3OTVA

Crystal structure of the intracellular domain of rv3910 from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
254
structure length
254
Chain Sequence
VQLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADRTEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 70
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3otvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3otvA01
3ORKA 2ITOA 4ASEA 2Y8OA 4FICA 1BI7A 4EOPA 2BDJA 2G1TA 2YISA 4LMUA 5CS6A 4Z55A 4KS8A 4NM5A 2C6TA 4A9SA 4RFYA 4XLIA 4DGNA 5TF9A 3ZUTA 4LUDA 3HVCA 4OAUC 2YJSA 1QMZA 2GS6A 2QR8A 3EKNA 2IW8A 1GZKA 2R3OA 5J5TA 4KINA 3SVVA 4GYIA 5A46A 1OL5A 3WOWA 3C9WA 5E8ZA 2J0KA 2F2UA 3UO5A 3OC1A 4AZVA 3IONA 4BDCA 2GFCA 3Q2MA 3JVRA 1J91A 2X8DA 4HPTE 3UIMA 5BPYA 2OI4X 3LMHA 1E1XA 4YTIA 2WQNA 2PMLX 3JVSA 4CT2A 3TL8A 5E91A 2NPQA 1WAKA 4YHJA 1Q99A 1U54B 3CTQA 4U97A 4FZFB 1KE6A 3D2KA 3QFVA 3W2SA 4QMLA 4F6SA 2C0OA 3KGAA 3NIZA 4QMUA 4OT6A 1KE7A 3HA6A 3F88A 1XBAA 3L9LA 3MA3A 5CZIA 4KIOA 4C34A 3MN3A 3TJDA 4UYNA 4CCBA 4DA5A 3TIYA 5BVWA 5DR6A 3A7FA 3BHUA 3GT8A 4LRKA 3FI2A 5HCYA 3ORMA 4FZ7A 4HW7A 1W84A 3EQGA 4AS0A 5EHOA 2QLUA 3VBQA 2C6OA 1M2RA 3CJGA 3GC9A 2OH4A 4FTTA 4M3QA 3SD0A 4ZS0A 1CSNA 4HGEA 2G2HA 4GG5A 5DHJA 3DTCA 2PUUA 1A9UA 3PIXA 3TJCA 4YSJA 5LMKC 4YC3A 2OFUA 2BRMA 4O7SA 5LCKA 3UZRA 3PXKA 3F3ZA 5KCVA 3KMMA 3ZRMA 3UGCA 4IAAA 3VRYA 4QTCA 4BF2A 3IW8A 1OI9A 4XYFA 4D9TA 4QP7A 5I9XA 4RIYA 3R7IA 4RC3A 4CEGA 4E73A 4QTBA 5IUHA 4BI2A 5B2KA 1YRPA 3C4EA 3QZGA 3CR0A 3PY1A 4UB7A 4XG3A 3IW4A 4FTKA 4JOAA 4V04A 4D0XA 5A54A 3BEGA 3QUDA 3O2MA 3PRIA 4FIIA 3RCJA 5C1QB 3TTJA 5DR2A 1WBPA 5IU2A 2OU7A 3BLRA 3EQHA 4DEHA 3KRRA 4NW5A 1IA9A 4BI1A 1UWHA 4XG8A 4DH8A 4L44A 4PWNA 3EMGA 3RINA 2X0GA 4EH5A 5IA1A 2ZM1A 4WSYA 1GNGA 1Q8YA 3G9NA 4XP3A 4WBBB 3DOGA 2FSMX 4QYFA 5D9HA 2RFDA 3QTXA 3V5LA 4FTMA 4BKZA 4KBAA 3CBLA 4FK3A 4ONAA 1YW2A 1ERKA 3TDVA 4BFMA 2R7IA 1PRYA 3QHWA 3AG9A 2C0IA 2WOTA 2Y9QA 3U9NA 4B99A 2PZYA 4W4WA 4XV1A 5CQUA 4BZOA 4DBXA 4I5HA 5ANIA 4TYJA 4KABA 4QMNA 4DN5A 1XBBA 5CY3A 3NUAA 3ODYX 1OL6A 3RAWA 4ENXA 5HIBA 3EHAA 4U6RA 4ALUA 5HCZA 4EQMA 3G0EA 5CWZA 3VUHA 5FG8A 4GFOA 3G5DA 1FBNA 3LJ0A 2PUIA 4QP9A 2VGOA 2BFYA 3OCTA 4JDJA 4M67A 4BCOA 3GC8A 4P5QA 3P86A 4I41A 1AQ1A 2C3IB 4RZVA 2O5KA 3C50A 3POOA 4BDEA 5GIPE 5K3YA 3EYHA 4ZTLA 3TNPC 3VJNA 2JAVA 1OKYA 3PJ2A 3OTVA 2NP8A 4QQJA 4WKQA 5CU6A 4OTHA 1IR3A 3Q9WA 3ENHA 2XZSA 5HG7A 4AZTA 3MH2A 1SYKA 5C8KA 4EORA 3HV6A 1CM8A 3CGFA 3COKA 3Q4ZA 3UNKA 4DITA 4LOQA 3PY0A 4NW6A 2VO0A 5CAUA 5AP5A 3F5PA 4F7LA 3K3JA 4O7LA 1NVQA 3WF7A 3DAKA 4BKYA 2ZOQA 4RG0A 2J2IB 3WARA 2V5QA 4UWBA 4H3BA 2NRYA 2YA9A 1KV2A 4AA4A 2BILB 3EN6A 3BU3A 3NSZA 5JEBA 1WBSA 4TZRA 2LAVA 5HG9A 1PMVA 4F99A 4G9RA 3QD2B 4U8ZA 5IMEA 3CPCA 3VUIA 3UE4A 1TQPA 2VRXA 4FR4A 2OXXA 4GJ2A 4QPAA 3ZS5A 1MUOA 1Q62A 2B54A 2RGPA 2WTKB 5EYDA 3O17A 2ITTA 4HJOA 3S1HA 4JR3A 4LFIA 5AV2A 2YERA 3OWKA 2NRUA 4KKHA 2VX3A 3D4QA 5L3AA 2EWAA 3IO7A 3IS5A 2G2IA 4DGOA 5L2TA 2UZNA 1MQ4A 3ZXTA 5A9UA 1M7QA 3DAEA 1Y8YA 2WMSA 2J6MA 2WMVA 2XK7A 3LCKA 3RP9A 2KULA 5HVKA 3VS1A 4G31A 2WAJA 5FUTA 2W1DA 2GHGA 4NWMA 4PRJA 5FEQA 3SOCA 4DGMA 5M09A 2BAJA 3ANRA 4C4GA 1U46A 4C62A 4BCIA 1L3RE 3QYZA 3U6JA 2XIXA 1BX6A 4R3CA 4O83A 3HUBA 4IVAA 3SC1A 1Q97A 3MBLA 2V62A 4MXZA 3LM0A 5EI6A 3NUXA 1TVOA 2ZB1A 2R3JA 4A4XA 5HTIA 3WI6A 5HZNA 1S9JA 2OGVA 4DCEA 3ULZA 1VJYA 1WBWA 5CAVA 4O7YA 1KE5A 2F4JA 2GFSA 2FSTX 3CY2A 5L2QA 3TWJA 5GZAA 1JKLA 4PL3A 5AUZA 3C4WA 1GZNA 2R9SA 4ZSEA 3PA3A 5HOAA 5JN2A 4KRCA 4ID7A 4OLIA 4G5PA 2JIIA 2H96A 2BZKB 3U6HA 3PVUA 4EK5A 2JD5A 1KE9A 3BHYA 5DE2A 3D14A 3GFEA 4DEGA 3QALE 1M52A 3QGYA 2DYLA 3HDNA 5LWNA 4G3GA 2GNHA 3EN4A 1DI9A 2O3PA 3GB2A 4BBFA 3PTGA 1PXJA 1M2QA 4RA5A 3RZBA 5AUTA 3LCDA 1YOMA 1SMHA 2GU8A 2YCSA 3C4CA 4L68A 5HEZA 1PXPA 3VW8A 4XNEA 3BHHA 2C3JA 4ACCA 2Z02A 1PMEA 4Q9SA 2CGUA 5BUJA 5HTBA 5DNRA 2IPXA 1Y6BA 1OIYA 2I40A 2WELA 3IW6A 4HNIA 3MVHA 2R3FA 3D2IA 3JS2A 4FV2A 2W5BA 4OTGA 3ZFXA 3U51A 4DEBA 2W1GA 4EWHA 4F7JA 4U81A 3T3UA 4EKLA 2R4BA 4FTQA 4E6CA 2XP2A 5M4CA 4C4IA 4YLKA 2UZUE 4X3JA 2C4GA 3KL8A 4KSQA 4L9IA 3RWPA 3EIDA 3ORNA 3DBFA 2BHEA 1ZYCA 1I44A 3UQGA 4BWPA 1OITA 1YWRA 2ACXA 3BX5A 3P0MA 3LFBA 3LZBA 4OUCA 2Y4IC 4GUBA 2XBAA 5CF8A 3DAJA 3LFAA 1U54A 4R3RA 4F6UA 3KRLA 3ZUUA 1IAJA 4FV4A 3LW0A 4DH7A 3FSFA 2CN5A 1OPLA 2WTKC 3EB0A 4MNFA 1KSWA 4L53A 4R7HA 3LOKA 2PZRA 3R01A 1ZOEA 4KWPA 4UMQA 5HCXA 4L8MA 5HVYA 2IW9A 5E8SA 2I7QA 1R78A 2YFXA 2WQOA 4TT7A 3DBCA 2WGJA 4AZFA 5ICPA 1J1BA 3AC1A 5DMZA 3NVKI 3H0ZA 4FVQA 1OIQA 4K8AA 3JR1A 5I9WA 1SNXA 3QC9A 2BDWA 2CJMA 4M15A 5IH6A 4CV9A 4UN0C 4X2NA 5AUUA 5B2LA 3PXZA 5T3QA 1Q24A 1ZYDA 5CSWA 4J52A 5IEYA 2YM8A 3GCVA 4CRSA 4FVPA 2DWBA 2R3HA 4DH3A 5BYYA 4JDIA 4AA0A 4F9AA 4BIDA 3BEAA 1MRUA 2YCQA 2OZOA 4G2FA 4F63A 3NCZA 3OT3A 4FT7A 4NCTC 3OBJA 3DXPA 3AQVA 1PXOA 2A4LA 1ZMWA 3NUUA 3AC3A 2OWBA 4CG9A 4YJQA 4L01A 3PRFA 4RT7A 5EDRA 4L3JA 2IZUA 2ESMA 4Z9LA 5JT2A 2H8HA 1V0OA 4F1MA 4W8EA 4EOIA 2BVAA 1H8FA 2W9ZB 4NZWB 3R71A 3UYSA 4M66A 3CEKA 3LJ1A 2XH5A 4H58A 2HZIA 3QQKA 3R7VA 4Q9ZA 4ZSGA 4AW5A 