4MNEB

Crystal structure of the braf:mek1 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
270
Chain Sequence
DWEIPDGQITVGQRIGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure of the BRAF-MEK Complex Reveals a Kinase Activity Independent Role for BRAF in MAPK Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 270
sequence length 274
chains with identical sequence C, F, G
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mneB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mneB01
1KE9A 2BAJA 3UIMA 4EJNA 4O7ZA 4HCTA 4DGMA 4FKGA 1OL7A 3NAXA 3RK9A 3G9LX 4PNIA 4YZNA 4F6SA 3TNPC 1OIRA 3NNVA 4JG8A 3NYNA 1H1QA 5ANJA 4F09A 4GT4A 2R3IA 3EQRA 3FLZA 4GUBA 2W1DA 4IAIA 4M13A 4E4LA 5JT2A 1PMEA 2ITYA 2BIYA 3MV5A 2UVYA 4DHFA 3W8LA 1PHKA 2NP8A 2BFXA 4G3GA 3ULZA 5FD2A 3UVQA 4IB0A 3TDWA 1B38A 4RX8A 2WMQA 4X2GA 3TNHA 4RJ3A 3UODA 2W9ZB 2I7QA 3F2RA 2ETRA 3QGYA 4QPSA 4H1MA 3CY3A 2P4IA 2Q0BA 4NEUA 4OTFA 3KF4A 1NT2A 2UVXA 1F3MC 2PVLA 1I44A 2C0OA 2CCHA 2GNLA 5C03A 3RPSA 4NIFB 3FI2A 3ACJA 4JBQA 4OBPA 2RFEA 3NGAA 2CHLA 3QD0A 5DRBA 2C30A 3SD0A 3KVXA 2O63A 4ZTMA 3FLQA 3ID6C 3FPMA 4Y5HA 1M7NA 2PULA 4G6OA 5D7VA 2Z8CA 5EYDA 3TCPA 4KRDA 2GTNA 3OFMA 2EUFB 3MH1A 5F94A 5M09A 4IX5A 5EYMA 2AC3A 3ZO4A 2KULA 4R78A 5C26A 3AC8A 3RHKA 2Z2WA 4FV3A 4ZLYA 5L2IA 3BHTA 4AN2A 2W9FB 3BHHA 4RVTA 4UYAA 1B6CB 3FKLA 4IZ7A 3NWWA 2J9MA 5FP6A 2BROA 3ATTA 3H9FA 5GHVA 1YWVA 4Z9LA 3K2LA 3D2IA 3QHWA 1REKA 1J1CA 2NRUA 4Y95A 2REIA 4Z7HA 4KB8A 5EQEA 3FMKA 3R0TA 2X6DA 4FKSA 5CAQA 2B54A 3D14A 4QNAA 4TKSA 2QR8A 1ZZ2A 4GW8A 4QYFA 3GU6A 3OS3A 4AZFA 5IQBA 4CMUA 2UZUE 3NUSA 4RA4A 4J71A 5D9HA 5AAGA 4CVAA 3EZVA 3ZZEA 3FMLA 2B55A 4E3CA 5HTCA 3Q4UA 3VO3A 5FEDA 3O71A 3ZMMA 2IW9A 2Y8OA 3CD8A 4IVCA 3ZHPC 3HX4A 2P55A 4PDSA 4RJ7A 3DLZA 5JFXA 4JG6A 3BBTB 1ZMWA 3MTLA 5IQFA 3VS3A 4M12A 4WNOA 3FZRA 3ORXA 2PL0A 2PE1A 3Q5ZA 5CAOA 2ZYBA 2ZV8A 4EZ5A 3DKFA 4G17A 5CU0A 2QKRA 3TTIA 1KUTA 5HGIA 5CU2A 4OTIA 2QONA 3DOGA 3DK6A 4FUYA 4FZ7A 4YJNA 3C50A 2WTCA 3OXIA 4A06A 5CAUA 3EQDA 5IH5A 3UPZA 2EXEA 4ACHA 2VX0A 3PP1A 1JKTA 2GNFA 4C62A 4S33A 4CQEA 3TM0A 3KMWA 4U8ZA 5AR4A 4ZEGA 4B8MA 4CZYB 3BV3A 4D5HA 5FTQA 3NRMA 4NH1A 5IEYA 2JBPA 2ZDUA 2EXMA 3GCVA 4LOOA 3SA0A 3E62A 3R9DA 4ACCA 2JFMA 2WTVA 4GRBA 3RCDA 2B1PA 4WUAA 2PUIA 4P5QA 3MIYA 2HIWA 4BGQA 3LXPA 1UV5A 1O6KA 3CQWA 5BVWA 3TZ9A 3ZDIA 3KU2A 4C35A 3FZPA 1Y6AA 4YU2A 4A9YA 2A19B 3UVRA 5FTGA 4YLLA 3AC3A 3OBGA 4M3QA 5HNIX 3O8TA 4M14A 1Y8YA 3ZXTA 2YWVA 4YHTA 4XP2A 5A4EA 2C5OA 4YO4A 2V22A 2J50A 2OG8A 3PRFA 5DRDA 1BI7A 3DJ7A 5AJQA 3EFJA 5CF5A 4FG9A 5HTBA 1L8TA 4FSZA 4HVSA 3ZUVA 2XKFA 5FGKA 4YZBA 4YNOA 3ZRKA 2OGVA 2VWVA 5DT0A 4MBLA 3R7VA 4EK6A 2C5YA 4JR7A 4MQ1A 4R3PA 5B0XA 2QVSE 4RBLA 3UO4A 5HD4A 2H9VA 2YIQA 1WBTA 2XIRA 3TXOA 2PVYA 3T3VA 1YI4A 1TQIA 4MXAA 4QP1A 3KULA 1OI9A 4PV0A 5EFQA 5JH6A 3ODZX 4C36A 4NL0A 3P08A 2BTRA 2W1CA 4EH4A 2WELA 4RC3A 2ZM1A 3HDMA 2WMBA 3ALNA 4JBOA 2OJIA 3QRUA 3QKKA 4MNEB 3BYSA 2VTIA 4FZAB 4N4SA 4OBOA 5E8UA 3RK7A 4ZTRA 4AU8A 5D7AA 2PY3A 3WF8A 5JKGA 5KMKA 4ZMEA 2Z02A 2JC6A 5IQHA 5ETAA 5CAVA 4RFYA 3L9NA 2BHHA 4BRXA 2ZM4A 3D5UA 3I79A 5C8KA 4PMTA 4D2WA 2GHGA 2CKQA 3W8QA 3S4QA 3R6XA 3DY7A 4ANSA 4NM3A 3R2YA 4LYNA 1IR3A 2VTRA 5IQCA 2AC5A 1NVRA 2VTTA 1U46A 2X6EA 3A62A 1PYEA 3MVHA 2WQMA 4QMYA 4F65A 4K77A 3SVVA 3D7TB 3COIA 3ORZA 4XRLA 3RI1A 3TZMA 3N4TA 3EYHA 2O8YA 2PE2A 3EIDA 3GGFA 4KWPA 3UVPA 3ZONA 4C3RA 5GJFA 3HL7A 1H01A 2YIWA 2W1ZA 5DWRA 4B99A 4D2TA 4R7BA 4RRVA 3A4PA 4M67A 3H0ZA 5HE1A 3JR1A 2DQ7X 2C69A 4EH7A 4FV0A 2WFYA 4GFOA 2BRNA 4HYSA 3EKNA 5HKMA 3TNWA 4L01A 2QU5A 3BWJA 3VBQA 3LFNA 2W17A 2P2HA 3QGWA 4L45A 3SDJA 5M06A 5B2LA 2OJJA 4BCMA 5L2TA 4QTAA 5EG3A 1G5SA 4C58A 5FDPA 4DEEA 5HVJA 3Q4TA 1P14A 1OIYA 4AZVA 3AQVA 4JX7A 4F9WA 2A1AB 2WO6A 4F0IA 4I3ZA 3R1NA 5GZAA 1UU7A 4MX9A 5HG8A 3UO5A 4AE6A 2V5QA 4BWPA 4FT5A 1Q5KA 1S9IA 2C68A 3BPRA 3KFAA 3JPVA 4Q9SA 1M17A 2GPHA 2JDRA 2QNJA 2WTJA 4QP6A 4EONA 4HPTE 5BUIA 3CXWA 4UX9A 4FGRA 1U54A 4HYHA 