A 2HY81 5KMNA 3CBLA 4FT7A 3LJ0A 3CD3A 5IA5A 4ZK5A 4O4CA 1JPAA 4EH6A 3B2WA 3VBTA 2X9FA 3SV0A 4CNHA 4XLVA 4TYIA 3N4TA 5AR7A 1XBCA 1BI8A 2GS6A 2RSVA 2IPXA 2OXXA 4WNPA 4C3RA 4IMYA 1NW1A 3BRBA 5EKNA 2XARA 5EHYA 4M15A 1WBOA 2XKDA 4RFZA 2B55A 1WBNA 5ETCA 2XNGA 4HNIA 3TWJA 4BCGA 3AGMA 4F4PA 4QDEA 3LCDA 5C1QB 2C3LA 4FZFB 4C4IA 4QNYA 4BDFA 4YTFA 4QMTA 5H8EA 4IXPA 4YJPA 4NIFA 5I9XA 2R3PA 3KC3A 3M42A 4NSTA 4V0GB 2DWBA 5AP0A 5EK7A 4R7HA 4ANBA 5K5XA 3E92A 1ZRZA 1IAHA 4R7BA 4DT9A 3CC6A 4YMJA 3A7GA 3H4JA 3PRIA 4MF0A 4DEBA 3EZVA 4LMNA 4XV2A 5JFSA 5FXSA 4O4FA 2E9VA 3U8WA 5DVRA 3C7QA 1UNLA 4PDOA 2QOIA 4BIEA 1SZMA 5CSPA 3TNQB 4GCJA 4IWQA 2BRHA 3D94A 1JKLA 1HCKA 3HMOA 4BF2A 2X8IA 1SVGA 3KY2A 3R28A 2F7ZE 3QCXA 3QD0A 4FNYA 3QD3A 2XK4A 4FUYA 3GBZA 4FUXA 2JKMA 3U54A 1P4FA 3LFCA 2CN8A 3AQVA 2V7AA 5K4IA 3W0NA 1WVYA 3LKMA 1R39A 3QCSA 4W9XA 5HI2A 3QTRA 2PTKA 3UYSA 2IZUA 5L2WA 4FV7A 3OW4A 3S4QA 3EZRA 5E8WA 5LWMA 4P7EA 3OCGA 1H1RA 2AUHA 2R64A 3V01A 4XP3A 5IMEA 1LP4A 3PXFA 4FI1A 4EZ5A 4O6LA 3ZXTA 5JT2A 4O27B 2Y4PA 1YI4A 4PTCA 2ZM3A 4IZYA 4K9YA 2IW9A 1OKVA 3HV3A 4FKLA 3ERKA 4GH2A 3W33A 1ND4A 4QDVA 4L42A 2PL0A 3NW6A 5FDPA 1ZY4A 4U81A 5LMKA 3ZTXA 2ZM4A 4EUUA 3FI3A 5DR9A 4ZOGA 4ERKA 2OG8A 4W4VA 5B2LA 2NPQA 4G31A 2Y4IB 2QNJA 3RK5A 2O63A 1OKYA 2QONA 1RDQE 3LFAA 4L3JA 3UG2A 3ZEWA 4H3BA 2VX0A 2OSCA 5LVPA 5HNGA 5HO8A 1OKWA 4LL5A 1FVRA 3H9OA 4ZTMA 5GIPE 5IQIA 3KU2A 4DEAA 3I0OA 3NR9A 2PUNA 4EOIA 4FIIA 5HCXA 5D7VA 2NYAA 5CENA 4ZSGA 2UW7A 5IISA 2OXDA 5ETAA 2WZJA 3W32A 4IZAA 3H0YA 4EBWA 4YNOA 4D4YA 4BZNA 3Q2JA 2YHVA 1U5QA 4FGRA 4CMUA 1BI7A 4FTLA 3ORNA 2XNEA 3IGGA 2XVDA 3PJ2A 4DG2E 1H0VA 4UB7A 2X39A 