3OTVA

Crystal structure of the intracellular domain of rv3910 from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
254
structure length
254
Chain Sequence
VQLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADRTEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 70
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3otvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3otvA01
4QNYA 1H00A 3TNIA 3TN8A 3TZ9A 3MIAA 4AZVA 2P2IA 4KA3A 5C8NA 1Q8WA 1QPJA 4BGHA 5CSWA 2J0MB 2YZAA 4KIKA 2PZYA 1E9HA 3R8VA 2ZM1A 3LMGA 3U9NA 3BYMA 2X4ZA 4ZY6A 4ZSLA 3PJCA 5EH0A 3TTJA 3H9RA 4L7FA 3VQHA 4E5AX 4ONAA 1WBPA 2VWBA 3QQFA 4O21A 4M7IA 5FP6A 3NPCA 4PV0A 3PDTA 4QP9A 3W10A 4HVGA 3BIZA 4B4LA 4M66A 2R3OA 1BKXA 4L01A 2FYSA 4DFBA 3D5VA 4NL0A 2CNQA 3F88A 4XYFA 4IXPA 5ANGA 4QP2A 4EKKA 3QZFA 4FV1A 2BVAA 3OWKA 1PRYA 1OECA 1XH8A 1WBNA 2GNIA 4F64A 4IADA 4AW5A 3BLRA 3HMIA 4QMTA 4USFA 4ACMA 2QHMA 4EC9A 4K1BA 1H28A 2CLXA 4QNAA 1K9AA 3V01A 3ORXA 4M84A 2GHGA 3A2CA 3LCOA 4I92A 4PX6A 3EYHA 4O7NA 3FL5A 1PXLA 3DZQA 4PL5A 4JI9A 2JLDA 3LFBA 3VULA 4MF1A 3QD2B 2O65A 2CKQA 4FEQA 4RVKA 3CJFA 2Y4IC 3OS3A 4FGBA 4IFGA 3SAYA 2I7QA 2GNGA 3A7GA 5GIOE 3C0IA 2GTNA 3D94A 4RA4A 1K3AA 1OZ1A 5KMNA 1AD5A 5CEIA 5I5ZA 3UODA 3QZIA 4TYHA 2HWPA 2YLEA 1OB3A 3KEXA 5CS6A 4IZ5A 2PVJA 1OIYA 2R3IA 3PZEA 3VUHA 4FA2A 3ORTA 3T8OA 2C5YA 5GZ8A 2H6DA 3U6HA 4LYNA 1P14A 3Q96A 1UA2A 5HI2A 2XNNA 4ZZMA 3ZTXA 3NAYA 1OVEA 4CZYB 4LRKA 4O96A 4X2GA 5JT2A 3ORLA 4FEWA 4BBEA 5BUJA 1PXJA 4LGHA 1NY3A 3UIUA 4O6EA 4RWIA 5CAUA 1Y91A 3VRYA 3ZCLA 3U6IA 3HMPA 2UW3A 4HGSA 3VUGA 3R71A 4PMPA 3RJCA 1M2RA 3ZO3A 2QC6A 2UUEA 3HL7A 4IHPA 4M68A 4PTCA 3UGCA 1Q5KA 4I41A 4QYGA 3ZC5A 4I0SA 4PNKA 2PSQA 3RNYA 1OBDA 1FVTA 3F7ZA 4I21A 2W7XA 3PFQA 3V51A 2IO6A 5ETFA 5JZNA 4K18A 5A14A 4EHVA 4PPCA 2F2CB 5I9WA 1VYZA 3A7FA 4V05A 4AW0A 4FT9A 5EYKA 4DGNA 5EM7A 3PPKA 1H24A 5DMZA 4FL2A 3HMNA 1VR2A 3LQ5A 4PQNA 2WTKB 2R3GA 3OMVA 1XHAA 2WXVA 4IX3A 3FAAA 1WFCA 5CAVA 4K8AA 2YITA 4UZHA 3P79A 4HGLA 3TL8A 2JAMA 2NRUA 3F5PA 3ZFYA 1WVYA 3SXRA 3QWJA 4D1XA 1UNLA 1YOJA 3NUNA 2VNWA 2XBJA 5BVWA 3TZ7A 4BDHA 2IVUA 4DEGA 5JFXA 2VWWA 4ALWA 4E93A 2W1HA 5GZ9A 4FTRA 4PMMA 1UKIA 5EM8A 5DA3A 3C50A 4YTIA 5IQDA 5HO7A 4OTRA 5CI6A 3H9FA 3U8WA 1NVSA 4F6SA 4F9YA 3NVMB 4WNPA 3BZ3A 4ZMEA 4O7RA 5HCXA 5DIAA 3NEWA 5DOSA 4O0VA 3UNZA 2QU5A 4YHJA 3HNGA 3KU2A 1R0PA 4I6QA 3A62A 1BL7A 1YOMA 5HG8A 5KMMA 5M57A 2JFMA 3UZTA 2VTTA 3D7TA 3C4FA 4FEVA 4S31A 2ZDTA 4O6LA 3DQWA 3RCDA 4TPTA 4HVHA 4R7BA 3R7EA 3NVKI 1YDRE 5CQUA 4PL3A 3S3IA 4DG2E 3MVHA 5IQIA 5BYYA 4KBCA 3QUPA 4ACGA 2BROA 4AA0A 4FR4A 4FG9A 3GU6A 1JQHA 2WMVA 1MRUA 3FC2A 4DT9A 3KXGA 2A27A 3E8CA 4KNBA 4QYEA 4HGEA 2C5NA 4TWPA 4L3PA 3SC1A 4RJ3A 4TWNA 4IWPA 5DGZA 4IJPA 2VX1A 3OVVA 1REJA 3H9OA 4XRJA 5LVPA 3HV4A 4TYGA 2B9FA 2YAAA 3KRXA 5BYZA 3AMAA 3CLYA 5C9CA 3BGPA 4FSUA 4BCKA 3GCUA 1UV5A 2C5OA 4UV0A 3AC8A 5AIRA 4FTAA 3WE8A 4EH2A 4M97A 4OAVB 4ZTRA 4DGMA 3BE9A 3E8DA 5EDRA 5DYJA 2VWYA 4YO6A 1XWSA 5J7BA 2W5AA 4X2KA 5BX0A 5FTGA 4ZSGA 1YHVA 3QD3A 4CV9A 5HE3A 2W5HA 1XJDA 3NUSA 2BFYA 3A8WA 5CT0A 4UWBA 1KSWA 3FMDA 3KXXA 2C3JA 4ZS0A 2X4FA 3W2RA 3VRZA 3QTRA 4C3PA 3WZUA 2CPKE 2HAKA 3O7LD 2OH0E 1FGIA 2YIYA 4BDBA 3QGWA 2XJ0A 1JKLA 2OIQA 4CCBA 4EK6A 3B8QA 3EQRA 4BKZA 5AAGA 4HPUE 2IWIA 4F6WA 3LCDA 4LM5A 5I9VA 3FDNA 5E1SA 1Z5MA 3UG1A 2EXCX 3EIDA 3UZPA 2IW8A 1REKA 3ROCA 2QOIA 3R8PA 2PPQA 3N51A 3DLSA 3UOJA 3C5UA 2WTIA 3HX4A 2BAJA 2OXXA 3W18A 3O8PA 2V7AA 4FF8A 1Z9XA 5GHVA 2OXYA 4XV2A 3ZBXA 3QKLA 4CVAA 3L9MA 3E3PA 3SOAA 3UPXA 4YZ9A 4AZWA 4ZS4A 1M7NA 1Y6AA 2W96B 2ZV7A 4YUQA 3IG7A 4QTCA 5F94A 5TKDA 3MESA 3A61A 3MY5A 5HLPA 2W4JA 3FWQA 4JL9A 1NVQA 2C0OA 1FVRA 4JDJA 3L8XA 5H8BA 3GENA 4YPDA 3VIDA 3LJ0A 4GYGA 5M09A 4KD1A 2GNHA 4MF0A 4KIKB 4BWXA 4NFMA 3UVRA 5HLNA 4WNOA 5ETAA 5GJDA 5CU0A 3KMMA 3KXMA 3PE2A 4X2FA 3EYGA 4AN9A 4EOKA 5JGBA 2QOHA 1SZMA 3VBTA 1CKIA 3OROA 1ZY4A 4L46A 4GG7A 2Z02A 4F09A 3BPRA 1Q8ZA 5FG8A 3AT4A 5L8KA 3R9RA 2QI8A 3WZKA 1KOBA 3OT3A 4AW1A 5M4FA 1QPEA 4QMQA 1JNKA 3BELA 3LXNA 5AA9A 1LP4A 2BHEA 2Y8OA 2I0HA 3NNVA 3Q32A 4IVCA 4ZZNA 1AQ1A 4DEDA 3F3TA 2EB3A 2IG7A 5D7AA 2IZTA 5K5XA 1H1WA 3GEQA 4OTDA 4XG6A 3V6RA 4A06A 4A4XA 2HW7A 3MJ2A 2W4OA 3DXQA 3VS5A 4HZSA 4F9CA 2YJSA 5J5TA 3N4TA 1TVOA 4Z7GA 2R3HA 3KK9A 3FPQA 4JX3A 3FI4A 4RIYA 4Q5HA 2SRCA 4R77A 3TTIA 3I1AA 3KA0A 3H4JA 4DCEA 4E4MA 4FKOA 3DK3A 3ZZEA 5HICA 3O8TA 4D2WA 1FBNA 5HD7A 3ZXTA 4HOKA 4JT3A 4YPSA 4A9SA 1J7LA 2C6DA 4RFZA 1W8CA 3MPMA 2V5QA 3P9JA 4OBPA 5JQ5A 2X2MA 2Y0AA 2BDJA 5E9EA 5AR3A 3AC2A 3H30A 4V04A 4C4GA 4TYHB 2X0GA 4AU8A 5BVDA 5EQYA 2I0YA 2QLUA 5E8YA 3QLGA 4I0RA 3GC0A 1PXOA 4G5PA 4C62A 3I81A 3QRIA 1RW8A 4Q9ZA 3LIJA 4OAUC 4XUFA 3Q04A 3CQUA 4BCQA 1IA8A 3DBQA 4IACA 3QTXA 3FSFA 3Q4UA 2X1NA 1W0XC 3C0HA 4NM0A 4NKSA 3IDBA 4UYNA 3NNXA 1OPJA 3GCVA 2XRUA 3D0EA 5DNRA 4AZSA 4ACDA 4HNFA 2CHLA 3DCVA 1JKTA 4F1MA 3F3ZA 4J8MA 1Z57A 5F20A 4OTQA 3RM6A 3G0FA 2XEZA 4FTNA 3Q2JA 3FZ1A 4Z55A 4R7HA 3DOGA 2HXLA 2GFCA 4ZIMA 4MXYA 2WTCA 5E91A 2FUMA 3ULIA 5HIDA 3FZSA 4G9CA 4YC3A 5AP1A 5L6OA 3E93A 4UEUA 