4MNEB

Crystal structure of the braf:mek1 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
270
Chain Sequence
DWEIPDGQITVGQRIGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure of the BRAF-MEK Complex Reveals a Kinase Activity Independent Role for BRAF in MAPK Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 270
sequence length 274
chains with identical sequence C, F, G
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mneB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mneB01
2GHLA 4TW9A 3NLBA 3ZOSA 5I9UA 4E1ZA 2PULA 4Z7GA 4XBUA 3MA3A 3QXOA 3LXNA 4I6QA 4MBLA 5AV4A 5CNNA 4DTKA 1ND4A 2HY0A 1HOWA 2VTAA 1WBOA 2YJSA 1XBAA 3C9WA 2C5XA 3FSFA 4D4YA 2X0GA 2XIYA 1Y8GA 2XJ2A 2ETKA 3IW8A 4I21A 4CEGA 4F1TA 3OFMA 4CFMA 5L3AA 5GZ9A 5JSMA 4C37A 3LXPA 5JGBA 4FL3A 4Y85A 4RSSA 3C13A 2XRUA 4CG8A 4O7WA 3AC8A 1J7UA 4IAZA 5CS6A 4ZSAA 2RG6A 3EWHA 5L4QA 4RQKA 5FWKK 3R8MA 3OCGA 1GY3A 4F0FA 2ZJWA 1DAYA 2WU7A 4BWPA 2BAKA 4MK0A 4QQTA 2C47A 4A06A 2G15A 3LFDA 4M8TA 3O51A 3GENA 4FV4A 3K54A 2VZ6A 4CZUA 4EOJA 3PXFA 2YFXA 2ZYBA 2BHHA 1U54A 5M55A 3TM0A 5CLPA 3JVRA 3MFUA 2YISA 3KMUA 4V0GA 4AFEA 2PZIA 1XH9A 2UW3A 1YW2A 3FMKA 4UZDA 4X6QC 2BKZA 5T68A 4ZY4A 4GKIA 4ID7A 3NVKI 2FSLX 2ZMCA 3ZZEA 3VO3A 3NYOA 4R5YA 5E92A 2IZRA 4RJ6A 5FUTA 3OTUA 3R02A 3RWPA 3E62A 4FKVA 3SGCA 4A9UA 2XJ0A 2Y0AA 4ORKA 4FKJA 4G6LA 2QODA 3U6HA 3GXLA 3G0FA 2QG5A 5CVHA 5KMLA 1J3HA 4KS7A 3EQPA 2QURA 2ITVA 2PVLA 5DT0A 4PMTA 3SA0A 4IC8A 4HCUA 1DAWA 3OXTA 5GJGA 1YI3A 2WTWA 1ZZLA 4B8LA 3DNDA 3O8TA 4TRLA 4RG0A 4MBIA 4ASXA 1ZAOA 2BZIB 3VBTA 4FK6A 3FI3A 3TZ8A 4EUTA 3RINA 4K1BA 2PY3A 4EH2A 3QKMA 3A60A 5LJJA 4B4LA 5KNJA 3QTZA 2HW7A 4TWCA 2OXDA 3DTCA 4W4WA 4EZ7A 2IZUA 5JMSA 4R7HA 4EH5A 2JLDA 3NCGA 5E8ZA 4XLIA 3I60A 1R39A 2WXVA 3FI4A 5DWRA 4OR5A 2J0KA 5CASA 4FSUA 4LRKA 4ZS0A 3Q3BA 2CLQA 3Q6WA 4XV1A 2YERA 1O6YA 1ZY5A 3SV0A 3TACA 5DFPA 4BIEA 4RWKA 4DN5A 2IJMA 2JBPA 3FDNA 5HOAA 4ASEA 2UZVA 4RZWA 4DYMA 3W2PA 3GC8A 5M07A 4UMQA 2BFYA 3JYAA 5CU2A 3PE1A 4U0IA 3BGQA 3DA6A 3D15A 4BBFA 3HV3A 3ERKA 4W9WA 5EG3A 3RNYA 4ACDA 4RLLA 1WBVA 3R7IA 3AC3A 1U5RA 4CQGA 3KXGA 3KK8A 3TZMA 5KO1A 2B9IA 4L44A 3P7AA 4BF2A 2B9HA 1REKA 1ZLTA 3KRLA 3QTIA 3VBYA 5IQCA 1VYWA 4R6VA 3M11A 5F1ZA 3PDTA 4NTSA 4EORA 3A2CA 4XHKB 1U54B 3GU4A 2W99B 2WELA 2X4FA 4YZMA 4V0GB 1YHVA 4BDKA 3ZEWA 3RHXA 2Z8CA 2W9ZB 4WOVA 1RQQA 4JAIA 1PXNA 3C4XA 3PJ2A 4FTMA 4JAJA 2CGUA 4AZEA 3NNXA 4PNIA 5EI2A 3ZDIA 4MCVA 5BVEA 5FTGA 4I94A 3CD3A 4L3JA 4BI0A 4DT8A 5CQWA 3ZBFA 5IQHA 1UNHA 3KVXA 2ITXA 1WBWA 4DFBA 3V3VA 4CXAA 2GQRA 2JIUA 3PSCA 3DTWA 4FOBA 2BPMA 4IFCA 5CY3A 4D58A 3A62A 2NNWB 5JT2A 4JJRA 3FMEA 2QR8A 4L53A 4WHZA 3QQGA 5FEDA 4IVAA 3V01A 2GSFA 4JBPA 1H27A 4ZTSA 3HMMA 3U55A 2IZTA 3NNVA 3D7TA 1IAHA 4IM0A 4O2ZA 2BRNA 5BUJA 3UNKA 5I9WA 1R78A 4A7CA 2OKRA 4AZVA 3DK3A 2PUIA 4I5PA 4GRBA 4U7ZA 5D9HA 2VWIA 1QL6A 3P7CA 5BVKA 1H4LA 1Q5KA 2OBJA 2YAAA 1QPCA 1Q3WA 2VNYA 4YMJA 1Q8ZA 5E9EA 5AAGA 2VTLA 5DT3A 1LUFA 1NY3A 4AA5A 4ASZA 3H9FA 4XRJA 1PXOA 4BWKA 3RCDA 4YZCA 3CTQA 2YM5A 4RJ7A 3W2OA 5CAOA 4K33A 3CKWA 1CKJA 4NWMA 2ITZA 1PYXA 3ZUTA 3QBNA 2AC5A 5J5SA 5L6WL 4BCHA 2JD5A 5AA8A 4EKLA 4RX7A 1OUYA 5DRDA 2VTJA 5CENA 3S00A 2VTRA 4GFGA 2X8IA 1OPLA 2QVSE 3MH2A 4YJUA 5HICA 4NZWB 2F2UA 3R30A 1KV1A 5DBXA 2ZDUA 3BGPA 3HP2A 5I3RA 3RAHA 1K2PA 3HGKA 4D5KA 4F9WA 1Q8TA 2XEYA 3QWJA 3LJ0A 4O0YA 4BTKA 2BIYA 3W1FA 3GT8A 4S30A 4C36A 4FIEA 2Z7QA 3ANRA 3G5DA 5JH6A 4AZFA 3C0GA 2R4BA 4RJ5A 4OTHA 4AW1A 2FSOX 3L8PA 2GTMA 4TN6A 3GB2A 1WBPA 4BCGA 4RLKA 2F4JA 5J1VA 3F9NA 2YZLA 4PL5A 5IMXA 1LEWA 4BCPA 4NIFA 4EONA 1IR3A 3QYWA 4PP7A 1LPUA 4DA5A 4DG0E 3NUXA 3E8EA 4FTUA 4NJ3A 2B54A 4AOIA 5KX8A 3OOGA 3R7OA 4O81A 4X0MA 2XP2A 4E7WA 5LVPA 2WNTA 2WQEA 3A4PA 4YHJA 5AP4A 2ITNA 4FSRA 4IWDA 4E5BA 4CYIA 4GU6A 4QMOA 4RX9A 3TUBA 5BVNA 2UZNA 1OPJA 4TTHB 5HLPA 4U45A 3E3PA 4OBPA 4I0TA 1XH7A 2VTSA 1H1SA 4ZEGA 4DGLC 4A4OA 5M08A 2J51A 4FF8A 2CLXA 4O2PA 1YDSE 4DGMA 2GNIA 3R8VA 2ETMA 4QP7A 3EQRA 2XMYA 4FIIA 4JR7A 3FWQA 3TUCA 3DK6A 5I5ZA 4MWHA 4CNHA 3TUDA 3MS9A 3GU8A 5D11A 3ZSIA 3WE4A 4ACHA 4RIXA 4XJ0A 3CC6A 4BCIA 1UVRA 4FNWA 3NZ0A 3F7WA 4L8MA 2YDKA 3PXZA 2ITPA 3QF9A 5M57A 1GZNA 3WIKA 4M68A 3DQXA 5D7VA 2X2LA 3GU7A 4FT3A 3OCSA 4RJ3A 2C6KA 5JQ8A 1YHWA 4B0GA 4HGTA 3Q4TA 4M0ZA 5AP1A 3RAIA 3KL8A 2R3RA 2BILB 3M42A 3MPAA 3IK3A 3RK5A 3VF8A 2W96B 4QMZA 3W2QA 2QU6A 3I7CA 3KGAA 3FV8A 3GCSA 4FE2A 4IX4A 1OL7A 1GNGA 2G2FA 2P0CA 1PMEA 2QO2A 3FYKX 3MI9A 4OTWA 3F3UA 4RX8A 4XEYA 5AM6A 5CF5A 4WO5A 3VJNA 4EHEA 4M15A 4QQ5A 3LCOA 3F5GA 4L43A 4YZDA 5IQBA 3RK7A 4BI1A 4CFVA 2JAVA 2R3PA 3DNEA 2QOBA 2B7AA 4R1VA 2UZUE 1FVVA 3MN3A 5LQFA 3O8UA 3FHRA 4QRCA 3NUSA 1Q8WA 2VD5A 4YU2A 3DS6A 1OKYA 3QQKA 3OC1A 3LE6A 1URCA 3L8VA 2VO3A 4BGQA 1Z57A 2YN8A 4LYNA 3SX9A 5KKRB 3PJCA 3HMIA 4TYHA 1Q62A 2W17A 5JFXA 2UZDA 2XS0A 4FKPA 1GZKA 3SLSA 3VUKA 1ZOEA 3BLHA 3G51A 4RJ4A 4YUQA 2CSNA 2X2KA 4LL5A 4L6QA 4QPSA 2HZ4A 3FMHA 2QLQA 2C5YA 5EDQA 5DG5A 3R2BA 2OI4X 5BQ0A 5J9ZA 1U4DA 3MTLA 3FL4A 3OZ6A 5EM5A 5M4IA 3K5UA 4G16A 2XBJA 3C0HA 4KAOA 4FNZA 4NT4A 4ACCA 3B8QA 2Y6MA 4UMRA 