3OTVA

Crystal structure of the intracellular domain of rv3910 from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
254
structure length
254
Chain Sequence
VQLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADRTEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 70
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3otvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3otvA01
1W83A 4GG5A 3TT0A 3QFVA 4HCVA 4ASZA 1KE6A 4PWNA 5C8NA 4G31A 1OPLA 4DYMA 3TV6A 3E62A 2VTRA 3HMMA 4FTJA 3MJ1A 4BKZA 4XG6A 5IKWA 4ANMA 3LXPA 2PK9A 3QCSA 3UOLA 3EJ1A 5DHJA 1L8TA 1ERKA 4JRVA 1NT2A 4XBUA 1PW2A 3HUCA 3F3UA 1UWJA 2W06A 5HICA 2OIBA 3PWDA 5M53A 5CF8A 1NA7A 4JDHA 2YN8A 4X7QA 2Z8CA 3VW8A 2YACA 2X81A 3ANRA 4G5JA 4G9CA 2ETRA 5DLSA 3FLWA 4I1ZA 3PJ2A 4IFCA 1YWRA 4I23A 4K11A 2I6LA 3D7TA 4U0IA 2ITVA 1K3AA 4FYOA 3FZSA 4TWCA 3ORIA 3G15A 2FSMX 3PVGA 3D5UA 5AUZA 5AMNA 2R3LA 3WI6A 4YNOA 5L6OA 2VWYA 2XKDA 3MB6A 3NUXA 4QP1A 4MX9A 4YO6A 1XH7A 5HLPA 4NM5A 5FG8A 2A2AA 4QMSA 2ACXA 2OXDA 5CAPA 2I0YA 4IW0A 3DTWA 4L00A 4LGDA 4O96A 3RCDA 2ZV7A 3MH2A 1NVSA 1LPUA 3ULIA 3Q2JA 4JX7A 4ZS0A 5A9UA 4D4YA 4M84A 3E92A 3LQ8A 4HW7A 4EK6A 3FXXA 2XS0A 1KOAA 2EB3A 5ITAA 5EKOA 4H39A 5BVOA 4PL3A 4GVAA 2BDJA 3ATTA 1UWHA 3NSZA 2JIVA 4GU6A 4F1TA 4O83A 2R3NA 3QXPA 4QMQA 3LMGA 4AZWA 4JNWA 2YIRA 2UV2A 2CLXA 3G5DA 5LMKA 2OO8X 3NCGA 3HECA 2ZAZA 3ORLA 4AU8A 4AX8A 4JR3A 4WNPA 1DM2A 3Q6UA 3B2WA 5ACBC 3WF5A 4RIYA 4FL3A 3TTIA 2E9NA 3OMVA 3FMEA 5FWKK 4NM3A 1T46A 2QOHA 3O17A 4OBQA 3PXZA 3QRKA 1J7UA 1IR3A 3D9VA 3GC8A 5IEXA 2HXQA 1FMKA 1YWNA 1CDKA 2I40A 3QQUA 3FWQA 4G3GA 3BQRA 4S33A 2QG5A 5D41A 3PTGA 5HCXA 2X2MA 2R3HA 4K18A 4QMZA 3R9NA 4LRKA 2GQGA 2W99B 3FMMA 4PPBA 5HBEA 3A99A 3R83A 2QG7A 4X2JA 2X6EA 2HWPA 2VWUA 3R30A 5IUGA 5JGBA 4BDCA 5TO8A 4V04A 3HV4A 4XEYA 2YIQA 4QP3A 3VNTA 2BKZA 3HVCA 3R01A 4E26A 3V5LA 1VJYA 4BDGA 4CEGA 1OIQA 5CSHA 4YGAA 2IZUA 1ZYCA 4Q5EA 5BMSA 5KHWA 4FEUA 2BAJA 4DFLA 3BYSA 3EIDA 2XCKA 4FKSA 4J7BA 1Q41A 4K77A 3AMAA 4D28A 5IH6A 1QCFA 1U46A 2UZDA 1BMKA 1KE8A 2ITTA 5EG3A 5HG5A 3CTJA 4IVCA 2ZB0A 3EYHA 2X2LA 2QO2A 3P78A 3U9CA 4FSTA 3HA6A 4I5MA 3D7TB 3DLZA 3G9LX 4AT5A 4WUAA 4KRDA 4UEUA 3CSVA 3FMNA 5EHLA 2SRCA 2OJ9A 3I7CA 2ETMA 3TUDA 4I5HA 2XIKA 1PXPA 4R78A 3AC5A 3WE8A 4AOJA 1YI4A 5CEIA 3UYTA 2QHNA 3F3TA 1URCA 3GGFA 2H34A 2WZJA 4BYIA 3NVMB 4TW9A 5M44A 2WTWA 4APCA 3KF7A 4OUCA 3UO6A 4C36A 4O7VA 4C57A 4LL0A 1G8AA 3R9RA 4ANOA 4C4FA 4A9UA 5TOZA 2OG8A 2UW6A 4QTEA 1PMVA 4FTUA 4F6WA 5JK3A 3UMXA 3EHAA 2XK7A 2XUUA 4GEOA 5CU6A 1QPEA 2C6IA 3LOKA 4IM3A 4WUNA 4XV2A 2ITYA 1PMEA 2VTQA 3QCXA 2BROA 4ARKA 3MIAA 2HZIA 2OU7A 3EQPA 3RZBA 4EWHA 2PE2A 2ONLC 3A7JA 3KGAA 3R9HA 4MD7E 3RMFA 3GC9A 4IM0A 5CI7A 5E8VA 2UZOA 3D94A 4E4MA 1LEZA 2XKFA 4QRCA 5ANEA 2ITQA 5L2QA 2YM5A 2EXMA 3GU7A 3DFCB 2ZDTA 5DWRA 4RIYB 4D4SA 4DH5A 5FEDA 1MRYA 2BIYA 4QMOA 5LCKA 3LCKA 3TIZA 5CSVA 2CCHA 2YCSA 2X2KA 3E3BX 2R3GA 4O0YA 3GU4A 3Q96A 3HMNA 3KMUA 2YABA 3TUCA 3VW6A 4W8EA 3ZUTA 2XBJA 2Z7RA 1CKJA 5G1XA 5AEPA 5EW3A 4BWPA 4NKSA 1JKLA 3SV0A 3BHUA 4RIWA 3F2NA 4LV5A 4YLLA 5JEBA 5IA0A 3FLQA 2EVAA 3UTOA 3KULA 2PVLA 4H3PA 4ITIA 4TL0A 5EW9A 1GZNA 2J5FA 4O0SA 4QMLA 3UMWA 3EQIA 4LMNA 5CSWA 3LQ5A 1SM2A 2AC5A 2VO7A 4YZBA 3T9IA 1JVPP 1WBTA 4RQKA 4OTDA 3TV7A 1LEWA 4AA4A 4IZ7A 5A4LA 4DT8A 4ZSAA 4AZTA 4CYIA 1YXVA 2VU3A 4MD8E 2YLFA 4AP7A 1FMOE 4FTQA 4ZLZA 2GQRA 2BRHA 5FDXA 5FXSA 2C0TA 4DH1A 4YJPA 3QU0A 4JT3A 5EDRA 3K2LA 4JXFA 3WZKA 4B4LA 4EKKA 5FXRA 1KV2A 3MFTA 4BCKA 3PY1A 4QD6A 4QOXA 2W0JA 2OW3A 4EQCA 4KS7A 2QU6A 4NUSA 3UDBA 5C27A 3DGKA 2R3KA 1IASA 4RVTA 2Y9QA 1M7QA 3RWPA 5GIOE 1Q3DA 5CAQA 5JMSA 5E7RA 3CTHA 4GU9A 3QCYA 4IH8A 2B55A 2P0CA 3BGQA 4CMUA 2R3FA 2OXYA 5LCJA 3DAJA 1ZYLA 4TNBA 5DA3A 2P2IA 1S9JA 3VAPA 2XK4A 4GKIA 3N4TA 1Y8GA 2B0QA 4FTCA 3MPAA 3MWUA 3CGFA 2YDIA 3K5VA 4DINA 2UZWE 3ID6C 2CLQA 1YW2A 1K9AA 2IN6A 2R3MA 4JQ8A 3LLTA 5DEYA 4NJ3A 4ZTLA 2VWVA 5AAFA 2ITOA 2RSVA 4IAFA 4FL2A 1OMWA 4K8AA 4U42A 2BILB 1ZARA 4EHVA 3VS6A 3VUTA 1ND4A 2CHLA 3OXZA 4IANA 4WKQA 3EN9A 1Q61A 4QYGA 3KQ7A 3A7FA 2Q0BA 3R22A 1JSVA 5F1ZA 3E8DA 5J87A 4G1WA 3UVRA 4RVLA 4L53A 5DR9A 5BVEA 2BAQA 4J98A 5C8KA 4HGTA 4LUDA 4YLKA 3VS4A 4BN1A 3EZRA 4EK8A 4RC3A 4XUFA 5KZ0A 4YJNA 1KUTA 2PUPA 1FGIA 3DKCA 5J1WA 2BUJA 4M69A 3D14A 4X6QC 1Z57A 4M12A 4OTGA 3UQFA 4F9WA 1PYXA 1AGWA 2GCDA 3EFWA 1JBPE 4FKOA 2UZTA 4JBQA 4RJ6A 1J1CA 1PXJA 3OVVA 5AV3A 4RIWB 4FKTA 3QA0A 3RJCA 3EFLA 4CFNA 5KE0A 4O7YA 5L8KA 4FODA 5CVHA 4ITJA 2YITA 4Q9ZA 4TYHA 4I94A 1BI8A 1UA2A 3FY0A 4FEWA 4IAZA 3IPHA 2FVDA 3QA8A 3ZO4A 5CT7A 4UWCA 5BVNA 1CMKE 3GC7A 2ZV2A 3S4QA 1VR2A 3DS6A 4EOJA 4MVFA 2C1BA 3QC9A 4HYIA 4QTAA 4HCTA 4W4XA 4C4EA 1YOMA 4DFXE 4YSJA 1ZWSA 5JGAA 3FYJX 3E64A 5L6WL 4A9SA 3VS7A 3PYYA 2FSOX 2ITUA 3OT3A 4ZZNA 4GJ2A 3FZPA 4FIEA 4CXAA 5GHVA 3CD8A 3CC6A 2REIA 3CPBA 4OTIA 2HELA 2CKQA 2R0IA 3BCEA 3L9LA 4U7ZA 4L3PA 4K1BA 2IO6A 4FT5A 1CM8A 4FSZA 3FMJA 4FSUA 2NO3A 2YISA 3PIZA 4RWKA 3RPVA 3KREA 5BPYA 4EZ5A 2CNVA 2VTMA 3GBZA 3OG7A 3MH1A 3QQFA 4KD1A 2V5QA 1L3RE 2XK6A 4H1MA 1PMUA 3OTVA 4KA3A 5B2LA 4RQVA 