2HENA 3SXSA 4U3YA 3FBVA 2WTDA 2YIRA 4DCAA 2UZOA 2WQOA 5HBEA 4FEUA 3OHTA 3OEZA 4TKSA 3V6SA 1H1PA 4U81A 1J1CA 2WIHA 3O8UA 2VD5A 4GV1A 4NK9A 3RINA 3D2KA 3WYYA 5HBHA 4WIHA 3R7IA 1MUOA 2J6MA 2W4KA 2VTAA 4ENXA 3H0YA 4U79A 5GINE 5D9HA 3A4OX 1GIJA 3DKCA 3DZOA 3HMOA 4I1ZA 5AUWA 5M53A 1Q41A 2OO8X 5CT7A 2WPAA 3FKOA 2X7FA 4C4HA 1ATPE 3GU7A 4CXAA 3G9LX 4S33A 4NU1A 4CRLA 4FSNA 3H10A 3FMMA 4WG5A 1ZYSA 5HKMA 3WF9A 2YJRA 5AUXA 4BTFA 1SMHA 2C69A 1OM1A 2OFUA 1QPCA 3EWHA 4RJ5A 4JS8A 3TACA 4AP7A 4E6DA 5KX8A 2DYLA 3OCGA 5M56A 3RZFA 1H07A 1PMEA 3S95A 3CY3A 3DNDA 4MH7A 4B8MA 4GK3A 1JSTA 3R00A 2WMTA 3OCBA 4ZK5A 4XG7A 4J97A 4W4VA 3ACJA 3I6WA 5GZAA 2JDVA 4TYJA 2I1MA 3T9IA 2UZBA 3VNTA 2J0JA 4ASEA 5IH6A 5AMNA 3D7TB 1V0OA 4YJSA 4FT7A 3ORNA 1GZOA 3RPRA 5AEPA 1JLUE 2XK8A 2Y6MA 4TN6A 2QONA 4TYIA 4D55A 1XH5A 2I0EA 4O0WA 1BL6A 4LI5A 4CNHA 2J9MA 1MRYA 2CCIA 4JAJA 4ZTMA 2B1PA 3HRFA 4A9RA 3MSSA 4FKGA 4YJPA 1GZNA 1NA7A 2OBJA 3VC4A 5J95A 4AWIA 3ZEPA 5EW8A 3EJ1A 3P0MA 4DEBA 3CKWA 1OUKA 3NGAA 5I9ZA 2BRBA 5HIEA 2DUVA 3WARA 2QKWB 5K5NA 4PTEA 4DH7A 2UVZA 4N6ZA 4E6QA 1DAYA 4IAKA 3GT8A 3IK3A 2EVAA 3G33A 4O0UA 4WA9A 2JD5A 1H1QA 2R3MA 5FTOA 3B2TA 3R22A 4I24A 4IBMA 4FNYA 4DGGA 4CMOA 4DTBA 3OEFX 3HAMA 2ERZE 3KN5A 5IA1A 4IW0A 3TXOA 1OUYA 3PZHA 3SV0A 3VO3A 1XBCA 5EOBA 3ZHPC 5IMEA 4IM2A 1ZYJA 3QX2A 3QZHA 3V8SA 3ZUVA 1M52A 4U80A 4C02A 2J90A 4J1RA 4CEGA 4DFXE 2OGVA 3F5XA 3R73A 4J99A 4FSMA 1Q99A 4JG7A 4U45A 3VS1A 3ODZX 4U44A 4IANA 4D5KA 4EBWA 4O7YA 3UPZA 3LFAA 3LFFA 3S4QA 3ENMA 4C8BA 4FSYA 5CEMA 2C6MA 5L2TA 1Q8UA 4CG9A 3D7ZA 3AD6A 2R0UA 5BVNA 3W8LA 4GU6A 2WMXA 4MTAA 4FV3A 4GCJA 4FI1A 4DG0E 5B2KA 2XMYA 1ZMWA 3EQBA 2CGVA 4M0ZA 2VX3A 3MFUA 2X2LA 4J71A 4D2TA 3KCKA 2B53A 4JQEA 5ANJA 3ALNA 2GFSA 2ETRA 2UW6A 2VZ6A 4EYMA 5C26A 3HECA 4YO4A 3TUBA 2OSCA 2RFEA 1PMUA 3QL8A 4WBBB 5BPYA 4G6OA 1H1RA 2PTKA 3FY0A 4B6LA 4O81A 2PVFA 2I0VA 3FQEA 1FGKA 2YDJA 5IQAA 4WRGA 3FI8A 3RAHA 4D58A 3CTJA 5E8VA 5HBJA 2PUNA 3PVBA 4YZDA 3CY2A 4U40A 3I0OA 5ANKA 4OR5A 1WBTA 2IN6A 2JIVA 4C57A 2UZNA 1FPUA 2R9SA 2X2KA 5DT4A 4F6UA 3D15A 4L45A 5HVKA 4GEOA 1YW2A 4KIQA 4FV6A 3KK8A 5E8ZA 3SXFA 3W16A 5AP6A 4ID7A 2B7AA 4WHZA 2WTKC 4QTDA 2WQMA 2W06A 4RVLA 3GI3A 2FVDA 1WMKA 1MP8A 3CQEA 4NZWB 3PP1A 4F65A 4G6LA 2ITTA 2BMCA 3V8WA 4MWHA 3R28A 3S00A 2Z7SA 5E1EA 2UZEA 2AC3A 4EUUA 3K2LA 1I44A 4MNFA 1JWHA 2OFVA 3RM7A 4AQCA 1W82A 5L2IA 4QPAA 3QRJA 3R1NA 3SOCA 4UXQA 5E8UA 4FE2A 4FBXA 4JG8A 2IW9A 1UU3A 2CMWA 3W2SA 5DR9A 4JAIA 4TT7A 4ZXTA 2HOGA 3A60A 4H05A 3U54A 1H25A 3UOHA 3RALA 1Q97A 2OF2A 5HQ0A 3JR1A 3C9WA 3QXOA 1H1SA 2W9ZB 3CD3A 2VNYA 5E92A 3UQCA 4L9IA 4DN5A 4GS6A 4RIYB 4DH5A 5C4LA 3CBLA 3PJ2A 4MX9A 3O0GA 4L44A 3BBWA 2EUFB 2PHKA 3VBWA 4G3DA 4AZFA 1K2PA 2JAVA 4R8QA 5EHLA 2LAVA 4AF3A 2RFSA 3CCNA 3VS3A 2O2UA 5D12A 3UMWA 3AC4A 3S1HA 1QL6A 5KE0A 2G2IA 4Q5EA 3ZSGA 3E87A 3WYXA 3PJ3A 4YJVA 3WZJA 1G5SA 3QQJA 4HPTE 3UOLA 4QT1A 3W2CA 2J5EA 3PVGA 3V5LA 3O2MA 3BHVA 4BWKA 5M4CA 5FBNC 2BDFA 2E9PA 5IA3A 3RNIA 3HV3A 3F2RA 3BU6A 5FDXA 3FMNA 2Z7QA 3QUDA 3F5UA 2VWIA 2CKOA 2QOFA 4EOJA 3TIZA 2NP8A 1B39A 2R3NA 4Z9LA 2CCHA 3FZPA 4C4EA 4CT2A 5E7RA 4UZDA 4EI4A 2QOOA 2GQSA 2VN9A 5DEWA 5C27A 4F7JA 4DBNA 1S9IA 1UKHA 2J7TA 2C6KA 4MVFA 3DFAA 2CGWA 4FNWA 4EOOA 4HYIA 4FIHA 5AP2A 5LVNA 4RX9A 3THBA 4B99A 2G15A 4GUBA 2BR1A 4FTLA 1TKIA 3KMWA 3R1YA 2C6EA 3Q4CA 5CU4A 1OIQA 3DJ7A 2VGPA 4OTGA 2JFLA 3QRTA 3BV3A 3OW3A 4BDIA 2PVRA 2ZDUA 1MQBA 3DB8A 4NCTC 4NCTA 2XNOA 2C1BA 5AM6A 5E8SA 3R1QA 4UMUA 1BMKA 3FJQE 3TZMA 1LUFA 3TWJA 1YHWA 4ZY5A 3PG1A 3DK6A 3VBVA 2UZTA 2WEIA 4IZ7A 3KY2A 3IQ7A 1S9JA 5EHOA 3OBJA 3NUUA 3SGCA 2CLQA 4EZ5A 1TQPA 1M2QA 2YA9A 3COHA 3PXKA 4W9WA 3DKFA 1G8AA 3UIBA 2YERA 3A7HA 3M2WA 3ERKA 1FQ1B 5CF6A 4OTHA 4RC2A 5CYIA 4W4YA 3Q52A 3E64A 2YIWA 2XNEA 4RIXA 3PXFA 4Y72A 3C4XA 4UMQA 3FQSA 4EOLA 2PK9A 3MB6A 2ITQA 2WMUA 2CN5A 4Y5QA 2KULA 4EH5A 1YVJA 4U9AA 1QPDA 3EZRA 4OT6A 2X8IA 5KO1A 3FHIA 2ERKA 4F7LA 3QCXA 2C68A 5D10A 5DH3A 4OTIA 2IJMA 4Y46A 3C1XA 1T46A 3DJ5A 2CSNA 4UB7A 2ETKA 1WAKA 4ZTHA 4FVQA 3GNIB 4HYUA 4K77A 4M8TA 5ACBC 4FSQA 3E7VA 5TE0A 4A4LA 4G31A 2VTHA 4C7TA 5ICPA 2DQ7X 4UBAA 2RKUA 2FO0A 4KAOA 5HU3A 3RPSA 4NIFA 4E3CA 2O64A 2G2FA 4RZWA 3EL7A 4O83A 2C6TA 4GVAA 2XCKA 4L53A 5EG3A 3EQPA 4TW9A 5FWKK 2ITOA 4FV7A 5FLFA 3AT2A 5F1ZA 4GMYA 3PXYA 1YQJA 1GNGA 4KKHA 3PPJA 4UMPA 2F7EE 3HVCA 3RPVA 2O63A 2XP2A 3BU3A 3TV6A 2BAKA 3ENHA 1B38A 2OI4X 4EH6A 5CEPA 4JX7A 4YLJA 4FKIA 3OTVA 2ZJWA 3IPHA 4EQUA 4Z3VA 5K4JA 4WUAA 3CTHA 4ZLZA 2G01A 2JBOA 4FK3A 2F49A 4FZAB 3LMHA 2CGUA 2R3LA 5CLPA 3VHKA 3RBWA 4IVDA 3UP7A 1IA9A 1OL6A 3RGFA 3QHWA 4IZAA 4JJRA 2QR7A 3OWPA 2HWOA 4GIIA 1WZYA 4HCUA 4OTPA 4W4WA 3ZLWA 4D4VA 2XUUA 4V0GB 5IA4A 2P55A 3BWJA 4O0YA 4RMZA 2VTJA 3HV5A 3QA0A 4RVMA 2R3JA 3I0QA 2YM3A 5I3RA 3EFJA 1W7HA 3R7GA 4BCMA 2G1TA 5DBXA 5ANIA 1PHKA 1ZLTA 3BHHA 4J98A 4APCA 1Y8YA 2YWPA 3DKOA 3HMMA 4BDFA 3FMJA 5AUTA 4XLVA 4FV0A 4BR3A 3IW7A 3KRWA 4W9XA 3PA4A 2BRNA 4R5SA 2E9VA 2XYNA 4I6HA 3DGKA 2JC6A 3R02A 3OCSA 4L3LA 3ELJA 5CEKA 4I5MA 3FY2A 2C3LA 3P7CA 3WBLA 1GIIA 4MCVA 4GJ2A 4EUTA 4USDA 