3AMBA 2FYSA 1JWHA 5DNRA 4BGHA 4O0SA 4RX5A 5GJFA 2VAGA 3F2NA 5EHYA 3OW4A 5CU4A 3OWLA 3POZA 2C6TA 4J8NA 4QNAA 4IB0A 4JG8A 2VTQA 4DC2A 1K3AA 2W4JA 5HBHA 2YLFA 3MY5A 4GSBA 5D41A 4IC7A 3UODA 3EN9A 1B39A 3PTGA 3KREA 1V1KA 2GMXA 3LFCA 3P0MA 4MYGA 2BDJA 3KULA 4ZTQA 2XIRA 3FI2A 5ETFA 4Q9SA 4RIXB 4RGJA 4B6LA 3COIA 3KFAA 4MF0A 2XNPA 1PXJA 4BGGA 3VUMA 4O21A 2ZV2A 4AGWA 1IRKA 3CD8A 3NW7A 4FC0A 2R0UA 4FUYA 1W82A 2XZSA 4H58A 4UV0A 3FXWA 3CGOA 5DIAA 4H05A 2VX3A 2XA4A 2XKFA 4JRVA 2P55A 3ROYA 1RW8A 2ONLA 4AS0A 4FL2A 4ZMEA 3OWKA 3EKNA 4PV0A 3CPCA 1Q4LA 2C3LA 3UIMA 3C4WA 3WBLA 4FV7A 4PTCA 2OW3A 1OM1A 4R3RA 4DBNA 3ZC5A 4DF3A 3NYNA 4PMPA 3HX4A 3HZTA 3KF7A 3AOXA 2JDRA 3P1AA 2E9UA 2BDWA 3HP5A 1IAJA 3E8NA 4BKZA 3OY3A 3QCSA 3IW7A 2G1TA 4DHFA 1UA2A 3QD3A 4WRSA 1GIJA 4JVGA 3SW4A 3DBQA 3KMWA 4LOPA 3QUEA 2YAKA 3LFQA 1OIYA 4IJ9A 4XG6A 5C9CA 5HO6A 3DBFA 3W55A 4AAAA 1OI9A 1JSUA 5HNIX 1BMKA 1ZYLA 5AX3A 2VWWA 2IVSA 4LI5A 2GFSA 2UV2A 4EUUA 4LV5A 3CR0A 3ZDUA 3D94A 4EH7A 3EFWA 2XM8A 4L45A 3EB0A 4AN2A 4HJOA 3LW0A 4J96A 2BIKB 5J9LA 2OWBA 4E5AX 5IA0A 3DOGA 3I6UA 3PYYA 5DLSA 1TKIA 2YABA 3AC4A 3ORKA 5JZNA 2WTKC 3TZ9A 5CYIA 5GZ8A 5IQIA 3DT1A 4KA3A 1PMUA 5CNOA 3ZFYA 3FE3A 4YJSA 2V7OA 3OS3A 1CMKE 3TDVA 4D4SA 4R5SA 3KVWA 2XH5A 1PXMA 3PG1A 4TNDA 5JEBA 2BZJA 2XVDA 4IX3A 4DGNA 4APPA 3H3CA 3D5XA 4RC2A 4BC6A 1X8BA 4GFOA 1G8AA 3PWYA 3QZGA 3GCVA 5FEEA 3UQCA 5FM2A 2XUUA 4M3QA 4Z9LA 4G9CA 3R8ZA 4IB1A 4MXZA 3HRBA 4OTGA 3MJ2A 1M14A 2YA9A 2G2IA 4X6RA 5H8EA 4BIDA 4DFYA 4LRMA 3PIZA 3ZLWA 4Y83A 2OH0E 5L6PA 3RP9A 4K0YA 3RGFA 3VS7A 3TCPA 2ITOA 3QQUA 4MNEA 4QMSA 1RE8A 4C3RA 4CLJA 5IQFA 3I7BA 2Y4IB 3KULB 3I4BA 4UYNA 3U9CA 3POOA 4U81A 5HVYA 5HIDA 2XNEA 3RWQA 4D1ZA 5CSXA 4GK3A 4AE9A 4ANOA 4A4XA 2J0LA 4BCJA 4QMXA 2W05A 4DH7A 4IIRA 3R63A 3I1AA 3EOCA 1PJKA 3UNJA 1I09A 3FZSA 4W4XA 4AU8A 3QKLA 2W4KA 4D4RA 4ZSJA 3NNWA 3H4JA 4ZP5A 2CCIA 2XYUA 1WBNA 3QRIA 3HV6A 2QOFA 3VUDA 4OGRA 3ORTA 4HVHA 3L9MA 4DFNA 5E8TA 3SG8A 3PZEA 4LG4A 4J71A 5A4CA 3W8QA 4FODA 3ZO4A 4ALUA 5A4EA 3MSSA 5AX9A 5GINE 3PP1A 5AM7A 3R0TA 4RWLA 3T3UA 2Y9QA 3AT2A 5HGIA 2HXLA 4GV1A 5J5TA 5M4CA 2OFUA 4DGOA 4HVGA 2QOQA 5AUXA 3QX4A 3OT3A 4FZ6A 4GYGA 1GIHA 4LMUA 5H2UA 3RM7A 3R9NA 1G5SA 3CQEA 3AT4A 1SM2A 2GS6A 4FT5A 4CLIA 5LMKC 4FIFA 4FZ7A 5KZIA 4EZ5A 4D0XA 4C58A 2P2HA 5BVWA 2I0EA 5JFSA 2V0DA 4BCOA 4B99A 2IG7A 5A9UA 3GEQA 3VS3A 3OUNB 3V6RA 5M56A 4EC9A 3UO5A 5L8KA 3AXWA 1JKSA 2HAKA 5CANA 3PRFA 3UP2A 3G0EA 4HZSA 4NK9A 4XG7A 4AZSA 5A4LA 4WBOA 3EL7A 5HLNA 5L8LA 1YWVA 3O23A 1OBGA 3IECA 2JDVA 3KQ7A 3WZDA 4DAWA 4BR3A 2ZM3A 2GS7A 5E7RA 3PWDA 3DJ7A 2OSCA 2QOLA 4EC8A 4M12A 4O7RA 4YTIA 4EYMA 3SG9A 4P4CA 1KE5A 3PSDA 1APME 4NTTA 4G6OA 2WMSA 4I22A 4CV9A 5IDPA 1MUOA 5HNBA 5JRSA 4C62A 2QKWB 2VWYA 3AMYA 3FKLA 4JBOA 2DUVA 2PMOX 2W5AA 4QD6A 3S0OA 3AMAA 5F94A 4EQCA 5A4QA 3OBJA 5EW3A 5E1SA 4H36A 3FKOA 2ZDTA 3I5ZA 4MAOA 3R7VA 3P86A 3QTXA 5CU6A 1WVWA 3F82A 3GC0A 4RIWA 4Y95A 3UMWA 3VWAA 4UX9A 4N0SA 4M13A 4UYAA 3V51A 5FXSA 2WU6A 3C4ZA 3VJOA 4E6QA 4FG8A 4XOYA 4JS8A 5IUGA 2CJMA 3DZQA 4E6AA 2VRXA 3MESA 3S95A 4LGDA 5H8BA 3DXPA 4CCBA 3FC2A 5K5NA 1RDQE 4YO4A 1YOJA 4WNOA 1WFCA 5KUPA 4X21A 3CIKA 3HYHA 3BELA 5AIKA 5BYLA 4DFUA 3B8RA 3TL8A 4TYGA 3C1XA 2C5NA 4Q5HA 2IPXA 4DT9A 1MP8A 5DEYA 4AGDA 2WOUA 3QQJA 2PTKA 3ZFMA 4RWJA 2J0JA 3T3VA 4MD7E 2BUJA 2W1GA 3QD0A 3FAAA 5IPJA 2X6DA 1FOTA 3FPMA 4F6UA 1MQ4A 2C4GA 4FV1A 4CFUA 2O65A 3VBXA 1I44A 3MVJA 4X2FA 2UW6A 4AW5A 4O1PA 2ITTA 3QC4A 4EJ7A 4UB7A 4FYNA 2R7BA 3BI6A 5GIOE 1U46A 3R1NA 4YJTA 4D1SA 4ZOGA 5EQEA 5I9ZA 2EU9A 3ITZA 4RWIA 3Q2JA 1HCLA 2R3LA 3C7QA 3HV7A 3OEZA 3P7BA 3UVPA 3VUGA 5AWMA 2Q83A 3IGGA 4OT5A 4U5JA 2QO7A 1E9HA 2X7OA 1H25A 4XG8A 5AR2A 2BRGA 3TZ7A 5A46A 1RJBA 3SDJA 4EKKA 4K6ZA 4O22A 3UIXA 3OMVA 3DKGA 3FLQA 3KN6A 3U8WA 5ANIA 5ICPA 5HKMA 4F6SA 3CSVA 4JR3A 4L3LA 2YWPA 3LFSA 3EN7A 3AC2A 4FSQA 2CKQA 3L9NA 3OG7A 5DE2A 4EOQA 4FEUA 2UZWE 3K5VA 3QLFA 4PP9A 3RPOA 5HX8A 4BI2A 2PMIA 2NRUA 3PPZA 5CF4A 4FMQA 5M51A 3S4QA 2JGZA 4F7LA 4IM3A 2XCHA 2WMQA 4KRCA 5F20A 2OXYA 5JK3A 4ARKA 2E9OA 3ROCA 4UXLA 3TKHA 5LVOA 2ZM1A 5IA4A 4LOOA 4PPAA 2PK9A 3UGCA 1KUTA 5B2KA 5K5XA 2OO8X 1M2RA 5FG8A 3NDMA 5HO8A 5CU0A 4PY1A 5I9VA 4U6RA 5LOHA 1PRYA 4HYSA 5LMAA 4XRLA 4AZTA 4BDFA 4KNBA 3ZONA 5HG8A 3NUPA 3RPRA 4PDPA 4QMWA 4FEWA 4KSPA 4HOKA 3CQUA 5CT7A 5M09A 5JFWA 4PPBA 2B4SB 3Q96A 5IF1A 3VUIA 2GNLA 3NPCA 3QAME 3ATTA 1JKTA 3HUCA 4KIKA 2HENA 5HG9A 3ALNA 4M66A 5J8IA 4NEUA 2PVRA 3E88A 3KXNA 4GT3A 4QYYA 3UZRA 4G1WA 4HPUE 2B1PA 4R3CA 2C6IA 4Z3VA 5M4UA 3BYVA 4WNPA 4ZSGA 5AADA 1IA8A 4EHVA 3PPJA 4HCTA 1SVHA 3VBQA 4OW8A 4CT1A 5ETIA 2R5TA 4JNWA 3HVCA 2BDFA 5I3OA 4D55A 4ENXA 2NRYA 2QHMA 1QPJA 3MVHA 4ALVA 3FLYA 1OL5A 3M1SA 4YSJA 3ULZA 1B6CB 5FXRA 4EI4A 1VZOA 3KCKA 3AGLA 4YPDA 4AT3A 3AD6A 2BRMA 4KINA 3GCQA 2CN8A 4XMOA 3DU8A 3VUHA 3RPYA 3BV2A 3QQLA 1YOLA 3R7GA 4GW8A 1OITA 2X6EA 5AP5A 2PZYA 5EM6A 4OAVB 4R7BA 4FTNA 4F1MA 3V5PA 5IZFA 2O3PA 3NIEA 4QP2A 4EJNA 5L8JA 4ZZOA 3QX2A 3R73A 3NSZA 4UN0C 4QYFA 3OVVA 4AT5A 2WHBA 5IEVA 1L3RE 2A0CX 2FSMX 3Q5ZA 4YJOA 5AAFA 4HVIA 1WAKA 3F3TA 3TG1A 3H10A 