3FY2A 3AOXA 2XVDA 4OTQA 5KZIA 4C35A 3E8NA 3GUBA 5ANGA 5L2IA 1OPJA 2XB7A 4YU2A 4O86A 3EFKA 4PTGA 1BLXA 2JDTA 4IVBA 2W1ZA 2UZEA 4FV2A 3HMIA 3IW4A 3Q9YA 2YM6A 4LOQA 4FIJA 5E4HA 3F69A 4UWBA 4IMYA 5LVPA 3AC2A 3CKWA 1JNKA 1DS5A 2CMWA 4E7WA 4JAJA 4TPTA 3WF9A 5HU9A 3BBTB 1B6CB 2A4LA 4IBMA 4MNEB 4BHNA 1YI3A 3CP9A 5AUVA 5CF5A 2HY0A 4EJNA 3GCQA 2VZ6A 2DYLA 4HGEA 3WARA 3W8QA 3VBQA 1FPUA 1OKYA 1UU9A 1R0PA 3L1SA 2UW3A 4N4SA 4M69B 3VQHA 4FGBA 4ZZMA 3WE4A 2W1GA 2F49A 4FTAA 2WMWA 4C33A 2Z7QA 4BDAA 3KXNA 4EH5A 3NIEA 4C37A 3KXZA 3LLAA 4BCNA 5TKDA 3N9XA 3Q4UA 3QRTA 4KIQA 4BTFA 4BZDA 3FQHA 4R3PA 5A14A 3NEWA 5EFQA 2PVNA 3QRJA 4B9DA 2VTNA 4ZP5A 1NY3A 2P4IA 3UP2A 4WG3A 5H9BA 3R8ZA 5AV2A 1WZYA 2GTNA 4QYEA 3BWJA 3TKIA 4DC2A 2IWIA 3FE3A 4XYFA 2C5NA 4J71A 3NZ0A 3UZPA 5BMMA 3TN8A 4EBVA 5M55A 4YC3A 3AC8A 4JG6A 4X2FA 4F4PA 3LJ2A 2F9GA 5K5XA 1Q8WA 3NW7A 1M2QA 3VBWA 2X4FA 4F08A 2NPQA 1NW1A 2QO7A 5JRQA 2XIXA 5GZ8A 1OPKA 4EH3A 3AQVA 2V7OA 3ALNA 3AT2A 4OBOA 3IOPA 4EORA 5LMBA 1SYKA 2XYUA 4TNDA 4XRLA 1ZYJA 5AIRA 2X39A 2JKKA 4D0XA 5JQ8A 2FSLX 5HGIA 3RKBA 5DG5A 4U79A 4KBCA 4MF1A 3FMDA 4BHZA 3IOKA 4FR4A 1Y6BA 2GNGA 3IDBA 4PY1A 4HVGA 3HL7A 4XBRA 2GQSA 1GY3A 2GFSA 3OY3A 3ZEWA 4IM2A 5HZNA 4GW8A 3NYVA 4EOQA 3ZLXA 4CG9A 4FG9A 2UUEA 4F7SA 5EQEA 3LJ1A 4IQ6A 4AFJA 3IGGA 5IQEA 3QRUA 4O6LA 2HYYA 2G15A 5CU3A 4BCJA 3Q60A 3V5PA 4MWIA 1SVEA 4HYUA 3F2RA 4MK0A 4GVJA 2W05A 3VRYA 5ANIA 2Y7JA 5EHYA 4FKGA 4RSSA 1Q3WA 1MRVA 2C3JA 3QD2B 4FUXA 4RJ5A 4FTTA 1GIIA 4FOBA 5GJFA 4DGNA 5A46A 3R8LA 2QVSE 3UG1A 5CQWA 2VNWA 5CXZA 4FV6A 1UV5A 2J0JA 4M0YA 3TZ9A 1JSUA 2XK8A 2YM4A 3ZZEA 1WAKA 1YXXA 2NRUA 4BF2A 4DITA 4BDKA 1V0OA 2BAKA 2XMYA 4YC8A 3SLSA 1H1PA 1WMKA 5BQ0A 2JIIA 1ZOGA 3C4WA 2QKWB 3MFRA 3CY2A 5K0XA 3L9PA 5HG7A 5KMKA 3R7UA 4GFMA 3DK3A 2G9XA 3PA3A 3LXLA 5JN2A 3BU6A 3PE1A 5D1JA 3RNIA 4GV1A 4O22A 2W1FA 5AP0A 4AT3A 4F70A 3VRZA 4UN0C 3OOMA 3KRWA 2WEIA 2CNUA 5I9ZA 5H8EA 5HBHA 3TG1A 3TL8A 2GHGA 2E9OA 4G9RA 4I22A 2B9JA 4L9IA 2DQ7X 5HG8A 4AN3A 4F9BA 2WQNA 3T3VA 3MVJA 3UOJA 3UNKA 4ZS4A 3KA0A 4FV1A 2WTKC 3DQWA 3CIKA 3DKGA 4FVQA 4JG8A 4CZTA 4H05A 1H0VA 3OXIA 5T68A 5DN3A 5C01A 3ZZWA 3U6HA 4BBFA 1OL7A 3LXKA 3TACA 5IPJA 2OJFE 3D15A 4IX3A 1YXSA 4EH4A 4RBLA 1V0PA 3SW7A 3QQJA 3GENA 4BDEA 2WMBA 4FA2A 5HQ0A 4MD9E 4O7SA 3CJGA 4DFYA 3ZXZA 3TDWA 3DK7A 4UB7A 1GZOA 5IQDA 2XIYA 3OWLA 4RZWA 4FEVA 2X4ZA 4JRNA 5FEEA 2C6DA 4K2RA 3GCVA 3DBCA 2W1EA 2Y8OA 4FMQA 3TWJA 4BCQA 4JOAA 3PDTA 5EQPA 3PA5A 4I6FA 5HLNA 2R4BA 3C0IA 3C0GA 4FICA 3MJ2A 4CQGA 5JRSA 2OH4A 4M67A 1FGKA 4DCEA 4IX4A 4GSBA 4C2WA 4I4EA 5FP6A 5M57A 1H01A 1GAGA 4IZAA 2HK5A 4UMRA 1TKIA 2A1AB 2R7BA 4ZTQA 3BLRA 3MGYA 2C68A 4F6SA 3KXMA 4HVHA 3W2OA 4ONAA 4D5HA 3AD5A 4J8NA 4BBMA 3BGZA 5FD2A 3SHEA 1VEBA 2WD1A 3C4EA 3F66A 4QMTA 4FV5A 4FNZA 5BVKA 4I6QA 4I20A 3DAKA 2B4SB 4CFWA 4FT3A 2G2IA 4I5PA 5FXQA 2GS6A 1R78A 2CGVA 3WF8A 3FPMA 3QZGA 5DIAA 5KKRB 3NMUF 4LGHA 3SW4A 1E1VA 2HXLA 3G51A 5E8TA 1YDSE 3UIMA 3IK3A 3ULZA 4DFUA 5T3QA 4BDDA 2J0IA 3Q4CA 3ZUUA 5T6KA 2IW8A 4R3RA 3ZONA 4C4GA 3BV3A 3MIYA 5HU3A 1ZMUA 4FSQA 4O0RA 1BI7A 4BGHA 1OL5A 3RTPA 4QPMA 2VGOA 3COKA 4CD0A 4U40A 3IECA 3C0HA 5AR3A 2VTIA 3KN5A 2VTHA 4E1ZA 3DDQA 3DXQA 2C4GA 3QYWA 4GL9A 4FK6A 4U3YA 1M2RA 5M4CA 4E8AA 4HOKA 3R2YA 3IONA 1E9HA 4F63A 1H25A 2GNHA 1ZMWA 1FBNA 3G90X 2VV9A 3ITZA 4PPCA 5D7AA 3ZEPA 5K4IA 2DUVA 2C5XA 2OBJA 2PZ5A 3NNVA 4FX3A 2X8IA 5HE1A 3R7OA 5HBJA 3TZMA 4OAVB 1J7IA 4EH2A 4BCMA 5J95A 1JLUE 3BE2A 4FKRA 5AP3A 3H9FA 5FQDC 4AGCA 4EOKA 4AA5A 3FQEA 4EC9A 2GSFA 3C51A 4J1RA 4LQMA 2ERKA 5AIKA 3U4WA 2CGUA 2PMLX 2WQBA 5B2MA 4I41A 2UW9A 3QUEA 4ENXA 4P90A 5J9YA 5D10A 3E63A 4GMYA 4FOCA 1UNLA 1WCCA 1ZMVA 2OF2A 3AC1A 3PRFA 4YZMA 2ZMCA 3FQSA 1KWPA 4GKHA 3FHRA 5TF9A 3FI8A 3LFEA 4R8QA 3EYGA 1WBSA 3IQ7A 2CNQA 2XM9A 2HZNA 5IQAA 2VX3A 3OW4A 3FC2A 3WZDA 4BRXA 3V6SA 1H07A 4QTBA 4CGAA 1WVYA 3AC3A 2J6MA 5D9HA 5AV0A 2VO6A 3C7QA 3HRBA 5BYZA 5C26A 3TV4A 5IF1A 4AGUA 4IX6A 3HRCA 4M66A 2VWZA 4YO4A 4IC8A 2PPQA 2XCHA 3IS5A 1OUYA 4TN6A 2YERA 5DOSA 2PZYA 4CFUA 4Q9SA 3VULA 4BKJA 4O84A 3NUPA 5I9YA 4MEDA 1CKPA 2WIHA 4AGDA 1JSTA 5CSPA 4MHAA 1FINA 4RFMA 3E87A 3I0OA 2CSNA 1PKDA 3QD4A 3E93A 4XV1A 3ZM9A 5I9UA 3II5A 4A4OA 4NT4A 2WQEA 3E5AA 3P86A 3R9DA 4G16A 5KHXA 4G3FA 5M06A 3BWFA 2ZJWA 4ZLYA 4DEBA 5FM3A 3WF6A 3VS2A 5JGDA 2BZIB 2JITA 3DLSA 4DBNA 5I9XA 2OSCA 2RKUA 3F5UA 4EK5A 3PPJA 1XO2B 3UBDA 3VWAA 3DQXA 5DR2A 5IUIA 4IX5A 3P9JA 4Y95A 3KXHA 5LVLA 3ZFMA 5DT3A 4BFMA 5JSMA 1XBCA 2VWWA 3NW6A 5LVNA 3WBLA 3Q5IA 1UNGA 4RFZA 1UU3A 4G6OA 5H3QA 1IRKA 2BMCA 1H1QA 4U80A 4M8TA 1VZOA 5KUPA 2WU7A 3F82A 3P1AA 4EZ3A 4C4JA 2JLDA 5E92A 4K0YA 4R7BA 4FIIA 3IDPA 5FTGA 3FKNA 4HGLA 3I7BA 3P5KA 3DV3A 4MTAA 3DJ5A 4QTCA 5DT4A 2PHKA 3COHA 2OGVA 4PRJA 4D2RA 3M11A 3DBQA 3A2CA 3MH0A 3PPZA 1J1BA 4MXCA 1WBNA 4EH8A 1BL7A 1WBVA 2XK9A 3DXPA 3R04A 1WBWA 3ODYX 3TNPC 2YLEA 4X3FB 1RW8A 4EC8A 3VHEA 3UODA 1DAWA 3CQUA 4JIKA 4LG4A 4E20A 5BNJA 3MH3A 1OL1A 5IA5A 4DLIA 5CF6A 3GP0A 2PUUA 4UY9A 3TM0A 2ITZA 1W7HA 3MTLA 2OJJA 3TNWA 4AW1A 5ETCA 2ERZE 4EH6A 3QTIA 4NCTC 3U6IA 1V1KA 1PXMA 