4FZDB 4JR3A 4Q5HA 2X8DA 4QTCA 4X2FA 2QG5A 4X0MA 4ALWA 4GUEA 5K3YA 1DAYA 3Q9YA 4PPBA 2R3PA 1U4DA 4HPUE 3UC3A 4IWQA 4C4HA 5J1WA 4CSVA 5A54A 5M08A 3FDNA 4ANOA 3T9TA 4I5MA 4DYMA 2PUPA 1KWPA 4IC8A 3KRLA 4QOXA 3RHXA 3CPCA 4BWXA 2Z7SA 4C37A 3G9NA 5FWKK 4J99A 4NT4A 4F7SA 1XH5A 3W1FA 4OTDA 3KK8A 3MESA 4BY9E 1OIQA 3E3BX 4BKZA 4H39A 3FLNC 5GJGA 3ZSGA 4JG7A 4WNKA 3UQGA 1J7IA 3CY2A 5AWMA 3G5DA 5HHWA 3A99A 2VTLA 3NYXA 4CXAA 5IF1A 5L6OA 5M4FA 2E9VA 3P1AA 1GZOA 4FI1A 4LOPA 5BNJA 4QMQA 1R39A 4CZUA 1W82A 1K3AA 2WMXA 1IA9A 3S00A 3QTIA 1PKDA 4LV5A 3LM5A 4K2RA 2VRXA 3R7OA 4IAKA 2A0CX 3QLFA 4O21A 1UA2A 5C27A 3PUPA 5AAFA 5K9IA 2XNBA 4C2WA 5AP2A 2CKEA 4NM0A 3EHAA 3FXXA 3S2PA 3LXNA 3WZEA 3WZKA 4EEVA 1WBOA 5J5TA 1G8SA 2J5FA 1OBGA 3BBWA 4IFGA 4I21A 4OTQA 1O6LA 4UALA 5DVRA 4KBKA 5EI8A 2VTAA 3OVVA 4U81A 4EYMA 4C4IA 3Q5IA 3CEKA 3R04A 4I6BA 5DFPA 4P7EA 4OTPA 4U42A 1B39A 4BF2A 4FV9A 4R6VA 4E5AX 3K3IA 5BVDA 5DNRA 4PP9A 1CMKE 3A7IA 4CFUA 5HIEA 1M2QA 4L7FA 1ND4A 2JBOA 2ONLC 3MFRA 4N0SA 1ZZLA 1ZLTA 2G01A 4RT7A 2X7GA 1XBBA 4HZSA 4EOPA 2QO7A 3PA3A 2HW6A 3V6SA 5HLNA 3NNXA 3NEWA 4S34A 5A6OA 2PVMA 1Z5MA 4AZEA 3TIZA 2DUVA 2QLQA 4C02A 3C0HA 3IGOA 3FC2A 1DI8A 3GU4A 5CQWA 3R8ZA 3L8SA 4OBQA 2XYUA 4AN9A 2X4FA 3QCQA 5HO8A 1HCLA 2OJGA 4C59A 1RW8A 1PXMA 1Y91A 2OU7A 3OUKA 3D94A 5CI6A 3H9OA 3VS0A 4G5PA 3NLBA 4W9WA 1WVXA 2R3JA 2IO6A 5KZIA 4JBPA 4U79A 4FZ6A 3VS5A 4QPAA 4UY9A 3JS2A 4FR4A 3ELJA 4OT6A 2OW3A 2BILB 4FTTA 2R4BA 2QI8A 3C51A 5DPVA 3Q9XA 4O7LA 2X1NA 5DHJA 2HZIA 2HELA 1H07A 5LWNA 1XH4A 4FTIA 2YZAA 4QMVA 1ZOHA 2JD5A 3CTJA 1GZNA 2BZJA 2G9XA 3V04A 4BB4A 4BGGA 5AUUA 1GNGA 4DH1A 4BDJA 2ITPA 5B2KA 3C7QA 5FUTA 4I22A 1ZYDA 2XCKA 5EK7A 4BDGA 3OTUA 5E1EA 2I0HA 4DFLA 3PP0A 1CSNA 3PE2A 4X3JA 4HJOA 4KIOA 4E20A 4FTCA 3ZRMA 3UYSA 3UQCA 4V01A 4CKIA 2YHVA 3PA5A 4BCQA 4JDHA 4QMLA 5M4IA 3TV7A 3IECA 3KVWA 1QCFA 3BYMA 4I93A 3IW6A 4LL5A 2I6LA 2VD5A 3RPYA 4IE9A 3MTFA 3W2QA 5A14A 2BKKA 4BFMA 4EH5A 3FHRA 3THBA 4CD0A 2JKOA 4HGEA 4IM0A 4O0XA 3PG3A 4IAZA 1TVOA 4RWKA 3I6UA 5GZ8A 4UEUA 5J9ZA 1XKKA 5M55A 4WO5A 2P3GX 3DB8A 2YAAA 3WBLA 3O7LD 4YR8A 2B9IA 3ORTA 3ZEPA 2W4JA 2JKKA 4F9BA 2C3IB 3VS6A 2XEZA 4CLJA 3WIKA 4ERKA 5CANA 4XG8A 4JL9A 1XH7A 5BYLA 3QX4A 3NCGA 4O96A 5L2WA 5BVEA 4L67A 2QG7A 3E8DA 1ERKA 3ETAA 5JFWA 4FKJA 4EQCA 5DT4A 2QKWB 5CZHA 4QP8A 4NK9A 5LQFA 4OAVB 4RX5A 1H1RA 1Q3WA 4IANA 4YHFA 4MNFA 3VWAA 3F3ZA 1QPDA 3EJ1A 4V0GA 4E6QA 4CYIA 3TWJA 2C6TA 4MEDA 3IO7A 3W2PA 4K1BA 4YLJA 3CQUA 4E4MA 3GQLA 2W0JA 2IPXA 3E92A 5ETIA 3VJOA 1YXVA 4DEGA 1SNUA 2QOKA 2X2KA 4Q9ZA 4XG7A 2QLUA 2JDOA 3C5IA 3GFWA 2R3QA 3A7FA 2RGPA 3ZS5A 5BMMA 5I0BA 1UNGA 2QOIA 4FKQA 3TNQB 4IB1A 4YZDA 4AA4A 5JN2A 5GIPE 4MQ2A 1LPUA 4TZRA 3ZTXA 5CWZA 1A9UA 5EHLA 3BYVA 2W5AA 4EZ7A 5JZJA 2XKCA 3M11A 3OWLA 2JAMA 4WNMA 3SXSA 2FGIA 4ZY4A 1OB3A 5CEPA 2CPKE 3AT4A 3HYHA 4IM3A 2FO0A 5CSWA 3TJDA 2VWWA 4PWNA 3S1HA 4UB7A 4YLKA 5KMJA 3HA8A 2IVTA 4BTKA 1GIIA 4HCVA 4CFNA 4YTHA 4CKJA 3C4ZA 4C4GA 3NX8A 4X21A 3DNDA 3QA0A 2OWBA 4AT5A 4F08A 4IVBA 4HGTA 3Q4CA 3O8UA 5CNNA 5HE0A 4GG7A 3SX9A 4WD5A 5DT3A 2VTMA 3KRXA 5J79A 3HV3A 4IAAA 4FVRA 3SOCA 1Q3DA 2C3KA 5I9XA 2C5XA 4IQ6A 4IZ5A 2GU8A 3CE3A 3V6RA 4DA5A 4MWIA 3T3UA 4QYGA 3ZDUA 3U6JA 3BGPA 5M4CA 2E9PA 4TNBA 4EHVA 5JGDA 4BIEA 2CCIA 3TDVA 4NKAA 1MRUA 3ZUTA 4CRLA 5IZFA 5L8KA 2IZTA 3POZA 4APCA 4D4YA 4F6WA 1UVRA 4L42A 3PZHA 4NYEA 5EW3A 4O0RA 5BYZA 3UC4A 3QTQA 4GFGA 3F69A 4O2PA 4BCPA 3UP7A 4CFMA 5KUPA 2G1TA 4J98A 4PL4A 4BDIA 4IX6A 2NPQA 4AUAA 4MD7E 3LZBA 3P7BA 2RG5A 5AP5A 4F9CA 3C4WA 3OW3A 3QD2B 4M68A 3UNZA 1WZYA 3OCGA 2XM9A 4DF3A 5LOHA 4XOZA 4DH5A 2OI4X 5M57A 2JGZA 2CKOA 4XBUA 3E8CA 1QMZA 5GJDA 3VUIA 4L43A 2VAGA 4XX9A 2C6EA 4BCGA 1JLUE 3RPOA 3VNTA 3AC2A 2E9NA 2YDIA 4ASZA 3IS5A 1Q24A 2Y4IC 4FV8A 2BTSA 4RX7A 1FVRA 3ZYAA 4C34A 5DR2A 5HI2A 4FEXA 5EI2A 2YM7A 4FTAA 2VV9A 2WMUA 4WG5A 4RC4A 2WQNA 2FSMX 3W2CA 1ZY5A 4MCVA 3V01A 2H34A 5ACKA 3HAVA 5D41A 2VU3A 3VBYA 3DTWA 5AMNA 4D9TA 3PWYA 5IMEA 4WG3A 1GY3A 4F4PA 3TN8A 3R28A 