3JUHA 4LGHA 4GV1A 1JAMA 2W96B 2YM7A 5KBRA 3DDQA 2QOLA 2UZLA 4D2PA 3QC4A 4XRLA 2HELA 5IQBA 5IQHA 5J95A 5AP4A 5M06A 4F64A 4FG8A 1OL2A 3OEFX 3KXHA 4NL0A 1NY3A 1H07A 1XKKA 2XKEA 3CD8A 3R7UA 3TNQB 3V5TA 3KRXA 2C5OA 4DTAA 3DA6A 2WU7A 4S32A 2W1ZA 3M1SA 4U3YA 1XHAA 3FMDA 4IMYA 4F7NA 2ITZA 3HMNA 5J9ZA 3COIA 5L2WA 3RPSA 2VD5A 3LCSA 3QCYA 3LM5A 4N6ZA 5CNOA 1LEZA 3OFMA 3FY2A 2HOGA 4N6YA 5CF5A 4G1WA 3DGKA 3KRWA 4MXCA 5C8NA 2IO6A 4FSNA 4Q2AA 4G3FA 3FMHA 3FUPA 4I6FA 5CEPA 3MVJA 2R3RA 3ZFMA 3CTJA 1SNUA 3DK3A 4V05A 4I4EA 5FTQA 3LIJA 4C59A 4DG0E 3MESA 4EOSA 4PDSA 2Z60A 3P78A 5ETFA 3G33A 2CCHA 3C5UA 5CU3A 2XKDA 3NIEA 2A1AB 1Q41A 3MPMA 4J98A 5EYMA 3H9FA 4D2WA 3A4PA 5TOZA 3GOKA 1Z5MA 3DDPA 4V01A 1LR4A 5G1XA 3RPVA 2PVLA 3I5NA 2J90A 5AV0A 4JG7A 3QTUA 4RX8A 4CYJA 5KKRC 3VUDA 1ZYLA 4YZCA 3KVWA 4IAYA 3CE3A 4X7QA 3M11A 2YIRA 4V0GB 5DIAA 1YHVA 4O7NA 3ZM9A 4I5PA 4ZSJA 2W17A 4TRLA 2FSLX 4RVTA 4E8AA 4EOQA 3OUKA 3WZDA 5IEXA 5L2IA 2GCDA 4M69B 5CANA 4QO9A 2CMWA 3AC4A 4RVMA 4XBUA 4JX7A 3FQEA 4CYIA 4X3FC 5DT4A 3EZVA 3IOPA 3R8MA 4C3FA 4E6AA 4CZTA 5E8XA 4FTCA 4XX9A 5HU9A 4HYIA 1KOAA 4C02A 2R64A 4FL3A 3MFSA 2QOHA 5HLNA 1M14A 2GHLA 3FLQA 5HO8A 3R1QA 3BWFA 3QA8A 3VUTA 2OKRA 3EZRA 4BCGA 1JQHA 3FQSA 4FGRA 5A4CA 4QYGA 3UZTA 2UW8A 2FSOX 5E4HA 3QTWA 4M68A 2XNNA 1B39A 4WG5A 3F5XA 3V01A 4DT8A 4BDKA 3S0OA 3V5WA 4NK9A 3VJOA 4WNOA 2B7AA 2BRGA 2F57A 5FM2A 4FGBA 4QMPA 1ZRZA 4PTGA 4BCKA 4E93A 3SXFA 3ZSHA 2BKKA 2C5NA 3AD5A 1PMNA 4FSYA 4UY9A 4GG7A 3PP0A 2ITXA 4YZBA 2OSCA 3GU7A 3R1YA 1P5EA 2PVYA 5HKMA 1QL6A 4X2GA 2HWPA 3MA6A 4EHEA 4HPUE 4ANOA 3KULA 1JSVA 3GVUA 2FA2A 4X2FA 1UU9A 4I5CA 3PIYA 4WOVA 3WF6A 1M2PA 3JXWA 1XH7A 4JRVA 3TZ7A 2GNGA 3PFQA 4ACGA 3KMUA 4CTBA 3I79A 2UZEA 2HXLA 5CASA 1Y57A 2C5YA 3K5VA 3Q53A 4FKUA 1K3AA 4XBRA 5IQIA 3F66A 4JG8A 1FINA 3T8OA 4D55A 4RSSA 1U59A 2PMOX 1GOLA 4R6VA 5D41A 4O21A 1XQZA 5GJGA 5DLSA 4DTKA 3KCKA 2UZBA 4F9YA 4CKJA 2CGXA 4E4NA 5CVHA 3MY0A 5B2MA 2X8EA 1DAYA 2B9FA 2R0IA 2X81A 2PVKA 2XEZA 3KC3A 3LJ2A 5K0XA 2OLCA 3K2LA 3QQFA 3SG9A 4HOKA 4MTAA 5CTPA 2ZV2A 5HORA 5HG5A 1GAGA 4IC7A 2UZVA 5EI8A 3SA0A 4I92A 4IBMA 1JOWB 2Y6MA 3OY1A 5F1ZA 4ZTNA 2C5XA 4GIIA 3Q9ZA 4G9CA 4L42A 3FLSA 2NO3A 3C0GA 4BGGA 4ZY6A 3HMIA 4ZZMA 1VZOA 2XUUA 2XS0A 3KU2A 3L9NA 4FKLA 4O1OA 2VWUA 4O7TA 2W7XA 4BHZA 5IQDA 3ZZWA 3PZEA 3KA0A 2JBPA 4XLVA 2GNIA 3R8UA 3ZXZA 2G15A 3TZ8A 4RIXB 5H8EA 2Z7RA 5K0KA 2C3KA 1DAWA 4CVAA 5KHWA 3UVQA 4OTRA 3RPOA 3HA8A 5E8VA 4MXXA 4L46A 3W2RA 4BDBA 5TKDA 3C4XA 4UMTA 3U9CA 3I6UA 2OG8A 3A7JA 3A8WA 4QP3A 3CGOA 2GSFA 2XK8A 4O0RA 4WNPA 3RAHA 5IMXA 3GC7A 1IAHA 5HD4A 1Q5KA 3EQDA 3DJ7A 4IAKA 1PW2A 1WFCA 5DA3A 5BMSA 2R3GA 4X0MA 4AWIA 4USEA 3VUGA 4DH1A 3NUYA 1VR2A 2WD1A 2YN8A 5AIKA 4IANA 4CFUA 3MY5A 3P23A 4BDJA 4QP2A 3ZSGA 4X3FA 3OG7A 3QRUA 4TNDA 3UOKA 3EWHA 4D2RA 3V5JA 4U41A 4QMOA 3SRVB 4F9CA 3B8QA 4ZP5A 4I3ZA 3DFAA 1B6CB 2BRBA 2W0JA 2CKPA 2VUWA 3HRFA 4G5JA 2PSQA 2C6DA 5EM7A 3G6HA 3I7BA 3D83A 3W2CA 1JNKA 2P2IA 2VZ6A 1UNLA 2PUNA 3W8QA 2YJRA 5E8WA 4CV8A 4OTFA 4O0WA 3WILA 4JAIA 4J71A 3HGKA 1ZLTA 4M0YA 4O27B 4BDDA 3BHTA 5FRIA 4ZEGA 4E26A 2BRHA 3OS3A 4O7RA 5CYIA 4ASZA 4RX5A 5IF1A 5FDXA 2WTIA 5DG5A 4PMSA 3QQLA 3C13A 5E8UA 2GQRA 2BUJA 5CI6A 4X6QC 2J0IA 3FL5A 1WVYA 2E9UA 4IX5A 2BFXA 5HE2A 4P7EA 4MYGA 3TV6A 3WYXA 4E6QA 2PVNA 2B52A 2VTJA 4D4SA 4OBQA 2X2LA 4FF8A 4ALVA 4RGJA 5F20A 5HNGA 1H4LA 3FHIA 5CQWA 3VUKA 4JBOA 5BUEA 4KKEA 3LQ5A 3IOKA 1XH9A 2XKCA 3DFCB 4IAIA 5FXSA 4O96A 5CX9A 4ZJJA 3GGFA 3ANQA 3LXPA 2VWZA 4RJ6A 5AAGA 4O86A 3PVWA 2W9FB 3QU0A 5M08A 1U5RA 2UVZA 3Q96A 4QYEA 3KK9A 4RA4A 3VNTA 4AU8A 5FM3A 5D7VA 3B2TA 2B9IA 4KAOA 4QMZA 4XG6A 4OW8A 1URWA 4W9WA 2VTSA 4QMTA 5EQYA 2XNOA 5M44A 1RQQA 2OIBA 4MD8E 4YNEA 4PNKA 5AAEA 4I6HA 5F94A 4WD5A 2O64A 3IKAA 1XH4A 3R73A 1KE8A 4W4XA 5L8KA 3NNXA 2B9HA 1FMOE 2UVXA 1YDTE 4XCUA 3QF9A 3UTOA 5G6VA 5LVPA 4IX6A 5FEEA 5E8TA 2HAKA 1WCCA 4E6DA 3KVXA 3RTPA 4QYYA 1YKRA 1ZOGA 3UQFA 1A48A 4Y83A 3ROYA 2IN6A 4D1SA 3TM0A 2JAMA 5IA2A 4RWIA 3OF0A 3Q3BA 3OP5A 1OKWA 3NW6A 4FIGA 4WNKA 4XV9A 4ZJIA 1HOWA 4V0GA 2UW9A 5EDPA 4DTBA 3RM7A 3V6RA 3PJ3A 4GMYA 3EFKA 3VBWA 4OT5A 3K54A 3R9HA 1XH6A 2OJIA 4M69A 3VS6A 4XG4A 4PV0A 3QLFA 3I0QA 3Q9XA 5ETAA 2R3KA 5EW8A 1PF8A 1U4DA 3R02A 3SLSA 5GINE 5AM6A 3RZFA 4AN2A 3L9MA 4GYGA 2VX1A 4F9BA 3L8SA 3BKBA 2G9XA 3E93A 4FKWA 4LGDA 5ANGA 3RHXA 2VTQA 2OBJA 3N51A 3OOMA 4AOIA 3SW4A 2OZAB 3FLWA 3OUNB 3DKFA 3VIDA 3IDPA 3Q2JA 4FV0A 4BI0A 2JKMA 4U43A 3VO3A 2WQBA 3E88A 2HIWA 2XYUA 4PTEA 4U79A 3KY2A 4IB1A 5IEVA 3LAUA 1XO2B 4IWPA 3HUCA 5F9EA 3L1SA 3U54A 4BCQA 2RL5A 3D5VA 4Y85A 3C7QA 4FE2A 2BDFA 3FAAA 3VS3A 3DLZA 3LFNA 2WFYA 4UX9A 5FDPA 4PMMA 3F82A 3RJCA 3DK6A 4M12A 4R5YA 2QOBA 3MH1A 2CSNA 4FYNA 3GENA 5CALA 5CU0A 2JDRA 3ZC5A 2FVDA 1SVHA 2I0VA 4XOYA 5DOSA 3ZM4A 4F09A 3C5IA 4IZYA 2HENA 4CLJA 1GZ8A 3RWQA 3W18A 4FC0A 4F0FA 4FKGA 5DRBA 4BTMA 2FUMA 3OY3A 2AC5A 5CF6A 2JKQA 4WO5A 5IQAA 3EQCA 3FI4A 3BRBA 5J87A 5DRDA 2GTMA 3W2QA 5F4NA 1BI8A 5FTOA 3FPQA 4EOJA 2XCHA 5A6OA 1YDSE 5AX9A 5M4IA 4FV5A 3AD6A 2YAKA 3E64A 3MIYA 4DFYA 5EHYA 4NJ3A 2A2AA 4WUNA 