5CU0A 2RFSA 4DLJA 3OCBA 4F64A 2PZIA 4DHFA 4FV3A 3JY9A 4MXOA 4UMUA 5KBQA 4AOIA 1OITA 3R7GA 4XP3A 5BUIA 3PXQA 3W18A 3MPMA 3DBDA 4Y8DA 5EKNA 5IMEA 2E9VA 3P23A 1MUOA 3SRVA 4BB4A 5E1SA 3O23A 2OJIA 2IVVA 3D5VA 3IW5A 1YOLA 2JDSA 2P33A 1WBPA 4KAOA 4O1OA 3Q9ZA 4FI1A 4Q2AA 5ETFA 3LHJA 3MA6A 4XH6A 2ONLA 1OB3A 1GZ8A 3BLQA 3OFMA 3QL8A 5EDPA 4DFNA 4F99A 1QL6A 5AP6A 2J5EA 2X6DA 4PMPA 2C47A 4WBBB 3PP0A 3LFQA 5HIEA 1XH9A 2G2HA 5KNJA 5LOHA 2QKRA 5I3RA 5L2WA 5HE0A 4HVDA 2KULA 2OWBA 2OZAA 3DZOA 1A06A 4G17A 3TDVA 2IG7A 1MQBA 3IW8A 2X1NA 4BDJA 3GOKA 2BIKB 4E6QA 1ZRZA 2ZB1A 4F7JA 4O91A 4Z55A 2PUIA 2E9UA 1J91A 4L52A 2R64A 1ZYSA 2PY3A 4ID7A 1M52A 2JKOA 4XG8A 3QRIA 1M14A 3Q4ZA 2UZLA 2XJ0A 5E91A 3QAME 3LE6A 3O7LD 5CTPA 3UO5A 4O82A 2NNWB 2UW4A 2FB8A 2QO9A 2IPXA 3ZC5A 3C1XA 3MFSA 5ACKA 4YTCA 5DBXA 2C6OA 4TWNA 3SA0A 5HTIA 5IEVA 3V5WA 3HAVA 4I4FA 4BDHA 1WFCA 3SGCA 2PYWA 4BYJA 3TNQB 2C6TA 2PZPA 4C58A 4F9AA 4TZRA 2RFNA 5J9LA 4EJ7A 4Y73A 4CKIA 4EHGA 1Q8TA 4UMPA 2RG6A 3DKFA 3N51A 2QC6A 2O65A 3FL4A 4CNHA 5HIDA 1O6LA 3FXWA 3ZTXA 3RVGA 5HO6A 4YNEA 4F1OA 4R7IA 4HNFA 4AZSA 2QONA 4RWLA 2QOQA 3G0EA 2WMAA 2QLUA 4S2ZA 4PNIA 2YIXA 3DA6A 2GFCA 1YVJA 3DT1A 5CF4A 3S00A 4D1ZA 4A07A 3SOAA 5BX0A 1OUKA 1MP8A 4GYGA 2ITXA 2XP2A 3QYZA 3GEQA 2ZYBA 4NTSA 4EHZA 4F0GA 5CEOA 2VN9A 3KMMA 2CN5A 3B8QA 3MTFA 3OWKA 4PNKA 1XBAA 2W9FB 4HGSA 4PTCA 4RC2A 5KMIA 4E3CA 3VF9A 3ERKA 4QNYA 3BYUA 3FXZA 1PXKA 3T8OA 2UW5A 4E4XA 1OVEA 2ZDUA 2Z02A 4O7TA 3IW6A 3COIA 5GJDA 4EH9A 1URWA 1KE5A 3WIKA 3U6JA 4CLIA 5HTBA 3U54A 4APPA 4NZWB 4FKWA 3B2TA 4OTHA 4R5SA 3NUAA 3C4CA 4GRBA 5HORA 5I5ZA 3V01A 2C5OA 4EBWA 3HV6A 3MBLA 4O1PA 4W9XA 1KV1A 4E5WA 2OZAB 3AMBA 3OOGA 4G34A 5ANDA 3GNIB 3OT8A 3RK5A 4BTJA 5F9EA 3L8XA 2H9VA 4C2VA 2BKKA 2HY81 5LXMA 2VO0A 2NRYA 4FVPA 3TZ7A 2PVHA 3OS3A 4HYHA 3CY3A 1GOLA 3VBYA 4XOZA 4CG8A 4A7CA 3EKKA 4IB5A 3V8SA 3VBTA 1ZOHA 4IAYA 4JAIA 4YJTA 4ZTSA 1BYGA 3BHYA 3UIBA 5BVDA 4KUJA 3G6HA 4ACMA 5KCVA 3ACJA 4YUQA 3EWHA 5G6VA 4F0FA 5M4UA 3OCSA 2VWXA 3HDNA 4AAAA 4FKUA 2YFXA 5FEQA 4YPDA 3GQIA 5GINE 1J3HA 4C38A 5I4NA 4KSQA 4XLIA 1OL6A 2XEYA 3NUYA 5CEQA 3D5WA 2WAJA 3LCOA 2HWOA 1Q8YA 4TYJA 2WFYA 3H9RA 2WQOA 4EOSA 4DGLC 4FYNA 3NUNA 4PL5A 5E8UA 4EK3A 4RG0A 4X2KA 2EXCX 5CLPA 4TY1A 5FDPA 3KRLA 4QPSA 4RT7A 2YJRA 3ROYA 1W0XC 5HNBA 3UGCA 3VJOA 3ZXTA 5M56A 4O21A 4RVMA 5L2TA 2CPKE 4MXYA 3E7VA 3R9OA 3HV5A 5AM7A 3W10A 3R6XA 3PE2A 4U97A 2IVTA 4BL1A 3AT3A 3KRRA 4OW8A 4QQ5A 4UWYA 5FTQA 5FLFA 3Q04A 2JGZA 3WYXA 4LGGA 2PE1A 4G2FA 1F5QA 3QLGA 2PVKA 3RHXA 5M4IA 1PXIA 4GYIA 1YKRA 1YHVA 4KWPA 4IVDA 4K6ZA 5C03A 1H26A 2GU8A 2G2FA 2VWIA 1XH5A 3A60A 3ZLWA 2GS7A 5F95A 3KRJA 4DFZE 2BVAA 4KIOA 2QCSA 3SXFA 4HJOA 3OXTA 2QOIA 2YCFA 3JVSA 2XNEA 4WD5A 3EN5A 3F5XA 2QU5A 3WZEA 4AOTA 3TZ8A 3MYGA 2CGXA 4HNIA 2YAKA 4KIKA 5EH0A 2GHLA 2ZVAA 4II5A 4NYEA 3ROCA 2W5BA 4U43A 3UZTA 4FG8A 3C4FA 5AR4A 5CQUA 2WTIA 3R63A 4EYMA 2JFLA 4MBIA 1U59A 4PV0A 2ITWA 3NUUA 4FEQA 3KULB 5IH4A 4EL9A 3CXWA 4I24A 3ANQA 3V04A 1WVXA 1OKWA 1JKKA 4JX3A 4BCPA 2YZLA 1XH6A 2R7IA 3C9WA 5FUTA 4O7LA 5B2KA 2JAMA 3A7HA 4ZAUA 3NWWA 4ZY6A 1H24A 4GUBA 1JAMA 4PMMA 3RGFA 2OZOA 3ZH8A 4MAOA 3G2FA 3VBVA 3W32A 4DTAA 3QD0A 2GTMA 2Y6MA 5AM6A 4B6LA 4J97A 3DJ7A 4S32A 5HE2A 1A9UA 3NX8A 4G3EA 2HENA 2Z7SA 2VD5A 1YXUA 5HVJA 4O7WA 4B99A 4ZIMA 5IMXA 2R0UA 3Q32A 3FLNC 4O7NA 1O6YA 2XA4A 1RQQA 3NNUA 3NNWA 4RIXA 2BTSA 2C0OA 2ZM4A 3R7YA 4ASXA 1XJDA 5EM6A 5KMJA 3KVXA 2QOBA 4D58A 3OWPA 4AW0A 1P4OA 3E88A 4EQUA 4RJ4A 2XNNA 4QMWA 3ZFYA 5AUUA 4W4VA 2V55A 1WVWA 3DXNA 5HG9A 4NFMA 5F4NA 3LFFA 3RPSA 3BRBA 3BZ3A 2VO3A 3FSFA 2QR7A 3K54A 3MW1A 3IO7A 4P5QA 5IISA 4KIPA 5DPVA 5JZNA 1H1SA 3NUSA 4M3QA 5HIBA 1R3CA 3F5GA 3FL5A 3HV3A 2RFEA 4TYEA 3JY0A 3FZTA 3QALE 3ZRLA 4F1MA 1IA8A 4YJVA 4KB8A 4GIIA 4FSYA 4FV7A 3NIZA 2G01A 2VGPA 1W84A 4G3CA 5AR5A 4JR7A 2C0IA 1OBDA 4G6NA 3KL8A 5D11A 2BRGA 5IDPA 4AACA 4F9CA 3ZC6A 3ZRMA 4CFFA 3TKUA 2VAGA 3RK9A 3ZCLA 5IH5A 3COMA 3MVLA 5IA3A 4DGMA 1W8CA 3M1SA 3O8UA 1LR4A 2QD9A 3PLAE 4BIBA 4MQ1A 4CFXA 4QQTA 2VTPA 2VX1A 5CYIA 4AA0A 4TTHB 2H6DA 5IA2A 4KIKB 5CZIA 3UQCA 3AC4A 4BI2A 3LCTA 2X8EA 2JEDA 4H3QA 1APME 4MBJA 3CQEA 4TT7A 5B7VA 3SXSA 4XG2A 1SNUA 3HLLA 5DRDA 4D4VA 4L42A 3LW0A 3VS3A 3V5QA 3KU2A 3FMHA 2P55A 2JDRA 2WO6A 5FRIA 3A61A 4TYHB 1X8BA 2W5AA 1YWVA 5CVFA 5F94A 4IB3A 5K4JA 1Z9XA 1WBOA 4GT5A 5GJGA 2E9PA 2CDZA 4IB0A 2WMUA 5J7HA 3ZSGA 3UYSA 3L9NA 3K5UA 5CSXA 2XRUA 4H58A 1Q5KA 5CAOA 5M07A 3PXFA 3UPZA 3JVRA 3KB7A 3ETAA 2R3IA 4ZOGA 3UNJA 3QUPA 1RE8A 2F7XE 1UKIA 3OC1A 4MXAA 4ALVA 2JAVA 2W1DA 4QQCA 3PIXA 2W1CA 3EN4A 4AE6A 4RJ8A 1PYEA 4CV9A 4RIXB 3C5UA 1Q62A 4KKGA 3KRXA 1OIRA 3W16A 3VUKA 4HVIA 1LUFA 4ZMFA 4FBXA 4QNAA 5IUHA 3KEXA 4L8MA 5AR2A 4DTBA 2IZSA 5LWNA 4OTFA 3UO4A 3UE4A 4ACHA 4KINA 3HV7A 5AA9A 1M17A 1OGUA 3ENHA 1YHSA 2Z2WA 3RPOA 3EQGA 3ZO3A 3W2QA 5HVKA 4C3RA 4U6RA 3L8SA 1Y57A 3QQHA 4QQJA 4FT0A 5JFXA 3POOA 1PXNA 4XG4A 2RIOA 5AP4A 2J50A 4D2WA 2C5VA 5FP5A 4ZMEA 3QF9A 2DWBA 3BX5A 4AGWA 2W96B 3EZVA 1KSWA 3EH9A 3VO3A 2PWLA 2JD5A 1BUHA 3F6XA 4OTWA 5CVGA 5AAEA 4E5BA 4C4HA 2P2HA 4U81A 3P79A 