1FVVA 2ITOA 2QO9A 3NS9A 4IZAA 4L00A 5C8NA 3RK5A 4A7CA 2F57A 3F5UA 3PVWA 4FT9A 5EM7A 2BZHB 1FGIA 3ZXZA 3CGOA 1A48A 1Q62A 2C0TA 2X8EA 3SHEA 5GNKA 3W16A 3A7JA 4FTOA 2W1EA 4KBCA 4WRSA 2W7XA 1AQ1A 3LQ5A 4XV9A 3SXFA 3OZ6A 1U54B 4ANLA 5FBOA 1XQZA 2RSVA 3M42A 4LQMA 4U43A 1R78A 2YAKA 3MWUA 2BCJA 4EBWA 4BDKA 4TN6A 5ETFA 3ODYX 4XG4A 3DBCA 3EN7A 3FHIA 2Y6MA 4IB5A 4Q2AA 4ANMA 4YZMA 3KMUA 2QURA 2RFNA 3PIXA 3GC8A 4H3PA 3I0QA 4Y5QA 3HV7A 3NNWA 4FSMA 3N4VA 3AMAA 2YITA 3HZTA 3L9PA 4I0RA 3M2WA 2XNEA 4J97A 3U6IA 3CGFA 4AA0A 5HIDA 4I23A 4ZSEA 3Q9ZA 3OBJA 3R1YA 4YHJA 3AT2A 2XNGA 5DE2A 3VS1A 2A4LA 3FSKA 3QKLA 3NIZA 4ZS0A 4D2PA 5HEZA 4BHNA 3C0GA 2X8IA 1YOLA 1H1PA 4MTAA 5EYCA 1YW2A 3QYZA 3NCZA 3V8SA 4MKCA 3LCSA 4CYJA 3BQCA 2ITXA 4DFYA 4R1VA 1Q8TA 1WVWA 2XK9A 4J95A 3FZSA 5AA9A 1PXLA 2PZ5A 3CD3A 5E90A 3R1QA 4RSSA 4B4LA 2BDFA 5D12A 3F3TA 3UNJA 5AR8A 4D55A 5GZ9A 4QTEA 3HMIA 4K0YA 5E8XA 1SMHA 4BDFA 2XIYA 3Q4ZA 3QTZA 4FSQA 2X2MA 4EHEA 4IVDA 2NO3A 4QMPA 3VQHA 2O2UA 3HNGA 5FM3A 4FV2A 3ZSHA 4IWPA 4KUJA 4ZZOA 4N57A 3ZM9A 3NUNA 4C57A 1H08A 4NCTC 2PU8A 1H24A 1CKJA 3CPBA 4RWJA 3FZ1A 5BYYA 5J5SA 2PYWA 4XG3A 3R30A 1UU3A 3RP9A 4YC3A 3UIUA 3TUDA 2F7ZE 2YM3A 5IH4A 4P4CA 3FMHA 3QC4A 4KSPA 4RZWA 4YBJA 4BI0A 5HVKA 3QD3A 4KINA 2GS2A 4R5YA 4NM7A 2OIBA 4PTCA 5KHWA 2SRCA 2UW6A 1YXUA 1XR1A 2WPAA 1PYXA 1Q8YA 2YIYA 5BQ0A 3PSDA 2CN8A 1SM2A 1YXXA 2PVRA 3F5PA 3R1SA 1FMKA 1OUYA 2JITA 3EQGA 2QU6A 1BLXA 4FK6A 3ET7A 4FTQA 4G16A 4XV2A 5E8WA 2JKMA 4BL1A 2VTOA 3QA8A 5LVNA 4DAWA 3HP5A 3QCXA 4IX4A 4M8TA 4BCIA 4U45A 3BV2A 2E9UA 1IRKA 2W99B 4FV1A 4IAFA 4BZOA 2WOUA 4GG5A 5FXSA 1H27A 4WHZA 4EBVA 3RZFA 4Z7GA 2RL5A 3TKHA 4RLLA 3VUDA 4F0FA 1H0WA 3EOCA 4UMRA 2HWPA 2VGPA 3L8XA 4GVJA 4J52A 4BYJA 1P4FA 3HV5A 2UW9A 2F9GA 3UMXA 4D1SA 5CX9A 2Q0NA 2XNMA 4K33A 3AGMA 3EN6A 5T6KA 5CYIA 4FV7A 3GI3A 3UO6A 4YJSA 2ERKA 2PZPA 4RFMA 5E1SA 3LXKA 2FSTX 3FI3A 3MVLA 2QR7A 4FTUA 3MW1A 2ZMDA 5EOLA 3OROA 1KE5A 3F7ZA 3E7OA 3QCYA 5HICA 1GOLA 5KO1A 4HNIA 4AGDA 4L9IA 2YWPA 4C38A 5IA2A 3EN5A 3NUPA 3R22A 4ERWA 3I7CA 4D58A 3PXQA 4B6LA 3PYYA 1OKWA 3SLSA 4GFMA 4TRLA 3HP2A 1APME 4BDDA 2IVSA 4W4VA 3VUKA 2XNNA 3NMUF 4O1PA 3D2KA 2XKEA 4XRJA 5DGZA 5LXMA 3BX5A 4X6RA 4O0UA 2PK9A 3DKCA 3A8WA 1VZOA 3HRCA 5CEIA 3D15A 5DH3A 5B7VA 3DAJA 4F1TA 2J0LA 3VRYA 3U87A 2C6KA 4AE9A 2R3NA 1U59A 3DCVA 3LFFA 5AADA 4F1OA 1W84A 3PY1A 2GTMA 3LQ8A 1V0OA 4FOBA 2ZOQA 4GU6A 4RA5A 1KOBA 4WG4A 5CU6A 5LCJA 3CSVA 5DI1A 3NVMB 3GCSA 3QHRA 4U3ZA 3GCQA 4JIAA 1Z57A 4BCJA 3SXRA 3A60A 5CF8A 5AIKA 4F7NA 2OKRA 3ZH8A 2R7BA 3AC5A 3F7WA 5C01A 4EKKA 4F0GA 3MB7A 4EH9A 1PMUA 4XG6A 3JUHA 4RJ6A 3MFUA 5FM2A 4CCUA 2QOBA 1ZYLA 5CXHA 3ULIA 2FSLX 2OFVA 3B2WA 4CT2A 3RM7A 3QTXA 3PXZA 1NW1A 3DQXA 1UKHA 5AUWA 1RDQE 2VTPA 3OCTA 5FP5A 3VBVA 5E9EA 5TR6A 2ONLA 4ZTNA 5H9BA 1G8AA 3F2AA 4O7YA 4H3QA 3FLYA 4IAYA 3VF8A 3ZC6A 2G2FA 5CSVA 1MQ4A 3RM6A 5EH0A 3PSCA 3OG7A 3FE3A 2VWIA 2RG6A 1SZMA 2Y9QA 4UWCA 2C5VA 4V04A 4DFXE 1LP4A 4C61A 5JMSA 3DK3A 4TY1A 4V05A 4APPA 5I3RA 3NUXA 4FEUA 4ASDA 2P2IA 4FC0A 2OXYA 3VUMA 3ZO2A 3RCJA 3OHTA 3HRFA 4KRCA 2WIPA 2YCRA 1OKYA 3HVCA 4K6ZA 4ZP5A 2UZEA 3OWPA 5KZ0A 3V8WA 2UZOA 2VO6A 4QYHA 3VS4A 4C7TA 3LCOA 5IUHA 4JDJA 2BHEA 3FSFA 4FNXA 1OITA 4FSUA 2KTYA 4TYGA 3VW6A 3ZOSA 3SRVA 5AV4A 5AEPA 2O64A 3LOKA 4EOLA 4GS6A 3NNUA 4IBMA 2WTWA 1KE8A 3QQJA 4II5A 5DG5A 4LRMA 4E7WA 4UMUA 2JKQA 5AR7A 4Z3VA 2PMNX 4ZZNA 5IA3A 1GIJA 5HG9A 3QBNA 2IW6A 2R2PA 2PZIA 3OWKA 3EQIA 4QP9A 1V0BA 5HE2A 1ZOEA 3GU5A 4ZJVA 3A4OX 3QZFA 4C4JA 5M4UA 3QQLA 4MK0A 4ZSLA 5C8MA 4YPSA 3QD4A 4PDOA 1KV1A 3QRKA 5AP0A 2XRWA 5CNOA 4BCNA 3PJ8A 4L3LA 1R0PA 3IW4A 5A4LA 3O96A 2XCHA 2X0GA 4H3BA 4I5PA 4LRJA 3EFLA 5CQUA 1YWNA 2J4ZA 3RBWA 4NJ3A 4MXOA 4OTHA 5HCYA 2W1HA 3LVPA 4L3PA 1P2AA 3IDBA 4FIHA 4M0YA 1PXJA 5K5NA 1PMVA 2ZV7A 3G2FA 3SGCA 3G33A 4DH8A 2PZRA 4LG4A 4X3FA 5CSHA 5HCXA 5AM6A 3A7GA 3V3VA 3R71A 5IUGA 5EOBA 5KMLA 1VYZA 4IH8A 4BBEA 2VN9A 4RJ5A 4QQCA 5HG7A 1SNXA 4EK5A 4WBOA 3FLSA 5I9WA 4QMNA 1OKZA 4ZY6A 4IX3A 