5ICPA 2BPMA 4WG5A 4YNEA 2RG5A 5J7HA 3RWQA 3VF9A 3V5PA 1T45A 4DLIA 3L8SA 4BTJA 3D2KA 4FEWA 4KD1A 4QD6A 3U9CA 1DM2A 2C6LA 2ETRA 1DAYA 1M7NA 3DAJA 2HELA 3ETAA 3PSCA 3ZEPA 4BKZA 3UIXA 5L6PA 3NUYA 4B8LA 4EHVA 5HTIA 5EM5A 5BYLA 2C47A 4NH1A 2JITA 5FTGA 1P14A 2V55A 3PVWA 4FG8A 3UC4A 1CMKE 4O7LA 2YERA 5AV1A 3BHHA 4ITHA 4BDJA 2UW9A 1OVEA 4R8QA 4TNDA 3C4XA 3OWLA 4IVCA 2IWIA 4F9AA 2J9MA 4XOZA 4FV9A 4CYIA 3PXQA 4XEYA 5EYCA 2JKQA 3DJ5A 1OITA 1S9JA 2C68A 3KXHA 2R3GA 4J96A 3BL7A 1A9UA 4EWHA 4LG4A 4O0UA 3WZKA 4GV1A 2GFSA 2AQXA 4MVFA 2B4SB 4WG3A 1GZOA 1URWA 3VRZA 3DBFA 2ONLC 5ANGA 3KVXA 1Q24A 3PYYA 3UBDA 5JN2A 3FSKA 3R83A 2E2BA 2DQ7X 3FL5A 1MP8A 2V7OA 1T46A 4BY9E 4L46A 5FP6A 4DH5A 1DI8A 5DT0A 3UNJA 3JY9A 4MQ2A 3DAKA 3FV8A 4RVLA 2Y8OA 2YM8A 3AC1A 4OTGA 3UNKA 2QO2A 3N9XA 4GT4A 1GZ8A 4DH1A 4DBNA 3QF9A 4QQTA 4BDDA 2XJ0A 3OEFX 3DA6A 3MH3A 3QQLA 4FODA 2PULA 4ZZMA 2QOQA 3UE4A 4YJTA 4AF3A 3QUPA 4RIWA 3ZM9A 4KKEA 3AMYA 3EWHA 2W1DA 3MVJA 4XRJA 3WZEA 4DINA 3WF5A 1CM8A 2IEWA 4TWPA 2R0IA 3HNGA 2X8DA 3L8VA 4P90A 4WNMA 3WE4A 3GFWA 2QR8A 4G3CA 3FLZA 4IEBA 4XHKB 4QMNA 4DFYA 1H8FA 1REJA 1XH6A 3QTWA 1QL6A 3L9PA 2W1ZA 4IIRA 4U80A 3DCVA 3G6GA 1RQQA 4BTKA 4D1XA 2WOUA 2UW4A 4AOJA 5AX9A 3GC7A 3DK3A 3PE2A 3V3VA 3AC3A 3E7VA 3JR1A 3SQQA 5AP2A 4ZSAA 2IZSA 4BCJA 4B4LA 3GU8A 4BGQA 2IZTA 3VUMA 3ELJA 1ERKA 2BDFA 4N0SA 5I9UA 5HX8A 3V5JA 3ZMMA 3E5AA 4AFEA 4FKVA 3DBQA 1KE6A 1TQIA 2GFCA 1PXKA 2WMXA 3BV3A 4BKJA 1DAWA 1OGUA 2X7GA 3PWDA 4U0IA 2WTCA 4R6VA 5AAFA 3E7OA 4L9IA 2ITYA 1Q4LA 1XQZA 2X81A 4XP0A 4ACHA 2XS0A 5AAEA 3AXWA 1KE7A 3WE8A 3SRVA 4ZJVA 3PJ3A 4G3DA 5AAGA 3UO4A 4DG0E 1YWVA 5J79A 4ANQA 4QP4A 2YCQA 