2C1AA 2RFDA 3CBLA 2E2BA 3FBVA 4MXXA 4HPUE 4EH7A 3V51A 4CFVA 3MV5A 4Y5HA 4ACCA 3WOWA 4USEA 4H1JA 5F20A 5DE2A 3LXNA 3QZFA 4CLJA 3PA4A 3C50A 4BKYA 4K33A 4QMVA 3S95A 2VTSA 2BZKB 3ZHPC 4QPAA 4ZLOA 4I6HA 5L8LA 3QD3A 5E1EA 1ZLTA 2IVSA 5ANOA 4CZUA 4FKPA 3Q3BA 3CPCA 1Q24A 3QBNA 5K3YA 4LI5A 3PPKA 4FVRA 3V5JA 5JFSA 1SVGA 4W8DA 5EM5A 5M08A 5TR6A 4H3BA 4BTMA 3HYHA 2JFMA 3NAYA 4U5JA 5AP7A 5CEPA 3EMGA 3R8PA 4CTCA 3H9OA 4CV8A 4XV9A 2W4KA 3HKOA 5CU4A 2IZTA 5E8YA 2WMQA 2CGWA 4YTIA 1QPDA 5IQCA 4YURA 3NAXA 1E1XA 5JFWA 1YI6A 3ENMA 4X21A 2X9FA 4J52A 4ANLA 2QQ7A 3OF0A 2AUHA 4JL9A 3PY3A 1OIUA 1REJA 1ZY5A 2V0DA 4OTPA 4B7TA 2YEXA 2IZRA 1OIYA 4DA5A 4YJUA 2YM7A 3EQFA 4IHPA 5I9VA 4X2NA 1UKHA 2B9FA 5BVWA 2Y6OA 4ALUA 4IACA 4JDKA 3H0ZA 3JXWA 4KKHA 5AA8A 3FI4A 4C7TA 5EM8A 1A48A 2PU8A 2W1HA 3UP7A 4C3PA 4FF8A 4TKSA 1OKZA 2GDOA 4PDOA 2Q0NA 4ANSA 3IW7A 2FUMA 4BZNA 4YTHA 1P2AA 3DAEA 1I44A 1H1RA 1PMNA 3VS1A 2WEVA 2V22A 3UG2A 5J1VA 3EL7A 4PP9A 2I7QA 3P0MA 3JS2A 5L3AA 4A06A 4UXQA 4KKEA 4M68A 2VWBA 4IWOA 4ZY4A 4X2GA 4V05A 1HCLA 5GNKA 3Q52A 3DDPA 3POZA 1XH4A 5K0KA 5GZ9A 2QLQA 1TVOA 3PJ1A 3WZUA 5DH3A 1PY5A 5LWMA 4FC0A 1G8SA 3HP5A 3MA3A 4I21A 4ASDA 4BI1A 2PE0A 5KKRC 4RZVA 2YZAA 3MDYA 3LIJA 2FYSA 3U51A 2Y4IB 3KXXA 2R5TA 3BYOA 3WILA 4EYJA 3S2PA 5L2SA 4O7ZA 2OJGA 4MH7A 4H36A 3UIUA 4BI0A 2B9IA 4PQNA 4A9TA 3UQGA 3HX4A 3SDJA 2BCJA 3QTZA 4BCGA 3FKLA 4NK9A 5CNNA 4CCBA 3OCTA 5CENA 1UU8A 4O81A 2YWPA 4EOOA 3CJFA 4NWMA 1ZYDA 4QMMA 4WNKA 2WTJA 1Q8ZA 5L6PA 5HE3A 2QOLA 4RPVA 3EQRA 1UNHA 3MY0A 4FT9A 5EOLA 4CMOA 4FV8A 4DEHA 4RX5A 2EXEA 2PVRA 5CX9A 5FTOA 4D2PA 5I0BA 3BGPA 4EHEA 4FZAB 5M4FA 3G9NA 2FSTX 4WHZA 4ERKA 4JDJA 1H00A 4OLIA 5EYKA 5L4QA 3FI3A 4YLJA 4GT3A 5A4TA 4FE2A 4OGRA 5HKMA 4DTKA 3KCKA 4GK3A 4IAIA 1EH4A 4JVGA 3QTRA 1JWHA 4ZZOA 2VTLA 5C9CA 2BRNA 1V0BA 3R71A 5BUJA 4CKJA 2YIWA 3R02A 4FSWA 3SG9A 4KS8A 4MWHA 5AP1A 3CD3A 3ZBFA 3ZLYA 5ICPA 3EOCA 2CCIA 5HOAA 4O2PA 5DVRA 2F7ZE 3QTXA 3H4JA 4P7EA 3ET7A 4O0VA 5ETAA 4E93A 3DKOA 4MNFA 3GFEA 3GFWA 3C4ZA 3OUKA 5A4QA 4PDYA 3A62A 4F9YA 3OCGA 4MBLA 3QTUA 2X8DA 3AG9A 4X6RA 3LAUA 3SG8A 4KNBA 2WIPA 2BHEA 2HAKA 2UVXA 3HEGA 2OXXA 5EYDA 3FMKA 3ZU7A 3VVHA 4D1SA 3P7CA 3VF8A 3QZHA 4I0TA 3FDNA 2YDKA 4AZVA 2UZVA 3D0EA 3KCFA 4CMTA 3PVBA 2OF4A 2XNPA 4BDFA 5CI6A 3S0OA 2ETKA 2OKRA 3M42A 3ORTA 4B8LA 4XG7A 5DNRA 3NR9A 4YJSA 5EQYA 5HCZA 3RNYA 1Q99A 2W17A 4FZ7A 1T45A 4QP4A 4IJPA 1OBGA 4CFMA 3LZBA 4C61A 3FLZA 3VQUA 3REPA 4FTKA 4CYJA 3UJGA 4AW2A 4QYFA 1H1WA 2B52A 3HZTA 3WIGA 3I4BA 3LPBA 4ALWA 3C4XA 4BIDA 3PXKA 3OP5A 4I3ZA 5CZHA 2BZHB 1HOWA 5DMZA 2GS2A 4NCTA 4L7SA 4QMUA 3JR1A 3PSDA 4G6LA 3S1HA 5C4LA 3BQCA 3IKAA 4NM0A 3AXWA 4DEDA 4E73A 5CANA 4FTOA 3OZ6A 3R8VA 5KMOA 4FG7A 3MY1A 4JLCA 4DAWA 4OTRA 4GG7A 1H0WA 5JT2A 3EFJA 2R2PA 3FEGA 3PFQA 4GK2A 4JDIA 4UMTA 2QHMA 1PXOA 4OT5A 2J90A 4FSMA 2WMRA 1KE9A 3BIZA 2W4JA 4IZYA 2EB2A 4R6VA 4UZHA 3VBXA 1O6KA 5AJQA 3ORZA 4M7IA 4DH3A 2VRXA 3NYOA 2XJ2A 3VUMA 3U55A 5AV1A 3F9NA 2BTRA 5HI2A 4Q5HA 4E6CA 4O38A 4L3LA 1B39A 3FAAA 3P4KA 2J2IB 3R7IA 2XKCA 4RLLA 3BI6A 3FKOA 3MVHA 4F0IA 3R7EA 3BBWA 3LFAA 2WMSA 2W7XA 3EB0A 4WSYA 4FZFB 3WYYA 4DG0E 4DN5A 5AAGA 3SVVA 2GMXA 3IG7A 4FKLA 2CJMA 2PVMA 2XBAA 2XNOA 4LRMA 3TNHA 2UVZA 3FZ1A 2O63A 3QTQA 4RLKA 4DEIA 5LJJA 5A6NA 4I0RA 4IDVA 1PKGA 1S9IA 1STCE 2ZM3A 3ORNA 4IFGA 4DEAA 5HLWA 4X3FC 4WIHA 4ZJVA 5EM7A 4P5ZA 2HZ0A 5L8JA 1FVTA 2F7EE 2HZ4A 3VIDA 5LVOA 1U54A 2BDFA 1REKA 5AUYA 4QMNA 3ACKA 3ZS5A 4UX9A 5AUTA 4YZNA 3NLBA 1OL2A 3W2CA 3V5TA 4NL0A 2JDVA 4PX6A 1H8FA 2XJ1A 2W4OA 4CTBA 2ESMA 4O6EA 4DT9A 4F7NA 4M97A 1G5SA 2GNFA 4FTNA 4IAAA 3Q2MA 3DU8A 4OBPA 2AC3A 4L44A 3BU3A 3CR0A 2O8YA 3D83A 2PVFA 3R2BA 4RIOA 1RJBA 4IWQA 3V3VA 3U8WA 3MN3A 2W5HA 3NS9A 4FV9A 5AUWA 4MYGA 2GNLA 3L8VA 3BEGA 2JBPA 2OIDA 3K3JA 4M15A 3MY5A 3CS9A 2BALA 2OFVA 2WOUA 4YJQA 4D1XA 2WTVA 4JS8A 3RZFA 2J0KA 3N4VA 5KO1A 4C62A 1Y91A 2H8HA 2Z60A 4XHKB 5HVYA 3VC4A 2XZSA 4XRJA 3R1YA 4Y5QA 4BVUA 5IZFA 3RHKA 3UVPA 4NFNA 2IVUA 4USDA 3BU5A 4IJ9A 3QHRA 4R5YA 4BR3A 4AZEA 4JQEA 3SQQA 3ZBXA 3VUGA 3W55A 3I79A 4FTLA 3GCUA 1I09A 5KX8A 3LMIA 2QOCA 2YCRA 3GXLA 4G5PA 4S30A 4YHTA 2WMVA 2X9EA 4ZTHA 3PXRA 3KK8A 4IIRA 5CY3A 4YSMA 3BELA 1OI9A 3GI3A 5H8BA 3BEAA 4Z7GA 2XIRA 3R0TA 2C6LA 2BRBA 3QWKA 2FO0A 3A7GA 2V7AA 4E6DA 3F61A 3UC3A 3Q4TA 1PRYA 2A27A 5ETIA 1P5EA 3I5NA 4DGOA 4RRVA 2Z7LA 4EOPA 5K9IA 5KMMA 4QYHA 4TYIA 3BE9A 4F09A 2PMNX 2YDJA 2ZV9A 3U4UA 5LVMA 2GPHA 3RAIA 3FC1X 5DRBA 2UZBA 2PSQA 3IGOA 2BPMA 4U8ZA 3LFDA 2J0LA 3QUDA 4EONA 3WF7A 1XBBA 3R1QA 4I0SA 4IDTA 1ZOEA 4RC4A 1H27A 4QO9A 2UZNA 4S31A 4ZJIA 3QKMA 4NU1A 3V8TA 3TJCA 4L46A 5LMKC 4C59A 4CZYB 4D9TA 4ERWA 4ZEGA 3FLYA 3MVMA 4YHFA 3O7LB 1U54B 4D2TA 1Y6AA 3ZOSA 4TXCA 2I0EA 4FNXA 3H10A 3PIYA 4ZSLA 3RK7A 3K3IA 1TQPA 3TCPA 1XWSA 3ZLSA 3ZUVA 4BDBA 1GNGA 3MFUA 2ITPA 3BYMA 4XV3A 2PMIA 1MQ4A 3HUBA 4XNEA 2EU9A 2WTCA 5D7VA 3KC3A 3TIYA 3W2SA 2IJMA 2C6EA 4AN2A 3CE3A 3KN6A 3UPXA 4IEBA 2CKOA 1XHAA 5HEZA 4F65A 2XNBA 3SRVB 4GS6A 4C0TA 2XRWA 5I9WA 3RP9A 2I0VA 1MRUA 4PDPA 3O50A 5IQFA 4WG5A 5CALA 5FM2A 5LARA 3ZYAA 3HMOA 4AUAA 