4UMPA 2XF0A 1IAHA 2XZSA 3IKAA 2UZLA 3A61A 2OXXA 3MA6A 3L1SA 3PY3A 2EU9A 1CKIA 3RPVA 2WMRA 4CKRA 5BVFA 5HZNA 4BGHA 1RQQA 4HVHA 5CI7A 2XK6A 5K4JA 3D5VA 4IJPA 1ZWSA 2GMXA 4U7ZA 1NY3A 3WIGA 4AGWA 4AX8A 1W83A 4B8LA 5AA8A 1XBCA 2R3FA 3PJ1A 4XYFA 4ITJA 3GB2A 5EDQA 4CFWA 2BZIB 1IG1A 4BDEA 4C0TA 5CEQA 1RE8A 3REPA 3I5NA 3HMMA 4L68A 5AV2A 4AGCA 5CEMA 1J7UA 2WMVA 3QTUA 3KXXA 1QPEA 3I1AA 5E91A 3DV3A 2OFUA 4RIYB 2ITUA 3AMBA 3BYUA 3Q3BA 2H8HA 5KNJA 4JX3A 3NPCA 3WARA 3GEQA 3HGKA 2XBJA 4TWNA 4ZJIA 4FEQA 2WKMA 3F66A 3MBLA 4PTGA 3G0FA 2R3MA 3AG9A 3QLGA 1SVGA 4FZFB 4NJDA 3PLAE 5AX9A 4Y85A 4YTFA 5AV1A 3BYOA 2W4OA 5HG5A 4P90A 2J0KA 3RAWA 5ANDA 5HOAA 4BR3A 2WXVA 1DM2A 4YJQA 4UWBA 3DAKA 4TYHA 5LVLA 3HUBA 5AP1A 4NKSA 3W55A 3NUAA 3U54A 4JI9A 3OY1A 4BI1A 2VO3A 1YDSE 1NVSA 4RVLA 3EN9A 3KC3A 4IZYA 3BEAA 1M7QA 4CCBA 4QP4A 4KD1A 3BU5A 4NTSA 5CZIA 4BI2A 5CSXA 3LCTA 4AW2A 3AC1A 4DEDA 5EM6A 2B9JA 3U4UA 4QP7A 4WBBB 4FBXA 4XEYA 2WAJA 5F20A 3O23A 3HKOA 5IG1A 2CNQA 3F3VA 3FY0A 2WMWA 3HMOA 2B9FA 1Q97A 2V7AA 5EDPA 3LJ0A 5JZNA 2OZAA 3BU3A 4O84A 3AMYA 2OIDA 4N6YA 3I5ZA 2XKDA 3SG9A 3FMEA 4YZ9A 2QOQA 2RFDA 3HMNA 3ZLSA 3EQBA 4I6QA 4MD8E 4JS8A 3CTQA 2VUWA 4M69A 2QCSA 3COHA 3TKUA 1PKGA 2X7FA 2HY81 2FVDA 3LIJA 5AV3A 3R9HA 4C4FA 1ZXEA 4EK3A 4QMUA 5J7BA 1WBWA 3ORKA 3NDMA 2UW0A 5E8TA 2VGOA 4FIIA 4NTTA 1OVEA 1YI3A 3U4WA 3IDCA 4DCAA 4PL3A 2IZSA 2YDJA 4QD6A 2ZMCA 1UKIA 3GUBA 2G2IA 3GC7A 4CMTA 4YTIA 4X2JA 2OBJA 3OC1A 4QQJA 3E64A 3RTPA 4DLJA 5HO7A 2XB7A 4LUEA 1Q4LA 4OTRA 5ANOA 5L3AA 2YM5A 3P23A 4I0SA 3L9LA 4CEGA 3AC4A 3QC9A 3MH0A 4JXFA 3O0GA 3UE4A 2WMTA 2OJ9A 4M0ZA 4EK4A 5K0XA 2F7EE 4GJ3A 4BC6A 3SG8A 3DBFA 1VJYA 4R8QA 2HYYA 3MDYA 1H1WA 4JNWA 4LGDA 5CY3A 2O3PA 3LFSA 2Z7LA 2YLFA 4RVMA 4AT4A 5IA0A 4KKEA 3BZ3A 2VWUA 3QKMA 3R00A 3H30A 4RIWA 4EUTA 4ZIMA 4PMPA 4C33A 4O0VA 3OP5A 3DXNA 3K54A 4HZRA 4CLIA 2GNHA 1F5QA 4UV0A 2JDSA 3OUNB 3TEIA 3LHJA 4KIPA 4NU1A 3UYTA 3MA3A 4AW0A 4D4SA 1W7HA 1WBNA 2ITNA 3B8QA 1V0PA 2Z7QA 4F99A 2YM8A 4BIDA 3P79A 5TKDA 4HNFA 3BU6A 4MF0A 5F95A 4E93A 3FC1X 3ZFYA 3UDBA 2OLCA 2WEVA 3DXPA 1WBPA 4FTRA 2I1MA 3EFKA 3ZO1A 4BTJA 4YC8A 5EM5A 4AW1A 4EOJA 3PFQA 1RJBA 5A9UA 4UBAA 3MN3A 3NZ0A 4G3CA 3OD6X 3ANRA 1W8CA 1KE7A 4YP8A 2W05A 4EOSA 3FAAA 4TYEA 2V0DA 5LMBA 3C9WA 3OWJA 2DWBA 3DNEA 4A4OA 3KREA 4PRJA 4FNZA 4LGHA 4ZSAA 3OMVA 4OAUC 3PJ2A 2GQSA 3WYYA 5CT7A 2EB2A 3R7IA 3FI4A 3UMWA 3UP2A 3LMHA 3DPKA 3R8PA 4EH6A 1XWSA 3ZM4A 4O7NA 3ORIA 3WF9A 1FMOE 5TF9A 3R63A 3GOKA 4MH7A 5LCKA 1H28A 3EMGA 4L44A 4MAOA 2VNWA 5BUEA 3OF0A 4L3JA 4RGJA 4O6LA 5CU4A 1H25A 3EQFA 2WD1A 1WVYA 2UW8A 2WTIA 2CGWA 4KABA 3TUBA 4BTFA 3WILA 4DINA 5J95A 4A9RA 5F4NA 4QMMA 2Z7RA 4IWOA 2A27A 5CENA 2XP2A 2W1GA 5KMNA 1WCCA 3TV4A 4DH3A 4RG0A 4UN0C 1CDKA 2AYPA 1GIHA 2Y7JA 4QMZA 4D28A 2BRGA 2X7OA 5A4TA 2GS7A 2YCQA 2FB8A 3W10A 4TWCA 1WAKA 2GHMA 2YJSA 1LUFA 4RX9A 2YDKA 4AZWA 4JIKA 4DG3E 4DTKA 4D4VA 2CSNA 3LFDA 3ROYA 2YZLA 2OIQA 4DFBA 5GINE 2R3GA 5JQ8A 2J7TA 2B52A 5I9UA 4GKIA 4FKUA 5IPJA 4RVKA 4YURA 4MBJA 2BKZA 2ZB0A 3KRRA 4J8NA 4NW5A 3R8VA 4AW5A 4F63A 3BLQA 4E4NA 4FNWA 3FL4A 4O22A 4H05A 2CLQA 4GK4A 1YWRA 4BDAA 3HRBA 3LJ2A 4AZTA 1Q8UA 4G3DA 3IOKA 4R3RA 5HTIA 1IEPA 2YCSA 4F7LA 4DFNA 2W06A 3C4CA 3DZQA 5J7HA 2BRHA 3FV8A 4I94A 3EQPA 4FSWA 1LEZA 3ZFXA 2BPMA 3E88A 2WIHA 4GV1A 3BI6A 5KHXA 4XNEA 3DA6A 5CAPA 4IACA 5KE0A 4ID7A 3VUGA 3NR9A 2ZDTA 4JVGA 1NXKA 3EN4A 2QO2A 3H9RA 3R21A 2BAQA 3F5GA 4G6LA 5I3OA 1UNLA 1URCA 2WNTA 3ZRLA 4BKYA 2AUHA 4U3YA 1JVPP 3DAEA 4W8DA 3NW5A 3O51A 5AUYA 3R73A 4E4XA 3QWJA 4MWHA 4YMJA 5IQAA 2C6OA 3UG2A 1YRPA 2XUUA 2RF9A 3MVMA 3KXHA 4G3FA 2WTDA 3F82A 4XLVA 4NSTA 2WB8A 2YN8A 3V8TA 3DBDA 1KE6A 5EQPA 3KXZA 5BPYA 2UW5A 1P4OA 3DDQA 4JOAA 2ESMA 3O2MA 4KNBA 3Q9WA 3EB0A 3JY9A 4ZY5A 3MIAA 5HNGA 3ENHA 3TUCA 2VX1A 4FKLA 4GL9A 3KK9A 4RQKA 2WEIA 3QFVA 3OEZA 3D5XA 4Y72A 3SQQA 5M53A 1Y57A 1MUOA 3DLSA 2Y6OA 4JQ7A 3LFCA 4FX3A 2QOLA 4M66A 3BHYA 3SRVB 3EKKA 3MH2A 5CSPA 3SAYA 5M56A 4FSNA 5AM7A 3OOMA 3BGZA 4ZSJA 4BCFA 5LMAA 