4YZNA 3KC3A 3QKKA 4KABA 1CTPE 1U5QA 4ZJIA 4P7EA 1FOTA 2BTRA 4QMXA 4DFNA 2R3PA 5CSXA 3ZRMA 4Z7HA 4L67A 5IH5A 4FKRA 4QP7A 3KXNA 2GHLA 2ZV8A 5K0KA 1M7QA 4S30A 4FSRA 4O27B 2PVLA 2WMQA 4TNBA 3TIYA 4DG3E 2X9FA 3IDPA 2ITVA 5EKNA 4XX9A 2G2HA 2YM6A 3PXZA 3WZEA 4EJNA 2C5VA 4IZYA 4YC6A 1W83A 4AUAA 4FT3A 4F9BA 1J7IA 4QP3A 4M15A 4BWPA 3F66A 5AP4A 2C6LA 4C4FA 1A9UA 2J5FA 5DHJA 4H3PA 2XNPA 4L7SA 3ROYA 5IQFA 4PP7A 4E7WA 4QMVA 3M1SA 4YJUA 1KE6A 4I22A 2C0TA 3TV4A 3R1SA 3VWAA 3NDMA 3RK7A 4O7ZA 1ZZLA 4L43A 3QC9A 2PY3A 2YN8A 3HRBA 4RWLA 3KXZA 5M44A 1YRPA 1ZMVA 3VN9A 2X39A 1A48A 4KS8A 3MVMA 4DC2A 2G9XA 3UQGA 1KE5A 3OT8A 2RG5A 4L6QA 4YZCA 4AOIA 4YNOA 5IH4A 3U51A 3BYSA 4XH6A 5LMKA 5LMKC 4LOPA 1IAHA 1WVWA 4O84A 4O2ZA 3DQXA 5CZIA 4BTJA 1WCCA 2UW7A 5AX3A 3L1SA 4ALVA 4F1OA 3Q6UA 4S34A 3ZH8A 4BDCA 5KBRA 3RKBA 2AC5A 2BFXA 3BKBA 4X3JA 5C01A 4GRBA 3C4WA 3MH2A 4A9TA 2YFXA 3LW0A 2FA2A 1A06A 3W32A 3PE1A 4U6RA 4Q9SA 1ZARA 1OBGA 3WILA 4DGOA 3DAKA 5B2MA 3ANRA 3QQHA 3BHTA 4JDIA 3P1AA 3WF7A 2OF4A 3R7VA 4CLJA 3BCEA 2W1DA 2WIPA 4EQMA 3SRVA 3QZGA 4LFIA 2BIKB 4MQ2A 2CKPA 2W99B 5AWMA 5LVOA 4OT5A 4F9WA 4B8LA 1FINA 1UVRA 3LAUA 3QBNA 3QD0A 3RP9A 5JN2A 3Q9YA 2H34A 2A4LA 4L00A 4D4SA 5J1WA 4RQVA 3U4WA 3FSKA 3CIKA 4P5QA 4WKQA 1W84A 5A9UA 3BQRA 3C4EA 4ACCA 5D41A 5I9YA 3DXPA 4XNEA 2J0IA 4RVTA 3TCPA 4CFMA 2W5BA 4QYYA 4RX8A 4ZTSA 3QQGA 2XRWA 2ITZA 4WG4A 4XMOA 5H9BA 2YM7A 2UVYA 4AGDA 4CCUA 5AV4A 2NNWB 3IO7A 2C30A 3LKMA 3D2IA 4JBVA 1YI6A 1QMZA 3B8RA 1BYGA 2XEYA 3WI6A 4A7CA 4ASXA 2YWVA 1JKKA 2XK6A 4KS7A 5KMJA 3VF9A 3TKUA 5IDNA 4AE9A 1YXUA 2IZSA 4N6YA 4IX5A 3S0OA 1GIHA 3BHUA 4FEXA 2GNJA 5L2WA 3EMGA 5AIKA 1E1VA 3ZBFA 2R3FA 3NW5A 5AP7A 4WG3A 4CQGA 3DAJA 4XBUA 5LMAA 5F4NA 1IG1A 3BRBA 4CV8A 4N0SA 4FG8A 4ANMA 5CAQA 4X7QA 3FI3A 1EH4A 2XCHA 3MPAA 2F7XE 4RJ7A 3VHEA 4C2VA 3UZRA 2W1GA 4FTIA 4MEDA 4RZVA 4F0FA 5AFVA 4O1OA 2GS7A 3KCFA 3OOMA 3SW7A 1FVVA 3NNUA 1UU9A 2X8DA 4GFMA 2H8HA 5A46A 4AA5A 3PY0A 4RIXB 4DE4A 2WQBA 4FYNA 3LXLA 4XHKB 5AR5A 2XIXA 4BDEA 3VJNA 3MFRA 3MH0A 3FUPA 4CFVA 4TL0A 3JS2A 4H3QA 5CI7A 2C3IB 1IASA 3SD0A 5I9UA 3RTPA 3RWQA 4YGAA 4PRJA 4EHEA 4NUSA 5HTIA 4CRSA 1SYKA 4FIIA 3O17A 4KUJA 3L8SA 2PMLX 1IEPA 3HYHA 4RJ4A 4XJ0A 1UNGA 2X9EA 4UN0C 2WFYA 1GOLA 3TZ8A 3R04A 1Y8GA 4AOTA 3MS9A 3FC1X 5IU2A 1RJBA 2J0LA 2PE0A 1DI8A 4QO9A 3CXWA 4FKSA 3CJGA 3GU5A 4ITJA 5KZ0A 4JQ8A 4RIOA 2VTMA 3ZUUA 5CAOA 5M07A 3ZU7A 3HEGA 1P4FA 4NIFB 4A9YA 4RT7A 5LWMA 3G2FA 5FXSA 4OBOA 4ZY4A 3DNEA 2NRYA 3R7OA 4D9UA 3OXIA 3NNWA 2WHBA 4N4SA 3BQCA 2RFNA 3CE3A 4MBLA 4YBKA 2RFDA 1PKGA 3UYSA 3GUBA 3EFKA 3EN5A 4HGTA 4BTMA 5AR4A 3EQFA 4G3GA 5IQGA 4WBOA 5F9EA 3F6XA 4QMSA 4DHFA 3KGAA 4PDSA 5DEYA 4DH8A 5JEBA 4KSQA 3ID6C 4WNMA 2IW6A 4D4RA 5CANA 4LRMA 2YAKA 4FTKA 3NCGA 4GH2A 4IC7A 4EORA 5BVOA 4BICA 2XIZA 4IDVA 4YLLA 3QUEA 4GT5A 5HIBA 5CF8A 3FYKX 3HA6A 3OWJA 2VTNA 3MWUA 4A9UA 4CFFA 2PVYA 5EOLA 3LQ3A 5FUTA 3Q6WA 2EWAA 2I40A 4CYIA 3NIEA 2XJ1A 4CD0A 4X6QC 1PW2A 5EYMA 2VWVA 3HKOA 5KUPA 3MW1A 5J9LA 3Q5IA 4C37A 3DAEA 1XBAA 2GMXA 1OITA 2VWXA 5AP0A 3QU0A 1OL2A 3CS9A 3RI1A 4TZRA 3TNQB 4D9TA 3NS9A 5GNKA 1JPAA 3TI1A 4CTCA 4IDTA 2QQ7A 4OGRA 5IQHA 1PYEA 4ZSEA 1KE8A 4FSTA 4XG4A 3WIKA 4DYMA 3LFSA 1UWHA 3K54A 4FC0A 4LGDA 4GFOA 5KCVA 5IQCA 4QYHA 3OXTA 5M08A 3I7BA 3TNWA 1H08A 4FKVA 4G1WA 3QF9A 2RIOA 5DRDA 3MY0A 5TO8A 1J3HA 3QAME 4KRDA 4BI1A 4WNKA 2PZPA 4FSZA 4JNWA 4UY9A 1H27A 5IA5A 2BPMA 1LPUA 3UNJA 3UTOA 3I5NA 4BIDA 2PVHA 4C59A 3ORZA 4IMYA 3N4VA 4DGLC 3FPMA 2XS0A 3V5PA 5M06A 5EQEA 3U6JA 2VUWA 4NW6A 4YJNA 3UG2A 3VBYA 5LXMA 5EI2A 3KRJA 1XQZA 4GW8A 5IEVA 4GT4A 2C47A 3A7JA 3QTZA 2CGXA 2GQGA 2BKKA 4XOYA 3BLHA 4BDGA 3UYTA 5BNJA 3PIZA 4XS2A 1J91A 4FICA 2OLCA 2CKEA 4FVRA 3RMFA 4KINA 3IGGA 5IQBA 5KMLA 4R78A 2B0QA 4FNXA 5A54A 4C33A 4CFXA 4BCPA 3DV3A 4IFCA 4FKPA 5HZNA 2XH5A 4NM5A 1J1BA 4A4OA 4FTJA 1ZOGA 4G2FA 3VJOA 2Q0NA 4I6BA 4YTFA 3PA3A 4YJTA 4AGCA 1H0VA 1X8BA 1YXSA 4I5PA 3NUXA 1XO2B 5J9ZA 3R2BA 4FNZA 4GVJA 4LL0A 1ZAOA 4IX4A 5EM5A 3VBXA 2CNUA 3LMIA 2J4ZA 5FEQA 2REIA 3PVWA 5LOHA 5ACKA 1LEZA 4KB8A 3ZEWA 2BZKB 4XG8A 2WMRA 4YC8A 1KV1A 1IRKA 2QOCA 5EDPA 3F7WA 2OJIA 1CDKA 1OPKA 2XYUA 4W8DA 5JFVA 3MFTA 5CVGA 3G15A 4M13A 4IH8A 5AX9A 4F70A 2HW6A 2W1ZA 4FMQA 3A4PA 3DA6A 3G9NA 3OUKA 1ZOEA 1M14A 4MD7E 4NSTA 1ZZ2A 5FM2A 2PE2A 1PYXA 4Q2AA 2C0IA 3BV2A 3GGFA 2ZYBA 4NH1A 3UIXA 2VO0A 5HVYA 4AOJA 4DEIA 2PU8A 4JBPA 2ZMCA 4QTBA 4R7IA 2X7OA 5CVFA 4LOOA 4Y5HA 3K3IA 3QTWA 3SRVB 4CSVA 3JPVA 1BI7A 4LMNA 3NYVA 5HO6A 3DBDA 4EBVA 5B7VA 5CNOA 3NYNA 3ACKA 3CGFA 5EKOA 4GL9A 3UBDA 1L3RE 3L8PA 3FXZA 4C36A 4H1MA 4IIRA 2R64A 4I23A 3TKIA 2JDRA 2IZRA 4I20A 5CEQA 3WF6A 4XBRA 4DLJA 4F99A 4O1PA 5CALA 3CR0A 3LFQA 3REPA 1VJYA 4AZEA 4IM0A 1GZ8A 3SW4A 4C0TA 4K9YA 1SVHA 3AXWA 3LCKA 3ZOSA 4ARKA 2ZV2A 5A3XA 4PWNA 4AGWA 4CT1A 4ANLA 3Q9XA 4NTSA 3TUDA 4EKLA 4WD5A 3DY7A 3EN6A 2QLQA 2Y7JA 2ZB1A 3FLYA 3LOKA 3R2YA 2A0CX 3L9PA 4U41A 4I6FA 3WE4A 5HG5A 1OMWA 2YISA 4V0GA 3BGZA 3D9VA 4YTCA 4JRVA 3D14A 2BALA 3NUPA 1WBVA 4NT4A 2PL0A 3KVWA 4O0SA 1PF8A 2HZ4A 3LE6A 2UW0A 1PXNA 3DJ6A 4HNIA 4IAIA 3H3CA 3SG9A 