4IM2A 1H07A 3RAWA 3ZO3A 3JS2A 5EI8A 3TNHA 2YIRA 3DOGA 3MV5A 3BX5A 3ODYX 5IQEA 3MW1A 3FAAA 4O7NA 4ITJA 4FVQA 3VUDA 4QRCA 4DC2A 3UTOA 5HTBA 3ZLXA 5CU0A 5C26A 3ATSA 3DXPA 4RX7A 4AXDA 4KAOA 2GMXA 4C3FA 2O0UA 3U4UA 4F64A 1YOJA 1BMKA 3HRBA 2FB8A 4JX7A 4NIFB 4QP9A 3S95A 4D5KA 2YAAA 4I0TA 4KRCA 2J7TA 1Y91A 4M84A 4GS6A 3NWWA 4JX3A 4U97A 5EHOA 5BVEA 1JKTA 1U46A 1VEBA 4BCPA 2A1AB 3C4CA 3Q3BA 4NU1A 5DRDA 4HVDA 2CKEA 4XX9A 3DDPA 3KIOC 1URCA 2G2FA 3ALOA 4TYHB 5M4CA 5HBHA 4D2PA 3A7FA 5IDNA 1J1CA 5DRBA 4USEA 3K3IA 2XIZA 2FSLX 3QA8A 4UYAA 4ANOA 4DEDA 2CCHA 4NUSA 3DTWA 4E20A 3VS0A 2R9SA 4JQEA 2BAKA 1WBTA 4AP7A 1BX6A 4FSWA 2ZM1A 4QTCA 4S32A 2ZJWA 4CV9A 2IO6A 3W2OA 4XG6A 3TXOA 1PF8A 3OY3A 2Z7RA 3R7GA 3ZCLA 2OW3A 3EFLA 3BLAA 3Q52A 3SGCA 5LOHA 2RFDA 4NL0A 5IEXA 4U9AA 3P7AA 3ENMA 3ORXA 4D1SA 3UPZA 2A27A 4PPCA 5BX0A 1YDTE 2VTSA 3G0FA 3QFVA 1F5QA 4IAIA 5FTQA 3R9NA 3VS7A 3SA0A 2LAVA 3QRTA 5FWKK 4ACMA 4CEGA 3MI9A 2WTIA 1W83A 4AW5A 5HE3A 4HVHA 3GVUA 5CTPA 3P0MA 4GFOA 4MYGA 4RQKA 5CQUA 4FKWA 1PXLA 3R71A 3GCQA 5AP1A 3QKMA 3AT2A 4JG8A 2CLXA 2QHMA 2EUFB 3OTUA 4O4EA 4TYGA 5CZHA 4RFYA 4YSMA 2BZJA 3DKGA 3WI6A 4CFWA 4O22A 3NAXA 3RWPA 4DH7A 5CF8A 5LXMA 4O7ZA 2HZNA 1B39A 1FMOE 3AD4A 3QA0A 2A0CX 3A8XA 4IB1A 4J71A 4Q5EA 5HG7A 4CLJA 2CNVA 3MGYA 4X2GA 2W4OA 5TO8A 3ULIA 4ALVA 1Y8YA 4BDCA 2JIIA 3IDPA 4NT4A 4ALWA 5CXZA 4O0YA 1YWRA 4FV8A 3B2TA 4JT3A 2PVNA 2Z8CA 3KK8A 5ANIA 3LCOA 5I9ZA 2UZEA 3ZLSA 4C59A 3AC8A 4QTDA 1AGWA 1JWHA 2YM7A 4X3FC 4BDEA 5A4CA 3DT1A 3R00A 3KRXA 4GMYA 1FPUA 5KMOA 1G3NA 2XKFA 4FICA 4JG6A 4M67A 3ITZA 3R1NA 4NKSA 4LOPA 3W55A 4NM0A 4X7QA 3I1AA 5LMKC 4RWLA 4CRLA 4AN2A 4ZTRA 4FTUA 1UKHA 