4PMPA 1ZYSA 2VX0A 5AP0A 3RPRA 4U9AA 5CF4A 1H0WA 4BGHA 4R7BA 2VTAA 4RMZA 4O6LA 3Q4TA 3RAKA 1YXSA 4EZ3A 2GMXA 5IQGA 4KNBA 4EH4A 5TT7A 2UVYA 4O0SA 4BCJA 3U8WA 1VYZA 4FKIA 3ZLYA 4F1TA 4YJPA 2ERZE 5A4TA 4UZDA 5DVRA 3R8VA 3ZLXA 2YM5A 3PLSA 2WTVA 2ERKA 3OEZA 5AUXA 5CAOA 3V5PA 4TYHB 2GQSA 4DFNA 2CN8A 3P7AA 3GXLA 3MTFA 5AA9A 3TKHA 5IH5A 2XNMA 3BV2A 2CLQA 4JNWA 4YJTA 2WMQA 1QPEA 1GIIA 1ZYJA 4NJDA 4GT4A 3R28A 2RSVA 3FLZA 4ZLOA 4ZLZA 3PG1A 4FNWA 4BCPA 4RIXA 1PMUA 1YHSA 2QOIA 3HECA 4PL4A 2X6DA 2XNPA 2WO6A 3LFFA 4FSMA 4NH1A 1URCA 5JZJA 5FBOA 5CU4A 5JSMA 1O6YA 2RG5A 3BZ3A 3UBDA 3IG7A 1L8TA 3DY7A 3ZONA 4YC8A 2QQ7A 4FKOA 4FKTA 1UKIA 3TNIA 3HV4A 2WIPA 2CLXA 1J1CA 2Z8CA 2RFEA 3DJ6A 3F2RA 4O84A 3BQCA 3GU5A 2IW6A 3OCSA 2W99B 3QQUA 4CLIA 2VV9A 1WVWA 4DEAA 1O6LA 4AW0A 1Q8UA 4JDKA 4MK0A 3QCSA 4BDHA 4BYJA 1UWJA 1Y91A 4U7ZA 3RAIA 3TUCA 3HV5A 4C38A 4ZTSA 3BQRA 3AMAA 4KA3A 1YXVA 4MCVA 1ZXEA 4AT3A 3EJ1A 3EKKA 3F5GA 1FGKA 2ITUA 4QQCA 3BGQA 4HVHA 1NW1A 1ZMUA 5CSHA 3DQWA 2RF9A 5DEYA 4C2WA 2JIUA 3S2PA 4O81A 5A4EA 2W1IA 3BU6A 2F7EE 3AOXA 3EH9A 3I6WA 3SRVA 4AQCA 3DQXA 3WYYA 2CCIA 2OJ9A 3H10A 4UZHA 3R00A 3F2AA 5AP2A 4EUUA 3BYSA 5IUGA 4EOLA 5J9YA 1R1WA 2XRUA 2YZAA 5A4QA 4JBPA 3UOHA 4UALA 4IDVA 3FKNA 2VWBA 3D5UA 1G8SA 4C4EA 4I22A 4C0TA 4BWXA 4FTAA 2E9VA 3WF8A 5A3XA 4DBNA 3HYHA 3TKUA 4D2VA 1SZMA 4RC2A 2C1AA 3DNDA 4LRJA 5B0XA 4GU6A 3R7OA 4FYOA 3TT0A 3VS2A 3LXNA 4RVKA 4X2JA 4FNYA 4DEEA 4UMRA 3O23A 5KMMA 1F3MC 4ITJA 4WG4A 5HG8A 1FQ1B 1YI3A 4KB8A 4BYIA 5CEKA 5L8LA 5DGZA 4QP8A 3G6GA 2C47A 5KO1A 1OPJA 3HMPA 3SDJA 5KUPA 3NNWA 1BLXA 2LGCA 2WTCA 3NWWA 3NRMA 3QCQA 3QTSA 3LPBA 2XJ0A 3FDNA 3ZH8A 2UV2A 3QLGA 5I5ZA 4ZMEA 1DM2A 2JDSA 2YIWA 3FMEA 5KMLA 3DXQA 5K4JA 3G9LX 2YDIA 3R1SA 3ACJA 2SRCA 3Q5IA 3ZBFA 4IE9A 3TDWA 3FI3A 2IVUA 1H01A 3VBTA 1JKKA 4DFZE 1BL7A 1XWSA 4CKIA 2QG5A 2YIXA 2ETKA 1MRYA 3DV3A 4FSZA 2J0JA 4FT5A 3CJFA 3ZDIA 4BHNA 3KN5A 4LUEA 4MAOA 4YTHA 4PPAA 4YR8A 1ND4A 2ZM3A 5CEQA 3ORZA 4GJ3A 3L8VA 2OIDA 3IGGA 4FKQA 3A7GA 4KBCA 4TPTA 4CCUA 4UMUA 3GNIB 2IZSA 1H08A 2ETRA 2Y0AA 2YLFA 3QZFA 3HMMA 5BVEA 3VUMA 4FKPA 5EDQA 3BCEA 4KRDA 2ZV9A 3R1NA 3VAPA 1W8CA 2QLQA 2J4ZA 1DS5A 2YWPA 2YAAA 4A9UA 5HE1A 3BV3A 4F1OA 3D9VA 4RBLA 3EQRA 3R2YA 3ZEWA 4FSQA 4Y46A 4RIWB 3I60A 3ZO1A 1PYXA 4AF3A 4EOOA 3LLAA 5HBEA 5IDPA 1MRVA 1W83A 4BDIA 4XRJA 3ENMA 4BZDA 5HO6A 2EXCX 3HMOA 3KEXA 5EK7A 5GZ9A 4CTCA 2PWLA 4RJ8A 5EYKA 3RHKA 3G15A 4MXYA 4A4OA 4IX4A 4UXQA 4TW9A 4UXLA 3FEGA 2EXEA 3LFQA 1GIHA 3AXWA 5I9YA 4EEVA 3LVPA 2FGIA 2QKRA 3L9PA 2OZAA 5D7AA 5L6OA 4B9DA 4L45A 5C26A 5CXZA 1RDQE 2R3MA 4MH7A 4RWJA 4TTHB 2C6KA 2XNBA 3RNYA 1JWHA 1SM2A 2PE2A 5E92A 1ZOHA 1NT2A 3EN7A 4BKJA 4PP7A 4K0YA 4FT0A 4EZ5A 4B4LA 2GDOA 4E7WA 3JY9A 3E7VA 3OW3A 1H1PA 4M7IA 4ENYA 2YCRA 3A8XA 5HVJA 2B9JA 4YJRA 3MB6A 1FMKA 4EBWA 4IWDA 3H9RA 2F7ZE 4HNFA 3MY1A 3F7WA 1V1KA 5HIDA 2WEVA 4YJUA 2PZIA 1XH5A 2BZIB 4MQ2A 1S9IA 4K6ZA 2JDOA 5L6PA 4WG3A 3QGWA 4XOZA 4Y95A 4CFMA 3ET7A 4PDOA 4JT3A 1PXKA 4FZDB 3UP2A 3PJCA 4BDGA 3T9IA 2IJMA 3ZMMA 3Q4CA 4G16A 4GVJA 1RE8A 3C0IA 4EYJA 2EVAA 3IECA 3FI8A 5IG1A 1J7IA 1KOBA 3VQHA 3MPTA 5JQ8A 3KK8A 3FPMA 2WNTA 3UO6A 4HCVA 4CNHA 4YURA 3NYVA 2I1MA 3ZU7A 4DE4A 2REIA 5EOBA 3EFJA 3IW7A 3VWAA 5IA3A 2GS7A 4TY1A 4EK6A 1J3HA 1OBGA 5IQCA 4HZSA 3QX2A 4XV3A 3QTRA 4S34A 4GL9A 4BC6A 1H1RA 2R3IA 3FY0A 4YLJA 4MD9E 1JLUE 3ZRKA 2XA4A 2W05A 1K2PA 5D12A 4IAFA 5AR5A 3I5ZA 4NKSA 4XJ0A 4O0YA 2JFLA 3BELA 4TYEA 5A4LA 4GEOA 4KIPA 2W4OA 2J5EA 2P2HA 5K5XA 4ITIA 1XJDA 4RJ3A 5KZIA 3ZDUA 4I6BA 4B8LA 3H3CA 4J95A 2YCFA 2JDTA 4B8MA 1OVEA 4E20A 4YO4A 2WMTA 3I4BA 2C6MA 3HX4A 1H24A 4IZ5A 4PQNA 3GUBA 4HVGA 4IXPA 1VEBA 4XG7A 3E63A 5HNIX 5BX0A 3UC4A 1H1WA 4EC9A 4YP8A 4Z7HA 3PJ8A 4YU2A 3P5KA 4FL1A 1YWVA 4ZOGA 5J7BA 1W7HA 5EQEA 3GOPA 4LM5A 4FIEA 1V0PA 4NTSA 4BCFA 4E4XA 4H36A 5CAQA 4N70A 1AGWA 4BB4A 5J1VA 4FODA 5JFXA 4USFA 4D2SA 2O65A 3SQQA 3D7ZA 4RLLA 4MQ1A 4D58A 3KKVA 4ANQA 4C4HA 3V51A 3VF9A 2PTKA 4R5SA 5AJQA 2QC6A 3UJGA 4DFLA 3LQ8A 5J7HA 5GZ8A 3C4ZA 4I4FA 3ZBXA 2DQ7X 5FP5A 4K1BA 2JGZA 2X6EA 4FK6A 3TV7A 5LVLA 4QMXA 3BYUA 4C57A 5FXRA 4HYHA 4DHFA 4Z16A 3FMKA 3QA0A 5DH3A 4BTKA 3P4KA 3PA4A 3R0TA 4CMUA 3RMFA 4ZK5A 3P79A 3QRTA 1G5SA 2QHMA 2R0UA 3CQUA 3DKCA 1GIJA 3PZHA 3SHEA 3R7EA 3A99A 3UG2A 3FXWA 3ZHPC 1H1QA 3FSKA 2EU9A 3AC5A 4TKSA 4U40A 2YWVA 4OTQA 2F7XE 3MPAA 4A9TA 4K9YA 3C0HA 3QTQA 5H3QA 2W1EA 2NNWB 3TACA 5D10A 2QHNA 2UW7A 5HICA 5DR9A 3D0EA 1OGUA 4IWOA 3G0FA 5AM7A 4QOXA 3PYYA 4GFMA 3QD3A 4EHGA 4QMQA 4IZAA 4YUQA 4JXFA 5ITAA 2UW6A 1NXKA 4FVRA 2BPMA 2VTLA 4TWPA 5AX3A 2XIKA 4ZMFA 4QYHA 4UV0A 3O7LB 2PYWA 4MF0A 3PE1A 5HLPA 4AZSA 5EW9A 2I0HA 3DKOA 2VWWA 3LMIA 3QD0A 3HAMA 1PKGA 4I23A 5I3RA 2CPKE 3QKMA 4FSTA 3NEWA 3LLTA 4RWLA 3ELJA 4EL9A 2QODA 4JVGA 3MJ2A 2R7BA 3T9TA 1FVTA 3HAVA 3Q6UA 4FTIA 4FX3A 4GKHA 1XH8A 2X4FA 3CC6A 4UWYA 3P08A 3VULA 4YO6A 4QNYA 3OD6X 4O0UA 4ZIMA 4S31A 3LXKA 4J8NA 5CXHA 4BR3A 4EK8A 3DJ5A 3ORXA 2OW3A 3ALOA 5KMKA 3MS9A 3Q4UA 3E8EA 5CEOA 2FO0A 2JFMA 4JAJA 2QNJA 3TUDA 2ZV8A 4GT5A 3KF4A 4FTOA 1I09A 1REKA 4CXAA 4FEUA 4GVAA 4EJNA 3SAYA 