3HLLA 3PXQA 4O86A 3A7IA 3LFEA 4XG2A 2XB7A 4YZBA 4FTUA 3RAKA 5CXHA 4GSBA 3QWKA 4FKUA 4UXLA 5IKWA 1E1XA 3QTUA 3DLZA 2IZUA 5BVEA 1R78A 3KB7A 3PIXA 4PMTA 2UW5A 4C3RA 2BTSA 3ZMMA 3GVUA 4ZSJA 2ACXA 3VW6A 5I4NA 5IUHA 4WO5A 4ANOA 4C35A 1YWVA 3ORKA 5BUEA 5CENA 2PZIA 1F3MC 4BY9E 4J53A 4QMUA 5C4KA 5IDPA 3VUKA 2BIYA 3KXHA 5A6NA 4RBLA 4QQJA 1ZYLA 2HIWA 4GT3A 4K0YA 5FD2A 3CP9A 4C58A 4EOQA 1H26A 1RDQE 3FXXA 5JRSA 4H58A 1R39A 4EOMA 5AA8A 4GKHA 4CZTA 2GS2A 2QOKA 3MB7A 1OGUA 1YHSA 3MPTA 4AT4A 4GKIA 4DH1A 5EQPA 3QFVA 5JFWA 2XK9A 4FIFA 1T45A 3D83A 1Q62A 3GP0A 5JGAA 2WQNA 2YDKA 5BVFA 4XCUA 3U87A 3UO6A 4BGQA 2XIYA 4MBIA 2UW8A 5AADA 3VS6A 1FMOE 2XVDA 3UC4A 2VTRA 3R63A 4E5BA 4LG4A 4S2ZA 3EZVA 2PZRA 5HD4A 2XZSA 4M69A 2WOUA 4K33A 4AGUA 4X21A 5DR6A 5IF1A 4PMSA 5A4LA 2VTSA 1YOLA 5BMSA 5KNJA 1DS5A 4PDYA 2ZM3A 4KIOA 4BGGA 2HZIA 2W1IA 2BHHA 1U5RA 3P86A 5C8KA 1FMKA 1PMNA 4NM7A 4EK4A 4BCOA 2XIRA 5LVMA 1DI9A 5BUIA 5HE1A 3PWYA 4G5JA 4ANSA 3UJGA 3W1FA 1ZOHA 5LCKA 3UP2A 4APPA 4QTEA 2QOLA 3E63A 4C38A 3DT1A 1APME 4PY1A 3M42A 4X2NA 4IE9A 2YCQA 4R5YA 3E3BX 4ERWA 3C5IA 1UWJA 2ZAZA 3UO4A 2FH9A 2P4IA 5EYCA 4IWQA 4RIWB 3R8MA 4JBQA 3FYJX 4BCFA 3U55A 3LM5A 3NIZA 4E6AA 4EH7A 2OWBA 4FTMA 1U54A 4BB4A 2R4BA 5E8XA 1RE8A 3KRRA 2R7BA 3MA6A 5FEDA 2Z2WA 5IPJA 4MWIA 5EI6A 3UOKA 3TUCA 3EN7A 3FLZA 4M0YA 4YLKA 3KMUA 2FSTX 4AW2A 4B9DA 1F0QA 5J5SA 5LCJA 5K3YA 5ANDA 1VYWA 3PYYA 3Q4TA 2R5TA 2YM5A 5HCZA 2YM8A 3COIA 4L42A 3ORPA 4UYAA 1OI9A 1JOWB 4I93A 2IVSA 2VO3A 2GNFA 2XA4A 3OFMA 5HHWA 2XJ2A 2VWZA 3K3JA 4LQMA 4H36A 4V01A 3RPYA 5LQFA 4DTKA 4BHNA 3PWDA 2JDOA 3E92A 4KKEA 4I0TA 3C4CA 3ZO2A 2YABA 1V1KA 4D2VA 3NZ0A 1ZWSA 4UWCA 5HE0A 3O23A 5JH6A 4WSYA 4JLCA 2XM8A 3PLAE 1Y6BA 3KF4A 3CKXA 2QODA 2BCJA 1XKKA 1YDTE 5DT0A 4IEBA 3V04A 5EI8A 1M2PA 3VVHA 2Z7RA 3BLQA 1NXKA 3EKNA 5E8WA 3NX8A 3ZO4A 3Q2MA 2OK1A 2P0CA 3QA8A 4NEUA 3VS4A 5J1VA 3TJDA 4MYGA 4G34A 5DT3A 5KHWA 3P5KA 5KZIA 3BBTB 2GTMA 3BYOA 5CASA 4TWOA 3FKLA 3P23A 2UW4A 4FUXA 4NKAA 2YIQA 4PL4A 4O91A 5L8JA 2PYWA 5LARA 4ACHA 4ANNA 1SVGA 2QOBA 5JFSA 3I7CA 4QMZA 4S32A 4CTBA 4GK4A 3LPBA 5EFQA 4PP9A 5CNNA 3EQHA 2WU6A 4FKWA 5H8EA 4D1SA 5LMBA 3PRFA 3NYOA 3Q3BA 1GAGA 3FZTA 3PJ8A 5IA0A 4UALA 4E6CA 1M17A 2BRMA 2JGZA 2JIIA 5HG7A 4DT8A 5KMKA 1SVEA 4IQ6A 4AE6A 4PPBA 3IECA 5AM7A 3E8NA 2UW9A 4QYFA 3ZLSA 2PUPA 2IVVA 3UIMA 1IAJA 4D4YA 3TDVA 4TRLA 5E8TA 1YKRA 4XP0A 3DU8A 3VAPA 3QCYA 4ANBA 4CG8A 1YXTA 2FGIA 4CFUA 4MBJA 3HAVA 3FKNA 1L8TA 3SLSA 4EC8A 1OIUA 4EH3A 2B4SB 3DFCB 4KSPA 3ZFMA 3WZDA 3GC7A 2OJJA 2X6EA 2I6LA 2RG6A 2J51A 5HE2A 5HOAA 3SVVA 3LQ8A 2BZIB 4MXOA 2C3KA 4MD8E 5HTCA 4FZDB 3NAXA 4JVGA 3RPOA 4BF2A 4C2WA 5J8IA 2QO9A 2OIDA 4R1YA 3RK5A 3P7AA 4BBFA 5DR2A 1XR1A 2QO7A 3FQHA 1U46A 4FL1A 3LJ2A 2WMSA 4QMWA 2WGJA 4G6NA 3R9HA 5FQDC 3UE4A 1ZYCA 1GJOA 3BWFA 4BDAA 4BDJA 1JVPP 3T9TA 2ZM4A 4JR7A 4E73A 5HGIA 3CSVA 2KTYA 4R3RA 4FV4A 2VV9A 3P4KA 5E90A 2UZUE 5AUUA 4DFUA 4IB0A 4AA4A 4EEVA 2AUHA 2UVXA 2W0JA 3AMYA 4U0IA 4XP2A 4D2RA 4XRLA 2OXDA 2VTPA 4OLIA 2WMBA 4U8ZA 5D7VA 4I4EA 3PP0A 2ITYA 4D5HA 5IISA 1RQQA 1YWRA 2GNLA 2XK4A 4M3QA 5HCYA 4HVIA 2P2HA 4IAAA 4FGRA 3NMUF 2QD9A 3OZ6A 4EH9A 2Z7LA 3EQCA 3B2WA 4FT5A 1UU8A 2FB8A 2EXMA 3LHJA 4PUZA 4TTHB 3R6XA 1YXVA 3SDJA 2O0UA 3DDQA 4UMTA 2YLFA 5BQ0A 2R3QA 5IQEA 4AG8A 5CVHA 5L8LA 4UMRA 5HX8A 3U9CA 3MDYA 2BDWA 4YJQA 5A4QA 2ZOQA 2PUIA 2JDTA 1Y57A 3KN6A 3NUYA 4AFEA 1H01A 3WIGA 2ITWA 5DFPA 3DBFA 4ITIA 5AP5A 2F4JA 4KBAA 4D2PA 4RX7A 3EH9A 3LVPA 4ZAUA 4RC3A 2YDIA 4HYSA 4EH8A 4OTFA 3KVXA 4ZP5A 1H0WA 1IR3A 5DN3A 1R3CA 4K11A 5CSPA 5K4IA 3FMLA 3ULZA 3O50A 4F63A 5G6VA 1I09A 2BAQA 2JKMA 4FKLA 3ZZWA 2HY0A 3PPZA 5JZJA 2BZHB 5EM6A 5HNGA 1J7UA 5EDQA 3U4UA 1AGWA 4I4FA 1OKVA 5JK3A 4HZRA 4K6ZA 4MXCA 3F3UA 2BUJA 3I4BA 3Q53A 4ZTQA 2R0IA 3MVLA 4KWPA 1O6KA 2R3KA 2W05A 4TXCA 3UO5A 4FTCA 2HXQA 1JAMA 2CJMA 3FZRA 4G3EA 3NWWA 2AYPA 2JBPA 3PY3A 4M69B 1YI3A 2W9FB 3FZOA 3G6GA 4FZFB 1ZRZA 4QD6A 2JKQA 2QR8A 4AXAA 4USEA 4KKGA 5CU3A 2CDZA 2WO6A 4R3PA 4F08A 4DA5A 2GPHA 5T6KA 4FZ6A 4XOZA 3DDPA 1CM8A 3TV7A 3ZO1A 3R8ZA 3NW7A 3ALOA 3ET7A 3RCJA 2C1AA 2O5KA 3AD5A 4ASDA 2EB2A 3F9NA 4LUDA 3UQFA 4B0GA 3NSZA 1JSUA 2VTIA 4EHGA 4YU2A 3PUPA 1NW1A 2FSMX 2PVMA 1KE9A 3V5WA 1KV2A 3HV7A 2WB8A 3GCPA 2B52A 3IGOA 2XIKA 3LFDA 4FV9A 4FX3A 1UNHA 4IWDA 1OKYA 1U54B 3V8TA 2V55A 3DXNA 2VRXA 4EL9A 2YM4A 3ZDUA 3LLAA 3GQLA 3DTCA 4QQTA 4CFNA 4BDKA 4Y8DA 5AAEA 3D4QA 4PF4A 1PXKA 2WELA 3W2PA 4BN1A 4LUEA 5ETCA 3I6UA 4BYJA 3PA5A 2W1CA 4C34A 3EQDA 5AR7A 4Z16A 5EW9A 3NYXA 1CSNA 3EB0A 3AG9A 5I9XA 4YP8A 5KMIA 3FLQA 4JOAA 3MH3A 3ZLYA 5DRBA 3ZUTA 5DI1A 4BCGA 5TR6A 4HW7A 5CF4A 3QC4A 4FOCA 3KRLA 3W33A 4LV5A 1ZY5A 4E20A 3VS0A 3FEGA 4PPAA 2ZB0A 4BDDA 4JR3A 3RHXA 3UVQA 2J0KA 4DFLA 3R7UA 4RX5A 4J96A 1G3NA 3PLSA 1KWPA 3IOPA 4MHAA 2V62A 5A4EA 2OJGA 1Q8TA 2P3GX 4FSWA 4CYJA 1QCFA 4PTGA 5M55A 4ORKA 1PKDA 4ZJJA 4QMPA 3FHRA 3UDBA 5C8MA 5IEYA 5JGDA 4GIHA 4G9RA 5AUZA 2FSLX 2YIXA 3LXKA 2OZAA 2B55A 2PVKA 4IX6A 3FLNC 2JKKA 4MKCA 4EQCA 3BX5A 3DBCA 4U5JA 3RK9A 4F1TA 4IB5A 1KUTA 3POZA 1G8SA 3V5QA 4QP6A 2X81A 5G1XA 5EW3A 5AAFA 