2XIKA 1MRUA 4IAZA 4BDIA 4BC6A 4ZLZA 2X6EA 4EH5A 4HJOA 4ZLYA 3DNDA 3R7UA 3G5DA 3EN7A 3LLAA 3VC4A 3E93A 2X6DA 2XNNA 2PE2A 3R8MA 5I9WA 2C6MA 3PVBA 5AV2A 4UMQA 3VBYA 4M69A 5DNRA 1PJKA 4GFGA 3FXZA 3RVGA 4F1TA 1R3CA 2CKPA 4PMSA 4DFUA 4X6RA 3LFDA 3Q6UA 4L44A 5EYMA 4M66A 3FZOA 4JG7A 3IOPA 5EYDA 2ESMA 3QAME 4PDSA 3NMUF 2YA9A 4ZY5A 3NGAA 4F9WA 3W16A 3ANQA 2B9HA 4E4NA 3MVLA 5E8VA 3DS6A 4PP9A 4EK6A 2CJMA 4QYGA 2PK9A 4FIJA 3VJOA 1OIQA 2WO6A 3WYXA 4S34A 3UZRA 3MA3A 2WMSA 1GNGA 5M07A 2OZOA 3G2FA 5CY3A 3MY5A 3VQUA 4F9CA 5CS6A 3ZHPC 4DF3A 5G1XA 4LFIA 3RAIA 4G5JA 5CT7A 1SYKA 3ROYA 2OXYA 2UZLA 4XUFA 3VUIA 4C34A 4R3PA 4AXEA 4K0YA 3QTZA 4RIYA 1NVQA 3W18A 4K1BA 3EQPA 3E3BX 3VF8A 4QMZA 2YFXA 2UW8A 4RLLA 4AFJA 5BYYA 1Z57A 4FZ6A 4AA4A 5FP5A 3PSBA 4ZAUA 4LV7A 3I5NA 3NUAA 3NW5A 5BMSA 4DE4A 4DFLA 3RHKA 5AUUA 5L8JA 4USDA 4DHFA 4BR3A 3EQIA 5DPVA 3O51A 4B7TA 3EN9A 5IQBA 3CE3A 5GINE 2WMWA 1OL7A 2CGUA 2QU5A 2XJ1A 4UWYA 4BL1A 4ASZA 5DA3A 3Q60A 1R78A 3DZQA 2UW0A 4LOOA 4NZWB 4V01A 5AFVA 5E4HA 2QOHA 4AACA 2W4JA 2QC6A 3GOKA 3P1AA 4KUJA 3EN5A 4IWOA 3GU4A 3PG3A 4O86A 3NYVA 5CWZA 2P4IA 3FZRA 4PF4A 3F5XA 4YJUA 4FTJA 2BROA 4AX8A 3HUBA 3GGFA 5BVWA 2YABA 1BKXA 1FINA 2I6LA 3F3WA 4RIYB 4O0VA 2W5HA 4WKQA 4ZZNA 4FA2A 5ACBC 3KRWA 3NRMA 5CVHA 4AXFA 4HPUE 5F9EA 4XCUA 4JLCA 3P78A 3TNIA 3COHA 3ZYAA 2KULA 2WMTA 1FVTA 3DJ7A 3O8UA 5A9UA 3QZHA 2NP8A 2W99B 4ZMEA 3ALNA 3R8ZA 3C9WA 4M0YA 3BQCA 3V51A 2BRNA 2G2IA 3ZH8A 4YC6A 5HD4A 5K9IA 1H1WA 4YZ9A 4QP1A 2QHNA 2YIYA 4GYIA 3DKFA 4CFFA 3ROCA 3PLSA 4PDYA 4X2NA 3HMNA 3OP5A 3AMBA 3K5UA 4FT0A 1M2QA 4RA5A 4MXAA 3LMHA 5J9ZA 1OPLA 3D0EA 4AGUA 5A4QA 3NUSA 3W2QA 1X8BA 3HV4A 