4YZ9A 2PUNA 3C13A 3TUBA 4PPAA 5KBRA 3T3UA 3O96A 5CEKA 5K5NA 1YDRE 3ALOA 3PSCA 4OT6A 2YM8A 5AV4A 3ZFXA 1IAHA 3E7OA 4WNMA 3TKHA 3DB6A 2X7OA 1JPAA 3ORKA 3RM6A 3LKMA 1VYWA 2X7FA 2BR1A 4FIGA 3TNIA 5EK7A 3DK6A 4LM5A 4ZJJA 4PDSA 4M13A 2WNTA 2F57A 4WNOA 3W8LA 3FV8A 2B53A 2NP8A 5LMAA 3RI1A 3ZSIA 5C4KA 4G3DA 4YJOA 3PJ3A 4AN9A 3R1NA 2BRMA 5JFVA 3PVWA 1XR1A 3UIXA 5BUEA 3O71A 1W98A 2ZM1A 1NVRA 3UOHA 4FV0A 5A6OA 3ZO1A 5J79A 3O0GA 3RPYA 3LCSA 4FNYA 5A54A 3BHVA 3QKLA 4QYYA 4XX9A 4XS2A 4PTEA 3I6UA 3G0FA 4ZTMA 3QQGA 1U5RA 4D5KA 1HCKA 4XG3A 1XQZA 3R28A 3BKBA 4WA9A 4V0GA 2WPAA 4UALA 4UXLA 2XEZA 5J7BA 4HCUA 3PJCA 3TXOA 2JBOA 3CLYA 5M51A 2A0CX 3HAMA 4B0GA 4M14A 4MF0A 4KRCA 4XP0A 3U87A 4RA5A 3NYXA 5GIPE 3EQHA 3E3PA 5E8SA 2BFYA 5HO8A 4ZY5A 1NXKA 5J9ZA 4TYGA 4LL5A 2VTAA 3RWQA 5CXHA 1SVHA 4ACDA 5HNIX 4Z16A 4DCAA 3KF4A 3Q9XA 3R8UA 4QP6A 4RVKA 3M2WA 4YZCA 3CCNA 1ZZLA 4LMUA 1U4DA 2XH5A 4P4CA 4FUYA 3MI9A 4LUEA 2LAVA 4ENYA 4UV0A 3HP2A 1Q8UA 3DBFA 4X3JA 1TQMA 3D5XA 3THBA 5DEWA 2A19B 2FH9A 5E90A 4QMXA 1NVQA 4A4LA 2RL5A 4BBEA 5CU2A 3BHTA 4C8BA 2WTDA 4Z3VA 3LVPA 2O2UA 3KK9A 2W1IA 2G1TA 4FSNA 5HX8A 2WU6A 5AR8A 5JH6A 4FIFA 1ZXEA 3F3ZA 3R1SA 3ZO2A 4RFYA 1YRPA 4CT2A 1IEPA 4R77A 3EN7A 3GB2A 3RM7A 5DI1A 4DH8A 5JZJA 4NTTA 2QOFA 3MESA 3CQWA 4U45A 4ANNA 1ATPE 2OIQA 3QTWA 4K9YA 4Y72A 4KBKA 4R3CA 4YP8A 4C34A 3OY1A 4WSQA 2BDWA 2GNIA 3MS9A 5A4EA 2JDOA 3CKXA 1JKSA 2VTJA 4UYNA 3DFAA 2EUFB 4DG2E 2QNJA 2ITNA 2HIWA 3PY0A 4QP2A 2R3PA 3QX4A 5BYLA 4MNEA 3LM0A 5DR6A 3OEZA 4ZTRA 3TTJA 3KXGA 3C5IA 2C69A 1W82A 2C6MA 2GHMA 1KOBA 2XYNA 3EQDA 3PP1A 3AD4A 4DE4A 1OKVA 3QLFA 4AT4A 1DAYA 2QOOA 2PTKA 2W9ZB 5CS6A 3QQKA 4F6UA 3HNGA 4WT6A 3R21A 1PJKA 4NH1A 3GC0A 3DBEA 4I92A 5AFVA 1QMZA 3DZQA 3L9MA 3PVUA 3V6RA 3R8MA 4BCFA 3SC1A 3OWJA 5AR7A 4CCUA 1SNXA 2WOTA 2X7GA 3FZRA 2IW9A 1KE7A 3DNEA 3OHTA 3ORMA 4GCJA 4Y46A 3VUHA 3D4QA 4A4XA 4BGGA 4BWXA 4WOVA 4BDIA 4BIEA 4EUTA 3F7WA 4JG7A 5DYJA 3ZSHA 3O2MA 4ACGA 3A8XA 2XM8A 5HESA 1QPJA 3CGOA 3RCJA 2DS1A 3GCSA 4V0GB 4AE9A 4AS0A 4IWDA 4C3FA 3QKKA 3LFBA 2XNMA 4O0XA 4FNWA 3VN9A 4PP7A 2ZV8A 4N6ZA 4F7LA 4USFA 3TI1A 3D7ZA 3VS0A 5LQFA 3PSBA 5CASA 1IG1A 4RGJA 4CVAA 4P2KA 5IEYA 5AADA 4JIAA 4J53A 4FEXA 2PZRA 2YM3A 4EOLA 4N57A 4L45A 4RX9A 4XJ0A 4D4RA 4N70A 3PLSA 1P14A 4WBOA 3EKNA 4NIFA 2JC6A 4XOYA 3NVKI 2OH0E 5EDQA 4LV8A 3AT4A 2O5KA 3P7BA 5B0XA 3KY2A 3BYVA 4J96A 3BPRA 4GK4A 4NW6A 5BYYA 1UU7A 5H8GA 3GVUA 3G33A 3D2KA 2WMXA 3FJQE 4U44A 4R1VA 4YR8A 3KKVA 4MXZA 1CKIA 3E8EA 5AP2A 4XG9A 4WRSA 1Z5MA 4ANBA 4E5AX 2C5YA 3PWYA 3Q9WA 4I6BA 2B7AA 3QGWA 4RA4A 2B1PA 3DNDA 5DT0A 5HHWA 4CT1A 2R3JA 3PJ8A 1IA9A 1U5QA 3DY7A 5CEMA 3F2AA 3RALA 4XCUA 4UYAA 1GZKA 3RAHA 2YWVA 4AW5A 3NYNA 5M09A 5ANKA 2BZJA 3I0QA 2XIZA 2C3LA 3DB8A 3FHIA 3NNXA 3DCVA 5D12A 2PVYA 3LFCA 3NRMA 2R3OA 2QOKA 2QURA 3A4OX 4FKJA 4V01A 4EK4A 5IQIA 4FK3A 3GU5A 4QP7A 5AX9A 2QI8A 1YOJA 3QWJA 4JBVA 2JKMA 3LMHA 3DOGA 4GFGA 4IZ5A 5IDNA 3ZM4A 2XKEA 2LGCA 3Q6WA 4FSRA 5HCYA 2HCKA 5TT7A 3PG1A 4YMJA 1UVRA 4JJRA 3S3IA 2C6KA 5EYMA 3AD6A 3LFSA 4XP2A 3FMLA 3HRFA 4DGGA 5CAVA 4FKIA 4FT7A 4FIHA 5CT0A 1JQHA 4J95A 1OZ1A 2RGPA 2WGJA 5EI8A 2YAAA 3F3VA 4PF4A 5HNGA 4RJ3A 2CN8A 2GNJA 2YJSA 1BL6A 3NGAA 4HZSA 3IDCA 4JBOA 4NJDA 2ZOQA 4ZSJA 3QCQA 1JKTA 3E8CA 3L8PA 4XLVA 5FBNC 5EHOA 4MKCA 3EN6A 3UC4A 3QC4A 4E6AA 1B38A 4PUZA 4O0TA 5J5TA 5IQHA 1OECA 5EI2A 3OD6X 4PMSA 3O8TA 3D2IA 3RPRA 3W1FA 3LFNA 4N6YA 2I1MA 2UZUE 4O0WA 1JOWB 1PF8A 2B54A 5C8MA 4AQCA 4D2VA 4WO5A 1H4LA 1RDQE 3PRIA 5E8WA 4IB1A 4EWQA 3SD0A 4ZK5A 2VNYA 4BWKA 2J0MB 4NIFB 4BICA 4GFOA 4DF3A 2OI4X 5IQGA 4LOPA 5H2UA 4QMPA 3QXOA 3FYKX 4L43A 4EZ7A 2O0UA 5AP5A 5HD4A 2O3PA 4QP9A 4UMQA 3UOKA 4BTKA 2H96A 4EQMA 4MQ2A 4IXPA 4O0UA 4YZDA 5HTCA 3P08A 3JYAA 5AX3A 3ODZX 4BCHA 1SMHA 1R39A 2XF0A 4O2ZA 2C30A 3ELJA 1YHWA 3DTCA 4AZFA 4CKRA 3MSSA 2VTOA 5IA1A 4BY9E 4IAKA 2J4ZA 3F3WA 3FSKA 2F2CB 5DFPA 5CAUA 3SOCA 2C3KA 2R3RA 2UW7A 4OR5A 3SKCA 5J5SA 5E8ZA 4ZSEA 1Q97A 3PZEA 3A4PA 3P7AA 2WHBA 5HO7A 3OBJA 4M0ZA 2JKQA 2RF9A 4ZXTA 5BVFA 4HYSA 4MCVA 3RAKA 3VS5A 1SZMA 4YBKA 4RX7A 5EW8A 4FKVA 1Y8YA 5A3XA 1LP4A 3OROA 4AXAA 2Q83A 4ORKA 4QT1A 3QX2A 4FTRA 1P4FA 2B9HA 1CTPE 2FGIA 3GT8A 1F3MC 3ORPA 4JQ7A 4FZ6A 3UZRA 1R1WA 1YDTE 2UW0A 2PVJA 5IG1A 3FLSA 3Q53A 4DH7A 2ZMDA 2RG5A 3LM5A 3FUPA 4EKLA 4HVSA 1H08A 2R9SA 3AGLA 3ZMMA 2OFUA 3OEFX 4GJ3A 3W33A 1AD5A 5EOBA 1GIHA 2CKEA 3F5PA 4RMZA 4YJRA 1GJOA 3I81A 2O64A 4IADA 2F4JA 3GU8A 1R0EA 2C3IB 3BLHA 4FKQA 3FI2A 3LJ0A 2EWAA 2WTKB 2XK3A 2P3GX 1PXLA 3CTQA 1FOTA 3H30A 2PL0A 4NEUA 3DJ6A 4QTDA 4WRGA 4AG8A 4BC6A 4EOIA 1YQJA 4D9UA 4NSTA 4UZDA 3HMPA 5KMNA 5J8IA 3BHHA 3PG3A 4W4YA 2OK1A 3JUHA 3NDMA 3R00A 4LOOA 5HD7A 5E9EA 3I60A 3KVWA 5CWZA 4RWIA 4J99A 4E4NA 2UW8A 5CNOA 1DI8A 2UVYA 5IA4A 4WG4A 3LCDA 3TEIA 3CEKA 5FGKA 4D0WA 2PULA 3JPVA 2R3QA 4D2SA 4FTMA 2FA2A 1ZAOA 3H3CA 4NW5A 3T9TA 3MB7A 3UNZA 2HW6A 4C02A 3NPCA 4I93A 4NM7A 3AGMA 4CRLA 4EUUA 3A7IA 3FZOA 1M7NA 4JI9A 2WKMA 2PMOX 4FL1A 4KSPA 3FPQA 3SX9A 3N4UA 4KABA 2Y4IC 4ZTNA 4OAUC 2F2UA 1IAJA 4CQEA 4L7FA 2WELA 4AF3A 3OW3A 1FVRA 4BCOA 4CSVA 5A4CA 