3QYWA 4FKRA 3PXRA 2XIKA 1OIUA 3L8VA 4O81A 3MB6A 4JRNA 5T68A 3IG7A 4ITHA 4FTLA 4J7BA 2IWIA 3T8OA 3C1XA 4HVDA 5BVNA 1OL2A 3PXFA 3WF7A 4XCUA 2PVFA 3PZEA 4E5BA 4NZWB 2PWLA 1JKLA 1Q8WA 3KGAA 3F9NA 2HENA 3P7AA 2X81A 5CT0A 4OTGA 1REJA 4FSYA 5DOSA 4TYIA 4DFZE 5ANKA 2R64A 3GC0A 3U9CA 3LKMA 4W4XA 1OBDA 3KULB 2J0IA 4MF1A 3MPMA 3C0IA 1L3RE 4I4EA 3R8UA 3EQCA 4UZHA 3D7ZA 1FPUA 4FA2A 5I4NA 4JAJA 1URWA 4YZCA 4K11A 2RIOA 3OCBA 4XBRA 4M84A 4X3FB 3BKBA 3QTWA 3QUPA 4FT0A 3RZBA 5CALA 4G3EA 4IIRA 4QMWA 4DLIA 1EH4A 2VO7A 4LMNA 4GT3A 2NRYA 3AGLA 3IGGA 4IWDA 4MYGA 5DIAA 3ROCA 4ASEA 1G3NA 5JGBA 2VTNA 4L7SA 4ORKA 4AWIA 3VW8A 1LR4A 3PVUA 3O17A 3QF9A 1PJKA 5BX0A 4N70A 3FPQA 2QODA 2C3LA 2WU7A 3ZO3A 3FLWA 3LE6A 1STCE 3TV6A 1JSTA 3NIEA 2HCKA 3L9MA 4YTCA 5TO8A 3ZEWA 3G6GA 1QPCA 5IQIA 5HESA 3FY2A 5IDPA 2CGVA 1SYKA 4S2ZA 2CLXA 2WGJA 4GIIA 3UIBA 4DEIA 3KN6A 3QRJA 4BVUA 2YJRA 3WI6A 4QQTA 4WSQA 3TZ8A 1BMKA 2VTQA 5AUTA 1GAGA 3BIZA 3KY2A 4ZTLA 3ZBXA 4EWQA 3E8NA 2PSQA 5FRIA 2O0UA 2YIXA 3D0EA 4OR5A 4ARKA 4FOCA 5IH6A 4AA5A 5AP4A 4U80A 5HBJA 1W98A 1Q99A 3P0MA 5D11A 1J7LA 3E7VA 4OUCA 3UOKA 4AACA 4DT9A 1O6YA 3OXTA 4TT7A 4HVIA 3A7HA 5DLSA 1H4LA 3V5QA 2C6MA 3UTOA 2W1FA 3DS6A 4YGAA 4DEAA 4RJ4A 4TYHB 4FE2A 2WQBA 4YJPA 5AUVA 3VUTA 2JLDA 4PQNA 4D9UA 4CTBA 4EC8A 2XA4A 4MBIA 4O82A 3PPJA 4YSJA 2XYNA 2XNPA 3AD4A 2B0QA 2BDWA 2G15A 3QXOA 3QCSA 4A4XA 4ENYA 5HORA 1JKSA 3P9JA 3R9RA 4FGBA 5I5ZA 3V51A 1OMWA 3FMDA 1YVJA 3FQHA 5AUZA 5HBHA 2BFYA 4J8MA 2YIRA 4R1YA 2GCDA 2XJ1A 5ETCA 2I0YA 3GQIA 3FKOA 4G34A 2CKPA 4KS7A 3ANQA 3AT3A 2OZAB 5BUJA 2YA9A 3UNKA 1PF8A 5IQEA 4UWYA 3BWFA 2IG7A 4AG8A 4AP7A 3W2OA 5I9VA 3V5JA 4DT8A 2PMLX 5H2UA 3RINA 3GP0A 4AF3A 4H1JA 3AD5A 3I0OA 2CDZA 4M69B 2W5BA 2QD9A 4XG9A 5DR6A 4BCKA 4GYGA 3KCKA 2XBAA 4IM2A 3DT1A 2ZJWA 2DYLA 1BYGA 2BR1A 3KEXA 2QOFA 5DA3A 4FTJA 1H00A 5ANEA 3WOWA 3HAMA 3MJ1A 5J8IA 4IEBA 5JEBA 4GMYA 2V55A 3CBLA 4TWPA 4L6QA 4ZXTA 1OM1A 4CTCA 2J2IB 5KMIA 3QUDA 2OSCA 3KA0A 5M07A 2CJMA 1SVEA 1PXPA 4WRGA 2UW3A 5CASA 4Y46A 3TKIA 1YI6A 3V5LA 4FODA 4X6QC 5ANGA 3W2SA 3EZRA 1R3CA 3F61A 4KKHA 4ANQA 3DFAA 4L53A 2OF4A 3QALE 4G6NA 4RIWB 4G2FA 5FG8A 2XK8A 5ITAA 5IEXA 4H36A 5AUXA 2XRUA 3IW5A 4O27B 3JY0A 4QTBA 4YSMA 3E3PA 2GNIA 3FXWA 3I7BA 3R2BA 4IVAA 4QMSA 5HX6A 5AIRA 3H0YA 1IAJA 2VWZA 4L52A 2BAKA 5KCVA 1M2PA 2ACXA 4I0TA 4FSRA 3VHKA 3RMFA 3IPHA 3JVRA 1YXSA 1XO2B 5L6PA 5K5XA 2QHMA 2OICA 5M51A 4O7WA 1NVQA 4AZSA 4TXCA 5K0KA 3QQUA 3CKXA 5HU9A 4CG8A 5AV0A 3ATSA 3EH9A 2HZ4A 4C3FA 3GFEA 3HLLA 3KCFA 5LJJA 2W1IA 3I60A 4KIKA 2WQEA 4ANNA 2F2CB 5A6NA 1JOWB 3LJ1A 2EWAA 2PHKA 5AR3A 4ZJJA 4DEBA 3KB7A 4XV1A 4KIQA 4B7TA 4OGRA 3SC1A 4AS0A 5LWMA 4FL1A 3B8RA 4RFZA 3NAYA 2BALA 3W33A 3P5KA 3K5UA 3C4EA 2BMCA 1ZAOA 2LGCA 3GCUA 3VN9A 3V5WA 5AX3A 3GU8A 3E93A 2J6MA 4C3PA 4EWHA 5KKRB 5L8LA 1OKVA 1J3HA 2BRBA 3QQKA 1PXNA 2UZDA 3QL8A 2ZV2A 2CMWA 2R7IA 5CEKA 3PDTA 3JVSA 3VVHA 4FKOA 4LI5A 2JDVA 2ZB1A 5FXRA 4X7QA 4PDPA 3WZUA 4BTMA 4UMQA 4C4EA 3TL8A 5A4QA 4CV9A 5HLWA 5M44A 3UQFA 1OL1A 3AD6A 4TTHB 2P33A 3TNIA 4CRSA 2PPQA 4KA3A 2XK3A 4FSTA 4GU9A 4D2VA 3K5VA 3VUHA 1VEBA 4O0YA 4XMOA 1OZ1A 2WU6A 4EH2A 2IZUA 3W2RA 4O7TA 2WTKB 4AXAA 4HGSA 3PIZA 3BQRA 3DDPA 3RWPA 4ZZMA 4A9TA 4CFVA 2LAVA 3GCPA 3VHEA 2J0MB 5L2QA 4C2VA 3Q6UA 3LW0A 1YHWA 4O6EA 4ACGA 4CGAA 5D10A 2HW7A 4DFUA 3MI9A 4MXCA 3LFQA 3OT8A 1Z9XA 3FQSA 5J1VA 3KMMA 2C5NA 3EQHA 5I9ZA 4C8BA 4LL0A 3MJ2A 3P86A 4QRCA 3WE8A 3ZSIA 4AFEA 1ATPE 1VYWA 2JDTA 3LMIA 3CJGA 3D5WA 3WF5A 2GNJA 2C1AA 4UYNA 3R9OA 5HX8A 4W4WA 5FXQA 5HO6A 5JQ5A 4JJRA 2B4SB 2OK1A 4M7IA 2XJ2A 4Q5EA 3PG1A 4DTAA 3BEGA 4ASXA 5DR9A 2GHLA 4U5JA 3VBWA 4DBXA 2XK4A 3TI1A 2YLEA 5CEOA 3M1SA 2BZKB 2WMAA 3IW7A 5FEQA 4TPTA 3CP9A 4D0WA 1WBSA 2J90A 4FNYA 3DTCA 2HZ0A 3NVKI 5HE3A 4V0GB 3ITZA 4X2KA 4XUFA 5L8JA 2ZAZA 1OPLA 4AOJA 4O0WA 1XH8A 3QRTA 1KV2A 4NFMA 4QYYA 2J5EA 2I40A 3WE4A 4FIFA 3DK7A 3QQFA 4O0SA 3C13A 3DKOA 1R1WA 5T3QA 2OH4A 4ACDA 4CT1A 4DC2A 4BIBA 3LXLA 3ORMA 3ORNA 4E5WA 5HVYA 1Q41A 3P78A 1YKRA 