4ZZOA 4EZ7A 3GU8A 4QQCA 4EK3A 5B2LA 3PG3A 5KHXA 3QTIA 1XBBA 4FTQA 4DITA 4EYJA 5IMXA 3Q9ZA 1ERKA 3BYUA 4J8NA 4IAYA 3SHEA 5M4UA 4HYHA 4IWOA 3OC1A 5CY3A 3WOWA 3OY3A 4H1JA 3UC3A 5L4QA 1XH9A 5DPVA 3FE3A 5HTBA 1TQMA 2C5XA 3MJ1A 4FV2A 1OL1A 4U43A 5LJJA 4HCVA 2A2AA 4IJ9A 4DTAA 3GOPA 3EN9A 3LXPA 4BBMA 3FLSA 5KBQA 5FGKA 3LZBA 4J52A 4RFYA 1WBSA 2QCSA 2WMAA 3AGMA 4Y85A 5CTPA 3RZBA 3R7YA 3QGYA 3W8QA 3E62A 4ENYA 4I3ZA 3GBZA 5GJFA 5KKRC 4EWQA 2RL5A 3GQIA 1OPLA 3LCSA 3QYZA 1LR4A 4GYIA 5KMOA 4YMJA 3LFCA 3D5UA 2XKEA 4BCHA 2UZDA 2XM9A 3VBQA 1DAWA 2OJFE 2QURA 5I0BA 5FM3A 3JVSA 3TDWA 2YCSA 1BUHA 4FZ7A 4F9AA 4FUYA 5HNIX 5A4TA 3NLBA 2WKMA 2JIUA 1LEWA 3R9NA 4CZUA 4YURA 4FIGA 1PXPA 5CSVA 4XG9A 2QO2A 4ZEGA 4MAOA 3KF7A 3HP2A 3T3VA 4AFJA 4N57A 3ITZA 2B54A 2F57A 4NFNA 3F61A 5BVKA 3ORMA 4BZNA 4NTTA 3R8UA 2HCKA 2Y9QA 5HNBA 2IPXA 4FG7A 3ZLXA 3OG7A 4A07A 5AUVA 2JITA 3OBGA 3FV8A 4KIPA 3GFEA 2NPQA 4FK6A 4M67A 5TOZA 5FXQA 3N9XA 3SQQA 4AZTA 3VQUA 4X6RA 3GCQA 2ITXA 4RLLA 3FL4A 3KULA 3QCQA 4JIAA 2EU9A 4RFMA 2GCDA 3PVUA 1OKWA 3TG1A 3IKAA 3R9DA 2E9NA 3AD4A 3S2PA 1PY5A 1JSVA 3DTWA 2RF9A 1XH6A 2PMOX 3GB2A 4O7SA 4XP3A 2RGPA 3NW6A 5JKGA 2BZJA 4CKIA 2J2IB 3LJ1A 4RIWA 5L6PA 3KFAA 5J87A 4ANQA 2X6DA 4CFWA 4C3FA 4F0IA 2W17A 3QHRA 4MNEA 4O7LA 5CSHA 2OKRA 3RHKA 4EZ3A 2QOQA 3IW8A 3L9LA 1HOWA 5FTQA 3ZC6A 4BCJA 4D28A 2CN8A 2VTLA 1MRVA 5HO8A 4X2JA 3HDMA 2R7IA 3NR9A 3FLWA 5AV3A 3W55A 3VUDA 3F3WA 4AT5A 4YHFA 2VGOA 1VZOA 1WBOA 3AGLA 3CEKA 3COKA 5HU9A 4I5HA 4WOVA 1TQIA 4RQKA 2QU6A 4O0XA 3TKHA 4MXAA 2X7GA 3DPKA 2Y4PA 5E4HA 4AN3A 1WBWA 1URCA 3QD4A 2H9VA 2WMWA 3BU5A 4OW8A 1O6YA 4X0MA 4RG0A 3BYVA 2WNTA 3FMEA 5H2UA 3C7QA 4UX9A 2HZNA 3G5DA 4J7BA 4BI2A 5C1QB 3O71A 4QMNA 4ZOGA 3GXLA 4DEHA 2ZV9A 4NW5A 1NVRA 2XNMA 3EFWA 4O38A 3ZS5A 2Y4IB 4EHZA 3ZSHA 4ALUA 3N4UA 3ZFXA 3D5XA 4XV9A 4EK5A 2B9HA 3P08A 4ITHA 4JXFA 4XV1A 5CWZA 4MK0A 5FRIA 2PVNA 5K0XA 1ND4A 2CNVA 5LVLA 3HV6A 4QP4A 5I3OA 1PXIA 4DEEA 4TWCA 2OJ9A 5CEOA 4O7TA 1SNXA 2WU7A 2A19B 3P7BA 4BCIA 5IA2A 3EQGA 4L68A 4BFMA 4IAFA 4D2SA 2VTOA 4E4NA 4FTOA 3MIYA 2R2PA 4NWMA 1DM2A 4EH4A 3CPCA 4QPSA 3ETAA 4BVUA 5K9IA 3HUBA 2QHNA 2E2BA 5JRQA 4QOXA 4QMLA 2ITNA 5AP3A 4E4LA 2C4GA 5T68A 2EXEA 3MBLA 3VS2A 4P4CA 4GU9A 2XNGA 3Q4ZA 5F95A 3SX9A 4OBQA 4X3FC 4X3FA 5ETIA 4C4JA 3IW6A 3OTUA 4FODA 4G16A 4IVAA 2P33A 3E88A 4BKYA 4E5WA 3G0EA 3FXWA 4XLIA 4O7VA 4L8MA 4AN2A 2PMIA 2QG7A 2ONLC 2ONLA 2V22A 4LGGA 4JG6A 5DLSA 4E8AA 2GSFA 1HCLA 3ORIA 3OXZA 4BZOA 3HA8A 4F0GA 5CAPA 2Z8CA 4RA5A 2ETMA 1U4DA 3ATSA 4GUEA 2YEXA 1CMKE 4BTKA 2Q83A 4YZMA 1R0EA 3OP5A 1WVXA 4O2PA 3IW4A 3HDNA 3UVPA 1URWA 3QXPA 3R8LA 3TT0A 5FDPA 3QQUA 2V0DA 2DWBA 3KQ7A 5DVRA 5AV0A 4ERKA 4H3BA 4Y95A 3MI9A 4CKJA 5L2SA 5L6WL 5CU6A 2ITPA 2UZLA 3VS7A 3AT3A 5H8GA 4LMUA 1SNUA 4G3FA 4YJOA 3OF0A 4MXXA 4QPMA 1NT2A 2WAJA 1HCKA 3HRCA 3IW5A 3F3VA 4WSQA 5AR2A 4HCTA 2B9JA 2XK3A 3AC3A 4BIBA 4DEAA 2BILB 2ITUA 3PJ1A 5FBOA 3AC1A 4W8EA 3CPBA 3GC8A 3MTLA 2BKZA 4QTAA 5JMSA 4ZLOA 1H4LA 3QQLA 3GCSA 4U7ZA 2QKRA 3MV5A 5CU2A 2W1FA 4YJRA 4AAAA 2PWLA 3EHAA 2JKOA 4RRVA 1Q61A 4Y83A 5DG5A 4R1VA 2WQEA 3RAWA 5BMMA 3L8VA 5HG9A 4XV3A 5AV2A 3D5WA 1BLXA 2E9UA 2GS6A 5DE2A 4GK2A 4D0WA 4FKQA 4YR8A 3GU4A 2JEDA 4FOBA 2HY81 3BE2A 4AS0A 2X8EA 4P2KA 3TJCA 2F9GA 4ASZA 4R3CA 2DS1A 4F4PA 3G6HA 3DB6A 3QCSA 4L3JA 4ZTLA 4HVDA 5CX9A 3EQIA 1Q3WA 4I94A 2OZAB 2YCFA 4TYEA 5HEZA 3QRUA 4G17A 3MGYA 3AC5A 3DK7A 4P5ZA 4BYIA 4FVPA 3BGQA 1Q3DA 4U97A 3UNKA 2QVSE 4KBKA 2PMNX 3HZTA 4OUCA 4D1ZA 1CKPA 1SM2A 3SG8A 4RJ8A 5M4IA 3PSBA 3JUHA 2VO6A 4TNDA 3Q5ZA 4I5CA 4U42A 3GC9A 4YHTA 3FI2A 3TNPC 4EWHA 4B7TA 2ZVAA 4JRNA 5M51A 4FKTA 5C03A 3CD8A 1OL5A 2BRGA 4QP8A 4MD9E 4PNIA 3MFSA 4W4XA 1H8FA 5HLWA 3C0GA 1UU7A 5TF9A 2UZVA 5HORA 3IONA 1O9UA 3O96A 4FL3A 5IG1A 5CQWA 1MQ4A 5JQ8A 5ANOA 1YWNA 2F2UA 3OCTA 2OH4A 4QRCA 4FKJA 2WD1A 2XF0A 3AMBA 4FV8A 3I79A 3EFLA 3T3UA 3TNHA 1GY3A 4R6VA 4BI0A 4LL5A 4K2RA 4NJDA 3LM0A 4YTHA 4RJ6A 4E1ZA 2JDSA 3PIYA 5ANEA 3ZM9A 3NUAA 3DBEA 3A8XA 4MQ1A 5KKRB 2WTVA 2WTJA 3OW4A 5AR8A 3KL8A 1XH4A 4EK8A 5LWNA 3RAIA 2GQRA 3JVRA 3K5UA 3ANQA 4NYEA 5AJQA 3QRKA 3QQKA 4GFGA 3O7LB 3TEIA 2XK7A 4M12A 3ZONA 3E8EA 3V5JA 3VUIA 3H0ZA 4N70A 3V5TA 1W98A 4NJ3A 5IEXA 5JSMA 1XH7A 2RSVA 1YI4A 3QKMA 3QLFA 3C13A 5L3AA 3PXRA 1JBPE 2OICA 3UMXA 3WF5A 3DKGA 4JQ7A 2OW3A 2PZ5A 4E4XA 4CKRA 3EKKA 5GJGA 1Q24A 3OD6X 2WEVA 4BCNA 3JYAA 4BRXA 4E26A 1BX6A 3QYWA 3GOKA 3G90X 3ZRKA 3EOCA 4D0XA 5A6OA 3PRIA 5B0XA 3JY0A 2PUUA 2Y6OA 3QX4A 4IVBA 4O0TA 3ZSIA 2J50A 4QMYA 3CGOA 3LCTA 4DFYA 3EL8A 3QTQA 3RVGA 3COMA 2ZMDA 4QQ5A 3R0TA 4J95A 4WUNA 3BEAA 1P2AA 3AOXA 3KULB 3V3VA 2WOTA 3BEGA 3POOA 4P90A 2HELA 5CZHA 4AACA 4O0RA 4IAZA 5EK7A 1B6CB 3R21A 4PDOA 4WT6A 2PULA 1R1WA 1GZKA 1Q8YA 3F2NA 4QMOA 3C51A 4M14A 4MXZA 1O6LA 2GHMA 4O7WA 1F5QA 2O8YA 4G3CA 3VW8A 3DS6A 3IS5A 5ITAA 2OZOA 4L52A 4WRSA 4PDPA 4YSJA 3BI6A 4LOQA 5IUGA 2YACA 3F82A 4MNEB 3ZYAA 4C4IA 5HX6A 3OOGA 4JBOA 3R01A 4FV5A 1KE7A 3L9NA 4JDHA 4RSSA 4EOSA 2HK5A 1P5EA 3G51A 4DINA 3BHYA 5EYDA 4CQEA 5H3QA 1U59A 3RWPA 4BC6A 3F69A 3MVJA 4O22A 3MY1A 4BL1A 2Z60A 4DF3A 