2XMYA 5AAFA 3TG1A 3FXXA 4ASDA 4FIFA 5C8MA 4HGSA 2C3LA 3OBGA 4APCA 4GIHA 4LOPA 5CENA 3LQ3A 4CFFA 5C4LA 3LFDA 4IEBA 4QMWA 4QMYA 5FP6A 3ZLWA 4CMOA 5JZNA 4A06A 1E9HA 3W1FA 2QOCA 3F5UA 4FV6A 2Z2WA 3B2WA 3FV8A 2C6EA 2PL0A 3MSSA 3BLHA 3GC0A 1FGIA 3A61A 2I0YA 2Q0NA 3O50A 4K2RA 5IQEA 4R1VA 3OXIA 1Q8WA 4CQEA 2VTPA 5FBNC 1OMWA 3R22A 4L3LA 5CU2A 3PP1A 5ACKA 1UU7A 3FC2A 4RIWA 4O82A 3AT2A 5DEWA 3ZCLA 3UNZA 3UDBA 3ZEPA 5DT3A 4DT9A 3BU5A 4FL2A 4BICA 2VWXA 1BKXA 1OKZA 4LQMA 3CS9A 4G3DA 1P4OA 4IAZA 4MWHA 1T45A 1UA2A 2BKZA 4PY1A 4R7IA 2QD9A 4B0GA 1CKPA 3OZ6A 2Y4PA 4IQ6A 5DFPA 3WIKA 3EL8A 4D4VA 5EI2A 4DLIA 1OKVA 3OWLA 5CI7A 4HYUA 3QTZA 5IA0A 4CMTA 2ZMDA 1SVEA 4IDTA 3TTIA 3DBQA 4JG6A 3OT8A 1UKHA 4PX6A 3WE8A 5AP1A 4H05A 2XK3A 4IM3A 1Q8TA 4Y73A 4YPDA 5EKNA 5M07A 3RK9A 4FG9A 4AXAA 2Z7SA 3PSDA 4EH7A 1ZAOA 5J8IA 3DKGA 4I1ZA 3RI1A 3BBWA 4F0GA 3PWYA 5CVFA 2I0EA 3ZUVA 1ZWSA 2QI8A 5JRSA 2CNQA 1YVJA 3GCUA 3WIGA 2IVVA 2UW0A 5TO8A 1K9AA 3O51A 3NYXA 1W98A 3OVVA 4YZMA 4ZAUA 4XEYA 1H1SA 4DEIA 3PPZA 4FTNA 1FVRA 3KN6A 3OHTA 4FKRA 4AFEA 1KWPA 4IWQA 3W16A 5CEMA 3M42A 4FV8A 5KNJA 3SG8A 2QO7A 4AN9A 5D1JA 4BDFA 3F3TA 3MH3A 3FQHA 3NW5A 2W5AA 5AR8A 4CFVA 5EQPA 5ETCA 5AV4A 3DBEA 3PPKA 3V8WA 5HU3A 2OF2A 3FYJX 1UNGA 2V7AA 2XNGA 3LHJA 5F95A 3VBVA 1YDRE 4I6QA 3W2PA 3WE4A 4CSVA 4PDYA 4WIHA 3G2FA 4XV2A 5KZ0A 5C27A 4DG2E 4NFMA 5C9CA 1H27A 2JC6A 4KKGA 3KRJA 4CKRA 4YHTA 1B38A 2WQEA 4C37A 3MVLA 4NM0A 4HGLA 4N0SA 4OTPA 4D4RA 2IZRA 3F2NA 5L6WL 5E9EA 2JKOA 2QKWB 4PL5A 4TWCA 4ZZOA 3KXGA 4LYNA 1STCE 4O91A 1YXXA 3CD3A 4IB5A 2YABA 3AGLA 4GSBA 4RRVA 3FC1X 4RFZA 3UO4A 4U0IA 5J79A 2HWOA 2GTNA 4QPSA 4ZY5A 4C36A 3N4UA 4ZY4A 3RKBA 2BROA 4R8QA 3VS7A 5DWRA 4QTAA 5EKOA 2CNVA 5EW3A 5AR2A 3VHKA 3TEIA 4FT3A 1H25A 4F6WA 2OO8X 3D5WA 3GCPA 3L8XA 3QX4A 4J7BA 4Q5HA 3POZA 3V6SA 2BHHA 3HRCA 2IVTA 3ORLA 4E5BA 3WZKA 2W1CA 5IDNA 5C4KA 1P14A 2J0MB 2YM6A 4RZWA 4U3ZA 3TI1A 4PPCA 3TXOA 3F7ZA 4BIEA 3G51A 4CT1A 2WQMA 3Q5ZA 2QOFA 2OK1A 3PXFA 3BBTB 2VWYA 3I7CA 4ANNA 5LMBA 2XJ2A 2C0TA 2WPAA 1PXMA 5C03A 2JEDA 4O0TA 3AMBA 2XIRA 3TV4A 4ACDA 5E1SA 3GBZA 1NVRA 1PHKA 4HCUA 3ZOSA 5A14A 1CDKA 4YNOA 2PY3A 2YDKA 3CP9A 5L8JA 5HQ0A 2DS1A 4YLLA 5JRQA 4EH8A 1O6KA 1ZARA 5EG3A 1XBCA 2B55A 2YLEA 3RBWA 4MEDA 2VTNA 5AIRA 3GI3A 4XHKB 4YZNA 4YGAA 3OW4A 2F9GA 4J1RA 4NM7A 4IC8A 5JKGA 3V8TA 5L4QA 3QWJA 5EOLA 4EH3A 4G6LA 4IVDA 3KFAA 3QCXA 4H39A 4L00A 2GNLA 3D15A 2JDVA 1IEPA 2JBOA 3QKKA 5CSXA 3H30A 3Q60A 4HVSA 4WRGA 3QYWA 4XP2A 2CKQA 4EYMA 1Z9XA 3QTIA 5CZHA 3CCNA 3RVGA 2E9NA 5KMNA 5LCJA 3A7IA 4HYSA 3GQLA 5KMJA 3PDTA 4A7CA 5BYLA 2XJ1A 4WA9A 3GCQA 4EH2A 5AADA 2CGWA 3HP5A 5DBXA 1OL1A 3Q9YA 2RIOA 3SW7A 3FKOA 2PVRA 4KS7A 4RWKA 2W1HA 2E2BA 3LFEA 4X21A 3V5QA 3VS5A 4EKKA 5AFVA 2VN9A 4JIKA 5GJFA 5HBHA 3M2WA 5FD2A 4LL0A 3VF8A 2P3GX 4MVFA 2QG7A 4I0SA 3R9RA 4ASXA 2JLDA 1WBOA 4JX3A 1X8BA 4F7SA 2XNEA 3ITZA 2OFVA 1YWNA 5ANJA 4Z3VA 4PDPA 3NUPA 2R3QA 4DF3A 3DNEA 4F0IA 4FIJA 4FSUA 2YDJA 4L6QA 1PKDA 3JY0A 5BQ0A 2BMCA 4C4JA 4IH8A 4ZTRA 4ZS4A 3R9OA 2ZV7A 4CGAA 4XMOA 4D28A 4E1ZA 1LP4A 4DAWA 3FE3A 3O8PA 4F08A 2JIVA 4FEWA 1FPUA 5HD7A 3R9NA 3EN9A 4HGTA 4DC2A 4IM2A 1H00A 3V8SA 4JBQA 4K77A 5KBQA 5HO7A 3AGMA 4R1YA 4UMPA 2UUEA 2HZNA 3PWDA 3DZOA 4EK4A 3DTWA 3KXZA 3KCFA 4G3CA 2W5HA 3IDCA 3RALA 4LMNA 5AP3A 3PLAE 3K3IA 5HIEA 2IWIA 5HESA 4ZTMA 3FMMA 5HX6A 2PZ5A 5EM6A 5EYCA 4BBMA 5FEDA 4C2VA 4D0WA 4J53A 2Q83A 4JI9A 4A07A 2XRWA 5TE0A 1Q61A 3HP2A 3PJ1A 2ZVAA 2XKFA 5CSPA 1OUKA 3CY3A 4ZTHA 3RM6A 3SGCA 3F3UA 4RPVA 5CAPA 2ZB0A 4AG8A 5HE0A 1OB3A 3MIAA 2XIZA 4P5ZA 4ZZNA 1BUHA 4FKVA 3SXRA 5AV3A 3NGAA 3CKWA 3UMWA 3R63A 4JS8A 2WXVA 4MNEB 4AUAA 1R0PA 2FB8A 3ULIA 3UP7A 4DFXE 1TQMA 4JL9A 1GZOA 3ATSA 1WBNA 4EZ7A 3QD4A 1OZ1A 5J9LA 1LPUA 4U42A 3FLYA 4BY9E 5H8GA 1Q4LA 1REJA 4MD7E 1YOJA 3LXLA 4NUSA 1NA7A 3CLYA 4PNIA 4RX9A 4UWCA 5E90A 3OWPA 1IASA 2CKEA 2QOOA 3SOAA 3RK5A 2BRNA 3GU8A 2H6DA 3R30A 1M17A 2E9OA 3VC4A 2X1NA 3ZLSA 4IHPA 3MV5A 2WOUA 2YM4A 2GHMA 2BAKA 4JQ8A 3A4OX 4WNMA 3ZRLA 3ZFYA 2WMBA 2BZHB 1QPCA 3E3BX 4IACA 4LOOA 4OR5A 2XK9A 4EONA 3A62A 3UQCA 1QCFA 3FZRA 3W33A 5LMAA 4NTTA 4F65A 5JK3A 4ACMA 2QOQA 3N4VA 3ERKA 3TNHA 3UIUA 5AMNA 4R3PA 4ERKA 4KIQA 5CT0A 4ZXTA 4M14A 4IX3A 4FTRA 1QPDA 3KB7A 4O1PA 3R8LA 1G8AA 2EUFB 5LXMA 2V55A 3FMLA 4CFWA 2HY81 4E5AX 2EB2A 3BE9A 3WBLA 4TWOA 4C58A 3BIZA 3ORIA 1ZZLA 3AT4A 4AT5A 4CD0A 2R3LA 3HV3A 3NZ0A 4BVUA 4JR7A 4BCNA 4I94A 4AZWA 4BCHA 2OJFE 3TUBA 4R77A 1R39A 3GFWA 4MX9A 4DYMA 4AGCA 3TN8A 3HNGA 5GNKA 2AC3A 4LV8A 5FGKA 3C51A 1O9UA 2P0CA 3QZHA 4FBXA 4CFNA 5I3OA 3OWJA 1WVXA 1GJOA 3KXMA 4J97A 5EM8A 3E92A 5AEPA 5FXQA 2QR7A 1MQBA 2WKMA 3PXRA 2UZOA 2B1PA 3R04A 3PVGA 1OL7A 4MBLA 2P33A 4H1JA 2VGPA 4HVDA 5DYJA 1M7NA 3MB7A 4IB3A 2F2CB 4WUAA 1KV1A 3VQUA 4ARKA 2WMUA 4WHZA 4FV1A 3COMA 4LGGA 5I9UA 3NAYA 5A6NA 5HTCA 3FYKX 1OIRA 3BGPA 1R0EA 2AUHA 4FOCA 3R9DA 2PULA 3PE2A 3ODZX 2X9EA 3PXQA 1CMKE 1PY5A 4TYIA 3DXNA 4MBIA 4E5WA 5BVDA 1HCLA 5HNBA 3ID6C 1OECA 3IGOA 4EOMA 1IRKA 2Z7QA 5I4NA 2WMXA 3CQWA 5TR6A 3ZC6A 2PPQA 2VO7A 3U87A 4C61A 3ROCA 3A7HA 3COHA 4G34A 4IJ9A 3LCOA 