2KULA 3IDCA 3IG7A 4U3ZA 1FMOE 5B7VA 3PLSA 3D5WA 3IKAA 4FOCA 3IDBA 1BL6A 2VTHA 3V8SA 4NM0A 4H1JA 2XK4A 5DGZA 5AA9A 3DXQA 3F66A 2YCFA 5E8WA 5HBEA 3BQRA 3K3IA 5A54A 4MVFA 5HIEA 5L2TA 5HVKA 4LFIA 1JOWB 2BCJA 4NL0A 1YXXA 4C61A 4JI9A 4YHTA 5AV1A 5AV3A 2JDOA 3DLSA 2HOGA 4EQMA 3QHRA 4IB3A 4CFWA 3HA6A 4LMNA 3KK9A 4RT7A 3ZS5A 4E6DA 4BDDA 4S34A 5CVFA 4DG3E 2BR1A 3F2AA 3WZKA 2XNOA 5KMKA 4APCA 4D5HA 4KIKB 3LMIA 4B9DA 3OEFX 5FQDC 4UWCA 2HELA 1CSNA 4C38A 2I0VA 2XK8A 4FUXA 4FICA 3SD0A 3FLSA 2YEXA 4D0WA 4BIBA 2B9FA 2WO6A 3PP0A 2OICA 3G9LX 4W4VA 3VN9A 4BZOA 3ZRKA 4EOSA 2OJGA 3AD5A 5CEQA 4USEA 4ONAA 3NAXA 5C8KA 2C5VA 3BZ3A 3BYUA 4F1OA 4OTPA 4NKSA 4P5QA 2OFVA 3LOKA 5GNKA 4BTJA 4KBKA 3ZLXA 1PMVA 2PE1A 2FUMA 4DH5A 4Q9ZA 2XK3A 4F4PA 4ZLYA 1Y6BA 1Q41A 3FBVA 4EOLA 4TY1A 2UZEA 4RA4A 5FTOA 3FC1X 3WYYA 4QMQA 5J87A 5IH5A 3LCDA 3ZCLA 3UYTA 2XK6A 3V5TA 4ZK5A 2YIXA 3EHAA 3E8CA 4M0YA 3ZUUA 5CXHA 3U87A 5TT7A 2GHGA 3MW1A 4KRDA 4KIQA 3A61A 4MBJA 4I41A 5HQ0A 3TV4A 3DXNA 3ZLSA 2GFCA 1XHAA 3EN6A 2R3HA 5FDPA 1T46A 4K11A 3JXWA 5LCJA 4H1MA 3OD6X 3SXSA 3UO4A 4USFA 4NYEA 2UVZA 3NYVA 1OGUA 1XBBA 2WTVA 1DI9A 3F5PA 3D4QA 4FTIA 1VJYA 4H3BA 1OKZA 4QPMA 3V5JA 4CZYB 4DITA 4P90A 5LMBA 2IVTA 3RM6A 2I0HA 2YWVA 4FEQA 4FSMA 4DCAA 3I5NA 4BY9E 1ZYSA 4PTEA 2VWUA 4MF1A 1Q99A 2QKRA 1U59A 2HZ0A 2PZRA 4FI1A 4I6FA 2XB7A 5EHLA 4C4IA 5FP5A 5IEXA 2WGJA 2DYLA 4X3FC 3EN5A 5KE0A 4HW7A 4JQ7A 4NW5A 5AIRA 2QI8A 2GCDA 3UOJA 1WBTA 2PUNA 3NVMB 1KOBA 1P14A 2GHMA 4QQCA 1KE8A 1KV2A 5TF9A 3W2CA 2O0UA 3I79A 4IVDA 2ZB0A 2DWBA 1Q8YA 1ZWSA 5G6VA 4PL4A 2JKKA 4IM2A 1H08A 2V7AA 2VN9A 5B2LA 4ZXTA 2PE0A 4DH1A 2XNMA 1H1WA 4ZTLA 4UMUA 2E9PA 2UZBA 4YJNA 4YBKA 2XM9A 4MEDA 5CF8A 4AGCA 4IVCA 3BIZA 4QYHA 2OJ9A 3E63A 3MPTA 4K2RA 4QTDA 4ZSLA 5H3QA 1PHKA 1UU3A 4FTJA 4O86A 2P33A 4MKCA 4IVBA 3NR9A 4RPVA 3CS9A 3Q04A 5IUHA 2I7QA 3IOKA 3KRJA 2C68A 3O71A 2GNFA 4IMYA 4L7FA 3T8OA 4CMOA 3O2MA 3U6IA 2G9XA 3QTWA 3EFKA 4I23A 4UBAA 2GDOA 5HCXA 4RA5A 1NVQA 3AQVA 1VYZA 2CN5A 2YCRA 1BKXA 3G90X 3LVPA 4FK3A 4G3EA 4EOOA 5BUEA 2ZV8A 4GJ2A 3CP9A 2C1BA 5JGDA 1IG1A 1YI6A 4C8BA 3I81A 3AD4A 3R22A 3QRUA 4LUDA 4GMYA 1CKPA 1WZYA 2UW8A 4PTGA 5DRBA 3IDPA 4DE4A 4PMMA 2VO6A 2WKMA 5BYZA 3TIZA 5CZHA 5I9YA 3PRIA 3TNQB 2QQ7A 4QP6A 5K4IA 4KKEA 1PXIA 3BU3A 2XEZA 4KSQA 3G9NA 2OU7A 3ZYAA 3R7YA 4MXAA 4O84A 4XV2A 3B2WA 1XH8A 2XBAA 1ZMWA 4USDA 4FTKA 4EEVA 3D83A 2W5HA 2VTNA 4YC6A 3LFNA 3CCNA 4FV3A 1KOAA 3FXZA 4C7TA 1T45A 5A6NA 4O7ZA 5F4NA 4RFZA 1YDRE 3FQEA 2UZOA 3GU6A 1F3MC 3BU5A 4H3QA 2PVYA 2F2CB 3WF5A 4EOMA 2ZB1A 4JOAA 3QLGA 4UY9A 4GIHA 2OJJA 3F3VA 4AG8A 4JX3A 3D7TB 3EFJA 5IEYA 4W4YA 4Z55A 2O64A 3E64A 5IQDA 3L1SA 3VS6A 5CXZA 2W1CA 3GC7A 1YDTE 2BALA 3DB6A 4PRJA 4IAAA 1P4FA 2X2MA 4JG6A 4IFGA 5HVJA 2C6DA 3O17A 4LGGA 2X8DA 3MPMA 2OIQA 3LXLA 5TKDA 3FMLA 3LM5A 1OIUA 2CNQA 3IPHA 5EW9A 4GT5A 3A7IA 4YURA 3Q9YA 3KXZA 3MVLA 4NM5A 3GFEA 3DB8A 1WVXA 4Y46A 5AP3A 3BV3A 3RCJA 3UOLA 4C33A 3ZC6A 3ANQA 4S31A 3PIYA 3V04A 4G3GA 4AE6A 3IW6A 2B52A 3BHYA 4FX3A 4WG5A 4R1YA 5HCZA 3VNTA 1YXSA 2W5BA 4JDJA 5HZNA 2CNUA 4UEUA 3UPXA 2OJIA 3DPKA 2OG8A 2VTIA 3JS2A 4CMUA 2OZAA 4LGHA 5KKRC 4BCFA 4XLVA 2WMAA 5K3YA 4AW2A 1SVGA 3NIZA 3BEGA 3EN4A 5FBOA 3O7LD 2RF9A 1ZMVA 1E1VA 3MTFA 3QRTA 4I92A 2BAQA 2OGVA 3G2FA 2C0TA 3NUNA 2P2IA 4GH2A 4XG3A 5B0XA 4WRGA 4ITJA 2RFSA 3ODZX 3HUBA 4NIFB 3ACJA 1Y91A 3DKOA 3WF9A 5EQPA 3MIAA 5JKGA 4FV8A 2UW5A 2W06A 5HTCA 2PVJA 3LFAA 4GK4A 5IA2A 4BN1A 3EIDA 3L8SA 5CWZA 4CMTA 5HCYA 1ZYDA 1BLXA 3ODYX 2WMBA 4EK4A 4ZJIA 4FIGA 3D14A 4M14A 4O7YA 4FNYA 5KMIA 4QYGA 2WB8A 4ZY6A 5CALA 5ANEA 1QCFA 3MH0A 3G15A 2EUFB 2IWIA 4WT6A 5CI7A 3WE8A 3GNIB 2CKOA 2WPAA 3CLYA 2DS1A 2X81A 2WEIA 4GJ3A 4L46A 2VO0A 3KXMA 4IANA 5AUUA 3F5UA 4C2WA 3CTJA 2PHKA 5HE3A 3OY1A 3R1QA 3BGZA 2UZTA 5HNGA 3SHEA 4RC3A 3N9XA 3ZU7A 3RPSA 3S2PA 2CMWA 2ERZE 1TQPA 3ID6C 2W9FB 4EOPA 1J1CA 2QR7A 5J79A 4RC4A 5IA5A 5LCKA 1Y8YA 3RJCA 4UZHA 5E91A 3REPA 2YDIA 2VNWA 4BCKA 4I4FA 4CKRA 3FKNA 1GOLA 3EYGA 5AV2A 5AUTA 2FA2A 2GQGA 5JRQA 5AP7A 4O0VA 4NM7A 3O50A 3ZO3A 3QYZA 3DKFA 4IAFA 3MVMA 4QMNA 5IQEA 2EXEA 1OIQA 4G31A 2PMLX 3OXZA 4O0WA 3GUBA 4YLLA 4ZTHA 3TEIA 3WI6A 3DJ6A 3WZEA 5C8NA 2O2UA 2E9VA 2CGWA 3TXOA 2R2PA 5KMNA 3NW6A 2X7GA 4PF4A 4BWXA 3VS2A 3TNWA 4AUAA 2J4ZA 4CSVA 3GOKA 3LCKA 5HE2A 4O38A 3B2TA 2UVYA 4CCUA 4DTBA 4C4JA 3EMGA 4E26A 3KXHA 1BUHA 4O7SA 2I40A 2G2HA 1CKIA 1UNLA 1BYGA 2V22A 3A8XA 2J9MA 3BE9A 3PG3A 4TYHB 5AR7A 3UYSA 5BMSA 3DFCB 3OUKA 2Z02A 4PDYA 4I4EA 2JFLA 4KD1A 4F7JA 5JN2A 3WIGA 4C35A 5DR2A 4E4LA 3LZBA 4EK5A 1KWPA 2C0IA 2GTNA 2QOOA 3ALOA 3QCYA 3WZUA 4AX8A 1J7IA 1NT2A 4CGAA 1EH4A 3HDNA 4LOQA 4I24A 2XIXA 2YCSA 2DQ7X 2JKQA 1SYKA 3MH3A 2YITA 4XV3A 3FZ1A 4M97A 3T9IA 1SNXA 4AT4A 1JSTA 3C5IA 1BI7A 1JVPP 2HXQA 4BFMA 3FQSA 4GVAA 2C3IB 4M69A 3ZHPC 3P08A 3RHKA 3LFEA 3ZRMA 5E4HA 3A8WA 4OTQA 2IW8A 4IZ7A 1JKKA 3KRXA 3WF8A 4EH9A 3Q4ZA 3DDPA 4QYEA 5LMKA 2V62A 3COMA 4FKRA 5ACKA 2Y4IC 4FTRA 4FTLA 4QMMA 4PNKA 3RPVA 4R77A 2WTKB 5E8XA 4C3PA 3SRVA 1OVEA 4J95A 1O6KA 2PVHA 3KRWA 3L8XA 3HAMA 4GYIA 5CAVA 1JPAA 3R6XA 2Y4PA 3R8UA 1M17A 3D9VA 3ENHA 3OT8A 