1YXXA 3F2AA 4FT0A 4JDKA 4U3ZA 2VWUA 4IC8A 3R9OA 2YCRA 3CQWA 4BIEA 3KREA 3FMHA 1CKJA 1PXMA 3ATTA 1OIRA 4CGAA 2Q0BA 5GIPE 2OIBA 5T3QA 4GG5A 4IB1A 4HVSA 4ZJVA 5IUIA 2R3RA 2UV2A 2VTQA 3WF8A 2GU8A 2NO3A 2VAGA 3QALE 3IDCA 5J79A 5J9YA 5IZFA 2HZ0A 3NRMA 4DFZE 4DBXA 2XBAA 4ZLYA 1ZMUA 4IM3A 4ZSAA 4HJOA 3OUNB 4EOIA 4C61A 3NCZA 1ZYDA 3CTQA 2XKDA 3GFWA 1OKZA 2QNJA 4CLIA 5D1JA 5D11A 2XNBA 4AX8A 3O51A 1V0PA 5FXRA 2YZLA 5J7HA 3OY1A 3W2QA 4Y73A 4RPVA 5CF5A 2QG5A 1VEBA 3ZM4A 3E5AA 3II5A 3R30A 2B9IA 2OU7A 4IB3A 4UWYA 3VUTA 3ZXZA 4BHZA 3Q60A 4FYOA 5L2QA 5CXZA 3MN3A 5AV1A 2BRHA 3MTFA 3E7OA 5FEEA 4RWJA 3LLTA 1PMVA 4CMTA 4H39A 3AQVA 1YDSE 4RWKA 5HESA 2HYYA 3I60A 2H96A 4BZDA 4BKJA 2OG8A 4ZMFA 2LGCA 2VO7A 2A1AB 2WTWA 3HP5A 5EHYA 2XKCA 3I5ZA 3C4ZA 4FIEA 4AT3A 4DLIA 4JIKA 4F7SA 3FMKA 3JXWA 2GDOA 3PSDA 2WZJA 3PTGA 4NM3A 4X3FB 5TT7A 3HUCA 4O82A 3P78A 3TM0A 3ODYX 4DH3A 1ZXEA 1STCE 2W1EA 4RGJA 4TY1A 3MH1A 3M11A 4FTTA 4EJ7A 3SA0A 3PSCA 2C6IA 2E9OA 3CC6A 4DAWA 2VX0A 3JY9A 1Q4LA 4OTWA 3VF8A 1KOAA 1BI8A 4RC4A 5AUYA 4YBJA 4YNEA 4CMUA 4QMMA 2FSOX 4EONA 2IVTA 3HGKA 3A99A 2UZWE 3EN4A 3OWLA 3KKVA 1OL7A 3IOKA 1V0BA 4YSMA 4XEYA 4QP1A 2VU3A 3K5VA 3MYGA 4LRJA 3MA3A 2ESMA 4II5A 2V7OA 3Q9WA 4LV8A 3ZDIA 4XG3A 4FIJA 5DWRA 3W2OA 4EOPA 2PE1A 3R83A 5BYLA 3VUMA 5HVJA 3LFNA 4F7NA 1PJKA 1JKSA 2O3PA 2C6OA 3SKCA 4KRCA 4RLKA 5FP5A 2YHVA 3PY1A 1P4OA 3ZRLA 3F5GA 2F7ZE 3QTSA 4GJ3A 2XKFA 5A4CA 4ZTNA
chains in the Genus database with same CATH superfamily
4QNYA 1H00A 3TNIA 3TN8A 3TZ9A 3MIAA 4AZVA 2P2IA 4KA3A 5C8NA 1Q8WA 1QPJA 4BGHA 5CSWA 2J0MB 2YZAA 4KIKA 2PZYA 1E9HA 3R8VA 2ZM1A 3LMGA 3U9NA 3BYMA 2X4ZA 4ZY6A 4ZSLA 3PJCA 5EH0A 3TTJA 3H9RA 4L7FA 3VQHA 4E5AX 4ONAA 1WBPA 5BV3A 2VWBA 3QQFA 4O21A 4M7IA 5FP6A 3NPCA 4PV0A 3PDTA 4QP9A 3W10A 4HVGA 3BIZA 4B4LA 4M66A 2R3OA 1BKXA 4L01A 2FYSA 4DFBA 3D5VA 4NL0A 2CNQA 3F88A 4XYFA 4IXPA 5ANGA 4QP2A 4EKKA 3QZFA 4FV1A 2BVAA 3OWKA 1PRYA 1OECA 1XH8A 1WBNA 2GNIA 4F64A 4IADA 4AW5A 3BLRA 3HMIA 4QMTA 4USFA 4ACMA 2QHMA 2XALA 4EC9A 4K1BA 1H28A 2CLXA 4QNAA 1K9AA 3V01A 3ORXA 4M84A 2GHGA 3A2CA 3LCOA 4I92A 4PX6A 3EYHA 4O7NA 3FL5A 1PXLA 3DZQA 4PL5A 4JI9A 2JLDA 3LFBA 3VULA 4MF1A 3QD2B 2O65A 2CKQA 4FEQA 4RVKA 3CJFA 2Y4IC 3OS3A 4FGBA 4IFGA 3SAYA 2I7QA 2GNGA 3A7GA 5GIOE 3C0IA 2GTNA 3D94A 4RA4A 1K3AA 3O5AA 1OZ1A 5KMNA 1AD5A 5CEIA 5I5ZA 3UODA 3QZIA 4TYHA 2HWPA 2YLEA 1OB3A 3KEXA 5CS6A 4IZ5A 2PVJA 1OIYA 2R3IA 3PZEA 3VUHA 4FA2A 3ORTA 3T8OA 2C5YA 5GZ8A 2H6DA 3U6HA 4LYNA 1P14A 3Q96A 1UA2A 5HI2A 2XNNA 4ZZMA 3ZTXA 3NAYA 1OVEA 4CZYB 4LRKA 4O96A 4X2GA 5JT2A 3ORLA 4FEWA 4BBEA 5BUJA 1PXJA 4LGHA 4AAYA 1NY3A 3UIUA 4O6EA 4RWIA 5CAUA 1Y91A 3VRYA 3ZCLA 3U6IA 3HMPA 2UW3A 4HGSA 3VUGA 3R71A 4PMPA 3AKJA 3RJCA 4AXEA 1M2RA 3ZO3A 2QC6A 2UUEA 3HL7A 4IHPA 4M68A 4PTCA 3UGCA 1Q5KA 4I41A 4QYGA 3ZC5A 4MUQA 4I0SA 4PNKA 2PSQA 3RNYA 1OBDA 1FVTA 3F7ZA 4I21A 2W7XA 3PFQA 3V51A 2IO6A 5ETFA 5JZNA 4K18A 5A14A 4EHVA 4PPCA 2F2CB 5I9WA 1VYZA 3A7FA 4V05A 4AW0A 4FT9A 5EYKA 4DGNA 5EM7A 3PPKA 1H24A 5DMZA 4FL2A 3HMNA 1VR2A 3LQ5A 4PQNA 2WTKB 2R3GA 3OMVA 1XHAA 2WXVA 4IX3A 3FAAA 1WFCA 5CAVA 4K8AA 2YITA 4UZHA 3P79A 4HGLA 3TL8A 2JAMA 2NRUA 3F5PA 2IF8A 3ZFYA 1WVYA 3SXRA 3QWJA 4D1XA 1UNLA 1YOJA 3NUNA 2VNWA 2XBJA 5BVWA 3TZ7A 4BDHA 2IVUA 4DEGA 5JFXA 2VWWA 4ALWA 4E93A 2W1HA 5GZ9A 4FTRA 4JMQA 4PMMA 1UKIA 5EM8A 5DA3A 3C50A 4YTIA 5IQDA 5HO7A 4OTRA 5CI6A 3H9FA 3U8WA 1NVSA 4F6SA 4F9YA 3NVMB 4WNPA 3BZ3A 4ZMEA 4O7RA 5HCXA 5DIAA 3NEWA 5DOSA 4O0VA 3UNZA 2QU5A 4YHJA 3HNGA 3KU2A 1R0PA 4I6QA 3A62A 1BL7A 1YOMA 5HG8A 5KMMA 5M57A 2JFMA 3UZTA 2VTTA 3D7TA 3C4FA 4FEVA 4S31A 2ZDTA 4O6LA 3DQWA 3RCDA 4TPTA 4HVHA 4R7BA 3R7EA 3NVKI 1YDRE 5CQUA 4PL3A 3S3IA 4DG2E 3MVHA 5IQIA 5BYYA 4KBCA 3QUPA 4ACGA 3W0RA 2BROA 4AA0A 4FR4A 4FG9A 3GU6A 1JQHA 2WMVA 1MRUA 3FC2A 4DT9A 3KXGA 2A27A 3E8CA 4KNBA 4QYEA 4HGEA 2C5NA 4TWPA 4L3PA 3SC1A 3W0OA 4RJ3A 4TWNA 4IWPA 5DGZA 4IJPA 2VX1A 3OVVA 1REJA 3H9OA 4XRJA 5LVPA 3HV4A 4TYGA 2B9FA 2YAAA 3KRXA 5BYZA 3AMAA 3CLYA 5C9CA 3BGPA 4FSUA 4BCKA 3GCUA 1UV5A 2C5OA 4UV0A 3AC8A 5AIRA 4FTAA 3WE8A 4EH2A 4M97A 4OAVB 4ZTRA 4DGMA 3BE9A 3E8DA 5EDRA 5DYJA 2VWYA 4YO6A 1XWSA 5J7BA 2W5AA 4X2KA 5BX0A 5FTGA 4ZSGA 1YHVA 3QD3A 4CV9A 5HE3A 2W5HA 1XJDA 3NUSA 2BFYA 3A8WA 5CT0A 4UWBA 1KSWA 3FMDA 3KXXA 2C3JA 4ZS0A 2X4FA 3W2RA 3VRZA 3QTRA 4C3PA 3WZUA 2CPKE 2HAKA 3O7LD 2OH0E 1FGIA 2YIYA 4BDBA 3QGWA 4FJVA 2XJ0A 1JKLA 2OIQA 4CCBA 4EK6A 3B8QA 3EQRA 4BKZA 5AAGA 4HPUE 2IWIA 4F6WA 3LCDA 4LM5A 5I9VA 3FDNA 5E1SA 1Z5MA 3UG1A 2EXCX 3EIDA 3UZPA 2IW8A 1REKA 3ROCA 2QOIA 3R8PA 2PPQA 3N51A 3DLSA 3UOJA 3C5UA 2WTIA 3HX4A 2BAJA 2OXXA 3W18A 3KIOC 3O8PA 2V7AA 4FF8A 1Z9XA 5GHVA 2OXYA 4XV2A 3ZBXA 3QKLA 4CVAA 3L9MA 3E3PA 3SOAA 3UPXA 4YZ9A 4AZWA 4ZS4A 1M7NA 1Y6AA 2W96B 2ZV7A 4YUQA 3IG7A 4QTCA 5F94A 5TKDA 3MESA 3A61A 3VONA 3MY5A 5HLPA 2W4JA 3FWQA 4JL9A 1NVQA 2C0OA 1FVRA 4JDJA 3L8XA 5H8BA 3GENA 4YPDA 3VIDA 3LJ0A 4GYGA 5M09A 4KD1A 2GNHA 4MF0A 4KIKB 4BWXA 4NFMA 3UVRA 5HLNA 4WNOA 5ETAA 5GJDA 5CU0A 3KMMA 3KXMA 3PE2A 4X2FA 3EYGA 4AN9A 4EOKA 5JGBA 2QOHA 1SZMA 3VBTA 1CKIA 3OROA 