3Q52A 2XVDA 3D7TB 4Y5HA 3ZTXA 2QO9A 3AD4A 5K4IA 5HE3A 4GK2A 2W1FA 3EFLA 4LG4A 1W82A 1ZY5A 4QMMA 4W9XA 3AC8A 2FH9A 1TKIA 3W32A 4KBKA 2BZJA 4A4LA 4I21A 2Y4IB 3UPZA 3EQIA 2XYNA 3T3VA 4MHAA 1W0XC 4EQCA 4L52A 4IFCA 4TXCA 3G90X 3QBNA 4AW2A 4K18A 5E1EA 3PY3A 3L8PA 3BWJA 5AUWA 3S00A 2J9MA 5K9IA 2IVSA 2RKUA 2UZWE 3FHRA 2ZDTA 4H1MA 4GUEA 4M8TA 4AGUA 4YZDA 3FBVA 2YIQA 2QCSA 4ANSA 4GRBA 4YJNA 3MTLA 3EQBA 3O96A 4FTJA 2RFNA 2OJGA 3R83A 5ANOA 3KREA 2G01A 3UOLA 3E62A 3HL7A 4GFGA 4I24A 2I6LA 3ZSIA 4BN1A 3BYOA 4DFBA 4G6NA 4UEUA 3ALNA 2YACA 3MVMA 4H3PA 4X2KA 3ZYAA 3HV7A 3AMYA 2ZMCA 5GJDA 3VVHA 5LMKA 2HK5A 3U55A 4U44A 4P90A 2W4KA 3ORTA 1QPJA 2VTRA 2A27A 4YSMA 1WBVA 4GKIA 4QQ5A 2C1BA 3IK3A 4O2ZA 4Y72A 3NAXA 1YI4A 1U5QA 5KMOA 3RPYA 3UVRA 3PA5A 3EQPA 4TNBA 3KULB 3VBXA 5JFWA 2XCKA 3MWUA 2UZDA 3RK7A 4ZTQA 2BCJA 1WMKA 4EHVA 2PUPA 4DINA 3DK7A 4BTJA 4IW0A 4YJOA 4FZAB 5JQ5A 4YHFA 2X9FA 5CLPA 1H26A 1YXUA 3A60A 4DEDA 1DI8A 1ZY4A 3FMNA 4EH9A 2IG7A 3BI6A 3S95A 4DGLC 4BWKA 1JSTA 3WZUA 2GQGA 3NUNA 4WRSA 5EM5A 3CSVA 4W4YA 2J5FA 3S3IA 2RFSA 2WMRA 4S30A 3WF5A 4FUXA 1UU3A 3DPKA 4MWIA 1UVRA 3BLQA 4BDAA 2R3PA 3W8LA 5BYZA 3PG3A 4M13A 4WBOA 4W4VA 4FV9A 2ZM4A 4BTFA 3FZPA 1PYEA 3DLSA 3P7BA 3MJ1A 4RIOA 2WHBA 1P4FA 4GT3A 3V04A 3SXSA 4TL0A 2XM9A 4JJRA 3U4UA 5CSVA 3E3PA 4KIKB 3KF7A 1MP8A 4EC8A 1Q8ZA 3BYMA 3R7YA 4QTDA 2PMIA 4ERWA 3EN5A 1FVVA 3OROA 1GY3A 3F69A 5CNNA 4HVIA 5HI2A 3REPA 4E4LA 4D2TA 3UVPA 4BGQA 3NDMA 3KXNA 3TKIA 4CZYB 3TZ9A 5DT0A 1RJBA 3MYGA 4LRMA 4NIFB 4O38A 4YPSA 4OGRA 4ALWA 4AW1A 5H8BA 3NYOA 3LCTA 4DLJA 1AD5A 3R8ZA 3A2CA 5ACBC 4GU9A 2WTDA 2VTMA 1BL6A 2J7TA 3NLBA 2ETMA 3ACKA 4J99A 5CT7A 3EQFA 5EH0A 4FT9A 2QONA 4BRXA 4EOKA 2OF4A 5AUYA 4USDA 2EB3A 4MBJA 2XBJA 2QOKA 3U4WA 4IZ7A 3TZMA 2WEIA 4AZEA 4EQUA 5T6KA 3QXOA 3GCSA 5D11A 3F6XA 3QRIA 5DPVA 4ACHA 4C7TA 3DZQA 4WSQA 5J1WA 4NT4A 4E4MA 2ITQA 4B7TA 3HRBA 2G2FA 3ZO2A 4PF4A 5LVOA 4FMQA 2CHLA 5KKRB 2ONLC 4MNEA 1UNHA 2WTWA 4F70A 3NPCA 3R8PA 4H3QA 3MFUA 5HX8A 4IVCA 4MKCA 5BUIA 3DB6A 2GPHA 3II5A 3CTHA 3NUSA 2V22A 3QQJA 4O0VA 5AP6A 3VBYA 2RG6A 2OIQA 3RGFA 3OCGA 2CGVA 3CIKA 3P9JA 4FSRA 4GK4A 4YJSA 2YHVA 4IJPA 4X3FB 4OTWA 1YI6A 1WZYA 5HLWA 2EXMA 1OUYA 4CZUA 2WMAA 2X2KA 2H9VA 3FZOA 4FOBA 3GQIA 5LJJA 2HW7A 3FLNC 4AAAA 4AX8A 2HZ4A 4EUTA 3P1AA 3Q04A 5IKWA 3IDBA 4W8DA 3ZZEA 1OBDA 4TYHA 2R2PA 2GNJA 5IQFA 4ANBA 2WZJA 3NNVA 4QP6A 4C3PA 4D5HA 5IA4A 3TNWA 2Y6OA 1JSUA 2J51A 3FXZA 4C3RA 4QP1A 4Y5QA 3P7CA 2VWVA 3PSBA 4UBAA 4ITHA 4A9RA 2WTJA 3C4FA 5ANKA 3F3WA 3MGYA 3WF9A 3OXTA 5C01A 2ZYBA 3MW1A 1J7LA 4IB0A 4C8BA 5FQDC 2QVSE 5AA8A 2QURA 5M51A 3QHRA 4QNAA 4I0TA 3BYVA 2BALA 2A19B 4TWNA 4D4YA 5L2SA 2UZTA 5KX8A 2V0DA 3UPXA 3F61A 5AR3A 3DU8A 3EL7A 4APPA 2JKKA 4BL1A 4FEXA 4ZSAA 3PUPA 4PPBA 4C4FA 4QD6A 3NVMB 3KXXA 5LARA 3D94A 5I9ZA 4M84A 2JITA 4E3CA 3CKXA 1Y8GA 2W06A 1YXTA 2FYSA 3CPBA 2VTHA 1YOLA 3MH0A 3VRZA 4ANMA 3OMVA 4ANLA 3FZTA 2GS2A 4QPMA 4BZNA 2BR1A 5AR7A 3CXWA 4KD1A 5LOHA 3OXZA 3AT3A 3LFSA 3NS9A 4D5KA 5KHXA 2UW4A 1PJKA 1LUFA 2BIKB 3LKMA 2J0LA 3EYGA 3R6XA 3CQEA 5BVKA 2YZLA 2PK9A 4AE9A 3I0OA 4RQVA 5IISA 2BTRA 4FNXA 4AA5A 2CKOA 3MFTA 4FA2A 2QO2A 4NU1A 4JRNA 2X39A 2WB8A 3R2BA 1APME 5LVNA 4HCTA 4FUYA 2X8IA 3QWKA 5JFVA 4YMJA 1LEWA 1J7UA 4KSPA 3D7TA 3UOJA 5FLFA 4DH5A 4JQ7A 2ZJWA 4A9YA 1CKIA 5IUIA 3OTUA 5LWMA 1XR1A 2VO6A 2O0UA 3QQHA 4TN6A 4NYEA 1WBTA 2PVFA 1RW8A 4QMSA 4FV7A 4AN3A 1BYGA 2XK6A 3C1XA 2HW6A 2XK4A 5T68A 5JGAA 3E87A 4K11A 5ETIA 4N57A 3S4QA 3QQGA 3QL8A 4U45A 4MXAA 5ANDA 5AUVA 4IADA 2XF0A 1CKJA 3HKOA 5B7VA 5AP7A 2BAQA 3DT1A 1G3NA 4Y8DA 1JKTA 3W10A 4ZLYA 1OPKA 5H2UA 4D9UA 5E8YA 4UYAA 1R3CA 2PHKA 3WZJA 2ITPA 5BVOA 4I5MA 4O7VA 2X4ZA 3JYAA 3O7LD 3VS4A 2ITNA 3B8RA 1EH4A 2O8YA 3QUEA 4XP0A 3FJQE 4P2KA 4NM3A 4EBVA 2ONLA 2HXQA 4JQEA 2O2UA 5JFSA 1YQJA 4IIRA 3SKCA 5I0BA 1ATPE 3EOCA 2YIYA 4QT1A 3E7OA 4X6RA 5EHLA 1A06A 5K5NA 5LVMA 3FMJA 3Q6WA 4Q5EA 4I0RA 4RC4A 4C35A 4RX7A 5IH4A 5M53A 1Q3DA 2J50A 3UYTA 2ZDUA 4EH6A 1NVSA 1PXLA 3R21A 2O63A 1PXIA 4JIAA 5DI1A 1TQIA 4U80A 3WZEA 2VNWA 4YZ9A 4EK3A 3MDYA 4NCTA 4XG9A 4N4SA 4GK3A 5I9VA 1F5QA 3U6IA 2PE0A 4RLKA 3DS6A 4M0ZA 3UC3A 2WU6A 2A0CX 4OTIA 3O71A 5E7RA 3NYNA 4L3PA 5CVGA 3KQ7A 4ZSLA 3V3VA 3SV0A 5HGIA 3QKLA 3R7GA 3I81A 4LI5A 3BE2A 5M4UA 4O22A 4GCJA 1UU8A 4AGWA 4PUZA 4RIYB 2HYYA 3O8UA 4KUJA 2OH0E 4LL5A 2UW3A 2BTSA 4FV3A 1BMKA 4XUFA 3FWQA 4RVLA 4OBOA 5EFQA 4L67A 4O7ZA 4CG8A 4U5JA 5J5SA 1JKSA 4CFXA 2OXDA 5BMMA 3O8TA 3W55A 3LE6A 4FKSA 5BVNA 2YITA 4OBPA 5JGBA 5M4FA 3E8CA 4AACA 2B0QA 4O0XA 2ITYA 4J96A 3THBA 5GHVA 3LMGA 1OM1A 4YTCA 5GIOE 3PXYA 4RJ4A 1JBPE 4I20A 4KIKA 4CQGA 2VWIA 4D1XA 2ZAZA 1Z57A 2VAGA 2PZPA 3ETAA 4YBKA 2E9PA 4IFGA 3HZTA 4O7WA 4QTEA 4AP7A 3LFCA 1V0BA 1IG1A 2VNYA 3I1AA 5ANEA 4FKJA 2C5VA 2C6LA 3MI9A 2H34A 4J8MA 4NIFA 2C30A 3QRKA 4YC6A 2F49A 2OJJA 5DN3A 1SVGA 1CTPE 5FTGA 1UV5A 2B53A 3JPVA 3GEQA 3UIBA 3ATTA 4HZRA 2AYPA 4ORKA 3ORPA 3TIZA 4NFNA 3UZPA 5IPJA 4FTUA 5AV1A 3PVBA 3UNJA 2GNFA 2UW5A 3NCGA 4TYGA 4XG2A 2VTIA 4F9WA 2R5TA 3FKLA 3PIZA 3BHVA 4BBEA 4I93A 4JDHA 4Z7GA 4JBVA 2VU3A 3N4TA 5AWMA 