4J97A 4PWNA 4C4FA 4DEHA 4E4XA 4FV9A 3ZFXA 2BTSA 2GU8A 2NP8A 3GC9A 4I0SA 4YZ9A 3A7GA 4R8QA 1ZARA 5L2IA 4Z7HA 2REIA 1W84A 3F5XA 4BTFA 4ZZMA 2NO3A 2VGPA 2H96A 3A7JA 5E90A 3E3BX 2WQOA 1H1QA 4FSWA 4CYJA 4DLJA 5IMEA 4AA4A 4KWPA 2ETRA 2VTPA 3R1SA 4O6EA 4UALA 4EHGA 5AUZA 4L3PA 2HK5A 4QMTA 2V5QA 3MY0A 4F7NA 5CAUA 3GOPA 4FT0A 5L2SA 2PU8A 1ZXEA 4MXOA 3R01A 1OECA 4D2VA 3BRBA 4TPTA 2YM6A 5DEWA 2X9FA 3C50A 3W18A 1VEBA 3TTIA 3E8DA 1F5QA 4X2KA 2RFDA 3EH9A 4C4HA 3ZBXA 3LCSA 1AQ1A 1P4OA 2ERKA 2F49A 2QLUA 3VS0A 2QHNA 2ZMDA 4IX6A 2VWZA 4D28A 4EWQA 3HMNA 2YM4A 4IEBA 4JIKA 1OB3A 1LEZA 3FZPA 3EQDA 1GZOA 1ZYJA 2YLEA 3E92A 3LM0A 3UOHA 2XKEA 5TOZA 4QOXA 3PVWA 1VR2A 1TVOA 4O0XA 3VQHA 3UBDA 5IUIA 4S2ZA 3VS4A 3PXRA 2OK1A 5GJDA 2WZJA 4AWIA 4MWIA 1B38A 4DH8A 3QGWA 4RIYA 1OUKA 3CY3A 2IO6A 5HD4A 4O91A 3MB7A 1XKKA 5DPVA 3ZM9A 3CBLA 5KMMA 2XCKA 5AUVA 1DM2A 2UUEA 4FTCA 3SKCA 4AA0A 4DH3A 3NAYA 4F64A 2QU5A 1CTPE 1MQBA 2QOIA 3CJGA 3PY3A 2RGPA 4FKUA 4JBVA 4ERWA 4BVUA 2J50A 2XKDA 1FINA 5L2WA 1H07A 4FG7A 1UKIA 4FR4A 2QONA 4MH7A 5BMMA 3UQFA 4BHNA 2J5FA 4GT4A 4AXAA 1L8TA 3N51A 3PXQA 1WMKA 1FPUA 1W98A 5E1EA 5EI8A 4AP7A 1BX6A 5GZAA 5ANKA 2I6LA 2J6MA 2Q0NA 4R7IA 2PUUA 5LARA 3EZRA 4DEBA 4DG2E 3UNZA 4OTIA 4OBQA 3CTHA 2HZIA 3ORMA 5M06A 3E93A 4QNYA 4WG4A 2YIYA 3SRVB 1DI8A 4MNEB 3F7ZA 3RI1A 4RRVA 3ET7A 4FKWA 4FVPA 4F7SA 3R7UA 4PDSA 1IA9A 4AFJA 5B2MA 2JFMA 2Z7SA 1R0EA 4QQJA 4RBLA 2VWXA 4CV8A 4X2NA 3FUPA 2JIVA 4ZLZA 5HORA 4WA9A 3PJ1A 4JXFA 4DEEA 2AUHA 4FZDB 4QP8A 5CSWA 3PPKA 3Q4CA 4CTCA 4BCNA 3U4UA 4BDHA 5J7BA 1CDKA 4RJ8A 2CCHA 3QUDA 4ITHA 2PSQA 3LIJA 5HEZA 4O1OA 3UMXA 3BCEA 2XK7A 2ITUA 2PE2A 3OWJA 2PPQA 5BNJA 4KS8A 4BL1A 2A2AA 3ZZWA 3NWWA 4CKJA 3N4VA 2O8YA 1JSVA 2X4ZA 4C2VA 3SC1A 1PXKA 4G17A 4DFXE 3UP7A 3AC1A 4Y72A 3BYOA 2O5KA 2J0MB 2QNJA 3HKOA 4ANNA 3NX8A 4BZDA 2J5EA 4E6CA 4BYIA 4GUEA 5EFQA 3DCVA 5FM3A 4O27B 5HD7A 5DH3A 2YIRA 1ZY4A 1OL6A 3C4EA 3H30A 3NYXA 4OTRA 5DI1A 4HVSA 2UW4A 2B0QA 4O7LA 1P2AA 4RMZA 4KIOA 4WNMA 2FO0A 4K9YA 2B55A 4YPSA 1UNGA 5HO7A 1OIRA 4PX6A 4NFNA 3IQ7A 1H00A 4U80A 3VUTA 2UZLA 5EYMA 4CQEA 3HL7A 4HYHA 4JX7A 1V0BA 1SNUA 3G6GA 1E1XA 4DINA 1M52A 4G2FA 4F9CA 5C4LA 2A4LA 4XG4A 5I4NA 5AMNA 2JBOA 3SAYA 2C0OA 3ENMA 4JIAA 2QG7A 4H3PA 3WZJA 4S33A 4U42A 4MQ1A 4YJVA 3NNUA 4IADA 3V5LA 2R3KA 1UWHA 3PA4A 3UVQA 3KXXA 4J52A 4NCTC 3W10A 3I6WA 4EH8A 4ZJVA 5CQUA 4DEDA 4E73A 5K4JA 4R78A 2W7XA 4U44A 1PKGA 3EQBA 4FKQA 3CKXA 1PXLA 4KBAA 2HIWA 2X8EA 5CSHA 5KZ0A 2FSTX 3UZPA 3Q4UA 3ZO1A 3MGYA 3R71A 1Y6AA 5E8UA 5DR9A 2BVAA 4RIWB 5C03A 4A9TA 5EYKA 2RL5A 3RAKA 4IZYA 1Q61A 2EXCX 3UOKA 4L68A 3QXPA 5DN3A 3VBVA 2WMWA 3OOMA 2B53A 5H9BA 2Z7RA 2OJFE 4D1XA 3VRZA 2OIDA 4RVTA 4IAKA 4TYIA 4ZAUA 3TT0A 3R7EA 4YNEA 5IH6A 2R3QA 3VQUA 4FV2A 1ATPE 4I0RA 4JLCA 4FA2A 5BX0A 3C4FA 4YTFA 3D5VA 4FTTA 2HWOA 4CRSA 4MXYA 4F09A 2ZOQA 4O83A 1GAGA 4YLJA 3SXFA 2B9JA 3KF4A 2W1FA 3QC9A 2RSVA 5FTQA 4GCJA 2WFYA 2PVFA 1KE9A 2O63A 3C0IA 4O0UA 4EH3A 3O96A 2YM3A 1ZZ2A 4U40A 2PZ5A 3K2LA 5HHWA 2R0IA 3FMDA 1Q3DA 4E4MA 3IW4A 2X7FA 4OUCA 5EH0A 4D2WA 4EHZA 4FT9A 4JDHA 5LWMA 4TWNA 4KBCA 1XBCA 4QT1A 3QD2B 1STCE 2WQMA 3R9HA 3RAWA 3BQCA 2SRCA 1FVRA 4IWPA 3DFAA 4OBOA 5HE0A 2OZOA 4F0GA 1QMZA 3FZRA 4S32A 3BEAA 3LFBA 3VVHA 5HLWA 4DFZE 2RFEA 4IDVA 5KCVA 4XYFA 5CEMA 5LVLA 5AUWA 2XNBA 3LMHA 1YI4A 3PVUA 3ZXTA 4DEAA 3EYHA 2XK9A 4BDGA 3VS1A 5EKNA 1ZYCA 4GFMA 3DY7A 2J7TA 2UW7A 3GQIA 3VF9A 3QGYA 4O7VA 1QPDA 4EZ3A 3QKKA 3DDQA 3PVBA 2GPHA 4IAYA 4EBVA 4UMPA 2F7EE 2F7ZE 3G6HA 4CT2A 2P4IA 2YDJA 2PL0A 3VBWA 3L9PA 3V8TA 1H01A 3ELJA 1WVYA 2QCSA 4DGGA 5FEQA 3ORIA 3BX5A 1Z5MA 2I0YA 3L9LA 3LPBA 4Q2AA 3VW8A 4E4NA 4K18A 2C5OA 4HCVA 2C30A 3HV4A 4U8ZA 2CGVA 1K9AA 2E2BA 4FIJA 5CAQA 3TNIA 4Q5EA 5A6OA 5IH4A 3HECA 3SVVA 1U5QA 4UMTA 2V55A 4IWOA 2AC3A 3KRRA 3QALE 3FYJX 4MXXA 2XF0A 2YIWA 3ORLA 3TKIA 5F95A 1XR1A 4G3CA 3UZTA 4FSZA 4FSYA 4FV0A 4YO6A 5AFVA 3EQHA 1YXTA 2VTOA 4J53A 2BZHB 2QO9A 2PMNX 3IS5A 3CE3A 2VX1A 3QA0A 2W1DA 3COKA 1H24A 3BHUA 4YLKA 3TWJA 1J7LA 3R8LA 1J1BA 4WUNA 3Q60A 1YWRA 3O8PA 3R2YA 2VUWA 1GIIA 3D5UA 3LMGA 3KA0A 4W8DA 4F70A 3N4UA 3Q9WA 2FVDA 3FQHA 4D2PA 4FV6A 5HU9A 1NVSA 3MV5A 3O0GA 4X2JA 3DK7A 5DVRA 4AN3A 4F99A 1M2QA 3R00A 3LLTA 4XS2A 3IW5A 3NEWA 1YRPA 5EOLA 4X3FA 3T9TA 1JLUE 3LJ2A 2QD9A 3R04A 4FNXA 2R7IA 4HVDA 4CVAA 4AN9A 4EH4A 5HU3A 3QCXA 3M2WA 4GUBA 4IE9A 4MNFA 4E93A 3BYMA 4FBXA 3A99A 3ACKA 3C4CA 3Q32A 3OP5A 4NW6A 5CX9A 2Q0BA 5IA3A 3CGFA 4ACMA 4B8MA 2A1AB 3WOWA 2R9SA 4MTAA 4EQUA 2UW0A 5TR6A 2XJ1A 2WTJA 3FZOA 4G5JA 3IOPA 4FTAA 5LVMA 3KMMA 5E8SA 4D4VA 4LV8A 3KCFA 2LAVA 4BKJA 1Z9XA 1V0OA 3FLWA 3TDWA 3R28A 1W0XC 3ZSGA 1NA7A 3DKCA 3QQFA 3MIYA 4I93A 4ANQA 5CEOA 4J98A 1ZMUA 2WIHA 1S9IA 4QP4A 3LLAA 3NUAA 3JR1A 1PYEA 4JL9A 4V04A 3UC3A 3OHTA 1YWNA 2HW6A 3ZRLA 2VTTA 5IISA 4XUFA 3HEGA 1XH6A 5A4TA 1KE6A 3SQQA 3TV6A 4RVKA 5DYJA 5EHOA 1AD5A 3V5WA 1FBNA 3KEXA 5TE0A 3R83A 3QFVA 3BWFA 5JZJA 4KUJA 3HA8A 5C4KA 1FGKA 3BPRA 2WD1A 3PJ3A 4Y73A 3E7VA 4U9AA 3ATSA 4LQMA 1BI8A 5LVNA 4U97A 4FGRA 4TT7A 4YJQA 4M67A 3CPBA 3EQFA 5AR4A 3TNHA 2NPQA 2CDZA 5BVOA 4GS6A 4A9YA 5AP6A 3BLRA 