3PIZA 5JQ8A 4FE2A 1W0XC 3CQEA 2YM3A 5D12A 5D9HA 3BWJA 3QTXA 3A8WA 4GUBA 2W06A 4AN3A 3PLAE 1QCFA 3AOXA 3BIZA 4IM3A 2PVHA 4EOSA 4ID7A 1QPDA 4G9RA 4PL3A 2PUPA 2C0IA 4MBIA 3UVPA 5DLSA 4A06A 4CVAA 4XJ0A 4ASXA 3LFNA 4WA9A 5KMMA 5IQDA 4BTFA 4R5SA 3DDQA 4BCHA 5GZAA 3RINA 3L9LA 3IOKA 5E8XA 3CPCA 3V8TA 3MSSA 4PMPA 3BYUA 4IX6A 2GQGA 2JDSA 2RFEA 2WOTA 3VS5A 5GIOE 3F3VA 1H1QA 2R2PA 3KXZA 2JDOA 2JBPA 4GT3A 1W82A 2VU3A 3FKOA 2WGJA 3SW4A 2YWVA 5EDQA 5J9LA 2YEXA 1UU7A 3RPOA 3PVUA 4O4DA 4EH8A 4QMQA 4IC7A 4FTKA 4MK0A 4XBUA 1W2FA 4YO4A 2CNQA 3KMMA 2B7AA 2XZSA 4FKUA 2OH0E 2JAMA 4ZIMA 4AT5A 3GEQA 3DB8A 5KHXA 3PP0A 5AUZA 2UVXA 3PXYA 4R7IA 1Z5MA 5HKMA 3ZOSA 4BCIA 4FKJA 4GVAA 3HYHA 3Q5IA 4ENYA 4Y73A 3WYYA 3BBWA 4RJ8A 5DH3A 4ZSLA 4C2VA 2OF2A 3K2LA 2X9EA 3LM0A 4IX3A 4HYUA 2QCSA 5HU3A 2QODA 3G0EA 4DFXE 3E8NA 4O83A 3VS3A 1JKKA 3DLZA 3QQHA 4RSSA 2VTQA 5GZ8A 2F9GA 3NAYA 3QUDA 4TN6A 2W1IA 3UZPA 1F3MC 4UZDA 3OCTA 3GCUA 1PYEA 5AP6A 4EH7A 1W7HA 2NRYA 4FIGA 3RKBA 2C6TA 3MY0A 4KWPA 2HXQA 4U42A 4FTQA 2WMRA 1GIIA 2XIXA 3GC8A 4A4XA 3U9NA 4EOPA 2VO0A 2ZFYA 1LEZA 5IQHA 5HTCA 4OAUC 1GOLA 3HP2A 5HESA 1PW2A 5IUIA 3ZFYA 4GIIA 4J98A 3MFSA 4F7LA 4IAYA 1PMUA 4MXXA 4R77A 3OG7A 4HCVA 4WBBB 2ZYBA 3FLYA 5CNOA 3DFCB 4Q9SA 4K18A 2XMYA 4FOBA 4TTHB 1OPJA 4XH6A 3ZC6A 4AN9A 5KNJA 4JI9A 1SVEA 4I41A 4QMUA 4G6NA 2YN8A 3ZM4A 3OFMA 4YHFA 2X1NA 3FDNA 3GU6A 5JZJA 2YIXA 1PHKA 4K77A 5CI6A 2QKWB 2XK9A 3H9RA 4BWXA 2VWBA 3PIXA 4U45A 4IQ6A 5LARA 4CG9A 5L2QA 3FBVA 4HPTE 3CTHA 1UV5A 4FTNA 2C5VA 3HV5A 1NVSA 4FKTA 2NNWB 3QTIA 5KCVA 1CDKA 4QTEA 4N57A 2IVSA 3A2CA 4FTIA 4NM7A 2YISA 1JBPE 2PYWA 5KZIA 5AUWA 3WOWA 2ITZA 3L8PA 4EH3A 4H39A 