4L01A 1AQ1A 3VUDA 4X0MA 4CRSA 3SAYA 3PZHA 4ZSGA 3VJNA 5FBOA 4NKAA 2J9MA 4A9YA 3SXRA 1ZZ2A 4E4LA 2X0GA 1YXTA 4U3ZA 4DBXA 3V8WA 2KTYA 3EQCA 3O8PA 4RX8A 3GQLA 4YBJA 5E8XA 5IQBA 3VUIA 4HZRA 4PL4A 3RBWA 2J7TA 2OICA 2XNGA 4DEEA 4C4IA 1Q4LA 3NCZA 3ATSA 4O7RA 2OLCA 2YHVA 1M2PA 2HW7A 2QR8A 4Y85A 3RAWA 4S34A 3BV2A 4U41A 3R73A 4GUEA 4BGQA 1GIJA 3I6WA 4FV4A 4LRJA 3ORXA 2YIYA 1J7LA 2JIUA 1XKKA 2QODA 4YC6A 4AFEA 2WB8A 3KFAA 3DPKA 4TWPA 1CSNA 3A8WA 4IVAA 4L67A 4BZOA 4BCIA 5JQ5A 4QMYA 4I5CA 4JBPA 3H0YA 4U9AA 4IWPA 4R7HA 3G6GA 3EL8A 3OTUA 4YPSA 2WMTA 4Z7HA 2BFXA 5C1QB 1BKXA 4EOMA 5ANJA 2J51A 3R7VA 1O9UA 3W2PA 2YCQA 4ANQA 2CKPA 1DI9A 3GOPA 3OUNB 4W4WA 4J8MA 3QZIA 4LFIA 3GCPA 4RJ7A 4XMOA 3WZJA 1FVVA 3ZDUA 1F0QA 1BX6A 4B8MA 2BHHA 3OBGA 5EI6A 4KBAA 4Y83A 3KMWA 3HGKA 3QGYA 4DEGA 4A9RA 2Y0AA 3TJDA 4EI4A 5IU2A 4YHJA 1H28A 3HDMA 5KMLA 1FQ1B 3EQBA 3F7ZA 1TQIA 3ZDIA 4PMTA 4UBAA 4L3JA 4IE9A 3I5ZA 4DG3E 3LQ3A 1ZY4A 3UVQA 4AWIA 3GU6A 4FZDB 4QP8A 4DFBA 4GIHA 3W2RA 4X3FA 5TE0A 4ITHA 5GZAA 3HA8A 1VYZA 2AYPA 3B8RA 2IW6A 2I0HA 4L6QA 5EYCA 4D55A 1XH8A 2VX0A 4YTFA 3RINA 2Y4PA 5HX6A 3VHKA 4ASEA 3ZRKA 4FTIA 3F88A 4GT4A 4TWOA 5DGZA 5JKGA 2VUWA 3O51A 4IC7A 2VTTA 4EEVA 2V62A 3Q5ZA 3AMYA 1G3NA 3QTSA 4L68A 4Z9LA 4TRLA 4LYNA 3PXYA 2WQMA 3QQLA 4N0SA 5AWMA 2YA9A 5I3OA 2HOGA 3QHWA 4R1YA 3U9NA 4O27B 4FGRA 1QPCA 1PHKA 1K2PA 1OM1A 3PUPA 2WXVA 3MPTA 3I1AA 5AUXA 4GH2A 4RWJA 4W9WA 4HPTE 3NW5A
chains in the Genus database with same CATH superfamily
1W83A 4GG5A 3TYKA 3TT0A 3QFVA 4HCVA 4ASZA 1KE6A 4PWNA 5C8NA 4G31A 1OPLA 4DYMA 3TV6A 3E62A 2VTRA 3HMMA 4FTJA 3MJ1A 4BKZA 3BL7A 4XG6A 5IKWA 4ANMA 3LXPA 2PK9A 3QCSA 3UOLA 2XAOA 3EJ1A 5DHJA 1L8TA 1ERKA 4JRVA 1NT2A 4XBUA 1PW2A 3HUCA 3F3UA 1UWJA 2W06A 5HICA 2OIBA 3PWDA 5M53A 5CF8A 1NA7A 2AEGA 4JDHA 2YN8A 4X7QA 2Z8CA 3VW8A 2YACA 2X81A 3ANRA 4G5JA 4G9CA 2ETRA 5DLSA 3FLWA 4I1ZA 3PJ2A 4IFCA 1YWRA 4I23A 4K11A 2I6LA 3D7TA 4U0IA 2ITVA 1K3AA 4FYOA 3FZSA 4TWCA 3ORIA 3G15A 2FSMX 3PVGA 3D5UA 5AUZA 5AMNA 2R3LA 3WI6A 4YNOA 5L6OA 2VWYA 2XKDA 3MB6A 3NUXA 4QP1A 4MX9A 4YO6A 1XH7A 5HLPA 4NM5A 5FG8A 2A2AA 4QMSA 2ACXA 2OXDA 5CAPA 2I0YA 4IW0A 3DTWA 4L00A 4LGDA 4O96A 3RCDA 2ZV7A 3MH2A 1NVSA 1LPUA 3ULIA 3Q2JA 4JX7A 4ZS0A 5A9UA 4D4YA 4M84A 3E92A 3LQ8A 4HW7A 4EK6A 3FXXA 2XS0A 1KOAA 2EB3A 5ITAA 5EKOA 4H39A 5BVOA 4PL3A 4GVAA 2BDJA 3ATTA 1UWHA 3NSZA 2JIVA 4GU6A 4F1TA 4O83A 2R3NA 3QXPA 4QMQA 3LMGA 4AZWA 4JNWA 2YIRA 2UV2A 2CLXA 3G5DA 5LMKA 2OO8X 3NCGA 3HECA 2ZAZA 3ORLA 4AU8A 4AX8A 4JR3A 4WNPA 1DM2A 3Q6UA 3B2WA 5ACBC 3WF5A 4RIYA 4FL3A 3TTIA 2E9NA 3OMVA 3FMEA 5FWKK 4NM3A 1T46A 2QOHA 3O17A 4OBQA 3PXZA 3QRKA 1J7UA 1IR3A 3D9VA 3GC8A 5IEXA 2HXQA 1FMKA 1YWNA 1CDKA 2I40A 3QQUA 3FWQA 4G3GA 3BQRA 4S33A 2QG5A 5D41A 3PTGA 5HCXA 2X2MA 2R3HA 4K18A 4QMZA 3R9NA 4LRKA 2GQGA 2W99B 3FMMA 4PPBA 5HBEA 3A99A 3R83A 2QG7A 4X2JA 2XALA 2X6EA 2HWPA 2VWUA 3R30A 5IUGA 5JGBA 4BDCA 5TO8A 4V04A 3HV4A 4XEYA 2YIQA 4QP3A 3VNTA 2BKZA 3HVCA 3R01A 4E26A 3V5LA 1VJYA 4BDGA 4CEGA 1OIQA 5CSHA 4YGAA 2IZUA 1ZYCA 4Q5EA 5BMSA 5KHWA 4FEUA 2BAJA 4DFLA 3BYSA 3EIDA 2XCKA 4FKSA 4J7BA 1Q41A 4K77A 3AMAA 4D28A 5IH6A 1QCFA 1U46A 2UZDA 1BMKA 1KE8A 2ITTA 5EG3A 5HG5A 3CTJA 4IVCA 2ZB0A 3EYHA 2X2LA 2QO2A 3P78A 3U9CA 4FSTA 3HA6A 4I5MA 3D7TB 3DLZA 3G9LX 4AT5A 4WUAA 4KRDA 4UEUA 3CSVA 3FMNA 5EHLA 2SRCA 2OJ9A 3I7CA 2ETMA 3TUDA 4I5HA 2XIKA 1PXPA 3AKJA 4R78A 3AC5A 3WE8A 4AOJA 1YI4A 5CEIA 3UYTA 2QHNA 3F3TA 1URCA 3GGFA 2H34A 2WZJA 4BYIA 3NVMB 4TW9A 5M44A 2WTWA 4APCA 3KF7A 4OUCA 3UO6A 4C36A 4O7VA 4C57A 4LL0A 1G8AA 3R9RA 4ANOA 4C4FA 4A9UA 5TOZA 2OG8A 2UW6A 4QTEA 1PMVA 4FTUA 4F6WA 5JK3A 3UMXA 3EHAA 2XK7A 2XUUA 4GEOA 5CU6A 1QPEA 2C6IA 3LOKA 4IM3A 4WUNA 4XV2A 2ITYA 1PMEA 2VTQA 3QCXA 2BROA 4ARKA 3MIAA 2HZIA 2OU7A 3EQPA 3RZBA 4EWHA 2PE2A 2ONLC 3A7JA 3KGAA 3R9HA 4MD7E 3RMFA 3GC9A 4IM0A 5CI7A 5E8VA 2UZOA 3D94A 4E4MA 1LEZA 2XKFA 4QRCA 5ANEA 2ITQA 5L2QA 2YM5A 2EXMA 3GU7A 3DFCB 2ZDTA 4FJVA 5DWRA 4RIYB 4D4SA 4DH5A 5FEDA 1MRYA 2BIYA 4QMOA 5LCKA 3LCKA 3TIZA 5CSVA 2CCHA 2YCSA 2X2KA 3E3BX 2R3GA 4O0YA 3GU4A 3Q96A 3HMNA 3KMUA 2YABA 3TUCA 3VW6A 4W8EA 3ZUTA 2XBJA 2Z7RA 1CKJA 5G1XA 5AEPA 5EW3A 4BWPA 4AXFA 4NKSA 1JKLA 3SV0A 3BHUA 4RIWA 3F2NA 3AKKA 4LV5A 4YLLA 5JEBA 5IA0A 3FLQA 2EVAA 3UTOA 3KULA 2PVLA 4H3PA 4ITIA 4TL0A 5EW9A 1GZNA 2J5FA 4O0SA 4QMLA 3UMWA 3EQIA 4LMNA 5CSWA 3LQ5A 1SM2A 2AC5A 2VO7A 4YZBA 3T9IA 1JVPP 1WBTA 4RQKA 4OTDA 3TV7A 1LEWA 4AA4A 4IZ7A 5A4LA 4DT8A 4ZSAA 4AZTA 4CYIA 1YXVA 2VU3A 4MD8E 2YLFA 4AP7A 1FMOE 4FTQA 4ZLZA 2GQRA 2BRHA 5FDXA 5FXSA 2C0TA 4DH1A 4YJPA 3P5JC 3QU0A 4JT3A 5EDRA 3K2LA 4JXFA 3WZKA 4B4LA 4EKKA 5FXRA 1KV2A 3MFTA 4BCKA 3PY1A 4QD6A 4QOXA 2W0JA 2OW3A 4EQCA 4KS7A 2QU6A 4NUSA 3UDBA 5C27A 3DGKA 2R3KA 1IASA 4RVTA 4AAYA 2Y9QA 1M7QA 3RWPA 5GIOE 1Q3DA 5CAQA 5JMSA 5E7RA 3CTHA 4MUQA 4GU9A 3QCYA 4IH8A 2B55A 3BLAA 2P0CA 3BGQA 4CMUA 2R3FA 2OXYA 5LCJA 3DAJA 1ZYLA 4TNBA 5DA3A 2P2IA 1S9JA 3VAPA 2XK4A 4GKIA 3N4TA 1Y8GA 2B0QA 4FTCA 3MPAA 3MWUA 3CGFA 2YDIA 3K5VA 4DINA 2UZWE 3ID6C 2CLQA 1YW2A 4AXEA 1K9AA 2IN6A 2R3MA 4JQ8A 3LLTA 5DEYA 4NJ3A 