4L43A 3Q32A 2X7GA 5CEIA 4B6LA 3PSCA 3EFWA 3IQ7A 3H0YA 3MFRA 4BIBA 3FZSA 2Y7JA 3NW7A 3UMXA 4EWQA 4XS2A 2XIYA 4NEUA 2C69A 2VO3A 4XH6A 4NKAA 3UODA 4F4PA 2YEXA 3E8NA 4S33A 2P55A 4PP9A 5H9BA 1H28A 3E5AA 1YHWA 2X7FA 2PE1A 3NNUA 4GW8A 4QRCA 4RJ5A 4YBJA 4AGDA 3QXPA 4FEVA 4OAVB 3FZ1A 3DCVA 3GP0A 2V7OA 4EHZA 3DB8A 4OTDA 4FI1A 2WMWA 1VYWA 2P4IA 3RNIA 4AE6A 4RFMA 2ITVA 4FNZA 3TCPA 3GU4A 4NSTA 4GS6A 5BVFA 5KMIA 3IW5A 2PVHA 4II5A 5FWKK 2PU8A 3VW6A 3N9XA 4YTFA 4BCMA 4CRLA 2VTTA 4DG3E 3GU6A 2DUVA 4GH2A 5JH6A 1FOTA 2HY0A 3H4JA 4D1ZA 2Q0BA 5JMSA 4O2PA 2XB7A 4QQTA 2KTYA 3QRJA 4FG7A 4G17A 2HZ0A 4P4CA 4LV5A 2CNUA 2R3NA 4L7FA 3ZO4A 4R78A 4FTLA 3NR9A 4IVBA 1OIUA 3SX9A 1IA8A 3AC2A 4O6EA 3ZO3A 5IZFA 1JVPP 5HHWA 2OXYA 4EI4A 2OICA 4WT6A 4AFJA 4FIHA 5IA5A 4FZ6A 2ITWA 3BGZA 4M97A 4QMVA 5KE0A 5M55A 2B4SB 2PVJA 4C33A 5HBJA 3K5UA 2VTOA 1JPAA 2HCKA 3H9OA 4DGGA 5LQFA 2X7OA 4K33A 1ZZ2A 2C68A 3RCDA 1E1VA 1P2AA 4FSWA 5AR4A 4S2ZA 3HEGA 3VN9A 4AOJA 3NMUF 2IZTA 1HCKA 3QZIA 3F9NA 4DFUA 2X2MA 4IM0A 4YJVA 1Y6AA 2PMNX 4QP4A 4PTCA 3W2OA 3QAME 4L7SA 2QU6A 3BPRA 3IPHA 5M57A 3HDMA 1H0VA 4MXOA 4FEQA 5BNJA 5JGDA 1ZMVA 3KMWA 2BIYA 1T46A 2Z7LA 3DBDA 2C6IA 2QU5A 3QUPA 1KUTA 4DCAA 4EJ7A 3VHEA 3NX8A 4G6OA 3OCBA 3D5XA 3F3VA 3E8DA 4RJ7A 4JLCA 4MF1A 2XM8A 1PXNA 1F0QA 2YM3A 4AOTA 4PMTA 4ZJVA 3VS0A 2PVMA 5M56A 3FL4A 3OOGA 2CDZA 2W4JA 3PPJA 4G3EA 1Q3WA 4RQKA 3UG1A 2XEYA 3HLLA 3O0GA 4AT4A 3UIXA 2WIHA
chains in the Genus database with same CATH superfamily
3ORKA 2ITOA 4ASEA 2Y8OA 4FICA 1BI7A 4EOPA 2BDJA 2AEGA 2G1TA 2YISA 4LMUA 5CS6A 4Z55A 4KS8A 4NM5A 2C6TA 4A9SA 4RFYA 4XLIA 4DGNA 5TF9A 3ZUTA 4LUDA 3HVCA 4OAUC 2YJSA 1QMZA 2GS6A 2QR8A 3EKNA 2IW8A 1GZKA 2R3OA 5J5TA 4KINA 3SVVA 4GYIA 5A46A 1OL5A 3WOWA 3C9WA 5E8ZA 2J0KA 2F2UA 3UO5A 3OC1A 4AZVA 3IONA 4BDCA 2GFCA 3Q2MA 3JVRA 1J91A 2X8DA 4HPTE 3UIMA 5BPYA 2OI4X 3LMHA 1E1XA 4YTIA 2WQNA 2PMLX 3JVSA 4CT2A 3TL8A 3ML1A 5E91A 4MUQA 2NPQA 1WAKA 4YHJA 1Q99A 1U54B 3CTQA 4U97A 4FZFB 1KE6A 3D2KA 3QFVA 3W2SA 4QMLA 4F6SA 2C0OA 3KGAA 3NIZA 4QMUA 4OT6A 1KE7A 3HA6A 3F88A 1XBAA 3L9LA 3MA3A 5CZIA 4KIOA 4C34A 3MN3A 3TJDA 4UYNA 4CCBA 4DA5A 3TIYA 5BVWA 5DR6A 3A7FA 3BHUA 3GT8A 4LRKA 3FI2A 5HCYA 3AKLA 3ORMA 4FZ7A 4HW7A 1W84A 3EQGA 4AS0A 5EHOA 2QLUA 3VBQA 2C6OA 1M2RA 3CJGA 3GC9A 2OH4A 4FTTA 4M3QA 3SD0A 4ZS0A 1CSNA 4HGEA 2G2HA 4GG5A 5DHJA 3DTCA 2PUUA 1A9UA 3PIXA 3TJCA 4YSJA 5LMKC 4YC3A 2OFUA 2BRMA 4O7SA 5LCKA 3AKKA 3UZRA 3PXKA 3F3ZA 5KCVA 3KMMA 3ZRMA 3UGCA 4IAAA 3VRYA 4QTCA 4BF2A 3IW8A 1OI9A 4XYFA 4D9TA 4QP7A 5I9XA 4RIYA 3R7IA 4RC3A 4CEGA 4E73A 4QTBA 5IUHA 4BI2A 5B2KA 1YRPA 3C4EA 3QZGA 3CR0A 3PY1A 4UB7A 4XG3A 3IW4A 4FTKA 4JOAA 4DHIB 4V04A 4D0XA 5A54A 3BEGA 3QUDA 3O2MA 3PRIA 4FIIA 3RCJA 5C1QB 3TTJA 5DR2A 1WBPA 5IU2A 2OU7A 3BLRA 3EQHA 4DEHA 3KRRA 4NW5A 1IA9A 4BI1A 1UWHA 4XG8A 4DH8A 4L44A 1ST4A 4PWNA 3EMGA 3RINA 2X0GA 4EH5A 5IA1A 2ZM1A 4WSYA 1GNGA 1Q8YA 3G9NA 4XP3A 4WBBB 3DOGA 2FSMX 4QYFA 5D9HA 2RFDA 3QTXA 3V5LA 4FTMA 4BKZA 4KBAA 3CBLA 4FK3A 4ONAA 1YW2A 1ERKA 3TDVA 4BFMA 2R7IA 1PRYA 3QHWA 3AG9A 2C0IA 2WOTA 2Y9QA 3U9NA 4B99A 2PZYA 4W4WA 4XV1A 5CQUA 4BZOA 4DBXA 4I5HA 5ANIA 4TYJA 4KABA 4QMNA 4DN5A 1XBBA 5CY3A 3NUAA 3ODYX 1OL6A 3RAWA 4ENXA 5HIBA 3EHAA 4U6RA 4ALUA 5HCZA 4EQMA 3G0EA 5CWZA 3VUHA 5FG8A 4GFOA 3G5DA 1FBNA 3LJ0A 2PUIA 4QP9A 2VGOA 2BFYA 3OCTA 4JDJA 4M67A 4BCOA 3GC8A 4P5QA 3P86A 4I41A 1AQ1A 2C3IB 4RZVA 2O5KA 3C50A 3POOA 4BDEA 5GIPE 5K3YA 3EYHA 4ZTLA 3TNPC 3VJNA 2JAVA 1OKYA 3KIOC 3PJ2A 3OTVA 2NP8A 4QQJA 4WKQA 5CU6A 4OTHA 4DHZA 1IR3A 3Q9WA 3ENHA 2XZSA 5HG7A 4AZTA 3MH2A 1SYKA 5C8KA 4EORA 3HV6A 4LDTA 1CM8A 3CGFA 3COKA 3Q4ZA 3UNKA 4DITA 4LOQA 3PY0A 4NW6A 2VO0A 5CAUA 5AP5A 3F5PA 4F7LA 3K3JA 4O7LA 1NVQA 3WF7A 3DAKA 4BKYA 2ZOQA 4RG0A 2J2IB 3WARA 2V5QA 4UWBA 4H3BA 2NRYA 2YA9A 1KV2A 4AA4A 2BILB 3EN6A 3BU3A 3NSZA 5JEBA 1WBSA 4TZRA 2LAVA 5HG9A 1PMVA 4F99A 4G9RA 3QD2B 4U8ZA 5IMEA 3CPCA 3VUIA 3UE4A 1TQPA 2VRXA 4FR4A 2OXXA 4GJ2A 4QPAA 3ZS5A 1MUOA 1Q62A 2B54A 2RGPA 2WTKB 5EYDA 3O17A 2ITTA 4HJOA 3S1HA 4JR3A 4LFIA 5AV2A 2YERA 3OWKA 2NRUA 4KKHA 2VX3A 3D4QA 5L3AA 2EWAA 3IO7A 3IS5A 2G2IA 4DGOA 5L2TA 2UZNA 1MQ4A 3ZXTA 5A9UA 1M7QA 3DAEA 1Y8YA 2WMSA 2J6MA 2WMVA 2XK7A 3LCKA 3RP9A 2KULA 5HVKA 3VS1A 4G31A 2WAJA 5FUTA 2W1DA 2GHGA 4NWMA 4PRJA 5FEQA 3SOCA 4DGMA 5M09A 2BAJA 3ANRA 4C4GA 1U46A 4C62A 4BCIA 1L3RE 3QYZA 3U6JA 2XIXA 1BX6A 4R3CA 4O83A 3HUBA 4IVAA 3SC1A 1Q97A 3MBLA 2V62A 4MXZA 3LM0A 5EI6A 3NUXA 1TVOA 2ZB1A 2R3JA 4A4XA 5HTIA 3WI6A 5HZNA 1S9JA 2OGVA 4DCEA 3ULZA 1VJYA 1WBWA 5CAVA 4O7YA 1KE5A 2F4JA 2GFSA 2FSTX 3CY2A 5L2QA 3TWJA 5GZAA 1JKLA 4PL3A 5AUZA 3C4WA 1GZNA 2R9SA 4ZSEA 3PA3A 5HOAA 5JN2A 4KRCA 4ID7A 4OLIA 4G5PA 2JIIA 2H96A 2BZKB 3U6HA 3PVUA 4EK5A 2JD5A 1KE9A 3BHYA 5DE2A 3D14A 3GFEA 4DEGA 3QALE 1M52A 3QGYA 2DYLA 3HDNA 5LWNA 4G3GA 2GNHA 3EN4A 1DI9A 2O3PA 3GB2A 4BBFA 3PTGA 1PXJA 1M2QA 4RA5A 3RZBA 5AUTA 3LCDA 1YOMA 1SMHA 2GU8A 2YCSA 3C4CA 4L68A 5HEZA 1PXPA 3VW8A 4XNEA 3BHHA 2C3JA 4ACCA 2Z02A 1PMEA 4Q9SA 2CGUA 5BUJA 5HTBA 5DNRA 2IPXA 1Y6BA 1OIYA 2I40A 2WELA 3IW6A 4HNIA 3MVHA 2R3FA 