4EJNA 4BDKA 1UWJA 3GCPA 3TG1A 5EHLA 4XYFA 1W8CA 2FSTX 2XH5A 5F20A 2EU9A 5J8IA 4G3GA 4RWIA 1NVRA 2WQNA 3ACKA 3UOHA 5I9YA 2WKMA 3CSVA 4A07A 3BU5A 3TIYA 4AWIA 2FGIA 5TT7A 2DYLA 2B9JA 2HW7A 1CSNA 3A4OX 5C01A 3S0OA 4GKHA 3OROA 4IHPA 3SRVB 2CDZA 2W5AA 2J0KA 5C8NA 3Q5ZA 4IBMA 4E1ZA 3PWYA 3BGPA 4O38A 4RIXB 1WCCA 4XG4A 5FTOA 4FIHA 5JKGA 4H05A 4NYEA 2QLUA 3GU7A 2ITVA 4FEVA 2H8HA 4FTOA 3MFUA 4Z16A 5TOZA 2ERKA 4D4VA 3FQSA 4MWIA 2QOOA 3PPZA 1ZARA 4O91A 2B0QA 5AV0A 3TNWA 3DAEA 1YDSE 4EK4A 4F7NA 3GUBA 3D2IA 3IS5A 3UQCA 4KA3A 4GK4A 4FYOA 5HG5A 4JNWA 4RIXA 5JQ5A 3RM7A 3MJ2A 4O7TA 3B8QA 3TZ9A 5DEYA 1BLXA 3GCSA 1YOLA 3A62A 3TCPA 5CAOA 4GKIA 4O7RA 2X4ZA 4GG5A 3COIA 3TI1A 3GC9A 3S00A 2YM5A 4LUDA 3KMUA 3LFSA 3SKCA 1G8SA 4P5ZA 4XP2A 2G1TA 2YIWA 4RFMA 5E8ZA 3VIDA 4K2RA 1H26A 3FZPA 5KHWA 5LJJA 4YJQA 3DB6A 5DR6A 2WTJA 3O2MA 3HMIA 2F2UA 3SAYA 4O7YA 2X0OA 3NLBA 1I44A 3K5VA 3ZO2A 3R7IA 3EYHA 3VVHA 1R0PA 2J4ZA 1Y57A 4XG3A 3I6UA 4F70A 3PJ1A 4KIQA 3E62A 3DBCA 4DGGA 3G15A 4YTCA 3TUDA 3O8TA 4PL5A 4E6DA 2FH9A 2F7EE 2GCDA 5ETIA 4ZY4A 3LQ3A 5IH6A 2XK8A 2ITNA 3A7IA 3LJ2A 3T8OA 4YSJA 4EHEA 1OUYA 4UALA 2GTMA 4II5A 3U6IA 4RWJA 2R7BA 3ZONA 3RJCA 5LWNA 4FK3A 3BLRA 3ET7A 1MQ4A 1B38A 4IW0A 4MD7E 3REPA 2J0IA 3PA5A 3H10A 3ZSGA 5L8KA 1PKDA 3RHXA 4HW7A 3FEGA 3ZLYA 4QYHA 5HX6A 3FXXA 1DI9A 4Z3VA 3PA3A 3EFKA 4P2KA 3E8DA 2R7IA 4CZTA 4FV5A 3F3ZA 1BL6A 3G9NA 5JH6A 3C5UA 4ONAA 3VW6A 1H01A 3EOCA 1SNXA 2VTAA 3BGZA 5FQDC 4F6WA 4EK3A 2XRWA 4CFVA 4FEQA 2O2UA 4IAAA 2HZ0A 3VUHA 2BZKB 2CSNA 1WBVA 1IA8A 4ZSEA 2JFMA 3DBEA 1JSUA 3UNZA 1H1PA 4A4OA 4YJVA 4HGTA 4W9WA 2XK3A 4PPBA 5JGBA 4BI0A 2GU8A 2OH4A 3VO3A 4OAVB 3LCKA 