2GQRA 1OUKA 1U5RA 2VWYA 5HU3A 4I1ZA 4O7RA 2XNOA 5ACBC 5JK3A 3PTGA 2HXQA 2XIXA 5E8YA 4WT6A 4N6ZA 1OGUA 3COMA 4R5SA 3FJQE 3FKNA 2JIUA 4KSQA 4GJ2A 4HOKA 4FKWA 4IXPA 2R3RA 5FEEA 3GC9A 2V7OA 4Z16A 2WMSA 2DS1A 4FG8A 4FICA 5CU3A 4AOIA 2VTJA 3K3JA 5A46A 3MH3A 5AP7A 1J91A 2ZV9A 4USFA 4L8MA 2G2HA 2UZNA 4U6RA 4QP2A 3QXPA 2E9OA 1ZYSA 2X2LA 2XVDA 4I5CA 4FKVA 3RAKA 5IDNA 1KSWA 4WA9A 4YNEA 4G31A 4FV6A 4AN3A 3QAME 4HW7A 2ITVA 2O5KA 3SOAA 3MSSA 1H1SA 4FKIA 4U9AA 2FYSA 3FL5A 3UJGA 4USEA 2UV2A 4EYJA 1MQBA 2UVZA 2XIZA 3U9NA 3R02A 4YBKA 3DJ5A 3PA4A 3HECA 4PY1A 5EKNA 5CVGA 1JPAA 4ALVA 1XH9A 5IISA 5LVMA 1U5QA 1QL6A 4ALUA 4EOIA 4NUSA 4BHZA 4XH6A 3MFTA 3ZU7A 3ZC5A 5BMSA 4P5ZA 3PWDA 4I92A 4NW6A 4A9SA 3VULA 2C3JA 3W32A 1F0QA 3IQ7A 4RIXA 2VO0A 2ITWA 3BRBA 4JQ8A 3II5A 4WSYA 5LARA 5EKOA 1X8BA 1PXOA 1YDTE 3NUUA 5E8VA 4CMOA 4EUUA 2PUUA 4AQCA 5IEVA 5KBQA 2EXCX 1PY5A 2CGXA 5E8ZA 2HK5A 2I0VA 3T9IA 4E6DA 3IONA 4O91A 2R5TA 1JSVA 2R0UA 1W0XC 4CQGA 1FINA 3O7LB 2GFCA 2PUNA 3NSZA 3RALA 1IASA 3LFEA 3DGKA 3LAUA 4U44A 4RJ8A 5LMKC 3EFWA 1PXIA 2Z60A 4TWOA 1H0VA 5H8GA 4GK2A 5CTPA 4BWKA 4PNKA 3PIYA 4U40A 4GKHA 4PTEA 2Y4PA 3TZ7A 4EOKA 4FG7A 4I6HA 2C6DA 3GNIB 4TL0A 3ALOA 3G51A 3JXWA 2XEYA 3V5PA 1OL5A 4ZTSA 3UZRA 2J0JA 2WOTA 4RWLA 3SW4A 5JGAA 2YM6A 3MPAA 4BZNA 2R9SA 3D9VA 4PL5A 4GH2A 4MXXA 3C5UA 3G15A 4IADA 3QZIA 4UZDA 4EH8A 5EM8A 3VJNA 2R0IA 4FT3A 4EL9A 1J1BA 4JT3A 4KKGA 4YJUA 4QMTA 4F70A 4QNYA 3PPKA 4QTDA 4S32A 2HWOA 3R8LA 3U51A 4EI4A 5CVFA 3LCDA 3BELA 2B7AA 4XP0A 4EZ3A 3FWQA 3ZLYA 3PSBA 4F6UA 3Q6WA 3BLRA 5C4LA 5IUIA 2CN5A 4DH7A 2FH9A 4IFCA 4O7SA 2OF2A 5IKWA 3QRIA 4CNHA 1CTPE 2QQ7A 5JFSA 3GOPA 4HGLA 4LUDA 4YJOA 4Y8DA 4O2ZA 4GT5A 5FBNC 1VR2A 4K8AA 1I09A 3LMGA 4FVQA 4IJ9A 4LV8A 5AR5A 4DN5A 5CF4A 3UPXA 1BKXA 2W5HA 3LFAA 3KL8A 1H26A 1P5EA 2EVAA 3BGQA 4Y73A 4EOOA 2GDOA 2QOOA 2FA2A 3NYOA 1O9UA 4FTMA 2OXDA 4QMOA 3I81A 2NNWB 3FZTA 3PVBA 4GCJA 4EHGA 4PMSA 3BLHA 4E8AA 4FIJA 4ACMA 3H4JA 3FQEA 5B2MA 4DG2E 5IA5A 4BDCA 4QYEA 3CQEA 2C6IA 2HZNA 5J87A 4ZLOA 4FT7A 4EQUA 3LLTA 4XOYA 3HA6A 3U8WA 4IHPA 2ITTA 3N51A 4WKQA 4DG0E 3PXYA 4W4YA 5FLFA 4ITIA 4MXYA 5I9YA 1E1VA 1MRVA 3RVGA 4EOQA 3OXZA 3S3IA 4O7VA 2X4ZA 3DJ6A 4QMXA 5TE0A 3A8XA 3I6WA 1FBNA 3IDPA 4FEVA 3E5AA 4CFXA 4UMTA 3LFBA 4I24A 3KKVA 2JIVA 3TACA 3DQWA 2BUJA 3ZLWA 4TW9A 5HBEA 2YERA 3OW4A 4W9XA 3R8MA 3PJ3A 2C4GA 4QO9A 4HVGA 3Q60A 1A06A 1WFCA 2PE0A 2C6LA 3F2NA 5KX8A 4FKTA 2QOHA 5HLPA 4KAOA 5F9EA 3VAPA 4DBNA 3B2TA 4F1MA 3W18A 4D5KA 2VWBA 4PF4A 5E8SA 3RNIA 3S95A 1OPKA 2IVVA 2PZYA 3WZJA 3CC6A 2VTHA 3DBQA 3HV4A 3N4UA 3Q04A 1XHAA 1ZARA 1S9JA 1GJOA 4D4RA 3U55A 4OT5A 2UW7A 3D83A 3FMJA 4I5HA 4USDA 4RQVA 5ANIA 3UOLA 3LM0A 1XH6A 4G1WA 4KIKB 4AOTA 3LQ3A 3DKGA 4EC9A 3N9XA 4ZAUA 1JKKA 4BCOA 2PMOX 3QTSA 4S30A 3OOGA 3D4QA 4ZSGA 3V5TA 1JWHA 2J51A 5E92A 3WZDA 5FDXA 1NA7A 4OW8A 3L8PA 3JYAA 5J9YA 4BN1A 4MVFA 1DS5A 3AOXA 3TT0A 1OPJA 3VC4A 3ZLXA 2XMYA 1UWHA 2XK7A 3ORPA 2R3LA 2QOCA 3R7GA 5KMMA 2EB3A 4NIFA 4I20A 2R3HA 3LLAA 3HV6A 3MY0A 3FZOA 3VF9A 4YO6A 2V62A 3ZUUA 1HOWA 4J1RA 4JDKA 2UZVA 3KF7A 4JBVA 4GSBA 4R7HA 4YJTA 3F3WA 3CIKA 3GT8A 4U41A 3VBTA 4J53A 3DBEA 3PVGA 3TJCA 4D2RA 3R7UA 4YJRA 4CZTA 4CV8A 5AP3A 3QQHA 3RNYA 2OJFE 4TNDA 4DEHA 4WIHA 3HEGA 5G1XA 3ENMA 4IMYA 4S31A 1BL6A 3ZBFA 2H6DA 4ZLZA 3ORLA 4NWMA 1OECA 2IW8A 1GZKA 1PMNA 1V1KA 3DZOA 2UZTA 3E87A 4RLKA 5EW8A 4EJ7A 3DFCB 5D1JA 2E2BA 1MP8A 4WNPA 1XJDA 2XM8A 3MY1A 2HY0A 2HOGA 3EYGA 4NM5A 3HMPA 1Q61A 4IDTA 4H58A 3GVUA 3GXLA 4IDVA 3AXWA 2ZM3A 2HXLA 1E9HA 4MHAA 4GEOA 5CS6A 3UZTA 3F88A 2X9FA 4A4LA 2JIIA 3FEGA 1AD5A 3IOPA 3C4FA 4X3FC 4RC2A 4YPDA 5FQDC 3VIDA 3C4XA 5IQGA 5IU2A 3FMMA 4IB3A 4NCTA 5H8BA 4PX6A 4GYIA 4Y83A 1UNHA 2PTKA 4BBFA 2UZBA 2ZVAA 3ZZWA 3MPTA 5C4KA 5AFVA 4PP7A 2RKUA 4I6FA 3CJFA 3RWQA 1AGWA 3NW7A 3KXNA 4BKJA 1PW2A 4BDHA 2C47A 1JBPE 3P4KA 5AR2A 3Q96A 2JAVA 3KRJA 5EHYA 5H8EA 5H3QA 3QTRA 4I4FA 2QHNA 1UU9A 1YHSA 4GK3A 3PRIA 4DGLC 4EQMA 3WYXA 4F9YA 3MYGA 4ZOGA 3RGFA 5DYJA 3VS2A 2IJMA 5IQDA 2UZWE 