1ZY4A 4L46A 4GG7A 2Z02A 4F09A 3BPRA 1Q8ZA 5FG8A 3AT4A 5L8KA 3R9RA 2QI8A 3WZKA 1KOBA 3OT3A 4AW1A 5M4FA 1QPEA 4QMQA 1JNKA 3BELA 3LXNA 5AA9A 1LP4A 2BHEA 2Y8OA 2I0HA 3NNVA 3Q32A 4IVCA 4ZZNA 1AQ1A 4DEDA 3F3TA 2EB3A 2IG7A 5D7AA 2IZTA 5K5XA 1H1WA 3GEQA 4OTDA 4XG6A 3V6RA 4A06A 4A4XA 2HW7A 3MJ2A 2W4OA 3DXQA 3VS5A 4HZSA 4F9CA 2YJSA 5J5TA 3N4TA 1TVOA 4Z7GA 2R3HA 3KK9A 3FPQA 4JX3A 3FI4A 4RIYA 4Q5HA 2SRCA 4R77A 3TTIA 3I1AA 3KA0A 3H4JA 4DCEA 4E4MA 4FKOA 3DK3A 3ZZEA 5HICA 3O8TA 4D2WA 1FBNA 1TFFA 5HD7A 3ZXTA 4HOKA 4JT3A 4YPSA 4A9SA 1J7LA 2C6DA 4RFZA 1W8CA 3MPMA 2V5QA 3P9JA 4OBPA 5JQ5A 2X0OA 2X2MA 2Y0AA 2BDJA 5E9EA 5AR3A 3AC2A 3H30A 4V04A 4C4GA 4TYHB 2X0GA 4AU8A 5BVDA 5EQYA 2I0YA 2QLUA 5E8YA 3QLGA 4I0RA 3GC0A 1PXOA 4G5PA 4C62A 3I81A 3QRIA 1RW8A 4Q9ZA 3LIJA 4OAUC 4XUFA 4LDTA 3Q04A 3CQUA 4BCQA 1IA8A 3DBQA 4IACA 3QTXA 3FSFA 3Q4UA 2X1NA 1W0XC 3C0HA 4NM0A 4NKSA 3IDBA 4UYNA 3NNXA 1OPJA 3GCVA 2XRUA 3D0EA 5DNRA 4AZSA 4ACDA 4HNFA 2CHLA 3DCVA 1JKTA 4F1MA 3F3ZA 4J8MA 1Z57A 5F20A 4OTQA 3RM6A 3G0FA 2XEZA 4FTNA 3Q2JA 3FZ1A 4Z55A 4R7HA 3DOGA 2HXLA 2GFCA 4ZIMA 4MXYA 2WTCA 5E91A 2FUMA 3ULIA 5HIDA 3FZSA 4G9CA 4YC3A 5AP1A 5L6OA 3E93A 4UEUA 2HENA 3SXSA 4U3YA 3FBVA 2WTDA 2YIRA 4DCAA 2UZOA 2WQOA 5HBEA 4FEUA 3OHTA 3OEZA 4TKSA 3V6SA 1H1PA 4U81A 1J1CA 2WIHA 3O8UA 2VD5A 4GV1A 4NK9A 3RINA 3D2KA 3WYYA 5HBHA 4WIHA 3R7IA 1MUOA 2J6MA 2W4KA 2VTAA 4ENXA 3H0YA 4U79A 5GINE 5D9HA 3A4OX 1GIJA 3DKCA 3DZOA 3HMOA 4I1ZA 5AUWA 5M53A 1Q41A 2OO8X 5CT7A 2WPAA 3FKOA 2X7FA 4C4HA 1ATPE 3GU7A 4CXAA 3G9LX 4S33A 4NU1A 4CRLA 4FSNA 3H10A 3FMMA 4WG5A 1ZYSA 5HKMA 3WF9A 2YJRA 5AUXA 4BTFA 1SMHA 2C69A 1OM1A 2OFUA 1QPCA 3EWHA 4RJ5A 4JS8A 3TACA 4AP7A 4E6DA 5KX8A 2DYLA 3OCGA 5M56A 3RZFA 1H07A 1PMEA 3S95A 3CY3A 3DNDA 3UDSA 4MH7A 4B8MA 4GK3A 1JSTA 3R00A 2WMTA 3OCBA 4ZK5A 4XG7A 4J97A 4W4VA 3ACJA 3I6WA 5GZAA 2JDVA 4TYJA 2I1MA 3T9IA 2UZBA 3VNTA 2J0JA 4ASEA 5IH6A 5AMNA 3D7TB 1V0OA 4YJSA 4FT7A 3ORNA 1GZOA 3RPRA 5AEPA 1JLUE 2XK8A 2Y6MA 4TN6A 2QONA 4TYIA 4D55A 1XH5A 2I0EA 4O0WA 1BL6A 4LI5A 4CNHA 2J9MA 1MRYA 2CCIA 3NFFB 4JAJA 4ZTMA 2B1PA 3HRFA 4A9RA 3MSSA 4FKGA 4YJPA 1GZNA 1NA7A 2OBJA 3VC4A 5J95A 4AWIA 3ZEPA 5EW8A 3EJ1A 3P0MA 4DEBA 3CKWA 1OUKA 3NGAA 5I9ZA 2BRBA 5HIEA 2DUVA 3WARA 2QKWB 5K5NA 4PTEA 4DH7A 2UVZA 4N6ZA 4E6QA 1DAYA 4IAKA 3GT8A 3IK3A 2EVAA 3G33A 4O0UA 4WA9A 2JD5A 1H1QA 2R3MA 5FTOA 3B2TA 3R22A 4I24A 4IBMA 4FNYA 4DGGA 4CMOA 4DTBA 3OEFX 3HAMA 2ERZE 3KN5A 5IA1A 4IW0A 3TXOA 1OUYA 3PZHA 3SV0A 3VO3A 1XBCA 5EOBA 3ZHPC 5IMEA 4IM2A 1ZYJA 3QX2A 3QZHA 3V8SA 3ZUVA 1M52A 4U80A 4C02A 2J90A 4J1RA 4CEGA 4DFXE 2OGVA 3F5XA 3R73A 4J99A 4FSMA 1Q99A 4JG7A 4U45A 3VS1A 3ODZX 4U44A 4IANA 4D5KA 4EBWA 4O7YA 3UPZA 3LFAA 3LFFA 3S4QA 3ENMA 4C8BA 4FSYA 5CEMA 2C6MA 5L2TA 1Q8UA 4CG9A 3D7ZA 3AD6A 2R0UA 5BVNA 3W8LA 4GU6A 2WMXA 4MTAA 4FV3A 4GCJA 4FI1A 4DG0E 5B2KA 2XMYA 1ZMWA 3EQBA 2CGVA 4M0ZA 2VX3A 3MFUA 2X2LA 4J71A 4D2TA 3KCKA 2B53A 4JQEA 5ANJA 3ALNA 2GFSA 2ETRA 2UW6A 2VZ6A 4EYMA 5C26A 3HECA 4YO4A 3TUBA 2OSCA 2RFEA 1PMUA 3QL8A 4WBBB 5BPYA 4G6OA 1H1RA 2PTKA 3FY0A 4B6LA 4O81A 2PVFA 2I0VA 3FQEA 1FGKA 2YDJA 5IQAA 4WRGA 3FI8A 3RAHA 4D58A 3CTJA 5E8VA 5HBJA 2PUNA 3PVBA 4YZDA 3CY2A 4U40A 3I0OA 5ANKA 4OR5A 1WBTA 2IN6A 2JIVA 4C57A 2UZNA 1FPUA 2R9SA 2X2KA 5DT4A 4F6UA 3D15A 4L45A 5HVKA 4GEOA 1YW2A 4KIQA 4FV6A 3KK8A 5E8ZA 3SXFA 3W16A 5AP6A 4ID7A 2B7AA 4WHZA 2WTKC 4QTDA 2WQMA 2W06A 4RVLA 3GI3A 2FVDA 1WMKA 1MP8A 3CQEA 4NZWB 3PP1A 4F65A 4G6LA 2ITTA 2BMCA 3V8WA 4MWHA 3R28A 3S00A 2Z7SA 5E1EA 2UZEA 2AC3A 4EUUA 3K2LA 1I44A 4MNFA 1JWHA 2OFVA 3RM7A 4AQCA 1W82A 5L2IA 4QPAA 3QRJA 3R1NA 3SOCA 4UXQA 5E8UA 4FE2A 4FBXA 4JG8A 2IW9A 4LV7A 1UU3A 2CMWA 3W2SA 5DR9A 3UDTA 4JAIA 4TT7A 4ZXTA 2HOGA 3A60A 4H05A 3U54A 1H25A 3UOHA 3RALA 1Q97A 4QDVA 2OF2A 5HQ0A 3JR1A 3C9WA 3QXOA 1H1SA 2W9ZB 3CD3A 2VNYA 5E92A 3UQCA 4L9IA 4BJJB 4DN5A 4GS6A 4RIYB 4DH5A 5C4LA 3CBLA 3PJ2A 4MX9A 3O0GA 4L44A 3BBWA 2EUFB 2PHKA 3VBWA 4G3DA 4AZFA 1K2PA 2JAVA 4R8QA 5EHLA 2LAVA 4AF3A 2RFSA 3CCNA 3VS3A 2O2UA 5D12A 3UMWA 3AC4A 3S1HA 1QL6A 5KE0A 2G2IA 4Q5EA 3ZSGA 3E87A 3WYXA 3PJ3A 4YJVA 3WZJA 4O4CA 1G5SA 3QQJA 4HPTE 3UOLA 4QT1A 3W2CA 2J5EA 3PVGA 3V5LA 3O2MA 3BHVA 4BWKA 5M4CA 5FBNC 2BDFA 2E9PA 5IA3A 3RNIA 3HV3A 3F2RA 3BU6A 5FDXA 3FMNA 2Z7QA 3QUDA 3F5UA 2VWIA 2CKOA 2QOFA 4EOJA 3TIZA 2NP8A 1B39A 2R3NA 4Z9LA 2CCHA 3FZPA 4C4EA 4CT2A 5E7RA 4UZDA 4EI4A 2QOOA 2GQSA 2VN9A 5DEWA 5C27A 4F7JA 4DBNA 1S9IA 1UKHA 2J7TA 2C6KA 4MVFA 3DFAA 2CGWA 4FNWA 4EOOA 4HYIA 4FIHA 5AP2A 5LVNA 4RX9A 3THBA 4B99A 2G15A 4GUBA 2BR1A 4FTLA 1TKIA 3KMWA 3R1YA 2C6EA 3Q4CA 5CU4A 1OIQA 3DJ7A 2VGPA 4OTGA 2JFLA 3QRTA 3BV3A 3OW3A 4BDIA 2PVRA 2ZDUA 1MQBA 3DB8A 4NCTC 4NCTA 2XNOA 2C1BA 5AM6A 5E8SA 3R1QA 4UMUA 1BMKA 3FJQE 3TZMA 1LUFA 3TWJA 1YHWA 3BL9A 4ZY5A 3PG1A 3DK6A 3VBVA 2UZTA 2WEIA 4IZ7A 3KY2A 3IQ7A 1S9JA 5EHOA 3OBJA 3NUUA 3SGCA 2CLQA 4EZ5A 1TQPA 1M2QA 2YA9A 3COHA 3PXKA 4W9WA 3DKFA 1G8AA 3UIBA 2YERA 3A7HA 3M2WA 3ERKA 1FQ1B 5CF6A 4OTHA 4RC2A 5CYIA 4W4YA 3Q52A 3E64A 2YIWA 2XNEA 4RIXA 3PXFA 4Y72A 3C4XA 4UMQA 3FQSA 4EOLA 2PK9A 3MB6A 2ITQA 