4ZTLA 2VWVA 5AAFA 2ITOA 2RSVA 4IAFA 4FL2A 1OMWA 4K8AA 4U42A 2BILB 1ZARA 4EHVA 3VS6A 3VUTA 1ND4A 2CHLA 3OXZA 4IANA 4WKQA 3EN9A 1Q61A 4QYGA 3KQ7A 3A7FA 2Q0BA 3R22A 1JSVA 5F1ZA 4LV7A 3E8DA 5J87A 4G1WA 3UVRA 4RVLA 4L53A 5DR9A 5BVEA 2BAQA 4J98A 5C8KA 4HGTA 4LUDA 4YLKA 3VS4A 4BN1A 3EZRA 4EK8A 4RC3A 4XUFA 5KZ0A 4YJNA 1KUTA 2PUPA 1FGIA 3DKCA 5J1WA 2BUJA 4M69A 3D14A 4X6QC 1Z57A 4M12A 4OTGA 3UQFA 4F9WA 1PYXA 1AGWA 2GCDA 3EFWA 1JBPE 4FKOA 2UZTA 4JBQA 4RJ6A 1J1CA 1PXJA 3OVVA 5AV3A 4RIWB 4FKTA 3QA0A 3RJCA 3EFLA 4CFNA 5KE0A 4O7YA 5L8KA 4FODA 5CVHA 4ITJA 2YITA 4Q9ZA 4TYHA 4I94A 1BI8A 1UA2A 3FY0A 4FEWA 4IAZA 3IPHA 2FVDA 3QA8A 3ZO4A 5CT7A 4UWCA 5BVNA 1CMKE 3GC7A 2ZV2A 3S4QA 1VR2A 3DS6A 4EOJA 4MVFA 2C1BA 3QC9A 4HYIA 4QTAA 4HCTA 4W4XA 4C4EA 1YOMA 4DFXE 4YSJA 1ZWSA 5JGAA 3FYJX 3E64A 5L6WL 4A9SA 3VS7A 3PYYA 2FSOX 2ITUA 3OT3A 4ZZNA 4GJ2A 3FZPA 4FIEA 4CXAA 5GHVA 3CD8A 3CC6A 2REIA 3CPBA 4OTIA 2HELA 2CKQA 2R0IA 3BCEA 3L9LA 4U7ZA 4L3PA 4K1BA 2IO6A 4FT5A 1CM8A 4FSZA 3FMJA 4FSUA 2NO3A 2YISA 3PIZA 4RWKA 3RPVA 3KREA 5BPYA 4EZ5A 2CNVA 2VTMA 3GBZA 1G8KA 3OG7A 4O4EA 3MH1A 3QQFA 4KD1A 2V5QA 1L3RE 2XK6A 4H1MA 1PMUA 3OTVA 4KA3A 5B2LA 4RQVA 3FY2A 3AOXA 2XVDA 4OTQA 5KZIA 4C35A 3E8NA 3GUBA 5ANGA 5L2IA 1OPJA 2XB7A 4YU2A 4O86A 3EFKA 4PTGA 1BLXA 2JDTA 4IVBA 2W1ZA 2UZEA 4FV2A 3HMIA 3IW4A 3Q9YA 2YM6A 4LOQA 4FIJA 5E4HA 3F69A 4UWBA 4IMYA 5LVPA 3AC2A 3CKWA 1JNKA 1DS5A 2CMWA 4E7WA 4JAJA 4TPTA 3WF9A 5HU9A 3BBTB 1B6CB 2A4LA 4IBMA 4MNEB 4BHNA 1YI3A 3CP9A 5AUVA 5CF5A 2HY0A 4EJNA 3GCQA 2VZ6A 2DYLA 4HGEA 3WARA 3W8QA 3VBQA 1FPUA 1OKYA 1UU9A 1R0PA 3L1SA 2UW3A 4N4SA 4M69B 3VQHA 4FGBA 4ZZMA 3WE4A 2W1GA 2F49A 4FTAA 2WMWA 4C33A 2Z7QA 4BDAA 3KXNA 4EH5A 3NIEA 4C37A 2XANA 3KXZA 3LLAA 4BCNA 5TKDA 3N9XA 3Q4UA 3QRTA 4KIQA 4BTFA 4BZDA 3FQHA 4R3PA 5A14A 3NEWA 5EFQA 2PVNA 3QRJA 4B9DA 2VTNA 4ZP5A 1NY3A 2P4IA 3UP2A 4WG3A 5H9BA 3R8ZA 5AV2A 1WZYA 2GTNA 4QYEA 3BWJA 3TKIA 4DC2A 2IWIA 3FE3A 4XYFA 2C5NA 4AXCA 4J71A 3NZ0A 3UZPA 2A98A 5BMMA 3TN8A 4EBVA 5M55A 4YC3A 3AC8A 4JG6A 4X2FA 4F4PA 3LJ2A 2F9GA 5K5XA 1Q8WA 3NW7A 1M2QA 3VBWA 2X4FA 4F08A 2NPQA 1NW1A 2QO7A 5JRQA 2XIXA 5GZ8A 1OPKA 4EH3A 3AQVA 2V7OA 3ALNA 3AT2A 4OBOA 3IOPA 4EORA 5LMBA 1SYKA 2XYUA 4TNDA 4XRLA 1ZYJA 5AIRA 2X39A 2JKKA 4D0XA 5JQ8A 2FSLX 5HGIA 3RKBA 5DG5A 4U79A 4KBCA 4MF1A 3FMDA 4BHZA 3IOKA 4FR4A 1Y6BA 2GNGA 3IDBA 4PY1A 4HVGA 3HL7A 4XBRA 2GQSA 1GY3A 2GFSA 3OY3A 3ZEWA 4IM2A 5HZNA 4GW8A 3NYVA 4EOQA 3ZLXA 4CG9A 4FG9A 2UUEA 4F7SA 5EQEA 3LJ1A 4IQ6A 4AFJA 3IGGA 5IQEA 3QRUA 4O6LA 2HYYA 2G15A 5CU3A 4BCJA 3Q60A 3V5PA 4MWIA 1SVEA 4HYUA 3F2RA 4MK0A 4GVJA 2W05A 3VRYA 5ANIA 2Y7JA 5EHYA 4FKGA 4RSSA 1Q3WA 1MRVA 2C3JA 3QD2B 4FUXA 4RJ5A 4FTTA 1GIIA 4FOBA 5GJFA 4DGNA 5A46A 3R8LA 2QVSE 3UG1A 3VONA 5CQWA 2VNWA 5CXZA 4FV6A 1UV5A 2J0JA 4M0YA 3TZ9A 1JSUA 2XK8A 2YM4A 3ZZEA 1WAKA 1YXXA 2NRUA 4BF2A 4DITA 4BDKA 1V0OA 2BAKA 2XMYA 4YC8A 3SLSA 1H1PA 1WMKA 2X0PA 3C4WA 2JIIA 1ZOGA 2QKWB 3MFRA 3CY2A 5BQ0A 5K0XA 3L9PA 5HG7A 5KMKA 1W2DA 3R7UA 4GFMA 3DK3A 2G9XA 3PA3A 3LXLA 5JN2A 3BU6A 3PE1A 5D1JA 3RNIA 1TZDA 4GV1A 2W1FA 4O22A 5AP0A 4AT3A 3VRZA 4F70A 4UN0C 3OOMA 3KRWA 2WEIA 2CNUA 5I9ZA 5H8EA 5HBHA 3TG1A 3TL8A 2GHGA 2E9OA 4G9RA 4I22A 2B9JA 4L9IA 2DQ7X 5HG8A 4AN3A 4F9BA 2WQNA 3T3VA 3MVJA 3UOJA 3UNKA 4ZS4A 3KA0A 4FV1A 1ST0A 2WTKC 3DQWA 3CIKA 3DKGA 4FVQA 4JG8A 4CZTA 4H05A 1H0VA 3OXIA 5T68A 5DN3A 5C01A 3ZZWA 3U6HA 4BBFA 1OL7A 3LXKA 3TACA 5IPJA 2OJFE 3D15A 4IX3A 1YXSA 4EH4A 4RBLA 1V0PA 3SW7A 3QQJA 3GENA 4BDEA 2WMBA 4FA2A 5HQ0A 4MD9E 4O7SA 3CJGA 4DFYA 3ZXZA 3TDWA 3DK7A 4UB7A 1GZOA 5IQDA 2XIYA 3OWLA 4RZWA 4FEVA 2X4ZA 4JRNA 5FEEA 2C6DA 4K2RA 3GCVA 3DBCA 2W1EA 2Y8OA 4FMQA 3TWJA 4BCQA 4JOAA 3PDTA 5EQPA 3PA5A 4I6FA 5HLNA 2R4BA 3C0IA 3C0GA 4FICA 3MJ2A 4CQGA 5JRSA 2OH4A 4M67A 1FGKA 4DCEA 4IX4A 1XMMA 4GSBA 4C2WA 4I4EA 5FP6A 5M57A 1H01A 1GAGA 4IZAA 2HK5A 4UMRA 1TKIA 2A1AB 2R7BA 4ZTQA 3BLRA 3MGYA 2C68A 4F6SA 3KXMA 4HVHA 3W2OA 4ONAA 4D5HA 3AD5A 4J8NA 4BBMA 3BGZA 5FD2A 3SHEA 1VEBA 2WD1A 3C4EA 3F66A 4QMTA 4FV5A 4FNZA 5BVKA 4I6QA 4I20A 3DAKA 2B4SB 4CFWA 4FT3A 2G2IA 4I5PA 5FXQA 2GS6A 1R78A 1W2FA 2CGVA 3WF8A 3FPMA 3QZGA 5DIAA 5KKRB 3NMUF 4LGHA 3SW4A 1E1VA 2HXLA 3G51A 5E8TA 1YDSE 3UIMA 3IK3A 3ULZA 4DFUA 5T3QA 4BDDA 2J0IA 3Q4CA 3ZUUA 5T6KA 2IW8A 4R3RA 3ZONA 4C4GA 4FRFA 3BV3A 3MIYA 5HU3A 1ZMUA 4FSQA 4O0RA 1BI7A 4BGHA 1OL5A 3RTPA 4QPMA 2VGOA 3COKA 4CD0A 4U40A 3IECA 3C0HA 5AR3A 3TMOA 2VTIA 3KN5A 2VTHA 4E1ZA 3DDQA 3DXQA 2C4GA 3QYWA 4GL9A 4FK6A 4U3YA 1M2RA 5M4CA 4E8AA 4HOKA 3R2YA 3IONA 1E9HA 4F63A 1H25A 2GNHA 1ZMWA 1FBNA 3G90X 3W0PA 2VV9A 3ITZA 4PPCA 5D7AA 3ZEPA 5K4IA 2DUVA 2C5XA 2OBJA 2PZ5A 3NNVA 4FX3A 2X8IA 5HE1A 3R7OA 5HBJA 3TZMA 4OAVB 1J7IA 4EH2A 4BCMA 5J95A 1JLUE 4DDIA 3BE2A 4FKRA 5AP3A 3H9FA 5FQDC 4AGCA 4EOKA 4AA5A 3FQEA 4EC9A 2GSFA 3C51A 4J1RA 4LQMA 2ERKA 5AIKA 3U4WA 2CGUA 2PMLX 2WQBA 5B2MA 4I41A 2UW9A 3QUEA 4ENXA 4P90A 5J9YA 5D10A 3E63A 4GMYA 4FOCA 1UNLA 1WCCA 1ZMVA 2OF2A 3AC1A 3PRFA 4YZMA 2ZMCA 3FQSA 1KWPA 4GKHA 3NFGB 3FHRA 5TF9A 3FI8A 3LFEA 4R8QA 3EYGA 1WBSA 3IQ7A 2CNQA 2XM9A 2HZNA 