3D2IA 3JS2A 4FV2A 2W5BA 4OTGA 3ZFXA 3U51A 4DEBA 2W1GA 4EWHA 4F7JA 4U81A 3T3UA 4EKLA 2R4BA 4FTQA 4E6CA 2XP2A 5M4CA 4C4IA 4YLKA 2UZUE 4X3JA 2C4GA 3KL8A 4KSQA 4L9IA 3RWPA 3EIDA 3ORNA 3DBFA 2BHEA 1ZYCA 1I44A 3UQGA 4BWPA 1OITA 1YWRA 2ACXA 3BX5A 3P0MA 3LFBA 3LZBA 4OUCA 2Y4IC 4GUBA 2XBAA 5CF8A 3DAJA 3LFAA 1U54A 4R3RA 4F6UA 3KRLA 3ZUUA 1IAJA 4FV4A 3LW0A 4DH7A 3FSFA 2CN5A 1OPLA 2WTKC 3EB0A 4MNFA 1KSWA 4L53A 4R7HA 3LOKA 2PZRA 3R01A 1ZOEA 4KWPA 4UMQA 5HCXA 4L8MA 5HVYA 2IW9A 4DDGA 5E8SA 2I7QA 1G8KA 1R78A 2YFXA 2WQOA 4TT7A 3DBCA 2WGJA 4AZFA 5ICPA 1J1BA 3AC1A 5DMZA 3NVKI 3H0ZA 4FVQA 1OIQA 4K8AA 3JR1A 5I9WA 1SNXA 3QC9A 2BDWA 2CJMA 4M15A 5IH6A 4CV9A 4UN0C 4X2NA 5AUUA 5B2LA 3PXZA 5T3QA 1Q24A 1ZYDA 5CSWA 4J52A 5IEYA 2YM8A 3GCVA 4CRSA 4FVPA 2DWBA 2R3HA 4DH3A 5BYYA 4JDIA 4AA0A 4F9AA 4BIDA 3BEAA 1MRUA 2YCQA 2OZOA 4G2FA 4F63A 3NCZA 3OT3A 4FT7A 4NCTC 3OBJA 3DXPA 3AQVA 1PXOA 2A4LA 1ZMWA 3NUUA 3AC3A 2OWBA 4CG9A 4YJQA 4L01A 3PRFA 4RT7A 5EDRA 4L3JA 2IZUA 2ESMA 4Z9LA 5JT2A 4AQKA 2H8HA 1V0OA 4F1MA 5BV3A 4W8EA 4EOIA 2BVAA 1H8FA 2W9ZB 4NZWB 3R71A 3UYSA 4M66A 3CEKA 3LJ1A 2XH5A 4H58A 2HZIA 3QQKA 3R7VA 4Q9ZA 4ZSGA 4AW5A 3JUHA 4LGHA 4GV1A 1JAMA 2W96B 2YM7A 5KBRA 3DDQA 2QOLA 2UZLA 4D2PA 3QC4A 4XRLA 2HELA 5IQBA 5IQHA 5J95A 5AP4A 5M06A 4F64A 4FG8A 1OL2A 3OEFX 3KXHA 4NL0A 1NY3A 1H07A 1XKKA 2XKEA 3CD8A 3R7UA 3TNQB 3V5TA 3KRXA 2C5OA 4DTAA 3DA6A 2WU7A 4S32A 2W1ZA 3M1SA 4U3YA 1XHAA 3FMDA 4IMYA 4F7NA 4AXDA 2ITZA 2XAMA 3HMNA 5J9ZA 3COIA 5L2WA 3RPSA 2VD5A 3LCSA 3QCYA 4AXEA 3LM5A 4N6ZA 5CNOA 1LEZA 3OFMA 3FY2A 2HOGA 4N6YA 5CF5A 4G1WA 3DGKA 3KRWA 4MXCA 5C8NA 2IO6A 4FSNA 4Q2AA 4G3FA 3FMHA 3FUPA 4I6FA 5CEPA 3MVJA 2R3RA 3ZFMA 3CTJA 1SNUA 3DK3A 4V05A 4I4EA 5FTQA 3LIJA 4C59A 4DG0E 3MESA 4EOSA 4PDSA 2Z60A 3P78A 5ETFA 3G33A 2CCHA 3C5UA 5CU3A 2XKDA 3NIEA 2A1AB 1Q41A 3MPMA 4J98A 5EYMA 3H9FA 4D2WA 3A4PA 5TOZA 3GOKA 1Z5MA 3DDPA 4V01A 1LR4A 5G1XA 3RPVA 2PVLA 3I5NA 2J90A 5AV0A 4JG7A 3QTUA 4RX8A 4CYJA 5KKRC 3VUDA 1ZYLA 4YZCA 3KVWA 4IAYA 3CE3A 4X7QA 3M11A 2YIRA 4V0GB 5DIAA 1YHVA 4O7NA 3ZM9A 4I5PA 4ZSJA 2W17A 4TRLA 2FSLX 4RVTA 4E8AA 4EOQA 3OUKA 3WZDA 5IEXA 5L2IA 2GCDA 4M69B 5CANA 4QO9A 2CMWA 3AC4A 4RVMA 4XBUA 4JX7A 3FQEA 4CYIA 4X3FC 5DT4A 3EZVA 3IOPA 3R8MA 4C3FA 4E6AA 4CZTA 5E8XA 4FTCA 4XX9A 5HU9A 3VONA 4HYIA 1KOAA 4C02A 2R64A 2XARA 4FL3A 3MFSA 2QOHA 5HLNA 1M14A 2GHLA 4LV7A 3FLQA 5HO8A 3R1QA 3BWFA 3QA8A 3VUTA 2OKRA 3EZRA 4BCGA 1JQHA 3FQSA 4FGRA 5A4CA 4QYGA 3UZTA 2UW8A 2FSOX 5E4HA 3QTWA 4M68A 2XNNA 1B39A 4WG5A 3F5XA 3V01A 3P5JC 4DT8A 4BDKA 3S0OA 3V5WA 4NK9A 3VJOA 4WNOA 2B7AA 2BRGA 2F57A 5FM2A 4FGBA 4QMPA 1ZRZA 4PTGA 4BCKA 4E93A 3SXFA 3ZSHA 1G8JA 2BKKA 2C5NA 3AD5A 1PMNA 4FSYA 4UY9A 4GG7A 3PP0A 2ITXA 4YZBA 2OSCA 3GU7A 3R1YA 1P5EA 2PVYA 5HKMA 1QL6A 4X2GA 2HWPA 3MA6A 4EHEA 4HPUE 4ANOA 3KULA 1JSVA 3GVUA 2FA2A 4X2FA 1UU9A 4I5CA 3W0NA 3PIYA 4WOVA 3WF6A 1M2PA 3JXWA 1XH7A 4JRVA 3TZ7A 2GNGA 3PFQA 4ACGA 3KMUA 4CTBA 3I79A 2UZEA 2HXLA 5CASA 1Y57A 2C5YA 3K5VA 3Q53A 4FKUA 1K3AA 4XBRA 5IQIA 3F66A 4JG8A 1FINA 3T8OA 4D55A 4RSSA 1U59A 2PMOX 1GOLA 3NFGB 4R6VA 5D41A 4O21A 1XQZA 5GJGA 5DLSA 4DTKA 3KCKA 2UZBA 4F9YA 4CKJA 2CGXA 4E4NA 5CVHA 3MY0A 5B2MA 2X8EA 1DAYA 2B9FA 2R0IA 2X81A 2PVKA 2XEZA 3KC3A 3LJ2A 5K0XA 2OLCA 3K2LA 3QQFA 3SG9A 4HOKA 4MTAA 5CTPA 2ZV2A 5HORA 5HG5A 1GAGA 4IC7A 2UZVA 5EI8A 3SA0A 4I92A 4IBMA 1JOWB 2Y6MA 3OY1A 5F1ZA 4ZTNA 2C5XA 4GIIA 3Q9ZA 4G9CA 3TMOA 4L42A 3FLSA 2NO3A 3C0GA 4BGGA 4ZY6A 3HMIA 4ZZMA 1VZOA 2XUUA 2XS0A 3KU2A 3L9NA 4FKLA 4O1OA 2VWUA 4O7TA 2W7XA 4BHZA 5IQDA 3ZZWA 3PZEA 3KA0A 2JBPA 4XLVA 2GNIA 3R8UA 3ZXZA 2G15A 3TZ8A 4RIXB 5H8EA 2Z7RA 5K0KA 2C3KA 1DAWA 4CVAA 5KHWA 3UVQA 4OTRA 3RPOA 3HA8A 5E8VA 4MXXA 4L46A 3W2RA 4BDBA 5TKDA 3C4XA 4UMTA 3U9CA 3I6UA 2OG8A 3A7JA 3A8WA 4QP3A 3CGOA 2GSFA 2XK8A 4O0RA 4WNPA 3RAHA 5IMXA 3GC7A 1IAHA 5HD4A 1Q5KA 3EQDA 3DJ7A 4IAKA 1PW2A 1WFCA 5DA3A 5BMSA 2R3GA 4X0MA 4AWIA 4USEA 3VUGA 4DH1A 3TYKA 3NUYA 1VR2A 2WD1A 2YN8A 5AIKA 4IANA 4CFUA 3MY5A 3P23A 4BDJA 4QP2A 3ZSGA 4X3FA 3OG7A 3QRUA 4TNDA 3UOKA 3EWHA 4D2RA 3V5JA 4U41A 4QMOA 3SRVB 4F9CA 3B8QA 4ZP5A 4I3ZA 3DFAA 1B6CB 2BRBA 2W0JA 2CKPA 2VUWA 2IF8A 3HRFA 4G5JA 4DHJA 2PSQA 2C6DA 5EM7A 3G6HA 3I7BA 3D83A 3W2CA 1JNKA 2P2IA 2VZ6A 1UNLA 2PUNA 3W8QA 2YJRA 5E8WA 4CV8A 4OTFA 4O0WA 3WILA 4JAIA 4J71A 3HGKA 1ZLTA 4M0YA 4O27B 4BDDA 3BHTA 5FRIA 4ZEGA 4E26A 2BRHA 3OS3A 4O7RA 5CYIA 4ASZA 4RX5A 5IF1A 5FDXA 2WTIA 5DG5A 4PMSA 3QQLA 3C13A 5E8UA 2GQRA 2BUJA 5CI6A 4X6QC 2J0IA 3FL5A 1WVYA 2E9UA 4IX5A 2BFXA 5HE2A 4P7EA 4MYGA 3TV6A 3WYXA 4E6QA 2PVNA 2B52A 2VTJA 4D4SA 4OBQA 2X2LA 4FF8A 4ALVA 4RGJA 5F20A 5HNGA 1H4LA 3FHIA 5CQWA 3VUKA 4JBOA 5BUEA 4KKEA 3LQ5A 3IOKA 1XH9A 2XKCA 3DFCB 4IAIA 5FXSA 4O96A 5CX9A 4ZJJA 3GGFA 3ANQA 3LXPA 2VWZA 4RJ6A 5AAGA 4O86A 3PVWA 2W9FB 3QU0A 5M08A 1U5RA 2UVZA 3Q96A 4QYEA 3KK9A 4RA4A 3VNTA 4AU8A 5FM3A 5D7VA 3B2TA 2B9IA 4KAOA 4QMZA 4XG6A 4OW8A 1URWA 4W9WA 2VTSA 4QMTA 5EQYA 2XNOA 5M44A 1RQQA 2OIBA 4MD8E 4YNEA 4PNKA 5AAEA 4I6HA 5F94A 4WD5A 2O64A 3IKAA 1XH4A 3R73A 1KE8A 4W4XA 3UDSA 5L8KA 3NNXA 2B9HA 1FMOE 