4OLIA 4XP3A 3IK3A 2VX3A 3QZGA 4BYIA 5E4HA 4FK3A 4FIEA 4IC7A 4FEWA 4B9DA 4OTWA 2JFLA 5EHOA 1DI9A 4GIHA 4XS2A 5DBXA 2UUEA 4XG2A 3QZHA 4FV5A 3Q2MA 3WF6A 1TKIA 5DEWA 4DGGA 5HQ0A 4G9CA 3ACKA 3SW7A 2F4JA 4EKLA 4ZMFA 1YQJA 4G5JA 2WQOA 1DAWA 5L6WL 1BUHA 3MVJA 4FF8A 4UXLA 3TIYA 3RPRA 2ETMA 2F49A 5LVPA 5CF6A 4F9AA 1YDRE 3GU7A 4B0GA 4EHZA 4FL2A 2H96A 4HYUA 3O8PA 2IVUA 4R7IA 4PUZA 4XLIA 1WMKA 4ZTQA 4LMUA 3CKWA 1CKPA 3VRZA 4E6CA 3EWHA 5E7RA 1ZOGA 3ZCLA 1FVTA 3DXQA 3MS9A 4JAIA 1ZYCA 4QQ5A 3U6HA 3MFSA 4O38A 3QQGA 3RAHA 4YUQA 2IZRA 4I41A 4M97A 2A2AA 4XV3A 2VWXA 1BI8A 2PVKA 4PPCA 3RJCA 1TQMA 2WHBA 5CXZA 2PVNA 2PVJA 4XHKB 1BL7A 1ZRZA 4HCUA 4D1ZA 3PPZA 3NUYA 4Z55A 3R7EA 3QU0A 3GBZA 2YABA 3P7CA 5HIBA 4FMQA 2YFXA 5FTOA 1ZMUA 5A4CA 3VS7A 4FTNA 2O65A 2QC6A 2F2UA 5ICPA 2OO8X 2VNYA 2X39A 2VZ6A 3UZPA 3DU8A 3R01A 5IA1A 5CVHA 3OY3A 2PMIA 4FV4A 4EH3A 3LCKA 4MNEA 3OT3A 3GENA 3POOA 5L4QA 4HYIA 2GSFA 2ITQA 3F5XA 4LOQA 4FUXA 3UBDA 5JSMA 4ANBA 3RAIA 2XS0A 2BIKB 4CFFA 4WUNA 4BBMA 4JQEA 3G0EA 5JFVA 1E1XA 3BE9A 4LRKA 4RIXB 5EYKA 2I0EA 3OCSA 4FVPA 3H3CA 4O86A 3FBVA 3MY5A 4RMZA 4D1XA 4DGOA 3H10A 4O1OA 4MD9E 5G6VA 4NFNA 4O0TA 4XJ0A 4D0XA 5IMXA 2RFSA 4FKPA 5EDRA 3FI8A 2W4KA 4D2SA 1WBVA 3D7TA 2BVAA 2IN6A 3IW8A 4UXQA 5F1ZA 3OTVA 4FIGA 1TQPA 3UGCA 4E6AA 2CNUA 4U0IA 3CS9A 3QUEA 3VQUA 4EORA 5GIOE 3KXGA 3FUPA 4O83A 3G6HA 5J9LA 2OZOA 3UOHA 4PMMA 4BZDA 4RIYA 2W96B 3KXMA 4ZS4A 3COKA 4DTBA 2CNVA 3UOJA 2UW4A 4JRVA 4JDIA 5AP6A 1XBAA 3FMNA 1K9AA 5HNBA 3E63A 1Q8ZA 1JNKA 5TT7A 4AAAA 5IA4A 4YC6A 2YACA 5KBRA 2GQGA 4R3CA 4J96A 1M14A 1ZY4A 2BDJA 1Y6BA 4FYOA 3O50A 3Q32A 5K4IA 4K18A 3CTHA 4MXZA 2FSOX 2P0CA 3BHUA 4BDBA 2YEXA 3QX2A 3CLYA 1T45A 1M2RA 1JSUA 1KOAA 3FYJX 3ZFMA 3BE2A 5EI6A 4DITA 5DMZA 2F7XE 4QT1A 3SKCA 3G90X 4PPAA 5DN3A 3BHVA 2X9EA 3CR0A 1LEWA 4LGGA 4QPMA 2BRMA 1QPJA 3ERKA 1HCKA 4F64A 4F7JA 2C1BA 3S0OA 1Y8GA 3F6XA 3TG1A 2YM4A 5HCZA 1JAMA 3DB6A 1IA8A 3PLSA 2ERZE 2HAKA 4BCHA 2B9HA 2B53A 2GS6A 1YHVA 1SVHA 5KMOA 5C9CA 5KKRC 1MRYA 5AAEA 3KN5A 2GFSA 3PXKA 5L2SA 4LFIA 4W8EA 5BVOA 5LVOA 2PVHA 3PE1A 4M15A 4E73A 2Y0AA 3A2CA 2Q83A 1FOTA 3HDNA 4LM5A 3KRWA 4DCEA 1ZMVA 4TYJA 3R7YA 4DE4A 4JLCA 2R3OA 3BCEA 4A9UA 4E26A 4L46A 4P2KA 2R3KA 1R0EA 5JRQA 4ZTHA 1FQ1B 1T46A 3Q53A 1PXKA 4WOVA 2XH5A 3NYVA 3VBXA 3EL7A 3F3UA 1YOJA 5BVKA 4G9RA 3PY0A 4RPVA 4EK8A 1JQHA 4IW0A 4FL3A 3R83A 3UG1A 2WZJA 3NW6A 4AT3A 2WTKC 1UWJA 1FGKA 4K9YA 2ETKA 1YOMA 2GNGA 3I4BA 3Q2JA 3CCNA 3QWKA 1BX6A 1PRYA 2CGUA 2YISA 4YJVA 3R9NA 3TTJA 4EOMA 2XJ0A 1UU8A 3KQ7A 4RZVA 3SV0A 2ITZA 1GZ8A 3OEFX 1H8FA 1CM8A 4ZK5A 4A07A 5A3XA 1OL6A 3HUCA 4E1ZA 1ZYJA 4DGNA 3Q52A 3UIXA 4KBAA 5DEYA 4GVAA 3E8EA 5HD7A 5TOZA 5C1QB 5EW9A 2JEDA 4FTKA 5JRSA 4BICA 3RKBA 1M52A 4RWIA 2Y4IB 4ONAA 3FYKX 2OH0E 5CLPA 4RIOA 4R77A 4AFJA 4CG9A 3FXZA 4ENXA 5EQYA 2FUMA 3EL8A 3MGYA 4KS8A 2C0IA 4PDYA 4U97A 4X2NA 5LMKA 3LPBA 2YCFA 3PJCA 4FYNA 4QP3A 4AGUA 1YXTA 2VTSA 1K2PA
chains in the Genus database with same CATH superfamily
1KE9A 2BAJA 3UIMA 4EJNA 4O7ZA 4HCTA 4DGMA 4FKGA 1OL7A 3NAXA 3RK9A 3G9LX 4PNIA 4YZNA 4F6SA 3TNPC 1OIRA 3NNVA 4JG8A 3NYNA 1H1QA 5ANJA 4F09A 4GT4A 2R3IA 3EQRA 3FLZA 4GUBA 2W1DA 4IAIA 4M13A 4E4LA 5JT2A 1PMEA 2ITYA 2BIYA 3MV5A 2UVYA 4DHFA 3W8LA 1PHKA 2NP8A 2BFXA 4G3GA 3ULZA 5FD2A 3UVQA 4IB0A 3TDWA 1B38A 4RX8A 2WMQA 4X2GA 3TNHA 4RJ3A 3UODA 2W9ZB 2I7QA 3F2RA 2ETRA 3QGYA 4QPSA 4H1MA 3CY3A 2P4IA 2Q0BA 4NEUA 4OTFA 3KF4A 1NT2A 2UVXA 1F3MC 2PVLA 1I44A 2C0OA 2CCHA 2GNLA 5C03A 3RPSA 4NIFB 3FI2A 3ACJA 4JBQA 4OBPA 4LDTA 2RFEA 3NGAA 2CHLA 3QD0A 5DRBA 2C30A 3SD0A 3KVXA 2O63A 4ZTMA 3FLQA 3ID6C 3FPMA 4Y5HA 1M7NA 2PULA 4G6OA 5D7VA 2Z8CA 5EYDA 3TCPA 4KRDA 2GTNA 3OFMA 2EUFB 3MH1A 5F94A 5M09A 4IX5A 5EYMA 2AC3A 3ZO4A 2KULA 4R78A 5C26A 3AC8A 3RHKA 2Z2WA 4FV3A 4ZLYA 5L2IA 3BHTA 4AN2A 2W9FB 3BHHA 4RVTA 4UYAA 1B6CB 3FKLA 4FRFA 4IZ7A 3NWWA 2J9MA 5FP6A 2BROA 3ATTA 3H9FA 5GHVA 1YWVA 4Z9LA 3K2LA 3D2IA 3QHWA 1REKA 1J1CA 2NRUA 4Y95A 2REIA 4Z7HA 4KB8A 5EQEA 3FMKA 3R0TA 2X6DA 