5IQAA 2VX3A 3OW4A 3FC2A 3WZDA 4BRXA 3V6SA 1H07A 4QTBA 4CGAA 1WVYA 3AC3A 2J6MA 5D9HA 5AV0A 2VO6A 3C7QA 3HRBA 5BYZA 5C26A 3TV4A 5IF1A 4AGUA 4IX6A 3HRCA 4M66A 2VWZA 4YO4A 4IC8A 2PPQA 2XCHA 3IS5A 1OUYA 4TN6A 1XMLA 2YERA 5DOSA 2PZYA 4CFUA 4Q9SA 3VULA 4BKJA 4O84A 3NUPA 5I9YA 4MEDA 1CKPA 2WIHA 4AGDA 1JSTA 5CSPA 4MHAA 1FINA 4RFMA 3E87A 3I0OA 2CSNA 1PKDA 3QD4A 3E93A 4XV1A 3ZM9A 5I9UA 3II5A 4A4OA 4NT4A 2WQEA 3E5AA 3P86A 3R9DA 4G16A 5KHXA 4G3FA 5M06A 3KIOC 3BWFA 2ZJWA 4ZLYA 4DEBA 5FM3A 3WF6A 3VS2A 5JGDA 2BZIB 2JITA 3DLSA 4DBNA 5I9XA 2OSCA 2RKUA 3F5UA 4EK5A 3PPJA 1XO2B 3UBDA 3VWAA 3DQXA 5DR2A 5IUIA 4IX5A 3P9JA 4Y95A 3KXHA 5LVLA 3ZFMA 5DT3A 4BFMA 5JSMA 1XBCA 2VWWA 3NW6A 5LVNA 3WBLA 3Q5IA 1UNGA 4RFZA 1UU3A 4G6OA 5H3QA 1IRKA 1OGYA 2BMCA 1H1QA 4U80A 4M8TA 1VZOA 5KUPA 2WU7A 3F82A 3P1AA 4EZ3A 4C4JA 2JLDA 5E92A 4K0YA 4R7BA 4FIIA 3IDPA 5FTGA 3FKNA 4HGLA 3I7BA 3P5KA 3DV3A 4MTAA 3DJ5A 4QTCA 5DT4A 2PHKA 3COHA 2OGVA 4PRJA 4D2RA 3M11A 3DBQA 3A2CA 3MH0A 3PPZA 1J1BA 4MXCA 1WBNA 4EH8A 1BL7A 1WBVA 2X0QA 2XK9A 3DXPA 3R04A 1WBWA 3ODYX 3TNPC 2YLEA 4X3FB 1RW8A 4EC8A 3VHEA 3UODA 1DAWA 3CQUA 4JIKA 4LG4A 4E20A 5BNJA 3MH3A 1OL1A 5IA5A 4DLIA 5CF6A 3GP0A 2PUUA 4UY9A 3TM0A 2ITZA 1W7HA 3MTLA 2OJJA 3TNWA 4AW1A 5ETCA 2ERZE 4EH6A 3QTIA 4NCTC 3U6IA 1V1KA 1PXMA 5CU0A 2RFSA 4DLJA 3OCBA 4F64A 2PZIA 4DHFA 4FV3A 3JY9A 4MXOA 4UMUA 5KBQA 4AOIA 1OITA 3R7GA 4XP3A 5BUIA 3PXQA 3W18A 3MPMA 3DBDA 4Y8DA 5EKNA 5IMEA 2E9VA 3P23A 1MUOA 3SRVA 4BB4A 5E1SA 3O23A 2OJIA 2IVVA 3D5VA 3IW5A 1YOLA 2JDSA 2P33A 1WBPA 4KAOA 4O1OA 3Q9ZA 4FI1A 4Q2AA 5ETFA 4DHJA 3LHJA 3MA6A 4XH6A 2ONLA 1OB3A 1GZ8A 3BLQA 3OFMA 3QL8A 5EDPA 4DFNA 4F99A 1QL6A 5AP6A 2J5EA 2X6DA 4PMPA 2C47A 4WBBB 3PP0A 3LFQA 5HIEA 1XH9A 2G2HA 5KNJA 5LOHA 2QKRA 5I3RA 5L2WA 3W0QA 5HE0A 4HVDA 2KULA 2OWBA 2OZAA 3DZOA 1A06A 4G17A 3TDVA 2IG7A 1MQBA 3IW8A 2X1NA 4BDJA 3GOKA 2BIKB 4E6QA 1ZRZA 2ZB1A 4F7JA 4O91A 4Z55A 2PUIA 2E9UA 1J91A 4L52A 2R64A 1ZYSA 2PY3A 4ID7A 1M52A 2JKOA 4XG8A 3QRIA 1M14A 3Q4ZA 2UZLA 2XJ0A 5E91A 3QAME 3LE6A 3O7LD 5CTPA 3UO5A 4O82A 2NNWB 2UW4A 2FB8A 2QO9A 2IPXA 3ZC5A 3C1XA 3MFSA 5ACKA 4YTCA 5DBXA 2C6OA 4TWNA 3SA0A 5HTIA 5IEVA 3V5WA 3HAVA 4I4FA 4BDHA 1WFCA 3SGCA 2PYWA 4BYJA 3TNQB 2C6TA 2PZPA 4C58A 4F9AA 4TZRA 2RFNA 5J9LA 4EJ7A 4Y73A 4CKIA 4EHGA 1Q8TA 4UMPA 2RG6A 2XAMA 3DKFA 3N51A 2QC6A 2O65A 3FL4A 4CNHA 5HIDA 1O6LA 3FXWA 3ZTXA 3RVGA 5HO6A 4YNEA 4F1OA 4R7IA 4HNFA 4AZSA 2QONA 4RWLA 2QOQA 3G0EA 2WMAA 2QLUA 4S2ZA 4PNIA 2YIXA 3PFYA 3DA6A 2GFCA 1YVJA 3DT1A 5CF4A 3S00A 4D1ZA 4A07A 3SOAA 5BX0A 1OUKA 1MP8A 4GYGA 2ITXA 2XP2A 3QYZA 3GEQA 2ZYBA 4NTSA 4EHZA 4F0GA 5CEOA 2VN9A 3KMMA 2CN5A 3B8QA 3MTFA 3OWKA 4PNKA 1XBAA 2W9FB 4HGSA 4PTCA 4RC2A 5KMIA 4E3CA 3VF9A 3ERKA 4QNYA 3BYUA 3FXZA 1PXKA 3T8OA 2UW5A 4E4XA 1OVEA 2ZDUA 2Z02A 4O7TA 3IW6A 3COIA 5GJDA 4EH9A 1URWA 1KE5A 3WIKA 3U6JA 4CLIA 5HTBA 3U54A 4APPA 4NZWB 4FKWA 3B2TA 4OTHA 4R5SA 3NUAA 3C4CA 4GRBA 5HORA 5I5ZA 3V01A 2C5OA 4EBWA 3HV6A 3MBLA 4O1PA 4W9XA 1KV1A 4E5WA 2OZAB 3AMBA 3OOGA 4G34A 5ANDA 3GNIB 3OT8A 3RK5A 4BTJA 5F9EA 3L8XA 2H9VA 4C2VA 2BKKA 2HY81 5LXMA 2VO0A 2NRYA 4FVPA 3TZ7A 2PVHA 3OS3A 4HYHA 3CY3A 1GOLA 3VBYA 4XOZA 4CG8A 4A7CA 3EKKA 4IB5A 3V8SA 3VBTA 1ZOHA 4IAYA 4JAIA 4YJTA 4ZTSA 1BYGA 3BHYA 3UIBA 5BVDA 4KUJA 3G6HA 4ACMA 5KCVA 3ACJA 4YUQA 3EWHA 5G6VA 4O4CA 4F0FA 3OCSA 2VWXA 5M4UA 3HDNA 4AAAA 4FKUA 2YFXA 5FEQA 4YPDA 3GQIA 4LDTA 5GINE 1J3HA 4C38A 5I4NA 4KSQA 4XLIA 1OL6A 2XEYA 3NUYA 5CEQA 3D5WA 2WAJA 3LCOA 2HWOA 1Q8YA 4TYJA 2WFYA 3H9RA 2WQOA 4EOSA 4DGLC 4FYNA 3NUNA 4PL5A 5E8UA 4EK3A 4RG0A 4X2KA 2EXCX 5CLPA 4TY1A 5FDPA 3KRLA 4QPSA 4RT7A 2YJRA 3ROYA 1W0XC 5HNBA 3UGCA 3VJOA 3ZXTA 5M56A 2ZFYA 4O21A 4RVMA 5L2TA 2CPKE 4MXYA 3E7VA 3R9OA 3HV5A 5AM7A 3W10A 3R6XA 3PE2A 4U97A 2IVTA 4BL1A 3AT3A 3KRRA 4OW8A 4QQ5A 4UWYA 5FTQA 5FLFA 3Q04A 2JGZA 3WYXA 4LGGA 2PE1A 4G2FA 1F5QA 3QLGA 2PVKA 3RHXA 5M4IA 1PXIA 4O4BB 4GYIA 1YKRA 1YHVA 4KWPA 4IVDA 4K6ZA 5C03A 1H26A 2GU8A 2G2FA 2VWIA 1XH5A 3A60A 3ZLWA 2GS7A 5F95A 3KRJA 4DFZE 2BVAA 4KIOA 2QCSA 3SXFA 4HJOA 3OXTA 2QOIA 2YCFA 3JVSA 2XNEA 4WD5A 3EN5A 3F5XA 2QU5A 3WZEA 4AOTA 3TZ8A 3MYGA 2CGXA 4HNIA 2YAKA 4KIKA 5EH0A 3BL9A 2GHLA 2ZVAA 4II5A 4NYEA 3ROCA 2W5BA 4U43A 3UZTA 4FG8A 3C4FA 5AR4A 5CQUA 2WTIA 3R63A 4EYMA 2JFLA 4MBIA 1U59A 4PV0A 2ITWA 3NUUA 4FEQA 3KULB 5IH4A 4EL9A 3CXWA 4I24A 3ANQA 3V04A 1WVXA 1OKWA 1JKKA 4JX3A 4F78A 4BCPA 2YZLA 1XH6A 2R7IA 3C9WA 5FUTA 4O7LA 5B2KA 2JAMA 3A7HA 4ZAUA 3NWWA 4ZY6A 1H24A 4GUBA 1JAMA 4PMMA 3RGFA 2OZOA 3ZH8A 4MAOA 3G2FA 3VBVA 3W32A 4DTAA 3QD0A 2GTMA 2Y6MA 5AM6A 4B6LA 4J97A 3DJ7A 4S32A 5HE2A 1A9UA 3NX8A 4G3EA 2HENA 2Z7SA 2VD5A 1YXUA 5HVJA 4O7WA 4B99A 4BJJA 4ZIMA 4DHZA 5IMXA 2R0UA 3Q32A 3FLNC 4O7NA 1O6YA 2XA4A 1RQQA 3NNUA 3NNWA 4RIXA 2BTSA 2C0OA 2ZM4A 3R7YA 4ASXA 1XJDA 5EM6A 5KMJA 3KVXA 2QOBA 4D58A 3OWPA 4AW0A 1P4OA 4QDEA 3E88A 4EQUA 4RJ4A 2XNNA 4QMWA 3ZFYA 5AUUA 4W4VA 2V55A 1WVWA 3DXNA 5HG9A 4NFMA 3UDZA 5F4NA 3LFFA 3RPSA 3BRBA 3BZ3A 2VO3A 3FSFA 2QR7A 3K54A 3MW1A 3IO7A 4P5QA 5IISA 4KIPA 5DPVA 5JZNA 1H1SA 3NUSA 4M3QA 5HIBA 1R3CA