2WMUA 2CN5A 4Y5QA 2KULA 4EH5A 1YVJA 4U9AA 1QPDA 3EZRA 4OT6A 2X8IA 5KO1A 3FHIA 2ERKA 4F7LA 3QCXA 2C68A 5D10A 5DH3A 4OTIA 2IJMA 4Y46A 3C1XA 1T46A 3DJ5A 2CSNA 4UB7A 2ETKA 1WAKA 4ZTHA 4FVQA 3GNIB 4HYUA 4K77A 4M8TA 5ACBC 4FSQA 3E7VA 5TE0A 4A4LA 4G31A 2VTHA 4C7TA 5ICPA 2DQ7X 4UBAA 2RKUA 2FO0A 4KAOA 5HU3A 3RPSA 4NIFA 4E3CA 2O64A 2G2FA 4RZWA 3EL7A 4O83A 2C6TA 4GVAA 2XCKA 4L53A 5EG3A 3EQPA 4TW9A 5FWKK 2ITOA 4FV7A 4DDIA 5FLFA 3AT2A 5F1ZA 4GMYA 3PXYA 1YQJA 1GNGA 4KKHA 3PPJA 4UMPA 2F7EE 3HVCA 3RPVA 2O63A 2XP2A 3BU3A 3TV6A 2BAKA 3ENHA 1B38A 2OI4X 4EH6A 5CEPA 4DHZA 4I6LA 4JX7A 4YLJA 4FKIA 3OTVA 2ZJWA 3IPHA 4EQUA 4Z3VA 5K4JA 4WUAA 3CTHA 4ZLZA 2G01A 2JBOA 4FK3A 2F49A 4FZAB 3LMHA 2CGUA 2R3LA 5CLPA 3VHKA 3RBWA 4IVDA 3UP7A 1IA9A 1OL6A 3RGFA 3QHWA 4IZAA 4JJRA 2QR7A 3OWPA 2HWOA 4GIIA 1WZYA 4HCUA 4OTPA 4W4WA 3ZLWA 4D4VA 2XUUA 4V0GB 5IA4A 2P55A 3BWJA 4O4EA 4O0YA 4RMZA 2VTJA 3HV5A 3QA0A 4RVMA 2R3JA 3I0QA 2YM3A 5I3RA 3EFJA 1W7HA 3R7GA 4BCMA 2G1TA 5DBXA 5ANIA 1PHKA 1ZLTA 3BHHA 4J98A 4APCA 1Y8YA 2YWPA 3DKOA 3HMMA 4BDFA 3FMJA 5AUTA 4XLVA 4FV0A 4BR3A 3IW7A 3KRWA 4W9XA 3PA4A 2BRNA 4R5SA 2E9VA 2XYNA 4I6HA 3DGKA 2JC6A 3R02A 3OCSA 4L3LA 3ELJA 5CEKA 4I5MA 3FY2A 2C3LA 3P7CA 3WBLA 1GIIA 4MCVA 4GJ2A 4EUTA 4USDA 4YZNA 3KC3A 3QKKA 4KABA 1CTPE 1U5QA 4FRFA 4P7EA 4ZJIA 1FOTA 2BTRA 4QMXA 4DFNA 2R3PA 5CSXA 3ZRMA 4Z7HA 4L67A 5IH5A 4FKRA 4QP7A 3KXNA 2GHLA 2ZV8A 5K0KA 1M7QA 4S30A 4FSRA 2XARA 4O27B 2PVLA 2WMQA 4TNBA 3TIYA 4DG3E 2X9FA 3IDPA 2ITVA 5EKNA 4XX9A 2G2HA 2YM6A 3PXZA 3WZEA 4EJNA 2C5VA 4IZYA 4YC6A 1W83A 4AUAA 4FT3A 4F9BA 1J7IA 4QP3A 4M15A 4BWPA 3F66A 5AP4A 2C6LA 4C4FA 1A9UA 2J5FA 5DHJA 4H3PA 2XNPA 4L7SA 3ROYA 5IQFA 4PP7A 4E7WA 4QMVA 3M1SA 4YJUA 1KE6A 4I22A 2C0TA 3TV4A 3R1SA 3VWAA 3NDMA 3AKKA 3RK7A 4O7ZA 1ZZLA 4L43A 3QC9A 2PY3A 2YN8A 3HRBA 4RWLA 3KXZA 5M44A 1YRPA 1ZMVA 3VN9A 2X39A 1A48A 4KS8A 3MVMA 4DC2A 2G9XA 3UQGA 1KE5A 3OT8A 2RG5A 4L6QA 4YZCA 4AOIA 4YNOA 5IH4A 3U51A 3BYSA 4XH6A 5LMKA 5LMKC 4LOPA 1IAHA 1WVWA 4O84A 4O2ZA 3DQXA 5CZIA 4BTJA 1WCCA 2UW7A 5AX3A 3L1SA 4ALVA 4F1OA 3Q6UA 4S34A 3ZH8A 4BDCA 5KBRA 3RKBA 2AC5A 2BFXA 3BKBA 4X3JA 5C01A 4GRBA 3C4WA 3MH2A 4A9TA 2YFXA 3LW0A 2FA2A 1A06A 3W32A 3PE1A 4U6RA 4Q9SA 1ZARA 1OBGA 3WILA 4DGOA 3DAKA 5B2MA 3ANRA 3QQHA 3BHTA 4JDIA 3P1AA 3WF7A 2OF4A 3R7VA 4CLJA 3BCEA 2W1DA 2WIPA 4EQMA 3SRVA 3QZGA 4LFIA 2BIKB 4MQ2A 2CKPA 2W99B 5AWMA 5LVOA 4OT5A 4F9WA 4B8LA 1FINA 1UVRA 3LAUA 3QBNA 3QD0A 3RP9A 5JN2A 3Q9YA 2H34A 2A4LA 4L00A 4D4SA 5J1WA 1XMMA 4RQVA 3U4WA 3FSKA 3CIKA 4P5QA 4WKQA 1W84A 5A9UA 3BQRA 3C4EA 4ACCA 5D41A 5I9YA 3DXPA 4XNEA 2J0IA 4RVTA 3TCPA 4CFMA 1OGYA 2W5BA 4QYYA 4RX8A 4ZTSA 3QQGA 2XRWA 2ITZA 4WG4A 4XMOA 5H9BA 2YM7A 2UVYA 4AGDA 4CCUA 5AV4A 2NNWB 3IO7A 2C30A 3LKMA 3D2IA 4JBVA 1YI6A 1QMZA 3B8RA 1BYGA 2XEYA 3WI6A 4A7CA 4ASXA 2YWVA 1JKKA 2XK6A 4KS7A 5KMJA 3VF9A 3TKUA 5IDNA 4AE9A 1YXUA 2IZSA 4N6YA 4IX5A 3S0OA 1GIHA 3BHUA 4FEXA 2GNJA 5L2WA 3EMGA 5AIKA 1E1VA 3ZBFA 2R3FA 3NW5A 5AP7A 4WG3A 4CQGA 3DAJA 4XBUA 5LMAA 5F4NA 1IG1A 3BRBA 4CV8A 4N0SA 4FG8A 4ANMA 5CAQA 4X7QA 3FI3A 1EH4A 2XCHA 3MPAA 2F7XE 4RJ7A 3VHEA 4C2VA 3UZRA 2W1GA 4FTIA 4MEDA 4RZVA 4F0FA 5AFVA 4O1OA 2GS7A 3KCFA 3OOMA 3SW7A 1FVVA 3NNUA 1UU9A 2X8DA 4GFMA 2H8HA 5A46A 4AA5A 3PY0A 4RIXB 4DE4A 2WQBA 4FYNA 3LXLA 4XHKB 5AR5A 2XIXA 4BDEA 3VJNA 3MFRA 3MH0A 3FUPA 4CFVA 4TL0A 3JS2A 4H3QA 5CI7A 2C3IB 1IASA 3SD0A 5I9UA 3RTPA 3RWQA 4YGAA 4PRJA 4EHEA 4NUSA 5HTIA 4CRSA 1SYKA 4FIIA 3O17A 4KUJA 3L8SA 2PMLX 1IEPA 3HYHA 4RJ4A 4XJ0A 1UNGA 2X9EA 4UN0C 2WFYA 1GOLA 3TZ8A 3R04A 1Y8GA 4AOTA 3MS9A 3FC1X 5IU2A 1RJBA 2J0LA 2PE0A 1DI8A 4QO9A 3CXWA 4FKSA 3CJGA 3GU5A 4ITJA 5KZ0A 4JQ8A 4RIOA 2VTMA 3ZUUA 5CAOA 5M07A 3ZU7A 3HEGA 1P4FA 4NIFB 4A9YA 4RT7A 5LWMA 3G2FA 5FXSA 4OBOA 4ZY4A 3DNEA 2NRYA 3R7OA 4D9UA 3OXIA 3NNWA 2WHBA 4N4SA 3BQCA 2RFNA 3CE3A 4MBLA 4YBKA 2RFDA 1PKGA 3UYSA 3GUBA 3EFKA 3EN5A 4HGTA 4BTMA 5AR4A 3EQFA 4G3GA 5IQGA 4WBOA 5F9EA 3F6XA 4QMSA 4DHFA 3KGAA 4PDSA 5DEYA 4DH8A 5JEBA 4KSQA 3ID6C 4WNMA 2IW6A 4D4RA 5CANA 4LRMA 2YAKA 4FTKA 3NCGA 4GH2A 4IC7A 4EORA 5BVOA 4BICA 2XIZA 4IDVA 4YLLA 3QUEA 4GT5A 5HIBA 5CF8A 3FYKX 3HA6A 3OWJA 2VTNA 3MWUA 4A9UA 4CFFA 2PVYA 5EOLA 3LQ3A 5FUTA 3Q6WA 2EWAA 2I40A 4CYIA 3NIEA 2XJ1A 4CD0A 4X6QC 1PW2A 5EYMA 2VWVA 3HKOA 5KUPA 3MW1A 5J9LA 3Q5IA 4C37A 3DAEA 1XBAA 2GMXA 1OITA 2VWXA 5AP0A 3QU0A 1OL2A 3CS9A 3RI1A 4TZRA 3TNQB 4D9TA 3NS9A 5GNKA 1JPAA 3TI1A 4CTCA 4IDTA 2QQ7A 4OGRA 5IQHA 1PYEA 4ZSEA 1KE8A 4FSTA 4XG4A 3WIKA 4DYMA 3LFSA 1UWHA 3K54A 4FC0A 1W2CA 4LGDA 4GFOA 5KCVA 5IQCA 4QYHA 3OXTA 5M08A 3I7BA 3TNWA 1H08A 4FKVA 4G1WA 3QF9A 2RIOA 5DRDA 3MY0A 5TO8A 1J3HA 3QAME 4KRDA 4BI1A 4WNKA 2PZPA 4FSZA 4JNWA 4UY9A 1H27A 5IA5A 2BPMA 1LPUA 3UNJA 3UTOA 3I5NA 4BIDA 2PVHA 4C59A 3ORZA 4IMYA 3N4VA 4DGLC 3FPMA 2XS0A 3V5PA 5M06A 5EQEA 3U6JA 2VUWA 4NW6A 4YJNA 3UG2A 3VBYA 5LXMA 5EI2A 3KRJA 1XQZA 4O4BB 4GW8A 5IEVA 4GT4A 2C47A 3A7JA 3QTZA 2CGXA 2GQGA 2BKKA 4XOYA 3BLHA 4BDGA 3UYTA 5BNJA 3PIZA 4XS2A 1J91A 4FICA 2OLCA 2CKEA 4FVRA 3RMFA 4KINA 3IGGA 5IQBA 5KMLA 4R78A 2B0QA 4FNXA 5A54A 4C33A