2UVXA 1YDTE 4XCUA 3QF9A 3UTOA 5G6VA 5LVPA 4IX6A 5FEEA 5E8TA 2HAKA 1WCCA 4E6DA 3KVXA 3RTPA 4QYYA 1YKRA 1ZOGA 3UQFA 1A48A 4Y83A 3ROYA 2IN6A 4D1SA 3TM0A 2JAMA 5IA2A 4RWIA 3OF0A 3Q3BA 3OP5A 1OKWA 3NW6A 4FIGA 4WNKA 4XV9A 4ZJIA 1HOWA 4V0GA 2UW9A 5EDPA 4DTBA 3RM7A 3V6RA 3PJ3A 4GMYA 3EFKA 3VBWA 4OT5A 3K54A 3R9HA 1XH6A 2OJIA 4M69A 3VS6A 4XG4A 4PV0A 1OGYA 3QLFA 3I0QA 3Q9XA 5ETAA 2R3KA 5EW8A 1PF8A 1U4DA 3R02A 3SLSA 5GINE 5AM6A 3RZFA 4AN2A 3L9MA 4GYGA 2VX1A 4F9BA 3NFFB 3L8SA 3BKBA 2G9XA 3E93A 4FKWA 4LGDA 5ANGA 3RHXA 2VTQA 2OBJA 3N51A 3OOMA 4AOIA 3SW4A 2OZAB 3FLWA 3OUNB 3DKFA 3VIDA 3IDPA 3Q2JA 4FV0A 4BI0A 2JKMA 4U43A 3VO3A 2WQBA 3E88A 2HIWA 2XYUA 4PTEA 4U79A 3KY2A 4IB1A 5IEVA 3LAUA 1XO2B 4IWPA 3HUCA 5F9EA 3L1SA 3U54A 4BCQA 2RL5A 3D5VA 4Y85A 3C7QA 4FE2A 2BDFA 3FAAA 3VS3A 3DLZA 3LFNA 2WFYA 4UX9A 5FDPA 4PMMA 3F82A 3RJCA 3DK6A 4M12A 4R5YA 2QOBA 3MH1A 2CSNA 4FYNA 3GENA 5CALA 5CU0A 2JDRA 3ZC5A 2FVDA 1SVHA 2I0VA 4XOYA 5DOSA 3ZM4A 4F09A 3C5IA 3UDZA 4IZYA 2HENA 2A98A 4CLJA 1GZ8A 3RWQA 3W18A 4FC0A 4F0FA 4FKGA 5DRBA 4BTMA 2FUMA 3OY3A 2AC5A 5CF6A 2JKQA 4WO5A 5IQAA 3EQCA 3FI4A 3BRBA 5J87A 5DRDA 2GTMA 3W2QA 5F4NA 1BI8A 5FTOA 3FPQA 1TFFA 4EOJA 2XCHA 5A6OA 1YDSE 5AX9A 5M4IA 4FV5A 2X0OA 3AD6A 2YAKA 3E64A 3MIYA 4DFYA 5EHYA 4NJ3A 2A2AA 4WUNA 4PMPA 1ZYSA 2VX0A 5AP0A 3RPRA 4U9AA 5CF4A 1H0WA 4BGHA 4R7BA 2VTAA 4RMZA 4O6LA 3Q4TA 3RAKA 1YXSA 4EZ3A 2GMXA 5IQGA 4KNBA 4EH4A 5TT7A 4BJJB 2UVYA 4O0SA 3BL9A 4BCJA 3U8WA 1VYZA 4FKIA 3ZLYA 4F1TA 4YJPA 2ERZE 5A4TA 4UZDA 5DVRA 3R8VA 3ZLXA 2YM5A 3PLSA 2WTVA 2ERKA 3OEZA 5AUXA 5CAOA 3V5PA 4TYHB 2GQSA 4DFNA 2CN8A 3P7AA 3GXLA 3MTFA 5AA9A 3TKHA 5IH5A 2XNMA 3BV2A 2CLQA 4JNWA 4YJTA 2WMQA 1QPEA 1GIIA 1ZYJA 4NJDA 4GT4A 3R28A 2RSVA 3FLZA 4ZLOA 4ZLZA 3PG1A 4FNWA 4BCPA 4RIXA 1PMUA 1YHSA 2QOIA 3HECA 4PL4A 2X6DA 2XNPA 2WO6A 3LFFA 4FSMA 4NH1A 1URCA 5JZJA 5FBOA 5CU4A 5JSMA 1O6YA 2RG5A 3BZ3A 3UBDA 3IG7A 1L8TA 3DY7A 3ZONA 4YC8A 2QQ7A 4FKOA 4FKTA 1UKIA 3TNIA 3HV4A 2WIPA 2CLXA 1J1CA 2Z8CA 2RFEA 3DJ6A 3F2RA 4O84A 3BQCA 3GU5A 2IW6A 3OCSA 2W99B 3QQUA 4CLIA 2VV9A 1WVWA 4DEAA 1O6LA 4AW0A 1Q8UA 1XMLA 4JDKA 4MK0A 3QCSA 4BDHA 4BYJA 1UWJA 1Y91A 4U7ZA 3RAIA 3TUCA 3HV5A 4C38A 4ZTSA 3BQRA 3AMAA 4KA3A 1YXVA 4MCVA 1ZXEA 4AT3A 3EJ1A 3EKKA 3F5GA 1FGKA 2ITUA 4QQCA 3BGQA 4HVHA 1NW1A 1ZMUA 5CSHA 3DQWA 2RF9A 5DEYA 4C2WA 2JIUA 3S2PA 4O81A 5A4EA 2W1IA 3BU6A 2F7EE 3AOXA 3EH9A 3I6WA 3SRVA 4AQCA 3DQXA 3WYYA 2CCIA 2OJ9A 3H10A 4UZHA 3R00A 3F2AA 5AP2A 4EUUA 3BYSA 5IUGA 4EOLA 5J9YA 1R1WA 2XRUA 2YZAA 5A4QA 4JBPA 3UOHA 4UALA 4IDVA 3FKNA 2VWBA 3D5UA 1G8SA 4C4EA 4I22A 4C0TA 4BWXA 4FTAA 2E9VA 3WF8A 5A3XA 4DBNA 3HYHA 3TKUA 4D2VA 1SZMA 4RC2A 2C1AA 3DNDA 4LRJA 5B0XA 4GU6A 3R7OA 4FYOA 3TT0A 3VS2A 3LXNA 4RVKA 3W0OA 4X2JA 4FNYA 4DEEA 4UMRA 3O23A 5KMMA 1F3MC 4ITJA 4WG4A 5HG8A 1FQ1B 1YI3A 4KB8A 4BYIA 5CEKA 5L8LA 5DGZA 4QP8A 3G6GA 2C47A 5KO1A 1OPJA 3HMPA 3SDJA 5KUPA 3NNWA 1BLXA 2LGCA 2WTCA 3NWWA 3NRMA 3QCQA 3QTSA 3LPBA 2XJ0A 3FDNA 3ZH8A 2UV2A 3QLGA 5I5ZA 4ZMEA 1DM2A 2JDSA 2YIWA 3FMEA 5KMLA 3DXQA 5K4JA 3G9LX 2YDIA 3R1SA 3ACJA 2SRCA 3Q5IA 3ZBFA 4IE9A 3TDWA 3FI3A 2IVUA 1H01A 3VBTA 1JKKA 4DFZE 1BL7A 1XWSA 4CKIA 2QG5A 2YIXA 2ETKA 1MRYA 3DV3A 4FSZA 2J0JA 4FT5A 3CJFA 3ZDIA 4BHNA 3KN5A 4LUEA 4MAOA 4YTHA 4PPAA 4YR8A 1ND4A 2ZM3A 5CEQA 3ORZA 4GJ3A 3L8VA 2OIDA 3IGGA 4FKQA 3A7GA 4KBCA 4FJVA 4TPTA 4CCUA 4UMUA 3GNIB 2IZSA 1H08A 2ETRA 2Y0AA 2YLFA 3QZFA 1W2DA 3HMMA 5BVEA 3VUMA 4FKPA 5EDQA 3BCEA 4KRDA 2ZV9A 4O4CA 3R1NA 2IEWA 3VAPA 1W8CA 2QLQA 2J4ZA 1DS5A 2YWPA 2YAAA 4A9UA 5HE1A 3BV3A 4F1OA 3D9VA 4RBLA 3EQRA 3R2YA 3ZEWA 4FSQA 4Y46A 4RIWB 3I60A 3ZO1A 1PYXA 4AF3A 4EOOA 3LLAA 5HBEA 5IDPA 1MRVA 1W83A 4BDIA 4XRJA 3ENMA 4BZDA 5HO6A 2EXCX 3HMOA 3KEXA 5EK7A 5GZ9A 4CTCA 2PWLA 4RJ8A 5EYKA 3RHKA 3G15A 4MXYA 4A4OA 4IX4A 4UXQA 4TW9A 4UXLA 3FEGA 2EXEA 3LFQA 1GIHA 3AXWA 5I9YA 4EEVA 3LVPA 2FGIA 2QKRA 3L9PA 2OZAA 5D7AA 5L6OA 3UDTA 4B9DA 4L45A 5C26A 5CXZA 1RDQE 2R3MA 4MH7A 4RWJA 4TTHB 2C6KA 2XNBA 3RNYA 1JWHA 1SM2A 2PE2A 5E92A 1ZOHA 1NT2A 3EN7A 4BKJA 4PP7A 4K0YA 4FT0A 4EZ5A 4B4LA 2GDOA 4E7WA 3JY9A 3E7VA 3OW3A 1H1PA 4M7IA 4ENYA 2YCRA 3A8XA 5HVJA 2B9JA 4YJRA 3MB6A 1FMKA 4EBWA 4IWDA 3H9RA 2F7ZE 4HNFA 3MY1A 3F7WA 1V1KA 5HIDA 2WEVA 4YJUA 2PZIA 1XH5A 2BZIB 4MQ2A 1S9IA 4K6ZA 2JDOA 5L6PA 4WG3A 3QGWA 4XOZA 4Y95A 4CFMA 3ET7A 4PDOA 4JT3A 1PXKA 4FZDB 3UP2A 3PJCA 4BDGA 3T9IA 2IJMA 3ZMMA 3Q4CA 1W2FA 4G16A 4GVJA 1RE8A 3C0IA 4EYJA 2EVAA 3IECA 3FI8A 5IG1A 1J7IA 1KOBA 3VQHA 3MPTA 5JQ8A 3KK8A 4QDVA 3FPMA 2WNTA 3UO6A 4HCVA 4CNHA 4I6LA 4YURA 3NYVA 2I1MA 3ZU7A 4DE4A 2REIA 5EOBA 3EFJA 3IW7A 3VWAA 5IA3A 2GS7A 4TY1A 4EK6A 1J3HA 1OBGA 5IQCA 4HZSA 3QX2A 4XV3A 3QTRA 4S34A 4GL9A 4BC6A 1H1RA 2R3IA 3FY0A 4YLJA 4MD9E 1JLUE 3ZRKA 2XA4A 2W05A 1K2PA 5D12A 4IAFA 5AR5A 3I5ZA 4NKSA 4XJ0A 4O0YA 4BJJA 2JFLA 3BELA 4TYEA 5A4LA 4GEOA 4KIPA 2W4OA 2J5EA 2P2HA 5K5XA 4ITIA 1XJDA 4RJ3A 5KZIA 3ZDUA 4I6BA 4B8LA 3H3CA 4J95A 2YCFA 2JDTA 4B8MA 1OVEA 4E20A 4YO4A 2WMTA 3I4BA 2C6MA 3HX4A 1H24A 4IZ5A 4PQNA 3GUBA 4HVGA 4IXPA 1VEBA 4XG7A 3E63A 5HNIX 5BX0A 3UC4A 1H1WA