3VIDA 2OH4A 2PZPA 2IN6A 2UVXA 3AG9A 3ULIA 4XCUA 5ITAA 4UXQA 3UE4A 4O0RA 3ZLYA 1YQJA 2XYNA 1H0VA 1S9JA 1UU8A 3S3IA 4X3JA 5AP0A 4BCQA 3PUPA 5E8YA 3ZEPA 4JRNA 1O9UA 5T6KA 2P3GX 4C34A 4DEIA 5K9IA 4NJDA 1M7QA 4RVLA 1PY5A 2PVMA 4O7TA 4AW0A 4BKYA 4FVQA 5EQYA 2XNNA 3VW6A 2VO7A 4K8AA 3ZMMA 2Z60A 4FTQA 1YOMA 4IXPA 1M2PA 3H0YA 2IVVA 3F3WA 1OL1A 3NW5A 3OXIA 3UJGA 5AUYA 3BHVA 4IAIA 3LAUA 3W16A 3KKVA 4OLIA 4HYUA 4X3FB 3PIXA 3D2IA 4TYEA 3R21A 3WILA 1J91A 2C6LA 3MFTA 3D7ZA 2YHVA 4FZAB 3S1HA 2ESMA 2R3IA 3RZFA 4IZAA 5FLFA 3DGKA 1NW1A 5FGKA 4QMLA 1UU7A 1W83A 4FKLA 3A7FA 4N6YA 5HESA 2WMRA 4TWPA 5EYCA 1ZOHA 3Q52A 5ACBC 3MDYA 5C8MA 4Y5QA 4N57A 3VHEA 1F0QA 4WD5A 2LGCA 4MD9E 3FL5A 3P79A 4ANLA 5IG1A 2RKUA 1ERKA 3E5AA 3ETAA 3GCUA 3LCTA 1QPEA 3BHHA 2A27A 3PFQA 4GIIA 3R9OA 3SOAA 4TNBA 3ZH8A 5AR5A 3QRKA 1YXVA 1DS5A 2ZM4A 4O6LA 4TZRA 3GFWA 4PDOA 3GP0A 1PF8A 4EK8A 3FMJA 2KTYA 4N4SA 5HE1A 3BYSA 5IQAA 4C0TA 4J1RA 3EZVA 1FGIA 2XRWA 3PJ8A 3QTRA 4TXCA 4BBMA 3VC4A 3IO7A 4O0TA 2F57A 1KE7A 2ITYA 3KC3A 5DA3A 4ZTRA 3UIUA 4FKSA 3RBWA 3QTUA 3PZHA 2BKKA 4YR8A 5F9EA 2FH9A 2GNGA 2R3JA 3C5UA 3AGMA 2VWBA 2R64A 3GI3A 1A48A 2YIQA 5EK7A 1SVEA 4DFLA 1SZMA 3DBCA 4L01A 4CFXA 4W9XA 2RG5A 2XIZA 2BRHA 4MHAA 4QMPA 3ZXZA 5K0XA 4FVRA 5DMZA 3R1YA 5ETAA 2F7XE 3FSKA 4Y8DA 4D9UA 4YJRA 1GJOA 3RK9A 2A19B 2G01A 3P78A 4FSTA 4QMVA 4XV9A 4JDIA 1NVRA 3D2KA 4WNKA 3PY1A 5CSVA 2CGXA 3QZHA 2AYPA 4I6HA 3TNPC 3UDBA 3O7LB 4QTAA 5CSPA 4V05A 4HZRA 1PMNA 3P4KA 5IQGA 4YTHA 2WEVA 3LQ8A 3TJDA 4BYJA 1Y57A 3GU5A 3JPVA 5L6OA 3HAVA 3QZIA 5FXQA 2XKCA 5EI6A 1CM8A 2GNHA 5FRIA 4ZJJA 4Z16A 3QU0A 2J90A 3II5A 2JKOA 4RIOA 4PMSA 3E7OA 1LP4A 4TL0A 3F3ZA 5HTIA 4D2TA 4GU9A 4D2SA 4XX9A 1FVTA 3FMNA 4U41A 4NH1A 5L2QA 2EXMA 5CEKA 1JNKA 1OKWA 2WMXA 4NKAA 4ASDA 5JGAA 3JY0A 5EDPA 4O7NA 1NXKA 1H8FA 4QPAA 4D2RA 3HRFA 4U3YA 2Y7JA 4JQ8A 4O82A 4PQNA 5T3QA 5CF6A 3V5QA 4IBMA 5GHVA 1JAMA 1HCKA 1JQHA 5EOBA 3ORNA 4HGSA 3H0ZA 4LL0A 5DR6A 3ORXA 2H6DA 4CRLA 4I3ZA 3PXYA 3UTOA 1R3CA 3IGOA 4YTCA 5HBJA 2HY81 3DV3A 4IHPA 5M53A 4BBEA 1H0WA 5JQ5A 5EKOA 4CZTA 4I20A 4IW0A 4JT3A 4L67A 3VS5A 3LHJA 1YVJA 4B7TA 4GK2A 2R3NA 5CZIA 3HMOA 4ANSA 4DEGA 4DCEA 4F63A 3FY0A 2C6EA 4G3DA 4V01A 1ZRZA 4OT6A 3HDMA 5C01A 4ANBA 2JIIA 3IONA 3UG2A 3PE2A 3WF7A 2VU3A 5I0BA 4PL3A 4AACA 2BROA 4E5WA 5HI2A 3CY2A 5KHWA 2X1NA 3E87A 4QMUA 5ANDA 3EKKA 4DTAA 2BAJA 4EOIA 1SMHA 3BLQA 4BDCA 4L42A 3OBGA 2WTIA 2XNGA 3QZFA 4FEXA 1LR4A 4N70A 4AGUA 5BVFA 4HNFA 4WG3A 2VGOA 5CEPA 4RVMA 4GEOA 4EK6A 4CFFA 2C3JA 4E3CA 2ITWA 3AT3A 3EQCA 1XH5A 2JDTA 4JG7A 4C4EA 3DZOA 4I6BA 3OWPA 1Q8UA 1BL7A 4BRXA 3V8WA 3PY0A 4PPCA 2R3MA 2ZVAA 3BWJA 4QO9A 4F6WA 1M7NA 3HLLA 3VAPA 3QTSA 5AAEA 5AR3A 4IACA 4IWQA 1H1PA 4G5PA 3FPQA 3MY1A 4QTBA 3FHIA 3A7HA 3RKBA 2OF2A 5DT4A 3U51A 1Q24A 3MBLA 4IB5A 2WMUA 2OZAB 2WTCA 2HWPA 3QL8A 1G3NA 3BBWA 3OROA 5J95A 4CTBA 4N6ZA 4AOJA 5CTPA 4ANMA 2UW9A 4MQ2A 4NUSA 4EOKA 4L9IA 3U9NA 2VX0A 3FI8A 2FB8A 4BICA 4BB4A 3UO6A 2IVUA 5ANOA 4EK3A 5JFVA 3W33A 3TJCA 2OIBA 3DJ5A 3C51A 5ANGA 3D0EA 2BZKB 5ETCA 3R9RA 3I0OA 2W1EA 4GKHA 5BUIA 4ENYA 3EFLA 5BPYA 4WBBB 1GZ8A 3I0QA 3TI1A 3TTJA 4A9SA 5D10A 4F65A 5AEPA 3NUYA 3RZBA 3QHWA 4KABA 4DLIA 2ACXA 2H9VA 1PW2A 3GQLA 4YHFA 4A9RA 5AR8A 5M44A 4ZSEA 3MFRA 4FZFB 4J99A 4NFMA 1OKVA 3QA8A 4NSTA 4EBWA 2X9EA 4AZWA 4BDJA 3FJQE 3P23A 4ITIA 3SOCA 1W8CA 2C6OA 2Y8OA 3LJ1A 3GVUA 4XP0A 2VWVA 3SXRA 4K77A 3R8PA 3EQIA 3TV7A 4X2GA 3MB6A 3EL8A 1H1RA 2F9GA 2ZV9A 4FV5A 4FYOA 3DAJA 3KN5A 3VRYA 2EWAA 5IU2A 3DBDA 2H34A 3UC4A 5HIBA 2RIOA 4YSMA 2WTDA 3Q53A 3ZUVA 3CXWA 2J2IB 4BDIA 5GIPE 2EB2A 1A9UA 4FKIA 3DQWA 2IW6A 4ZLOA 2ONLC 3W8LA 4RFYA 4XNEA 5CU3A 5EM7A 4CFNA 3BE2A 1XO2B 4L7SA 4MD8E 2W1HA 4GL9A 1TQMA 3QWKA 4IH8A 4RFMA 4XG2A 2E9NA 5BVDA 4CG9A 5J7HA 3ZO2A 4YZBA 3TKUA 2W1ZA 3W2RA 4D9TA 4KKHA 3JY9A 3OF0A 4ACGA 3DAEA 4KB8A 2C1AA 2BHEA 4FGBA 3RVGA 3WF6A 3NUUA 4BZNA 2QC6A 4WIHA 4MX9A 1PXPA 4MXCA 5H8GA 4BDBA 5I9XA 3ZTXA 4EL9A 2YCQA 3VHKA 3KY2A 3PXKA 5D12A 1O6LA 3U6JA 3MA6A 2R3OA 4HPTE 5A3XA 3W32A 2OXXA 3PVGA 3BBTB 3W2SA 2VTMA 1IASA 4YZNA 4YNOA 4ZTNA 2CKEA 3Q5IA 1YXUA 4II5A 4G6NA 1WBSA 2JDSA 4M7IA 3LXKA 3KU2A 3DAKA 4F0IA 3ORZA 5FD2A 4ZTMA 1W7HA 3EJ1A 4UWBA 5EDRA 3FXXA 4C3FA 1A06A 2RFNA 1OZ1A 2J0IA 3COHA 3HRCA 1URWA 1MRYA 3Q2MA 4HGLA 4WSQA 4XP3A 2BMCA 3FMMA 3U4WA 3P5KA 3SW7A 4TWOA 3QRJA 1OBDA 1MRVA 2R3GA 2Z7LA 2CKPA 1ZOGA 3EQGA 3HMPA 3K3JA 2ZV7A 4G34A 3OW3A 3BU6A 1V0PA 3RALA 2CPKE 2Y6OA 5EYDA 4ZMFA 2JAMA 3H9OA 4F9AA 3HNGA 3UPZA 4W8EA 5IDNA 2JC6A 2WQNA 2WIPA 3FY2A 4YGAA 2EVAA 3ZSHA 1OPKA 2PYWA 1UU9A 4XG9A 3PA5A 4KKGA 4BHZA 2R3FA 2BRBA 5KMJA 3UQGA 2JEDA 3QTQA 4BDEA 4EWHA 4IQ6A 1MRUA 5C26A 4C57A 5FP6A 4IJPA 4M69B 4A4LA 4YC3A 2I1MA 1FMKA 3ORPA 1UV5A 3OCTA 3G33A 1JKLA 4EYJA 5IKWA 3WYXA 4QMYA 5J1WA 3BKBA 1XJDA 4I5MA 4IDTA 3NCZA 4BTMA 3OCBA 4AQCA 4C4GA 3CJFA 3MJ1A 4LRJA 2W4OA 1WCCA 2JKMA 4F08A 3MYGA 5E8VA 5D7AA 1XQZA 5EM8A 2YACA 1UKHA 4KIPA 3NGAA 4E8AA 2YM7A 4FIHA 2XIKA 1XH4A 4FKOA 1UWJA 2GS2A 4YBJA 2PVNA 2FGIA 3U54A 1PKDA 5J9YA 1XWSA 1IEPA 5IA1A 4OTFA 4YC8A 5K0KA 4ALWA 3TN8A 4A07A 3MFSA 4X7QA 4AF3A 4I5HA 