4CTCA 3FWQA 4WRGA 4YPDA 3BPRA 4P4CA 2J2IB 2B52A 5DEWA 5IQAA 3BELA 4QMSA 2PVJA 3T3UA 4EQCA 2GSFA 1JLUE 1W98A 4F9BA 5DOSA 2O64A 3MYGA 3VBWA 2UW3A 4GIHA 4EOOA 4C35A 3BYVA 4AW0A 5AM6A 2BIYA 4S33A 4M7IA 3HDMA 3MY1A 2RFNA 3KXGA 3RCJA 4NJDA 2HCKA 2C3IB 4NK9A 3AG9A 1WFCA 1XH5A 3I60A 2F49A 3TIZA 4L00A 4AW1A 5L2TA 5HZNA 3NDMA 5IKWA 3CPBA 1UKIA 3PTGA 3AD6A 5LMAA 2Z7QA 5IF1A 2XM8A 3BKBA 4M13A 3SG9A 3LMGA 4RIOA 4BHNA 2XM9A 2OWBA 4AS0A 5L8LA 4BRXA 3P9JA 3I79A 5KO1A 4G2FA 2J5FA 5AV4A 3W0QA 2WTVA 4JBVA 4ZEGA 3OVVA 1JNKA 4KKHA 3ZRKA 3OCBA 1EH4A 4FTTA 3HA6A 4A9RA 2R3QA 4FNWA 5F1ZA 2Y9QA 3CTJA 5TR6A 2YWPA 5BVKA 4Z55A 2BILB 2CGVA 1QMZA 3MPTA 3N51A 2HK5A 5IEVA 5BYZA 4E93A 3QU0A 3RAKA 2QU6A 5T3QA 4JMQA 5E8UA 3AD5A 5KMLA 3RPRA 3MESA 3GU5A 3DPKA 2C5OA 2P2HA 3CGFA 2HXLA 4KSQA 5IDPA 3QTUA 5HVKA 4L52A 2VN9A 3O23A 4IJPA 4GRBA 5ANJA 4HYIA 4MNEA 2JEDA 3NPCA 4IB0A 3MIYA 3TACA 4YU2A 2Z60A 3EKKA 2F7XE 4F7JA 4BCFA 4ZY6A 1PY5A 4KS8A 4RMZA 5EKOA 3MH0A 4QQCA 2WHBA 4FSTA 2V22A 5CASA 2JGZA 3DGKA 1O9UA 4U7ZA 1OI9A 3L9MA 2B53A 5JRQA 2IN6A 2RKUA 1ZYLA 3WARA 3PFQA 4YR8A 3SVVA 4QO9A 2WQBA 2QURA 5AEPA 3NCGA 3W0RA 4G1WA 3OWPA 3HUCA 3UQGA 5J1WA 4ACDA 3HMPA 4PY1A 1YKRA 2BDWA 3EQRA 4EZ3A 4F0GA 2YZAA 4CMTA 3N4UA 2W1HA 3BI6A 3H9FA 1YXTA 2OIBA 5FRIA 5A46A 1Q99A 5A4TA 2XK6A 2UZNA 3QC9A 3SLSA 2XAMA 3P86A 1LR4A 3GB2A 4HNFA 2CKQA 3V5LA 2X4FA 3DK7A 4XMOA 3RTPA 4BBMA 5JGDA 2O65A 5EM6A 3P4KA 4UMRA 5EW9A 2R3OA 5IH5A 3QGWA 5AP7A 2ITUA 3Q4ZA 2F57A 3QHWA 1IG1A 4W8DA 5EW3A 4D58A 3TM0A 4W4XA 4PRJA 3BQRA 4AUAA 5HORA 4BCQA 5EM8A 4JQ7A 1G8KA 5C4LA 2OO8X 4AXAA 3LXKA 2VX1A 5CU3A 4EKKA 3LCSA 3ZRLA 3AC4A 1KE8A 2VWUA 1HOWA 