2OF4A 4HYIA 3N4TA 3MWUA 4HGEA 3WARA 3R9DA 3THBA 1KSWA 2JITA 3TIYA 4XBRA 3PSBA 5KBRA 3Q9XA 3NRMA 4J8MA 4L00A 4NCTA 4EH6A 3QD4A 3LQ5A 3GBZA 3RNIA 4FG9A 5HG7A 3UIBA 4XP2A 4WUAA 4AOTA 5EW8A 4RQVA 2QOCA 4M84A 4FTOA 4LUEA 4XOZA 5CT0A 4F9YA 4PUZA 4G9RA 3UG1A 2CNVA 4JDKA 2W1IA 2C69A 3UVRA 2VV9A 3F88A 4RZVA 3CQWA 2ITQA 4ERKA 2BFXA 4RIYB 5M4FA 3DLZA 3GGFA 3NMUF 2WAJA 3FLNC 4ZS4A 3GCPA 5CEIA 2CHLA 2PUPA 3Q6UA 3P9JA 3RTPA 2HCKA 5HTBA 4QP3A 2YJRA 2WOTA 3LKMA 4I1ZA 1R1WA 4P7EA 3QCQA 2YM8A 3Q9ZA 1H28A 5FDXA 5CAPA 3FEGA 1TQIA 5HX6A 4IZ5A 3JUHA 4FKGA 4XH6A 3VULA 2WQBA 5LWNA 4OAUC 2GQSA 3F6XA 3NS9A 4F9BA 3V6SA 4Y5HA 3A4OX 4U43A 4C59A 4ZZNA 2OLCA 2IZSA 1JBPE 3MH1A 1FQ1B 4WKQA 1YKRA 2IW9A 4BDAA 4J7BA 5AJQA 2EB3A 1P5EA 2QOHA 5CI6A 5AV0A 5TO8A 3LQ3A 5CVGA 2GNJA 3FLZA 4NM3A 4UWYA 1YHSA 4L52A 4G3FA 1R0PA 5FBNC 2WMTA 2BTRA 3DBEA 3OTVA 4OTDA 4QTEA 4NU1A 3HV5A 3KB7A 3QQHA 2C6MA 3JVSA 3FZTA 1H26A 2H8HA 2HYYA 4LM5A 4YJPA 3F61A 5KMOA 5G1XA 4GG7A 4TYJA 4FKTA 1Q97A 3AC5A 4JBQA 2YZAA 3F69A 2W0JA 4GVJA 5A14A 5HG5A 3CEKA 3PA3A 4QTCA 2WMVA 4GG5A 5KBQA 4H39A 4JQEA 1G8SA 5BYYA 4TKSA 4U79A 5ANJA 5AP2A 3F2RA 4O96A 4BCMA 2C3KA 2X39A 2QOKA 4FSNA 5C27A 4P2KA 4E20A 3PLAE 4ZIMA 4P5ZA 3H9RA 4R3PA 1OMWA 4HNIA 4WSYA 5C1QB 4FT7A 4DBXA 2HZNA 2PVKA 1AGWA 2PWLA 4YP8A 3BHTA 3ZM4A 3QUPA 5D1JA 3RMFA 1REJA 4CKIA 4ZY5A 2Z2WA 5KHXA 2ZAZA 4FEVA 4QP1A 1OL2A 4FL1A 4IX5A 5DOSA 4QP9A 4I5CA 5DHJA 3LFFA 4CD0A 4C02A 5LXMA
chains in the Genus database with same CATH superfamily
2GHLA 3TMOA 4TW9A 3NLBA 3ZOSA 5I9UA 4E1ZA 2PULA 4Z7GA 3PFYA 4XBUA 3MA3A 3QXOA 3LXNA 4I6QA 4MBLA 5AV4A 5CNNA 4DTKA 1ND4A 4O4FA 2HY0A 1HOWA 2VTAA 1WBOA 2YJSA 1XBAA 3C9WA 2C5XA 3FSFA 4D4YA 2X0GA 2XIYA 1Y8GA 2XJ2A 2ETKA 3IW8A 4I21A 4CEGA 4F1TA 3OFMA 4CFMA 5L3AA 5GZ9A 5JSMA 4C37A 3LXPA 5JGBA 4FL3A 4Y85A 4RSSA 3C13A 2XRUA 4CG8A 4O7WA 3AC8A 1J7UA 4IAZA 5CS6A 4ZSAA 2RG6A 3EWHA 5L4QA 3PUFC 4RQKA 5FWKK 3R8MA 3OCGA 1GY3A 4F0FA 2ZJWA 1DAYA 2WU7A 4BWPA 2BAKA 4MK0A 4QQTA 2C47A 4A06A 2G15A 3LFDA 4M8TA 3O51A 3GENA 4FV4A 3K54A 2VZ6A 4CZUA 4EOJA 3PXFA 2YFXA 2ZYBA 2BHHA 1U54A 5M55A 3TM0A 5CLPA 3JVRA 3MFUA 2YISA 3KMUA 4V0GA 4AFEA 2PZIA 1XH9A 2UW3A 1YW2A 3FMKA 4UZDA 4X6QC 2BKZA 5T68A 4ZY4A 4GKIA 4ID7A 3NVKI 2FSLX 2ZMCA 3ZZEA 3VO3A 3NYOA 4R5YA 5E92A 2IZRA 4RJ6A 5FUTA 3OTUA 3R02A 3RWPA 3E62A 4FKVA 3SGCA 4A9UA 2XJ0A 2Y0AA 4ORKA 3W0NA 4FKJA 4G6LA 2QODA 3U6HA 3GXLA 3G0FA 2QG5A 5CVHA 5KMLA 1J3HA 4KS7A 3EQPA 2QURA 2ITVA 2PVLA 5DT0A 4PMTA 3SA0A 4I6LA 4IC8A 4HCUA 1DAWA 3OXTA 5GJGA 1YI3A 2WTWA 1ZZLA 4B8LA 3DNDA 3O8TA 4TRLA 4RG0A 4MBIA 4ASXA 1ZAOA 2BZIB 3VBTA 4FK6A 3FI3A 3TZ8A 4EUTA 3RINA 4K1BA 2PY3A 4EH2A 3QKMA 3A60A 5LJJA 4B4LA 5KNJA 3QTZA 2HW7A 4TWCA 2OXDA 3DTCA 4W4WA 4EZ7A 2NYAA 2IZUA 5JMSA 1XMLA 4R7HA 4EH5A 2JLDA 3NCGA 5E8ZA 4XLIA 3I60A 1R39A 2WXVA 3FI4A 5DWRA 4OR5A 2J0KA 5CASA 4FSUA 4LRKA 4ZS0A 3Q3BA 2CLQA 3Q6WA 4XV1A 2YERA 1O6YA 1ZY5A 3SV0A 3TACA 5DFPA 4BIEA 3BL9A 4RWKA 4DN5A 2IJMA 2JBPA 3FDNA 5HOAA 4ASEA 2UZVA 4RZWA 4DYMA 3W2PA 3GC8A 5M07A 4UMQA 2BFYA 3JYAA 5CU2A 2ZFYA 3PE1A 4U0IA 3BGQA 3DA6A 1VLRA 3D15A 4BBFA 3HV3A 3ERKA 4W9WA 5EG3A 3RNYA 4ACDA 4RLLA 1WBVA 3R7IA 3AC3A 1U5RA 4CQGA 3KXGA 3KK8A 3TZMA 5KO1A 2B9IA 4L44A 3P7AA 4BF2A 2B9HA 1REKA 1ZLTA 3KRLA 3QTIA 3VBYA 5IQCA 1VYWA 4R6VA 3M11A 5F1ZA 3NFGB 4NTSA 4EORA 3PDTA 3A2CA 4XHKB 1U54B 3GU4A 2W99B 2WELA 2X4FA 4YZMA 4V0GB 1YHVA 4BDKA 3ZEWA 3RHXA 2Z8CA 2W9ZB 4WOVA 1RQQA 4JAIA 1PXNA 3C4XA 3PJ2A 4FTMA 4JAJA 2CGUA 4AZEA 1ST0A 3NNXA 4PNIA 5EI2A 3ZDIA 4MCVA 5BVEA 5FTGA 4I94A 3CD3A 4L3JA 4BI0A 4DT8A 5CQWA 3ZBFA 5IQHA 1UNHA 3KVXA 2ITXA 1WBWA 4DFBA 3V3VA 4CXAA 2GQRA 2JIUA 3PSCA 3DTWA 4FOBA 2BPMA 4IFCA 5CY3A 4D58A 3A62A 2NNWB 5JT2A 4JJRA 3FMEA 2QR8A 4L53A 4WHZA 3QQGA 5FEDA 4IVAA 3V01A 2GSFA 4JBPA 1H27A 4ZTSA 3HMMA 3U55A 2IZTA 3NNVA 3D7TA 1IAHA 4IM0A 4O2ZA 2BRNA 5BUJA 3UNKA 1OGYA 5I9WA 1R78A 4A7CA 2OKRA 4AZVA 3DK3A 2PUIA 4I5PA 4GRBA 4U7ZA 5D9HA 2VWIA 1QL6A 3P7CA 5BVKA 1H4LA 1Q5KA 2OBJA 2YAAA 1QPCA 1Q3WA 2VNYA 4YMJA 1Q8ZA 5E9EA 5AAGA 2VTLA 5DT3A 1LUFA 1NY3A 4AA5A 4ASZA 3H9FA 4XRJA 1PXOA 4BWKA 3RCDA 4YZCA 3CTQA 2YM5A 4RJ7A 3W2OA 5CAOA 4K33A 3CKWA 1CKJA 4NWMA 2ITZA 1PYXA 4AXCA 3ZUTA 3QBNA 2AC5A 5J5SA 5L6WL 4BCHA 2JD5A 5AA8A 4EKLA 4RX7A 1OUYA 5DRDA 2VTJA 5CENA 3S00A 2VTRA 4GFGA 2X8IA 1OPLA 2QVSE 3MH2A 4YJUA 5HICA 4NZWB 2F2UA 3R30A 1KV1A 5DBXA 2ZDUA 3BGPA 3HP2A 5I3RA 3RAHA 1K2PA 3HGKA 4D5KA 4F9WA 1Q8TA 2XEYA 3QWJA 3LJ0A 4O0YA 4BTKA 2BIYA 3W1FA 3GT8A 4S30A 4C36A 4FIEA 2Z7QA 3ANRA 3G5DA 5JH6A 4AZFA 3C0GA 2R4BA 4RJ5A 4OTHA 4AW1A 2FSOX 3L8PA 2GTMA 4TN6A 3GB2A 1WBPA 4BCGA 3BL7A 4RLKA 2F4JA 5J1VA 3F9NA 2YZLA 4PL5A 5IMXA 1LEWA 4BCPA 4NIFA 4EONA 1IR3A 3QYWA 4PP7A 1LPUA 4DA5A 4DG0E 3NUXA 3E8EA 4FTUA 4NJ3A 2B54A 4AOIA 5KX8A 3OOGA 3R7OA 4O81A 4X0MA 2XP2A 4E7WA 5LVPA 2WNTA 2WQEA 3A4PA 4YHJA 5AP4A 2ITNA 4FSRA 4IWDA 4E5BA 4CYIA 4GU6A 4QMOA 4RX9A 3TUBA 5BVNA 2UZNA 1OPJA 4TTHB 5HLPA 4U45A 3E3PA 4OBPA 4I0TA 1XH7A 2VTSA 1H1SA 4ZEGA 4DGLC 4A4OA 5M08A 2J51A 4FF8A 2CLXA 4O2PA 1YDSE 4DGMA 2GNIA 3R8VA 2ETMA 4QP7A 3EQRA 2XMYA 4FIIA 4JR7A 