4QMPA 1FQ1B 1PMVA 4G3FA 5CVGA 5BPYA 3EMGA 4TKSA 5E91A 3W2CA 4UN0C 3DQXA 2Q83A 1V0BA 3OBJA 3ZFMA 4JIAA 3UC3A 4I0RA 4C4HA 4L3LA 4BIDA 1OB3A 5D11A 3T9IA 3U6JA 3TJDA 4RZVA 1YVJA 3VW8A 2C1AA 1GJOA 2XNPA 1M2PA 4I5HA 4PWNA 4I20A 4CFXA 2YM4A 2IG7A 2YLEA 3GI3A 5AA8A 1JKSA 1Q61A 2PUUA 3O0GA 3WILA 3QQJA 4QP2A 2VWVA 2YM6A 3QX2A 2QOFA 4YHTA 3KVWA 4I1ZA 2HWPA 3UQFA 4Z7HA 1JOWB 1VR2A 4NTSA 4BICA 4PNKA 4CRSA 4EWQA 4YC3A 1IRKA 3W10A 3BCEA 4EOQA 2VTMA 3O50A 1Q5KA 3BHVA 2VX3A 5HLPA 4ZS4A 3RBWA 3KA0A 3Q4CA 4F9YA 4EH9A 3IDBA 3QRUA 4QQ5A 2WB8A 2QOBA 3FYKX 4DCAA 3E8EA 4FTMA 2ITXA 4NCTA 4ZTSA 4AAYA 4TWOA 5M57A 5HD7A 2WTKB 4F78A 4X21A 4DGNA 3VONA 3PIYA 5F94A 1GY3A 3QC4A 4CFNA 2J0JA 2PVRA 3L8XA 2C6KA 3LXNA 4FKRA 3U55A 3C4WA 5JRSA 5G6VA 5M4IA 1J3HA 4KIKA 2PVMA 4I6QA 4JDKA 2BTSA 3DK6A 4GUEA 4WHZA 1ZXEA 2I1MA 2WQOA 3EQCA 5FDXA 4YJNA 5AA9A 4W4WA 1IR3A 4FSZA 5BQ0A 5HIBA 3PXZA 3R73A 3ZLWA 3OC1A 3B8RA 4QPSA 2VNYA 4PUZA 4WG4A 3PZHA 4FV1A 5EQYA 2VGOA 4WRSA 3QGYA 4L68A 4NM3A 4QEBA 2XEYA 3BE9A 3VS6A 4L8MA 2JIVA 4NTTA 4C57A 4XS2A 4OLIA 4FR4A 3E64A 2AEGA 3PUPA 4KBAA 4QP8A 5KZ0A 1WBWA 3SG8A 4KS7A 1Q3DA 4XG8A 5HVYA 4DTBA 4BCMA 2PPQA 2YCRA 2IVTA 2R3KA 2FYSA 2HZ4A 2IZRA 3QYZA 1UWHA 3UOKA 4MXCA 4W8EA 2JKKA 4DGOA 5IUHA 3D5XA 2G9XA 3GXLA 3BE2A 3P08A 4C33A 4LUEA 1VLRA 1VYWA 3DY7A 3Q9ZA 3RK9A 4EYJA 5L4QA 3LQ5A 3CEKA 1KOAA 4JJRA 4OTPA 4UYNA 5FXRA 4L53A 4F63A 2VAGA 4X3JA 4BFMA 3ZUVA 3D7TB 1V0OA 2Q0NA 3QTSA 5EM7A 4AGCA 5BVFA 3PPJA 4A9YA 5IU2A 3W0MA 5IA3A 3RGFA 4MNFA 4ZP5A 1YXSA 4UBAA 4YTHA 4D28A 2BFYA 2C6EA 3NSZA 5KX8A 4FEXA 4DG3E 5CYIA 3OMVA 2EXEA 4IM0A 5C8MA 4B6LA 4M68A 3RZBA 5DI1A 4RJ6A 4QMMA 4BDHA 5KMK