3FWQA 2XARA 3TUCA 3DK6A 5I5ZA 4MWHA 4CNHA 3TUDA 3MS9A 3GU8A 5D11A 3ZSIA 3WE4A 4AXFA 4ACHA 4RIXA 4XJ0A 3CC6A 4BCIA 1UVRA 4FNWA 3NZ0A 3F7WA 4L8MA 2YDKA 3PXZA 2ITPA 3QF9A 5M57A 1GZNA 3WIKA 4M68A 3DQXA 5D7VA 2X2LA 3GU7A 4FT3A 3OCSA 4RJ3A 4QDVA 2C6KA 5JQ8A 1YHWA 4B0GA 4HGTA 3Q4TA 4M0ZA 5AP1A 3RAIA 3KL8A 2R3RA 2BILB 3M42A 3MPAA 3IK3A 3RK5A 3VF8A 2W96B 4QMZA 3W2QA 3ML1A 2QU6A 3I7CA 3KGAA 3FV8A 3GCSA 4FE2A 4IX4A 1OL7A 1GNGA 2G2FA 2P0CA 1PMEA 2QO2A 3FYKX 3MI9A 4OTWA 3F3UA 4RX8A 4XEYA 5AM6A 5CF5A 4WO5A 3VJNA 4EHEA 4M15A 4QQ5A 3LCOA 3F5GA 4L43A 4YZDA 5IQBA 3RK7A 4BI1A 4CFVA 2JAVA 2R3PA 2AQXA 3DNEA 2QOBA 2B7AA 4R1VA 2UZUE 4AQKA 1FVVA 3MN3A 5LQFA 3O8UA 3FHRA 4QRCA 3NUSA 1Q8WA 2VD5A 4YU2A 3DS6A 1OKYA 3QQKA 3OC1A 3LE6A 1URCA 3L8VA 2VO3A 4BGQA 1Z57A 2YN8A 4LYNA 3SX9A 5KKRB 3PJCA 3HMIA 4TYHA 1Q62A 2W17A 5JFXA 2UZDA 2XS0A 4FKPA 1GZKA 3SLSA 3VUKA 1ZOEA 3BLHA 3G51A 4RJ4A 4YUQA 2CSNA 2X2KA 4LL5A 4L6QA 4QPSA 2HZ4A 3FMHA 2QLQA 2C5YA 5EDQA 5DG5A 3R2BA 2OI4X 5BQ0A 5J9ZA 1U4DA 3MTLA 3FL4A 3OZ6A 5EM5A 5M4IA 3K5UA 4G16A 2XBJA 3C0HA 4KAOA 4FNZA 4NT4A 4ACCA 3B8QA 2Y6MA 4UMRA 3AMBA 2FYSA 1JWHA 5DNRA 4BGHA 4O0SA 4RX5A 5GJFA 2VAGA 3F2NA 5EHYA 3OW4A 5CU4A 3OWLA 3POZA 2C6TA 4J8NA 4QNAA 4IB0A 4JG8A 2VTQA 4DC2A 1K3AA 2W4JA 5HBHA 2YLFA 3MY5A 4GSBA 5D41A 4IC7A 3UODA 3EN9A 1B39A 3PTGA 3KREA 1V1KA 2GMXA 3LFCA 3P0MA 4MYGA 2BDJA 3KULA 4ZTQA 2XIRA 3FI2A 5ETFA 4Q9SA 4RIXB 4RGJA 4B6LA 3COIA 3KFAA 4MF0A 2XNPA 1PXJA 4BGGA 3VUMA 4O21A 2ZV2A 4AGWA 1IRKA 3CD8A 3NW7A 4FC0A 2R0UA 4FUYA 1W82A 2XZSA 4H58A 4UV0A 3FXWA 3CGOA 5DIAA 4H05A 2VX3A 2XA4A 2XKFA 4JRVA 2P55A 3ROYA 1RW8A 2ONLA 4AS0A 4FL2A 4ZMEA 3OWKA 3EKNA 4PV0A 3CPCA 1Q4LA 2C3LA 3UIMA 3C4WA 3WBLA 4FV7A 4PTCA 2OW3A 1OM1A 4R3RA 4DBNA 3ZC5A 4DF3A 3NYNA 4PMPA 3HX4A 3HZTA 3KF7A 4DHJA 3AOXA 2JDRA 3P1AA 2E9UA 2BDWA 3HP5A 1IAJA 3E8NA 4BKZA 3OY3A 3AKKA 3QCSA 3IW7A 2G1TA 4DHFA 1UA2A 3QD3A 4WRSA 1GIJA 4JVGA 3SW4A 3DBQA 3KMWA 4LOPA 3QUEA 2YAKA 3LFQA 1OIYA 4IJ9A 4XG6A 5C9CA 5HO6A 3DBFA 3W55A 4AAAA 1OI9A 1JSUA 5HNIX 1BMKA 1ZYLA 5AX3A 2VWWA 2IVSA 4LI5A 2GFSA 2UV2A 4EUUA 4LV5A 3CR0A 3ZDUA 3D94A 4EH7A 3EFWA 2XM8A 4L45A 3EB0A 4AN2A 4HJOA 3LW0A 4J96A 2BIKB 5J9LA 2OWBA 4E5AX 5IA0A 3DOGA 3I6UA 3PYYA 5DLSA 1TKIA 2YABA 3AC4A 3ORKA 5JZNA 2WTKC 3TZ9A 5CYIA 5GZ8A 4JMQA 5IQIA 3DT1A 4KA3A 1PMUA 5CNOA 3ZFYA 3FE3A 4YJSA 2V7OA 3OS3A 1CMKE 3TDVA 4D4SA 4R5SA 3KVWA 2XH5A 1PXMA 3PG1A 4TNDA 5JEBA 2BZJA 2XVDA 4IX3A 4DGNA 4APPA 3H3CA 3D5XA 4RC2A 4BC6A 1X8BA 4GFOA 1G8AA 3PWYA 3QZGA 3GCVA 5FEEA 3UQCA 5FM2A 2XUUA 4M3QA 4Z9LA 4G9CA 3R8ZA 4IB1A 4MXZA 3HRBA 4OTGA 3MJ2A 1M14A 2YA9A 2G2IA 4X6RA 5H8EA 4BIDA 4DFYA 4LRMA 3PIZA 3ZLWA 4Y83A 2OH0E 5L6PA 3RP9A 4K0YA 3RGFA 3VS7A 3TCPA 2ITOA 3QQUA 4MNEA 4QMSA 1RE8A 4C3RA 4CLJA 5IQFA 3I7BA 2Y4IB 3KULB 3I4BA 4UYNA 3U9CA 3POOA 4U81A 5HVYA 5HIDA 2XNEA 3RWQA 4D1ZA 5CSXA 4GK3A 4AE9A 4ANOA 4A4XA 2J0LA 4BCJA 4QMXA 2W05A 4DH7A 4IIRA 3R63A 3I1AA 3EOCA 1PJKA 3UNJA 1I09A 3FZSA 4W4XA 4AU8A 3QKLA 2W4KA 4D4RA 2IF8A 4ZSJA 3NNWA 3H4JA 4ZP5A 2CCIA 2XYUA 4AXDA 1WBNA 3QRIA 3HV6A 2QOFA 2X0OA 3VUDA 4OGRA 3ORTA 4HVHA 3L9MA 4DFNA 5E8TA 3SG8A 3PZEA 4LG4A 4J71A 5A4CA 3W8QA 4FODA 3ZO4A 4ALUA 5A4EA 3MSSA 5AX9A 5GINE 3PP1A 5AM7A 3R0TA 4RWLA 3T3UA 2Y9QA 3AT2A 5HGIA 2HXLA 4GV1A 5J5TA 5M4CA 2OFUA 3W0SA 4DGOA 4HVGA 2QOQA 5AUXA 3QX4A 3OT3A 4FZ6A 4GYGA 1GIHA 4LMUA 5H2UA 3RM7A 3R9NA 1G5SA 3CQEA 3AT4A 1SM2A 2GS6A 4FT5A 4CLIA 5LMKC 4FIFA 4FZ7A 5KZIA 4EZ5A 4D0XA 4C58A 2P2HA 5BVWA 2I0EA 5JFSA 2V0DA 4BCOA 4B99A 2IG7A 5A9UA 3GEQA 3VS3A 3OUNB 3V6RA 5M56A 4EC9A 3UO5A 5L8KA 3AXWA 1JKSA 2HAKA 5CANA 3PRFA 3UP2A 3G0EA 4HZSA 4NK9A 4XG7A 4AZSA 5A4LA 4WBOA 3EL7A 5HLNA 5L8LA 1YWVA 3O23A 1OBGA 3IECA 2JDVA 3KQ7A 3WZDA 4DAWA 4BR3A 2ZM3A 2GS7A 5E7RA 3PWDA 3DJ7A 2OSCA 2QOLA 4EC8A 4M12A 4O7RA 4YTIA 4EYMA 3SG9A 4P4CA 1KE5A 3PSDA 1APME 4NTTA 4G6OA 2WMSA 4I22A 4CV9A 5IDPA 1MUOA 5HNBA 5JRSA 4C62A 2QKWB 2VWYA 3AMYA 3FKLA 4JBOA 2DUVA 2PMOX 2W5AA 4QD6A 3S0OA 3AMAA 5F94A 4EQCA 5A4QA 3OBJA 5EW3A 5E1SA 4H36A 3FKOA 2ZDTA 3I5ZA 4MAOA 3R7VA 3P86A 3QTXA 5CU6A 1WVWA 3F82A 3GC0A 4RIWA 4Y95A 3UMWA 3VWAA 4UX9A 4N0SA 4M13A 4UYAA 3V51A 5FXSA 2WU6A 3C4ZA 3VJOA 4E6QA 4FG8A 4XOYA 4JS8A 5IUGA 2CJMA 3DZQA 4E6AA 2VRXA 3MESA 3S95A 4LGDA 5H8BA 3DXPA 4CCBA 3FC2A 5K5NA 1RDQE 4YO4A 1YOJA 4WNOA 1WFCA 5KUPA 4X21A 3CIKA 3HYHA 3BELA 5AIKA 5BYLA 4DFUA 3B8RA 3TL8A 4TYGA 3C1XA 2C5NA 4Q5HA 2IPXA 4DT9A 1MP8A 5DEYA 4AGDA 2WOUA 3QQJA 2PTKA 3ZFMA 4RWJA 2J0JA 3T3VA 4MD7E 2BUJA 2W1GA 3QD0A 3FAAA 5IPJA 2X6DA 1FOTA 3FPMA 4F6UA 1MQ4A 2C4GA 4FV1A 4CFUA 2O65A 3VBXA 1I44A 3MVJA 4X2FA 2UW6A 4AW5A 4O1PA 2ITTA 3QC4A 4EJ7A 4UB7A 4FYNA 2R7BA 3BI6A 5GIOE 1U46A 3R1NA 4YJTA 4D1SA 4ZOGA 5EQEA 5I9ZA 2EU9A 3ITZA 4RWIA 3Q2JA 1HCLA 2R3LA 3C7QA 3HV7A 3OEZA 3P7BA 3UVPA 3VUGA 5AWMA 2Q83A 3IGGA 4OT5A 4U5JA 2QO7A 1E9HA 2X7OA 1H25A 4XG8A 5AR2A 2BRGA 3TZ7A 5A46A 1RJBA 3SDJA 4EKKA 4K6ZA 4O22A 3UIXA 3OMVA 3DKGA 3FLQA 3KN6A 3U8WA 3VONA 5ANIA 5ICPA 5HKMA 4F6SA 3CSVA 4JR3A 4L3LA 2YWPA 3LFSA 3EN7A 3AC2A 4FSQA 2CKQA 3L9NA 3OG7A 5DE2A 4EOQA 4FEUA 2UZWE 3K5VA 3QLFA 4PP9A 3RPOA 5HX8A 4BJJB 4BI2A 4FRFA 2PMIA 2NRUA 3PPZA 5CF4A 4FMQA 5M51A 3S4QA 2JGZA 4F7LA 4IM3A 2XCHA 2WMQA 4KRCA 5F20A 2OXYA 5JK3A 4ARKA 2E9OA 3ROCA 4UXLA 3TKHA 5LVOA 4QDEA 2ZM1A 5IA4A 4LOOA 4PPAA 2PK9A 3UGCA 1KUTA 5B2KA 5K5XA 2OO8X 1M2RA 5FG8A 3NDMA 5HO8A 5CU0A 4PY1A 5I9VA 4U6RA 5LOHA 1PRYA 4HYSA 5LMAA 4XRLA 4AZTA 1G8KA 4BDFA 4KNBA 3ZONA 5HG8A 3NUPA 3RPRA 4PDPA 4QMWA 4FEWA 4KSPA 4HOKA 3CQUA 5CT7A 5M09A 5JFWA 4PPBA 2B4SB 3Q96A 5IF1A 3VUIA 2GNLA 3NPCA 3QAME 3ATTA 1JKTA 3HUCA 4KIKA 3UDSA 2HENA 5HG9A 3ALNA 4M66A 5J8IA 4NEUA 1W2FA 2PVRA 3E88A 3KXNA 4GT3A 4QYYA 3O5AA 3UZRA 4G1WA 4HPUE 2B1PA 4R3CA 2C6IA 4Z3VA 5M4UA 3BYVA 4WNPA 4ZSGA 5AADA 1IA8A 4EHVA 3PPJA 4HCTA 1SVHA 3VBQA 4OW8A 4CT1A 5ETIA 2R5TA 4JNWA 3HVCA 2BDFA 5I3OA 4D55A 4ENXA 2NRYA 2QHMA 1QPJA 3MVHA 4ALVA 3FLYA 1OL5A 3M1SA 4YSJA 3ULZA 2X0QA 1B6CB 5FXRA 4EI4A 1VZOA 3KCKA 3AGLA 4YPDA 4AT3A 3AD6A 2BRMA 4KINA 3GCQA 2CN8A 4XMOA 3DU8A 3VUHA 3RPYA 3BV2A 3QQLA 1YOLA 3R7GA 4GW8A 1OITA 2X6EA 5AP5A 2PZYA 5EM6A 4OAVB 4R7BA 4FTNA 4F1MA 3V5PA 5IZFA 2O3PA 3NIEA 4QP2A 4EJNA 5L8JA 4ZZOA 3QX2A 3R73A 3NSZA 4UN0C 4QYFA 3OVVA 4AT5A 2WHBA 5IEVA 1L3RE 2A0CX 2FSMX 3Q5ZA 4YJOA 5AAFA 4HVIA 1WAKA 3F3TA 3TG1A 3H10A 2KULA 3IDCA 3IG7A 4U3ZA 1FMOE 5B7VA 3PLSA 3D5WA 3IKAA 4FOCA 3IDBA 1BL6A 2VTHA 3V8SA 4NM0A 4H1JA 2XK4A 5DGZA 5AA9A 3DXQA 3F66A 2YCFA 5E8WA 5HBEA 3BQRA 3K3IA 5A54A 4MVFA 5HIEA 5L2TA 5HVKA 4LFIA 3UDTA 1JOWB 2BCJA 4NL0A 1YXXA 4C61A 4JI9A 4YHTA 5AV1A 5AV3A 2JDOA 3DLSA 2HOGA 3BLAA 4EQMA 3QHRA 4IB3A 4CFWA 3HA6A 4LMNA 3KK9A 4RT7A 3ZS5A 4E6DA 4BDDA 4S34A 5CVFA 4DG3E 2BR1A 3F2AA 3WZKA 2XNOA 5KMKA 4APCA 4D5HA 4KIKB 3LMIA 4B9DA 3OEFX 5FQDC 4UWCA 2HELA 1CSNA 4C38A 2I0VA 2XK8A 4FUXA 4FICA 3SD0A 3FLSA 2YEXA 4D0WA 4BIBA 2B9FA 2WO6A 3PP0A 2OICA 3G9LX 4W4VA 3VN9A 4BZOA 3ZRKA 4EOSA 2OJGA 3AD5A 5CEQA 4USEA 3AKJA 4ONAA 3NAXA 4DDIA 5C8KA 2C5VA 3BZ3A 3BYUA 4F1OA 4OTPA 4NKSA 4P5QA 2OFVA 4O4BB 3LOKA 5GNKA 4BTJA 4KBKA 3ZLXA 1PMVA 2PE1A 2FUMA 4DH5A 4Q9ZA 2XK3A 4F4PA 4ZLYA 1Y6BA 1Q41A 3FBVA 4EOLA 4TY1A 2UZEA 4RA4A 5FTOA 3FC1X 3WYYA 4QMQA 5J87A 5IH5A 3LCDA 3ZCLA 3UYTA 2XK6A 3V5TA 4ZK5A 2YIXA 3EHAA 3E8CA 4M0YA 3ZUUA 5CXHA 3U87A 5TT7A 2GHGA 3MW1A 4KRDA 4KIQA 3A61A 4MBJA 3TYKA 4I41A 5HQ0A 3TV4A 3DXNA 3ZLSA 2GFCA 1XHAA 3EN6A 2R3HA 5FDPA 1T46A 4K11A 3JXWA 5LCJA 4H1MA 3OD6X 3SXSA 3UO4A 4USFA 4NYEA 2UVZA 3NYVA 1OGUA 1XBBA 2WTVA 1DI9A 3F5PA 3D4QA 4FTIA 1VJYA 4H3BA 1OKZA 4QPMA 3V5JA 4CZYB 4DITA 4P90A 5LMBA 2IVTA 3RM6A 2I0HA 2YWVA 4FEQA 4FSMA 4DCAA 3I5NA 4BY9E 1ZYSA 4PTEA 2VWUA 4MF1A 1Q99A 2QKRA 1U59A 2HZ0A 2PZRA 4FI1A 4I6FA 2XB7A 5EHLA 4C4IA 5FP5A 5IEXA 2WGJA 2DYLA 4X3FC 3EN5A 5KE0A 4HW7A 4JQ7A 4NW5A 5AIRA 2QI8A 2GCDA 3UOJA 1WBTA 2PUNA 3NVMB 1KOBA 1P14A 2GHMA 4QQCA 1KE8A 1KV2A 5TF9A 3W2CA 2O0UA 3I79A 4IVDA 2ZB0A 2DWBA 1Q8YA 1ZWSA 5G6VA 4PL4A 2JKKA 4IM2A 1H08A 2V7AA 2VN9A 5B2LA 4ZXTA 2PE0A 4DH1A 2XNMA 1H1WA 4ZTLA 4UMUA 2E9PA 2UZBA 4YJNA 4YBKA 2XM9A 4MEDA 5CF8A 4AGCA 4IVCA 3BIZA 4QYHA 2OJ9A 3E63A 3MPTA 4K2RA 4QTDA 4ZSLA 5H3QA 1PHKA 1UU3A 4FTJA 4O86A 2X0PA 2P33A 4MKCA 4IVBA 3NR9A 4RPVA 3CS9A 3Q04A 5IUHA 2I7QA 3IOKA 3KRJA 2C68A 3O71A 2GNFA 4IMYA 4L7FA 3T8OA 4CMOA 3O2MA 3U6IA 2G9XA 3QTWA 3EFKA 4I23A 4UBAA 2GDOA 5HCXA 4RA5A 1NVQA 3AQVA 1VYZA 2CN5A 2YCRA 1BKXA 3G90X 3LVPA 4FK3A 4G3EA 4EOOA 5BUEA 2ZV8A 4GJ2A 3CP9A 2C1BA 5JGDA 1IG1A 1YI6A 4C8BA 3I81A 3AD4A 1W2DA 3R22A 3QRUA 4LUDA 4GMYA 1CKPA 1WZYA 2UW8A 4PTGA 5DRBA 3IDPA 4O4DA 4DE4A 4PMMA 2VO6A 2WKMA 5BYZA 3TIZA 5CZHA 5I9YA 5BV3A 3PRIA 3TNQB 2QQ7A 4QP6A 5K4IA 4KKEA 1PXIA 3BU3A 2XEZA 4KSQA 3G9NA 2OU7A 3ZYAA 3R7YA 4MXAA 4O84A 4XV2A 3B2WA 1XH8A 2XBAA 1ZMWA 4USDA 4FTKA 4EEVA 3D83A 2W5HA 2VTNA 4YC6A 3LFNA 3CCNA 4FV3A 1KOAA 3FXZA 4C7TA 1T45A 5A6NA 4O7ZA 5F4NA 4RFZA 1YDRE 3FQEA 4LDTA 2UZOA 3GU6A 1F3MC 3BU5A 4H3QA 2PVYA 2F2CB 3WF5A 4EOMA 2ZB1A 4JOAA 3QLGA 4UY9A 4GIHA 2OJJA 3F3VA 4AG8A 4JX3A 3D7TB 3EFJA 5IEYA 4W4YA 4Z55A 2O64A 3E64A 5IQDA 3L1SA 4O4CA 3VS6A 5CXZA 2W1CA 3GC7A 1YDTE 2BALA 3DB6A 4PRJA 4IAAA 1P4FA 2X2MA 4JG6A 4IFGA 5HVJA 2C6DA 3O17A 4LGGA 2X8DA 3MPMA 2OIQA 3LXLA 5TKDA 3FMLA 3LM5A 1OIUA 2CNQA 3IPHA 5EW9A 4GT5A 3A7IA 4YURA 3Q9YA 3KXZA 3MVLA 4NM5A 3GFEA 3DB8A 1WVXA 4Y46A 5AP3A 3BV3A 3RCJA 3UOLA 4C33A 3ZC6A 3ANQA 4S31A 3PIYA 3V04A 4G3GA 4AE6A 3IW6A 2B52A 3BHYA 4FX3A 4WG5A 4R1YA 5HCZA 3VNTA 1YXSA 2W5BA 4JDJA 5HZNA 2CNUA 4UEUA 3UPXA 2OJIA 3DPKA 2OG8A 2VTIA 3JS2A 4CMUA 2OZAA 4LGHA 5KKRC 4BCFA 4XLVA 2WMAA 5K3YA 4AW2A 1SVGA 3NIZA 3KIOC 3BEGA 3EN4A 5FBOA 3O7LD 2RF9A 1ZMVA 1E1VA 3MTFA 3QRTA 4I92A 2BAQA 2OGVA 3G2FA 2C0TA 3NUNA 2P2IA 4GH2A 4XG3A 5B0XA 4WRGA 4ITJA 2RFSA 3ODZX 3HUBA 4NIFB 3ACJA 1Y91A 3DKOA 3WF9A 5EQPA 3MIAA 5JKGA 4FV8A 2UW5A 2W06A 5HTCA 2PVJA 3LFAA 4GK4A 5IA2A 4BN1A 3EIDA 3L8SA 5CWZA 4CMTA 5HCYA 1ZYDA 1BLXA 3ODYX 2WMBA 4EK4A 4ZJIA 4FIGA 3D14A 4M14A 4O7YA 4FNYA 5KMIA 4QYGA 4DHZA 2WB8A 4ZY6A 5CALA 5ANEA 1QCFA 3MH0A 3G15A 2EUFB 2IWIA 4WT6A 5CI7A 3WE8A 3GNIB 2CKOA 2WPAA 3CLYA 2DS1A 2X81A 2WEIA 4GJ3A 4L46A 2VO0A 3KXMA 4IANA 5AUUA 3F5UA 4C2WA 3CTJA 2PHKA 5HE3A 3OY1A 3R1QA 3BGZA 2UZTA 5HNGA