4FKSA 5CAQA 2B54A 3D14A 4QNAA 4TKSA 2QR8A 1ZZ2A 4GW8A 4QYFA 3GU6A 3OS3A 4AZFA 5IQBA 4CMUA 2UZUE 3NUSA 4RA4A 4J71A 5D9HA 5AAGA 4CVAA 3EZVA 3ZZEA 3FMLA 2B55A 4E3CA 5HTCA 3Q4UA 3VO3A 5FEDA 3O71A 3ZMMA 2IW9A 2Y8OA 3CD8A 4IVCA 3ZHPC 3HX4A 2P55A 4PDSA 4RJ7A 3DLZA 5JFXA 4JG6A 3BBTB 1ZMWA 3MTLA 5IQFA 3VS3A 4M12A 4WNOA 3FZRA 3ORXA 2PL0A 2PE1A 3Q5ZA 5CAOA 2ZYBA 2ZV8A 4EZ5A 3DKFA 4G17A 5CU0A 2QKRA 3TTIA 1KUTA 5HGIA 5CU2A 4OTIA 2QONA 3DOGA 3DK6A 4FUYA 4FZ7A 4YJNA 3C50A 2WTCA 3OXIA 4A06A 5CAUA 3EQDA 5IH5A 3UPZA 2EXEA 4ACHA 2VX0A 3PP1A 1JKTA 2GNFA 4C62A 4S33A 4CQEA 3TM0A 3KMWA 4U8ZA 5AR4A 4ZEGA 4B8MA 4CZYB 3BV3A 4D5HA 5FTQA 3NRMA 4NH1A 5IEYA 2JBPA 2ZDUA 2EXMA 3GCVA 4LOOA 3SA0A 3E62A 3R9DA 4ACCA 2JFMA 2WTVA 4GRBA 3RCDA 2B1PA 4WUAA 2PUIA 4P5QA 3MIYA 2HIWA 4BGQA 3LXPA 1UV5A 1O6KA 3CQWA 5BVWA 3TZ9A 3ZDIA 3KU2A 4C35A 3FZPA 1Y6AA 4YU2A 4A9YA 2A19B 3UVRA 3KIOC 4YLLA 3AC3A 5FTGA 3OBGA 4M3QA 5HNIX 3O8TA 4M14A 1Y8YA 3ZXTA 2YWVA 4YHTA 4XP2A 5A4EA 2C5OA 4YO4A 2V22A 2J50A 2OG8A 3PRFA 5DRDA 1BI7A 3DJ7A 5AJQA 3EFJA 5CF5A 4FG9A 5HTBA 1L8TA 4FSZA 4HVSA 3ZUVA 3UDSA 2XKFA 5FGKA 4YZBA 1ST0A 4YNOA 3ZRKA 2OGVA 2VWVA 5DT0A 4MBLA 3R7VA 4EK6A 2C5YA 4JR7A 4MQ1A 4R3PA 5B0XA 2QVSE 4RBLA 3UO4A 5HD4A 2H9VA 2YIQA 1WBTA 2XIRA 3TXOA 2PVYA 3T3VA 1YI4A 1TQIA 4MXAA 4QP1A 3KULA 1OI9A 4PV0A 5EFQA 5JH6A 3ODZX 4C36A 4NL0A 3P08A 2BTRA 2W1CA 4EH4A 2WELA 4RC3A 2ZM1A 3HDMA 2WMBA 3ALNA 4JBOA 2OJIA 3QRUA 3QKKA 4MNEB 3BYSA 2VTIA 4FZAB 4N4SA 4OBOA 5E8UA 3RK7A 4ZTRA 4AU8A 5D7AA 2PY3A 3WF8A 5JKGA 5KMKA 4ZMEA 2Z02A 2JC6A 5IQHA 5ETAA 5CAVA 4RFYA 3L9NA 2BHHA 4BRXA 2ZM4A 4QEBA 3D5UA 3I79A 5C8KA 4PMTA 4D2WA 2GHGA 2CKQA 3W8QA 3S4QA 3R6XA 3DY7A 4ANSA 4NM3A 3R2YA 4LYNA 1IR3A 2VTRA 5IQCA 2AC5A 1NVRA 2VTTA 1U46A 2X6EA 3A62A 1PYEA 3MVHA 2WQMA 4QMYA 4F65A 4K77A 3SVVA 3D7TB 3COIA 3ORZA 4XRLA 3RI1A 3TZMA 3N4TA 3EYHA 2O8YA 2PE2A 3EIDA 3GGFA 4KWPA 3UVPA 3ZONA 4C3RA 5GJFA 3HL7A 1H01A 2YIWA 2W1ZA 5DWRA 4B99A 4D2TA 4R7BA 4RRVA 3A4PA 4M67A 3H0ZA 5HE1A 3JR1A 2DQ7X 2C69A 4EH7A 4FV0A 2WFYA 4GFOA 2BRNA 4HYSA 3EKNA 5HKMA 4AXEA 3TNWA 4L01A 2QU5A 3BWJA 3VBQA 3LFNA 2W17A 2P2HA 3QGWA 4L45A 3SDJA 5M06A 5B2LA 2OJJA 4BCMA 5L2TA 4QTAA 5EG3A 1G5SA 4C58A 5FDPA 4DEEA 5HVJA 3Q4TA 1P14A 1OIYA 4O4CA 4AZVA 3AQVA 4JX7A 4F9WA 2A1AB 2WO6A 4F0IA 4I3ZA 3R1NA 5GZAA 1UU7A 4MX9A 5HG8A 3UO5A 4AE6A 2V5QA 4BWPA 4FT5A 1Q5KA 1S9IA 2C68A 3BPRA 3KFAA 3JPVA 4Q9SA 1M17A 2GPHA 2JDRA 2QNJA 2WTJA 4QP6A 4EONA 4HPTE 5BUIA 3CXWA 4UX9A 2NYAA 4FGRA 1U54A 4HYHA 4FZDB 4JR3A 4Q5HA 2X8DA 4QTCA 4X2FA 2QG5A 4X0MA 4ALWA 4GUEA 5K3YA 1DAYA 3Q9YA 4PPBA 2R3PA 1U4DA 4HPUE 3UC3A 4IWQA 4C4HA 5J1WA 4CSVA 5A54A 5M08A 3FDNA 4ANOA 3T9TA 4I5MA 4DYMA 2PUPA 1KWPA 4IC8A 3KRLA 4QDEA 4QOXA 3RHXA 3CPCA 4BWXA 2Z7SA 4C37A 3G9NA 5FWKK 4J99A 4NT4A 4F7SA 1XH5A 3W1FA 4OTDA 3KK8A 3MESA 4BY9E 1OIQA 3E3BX 4BKZA 4H39A 3FLNC 5GJGA 3ZSGA 4JG7A 4WNKA 3UQGA 1J7IA 3CY2A 5AWMA 3G5DA 5HHWA 3A99A 2VTLA 3NYXA 4CXAA 5IF1A 5L6OA 5M4FA 2E9VA 3P1AA 1GZOA 4FI1A 4LOPA 5BNJA 4QMQA 1R39A 4CZUA 1W82A 1K3AA 2WMXA 1IA9A 3S00A 3QTIA 1PKDA 4LV5A 3LM5A 4K2RA 2VRXA 3R7OA 4IAKA 2A0CX 3QLFA 4O21A 1UA2A 5C27A 3PUPA 2A98A 5AAFA 5K9IA 2XNBA 4C2WA 5AP2A 2CKEA 4NM0A 3EHAA 3FXXA 3S2PA 3LXNA 3WZEA 3WZKA 4EEVA 1WBOA 5J5TA 1G8SA 2J5FA 1OBGA 3BBWA 4IFGA 4I21A 4OTQA 1O6LA 4UALA 5DVRA 4KBKA 5EI8A 2VTAA 3OVVA 4U81A 4EYMA 4C4IA 3Q5IA 3CEKA 3R04A 4I6BA 5DFPA 4P7EA 4OTPA 4U42A 1B39A 4BF2A 4FV9A 4R6VA 4E5AX 3K3IA 5BVDA 5DNRA 4PP9A 1CMKE 3A7IA 4CFUA 5KUPA 5HIEA 1M2QA 4L7FA 1ND4A 2JBOA 2ONLC 3MFRA 4N0SA 1ZZLA 1ZLTA 2G01A 4RT7A 2X7GA 1XBBA 4HZSA 4EOPA 2QO7A 3PA3A 2HW6A 3V6SA 5HLNA 3NNXA 3NEWA 4S34A 5A6OA 2PVMA 1Z5MA 4AZEA 3TIZA 2DUVA 2QLQA 4C02A 3C0HA 3IGOA 3FC2A 1DI8A 3GU4A 5CQWA 3R8ZA 3L8SA 4OBQA 2XYUA 4AN9A 2X4FA 3QCQA 5HO8A 1HCLA 2OJGA 4C59A 1RW8A 1PXMA 1Y91A 2OU7A 3OUKA 4AAYA 3D94A 5CI6A 3H9OA 3VS0A 4G5PA 3NLBA 4W9WA 1WVXA 2R3JA 2IO6A 5KZIA 4JBPA 4U79A 4FZ6A 3VS5A 4QPAA 4UY9A 3JS2A 4FR4A 3ELJA 4OT6A 2OW3A 2BILB 4FTTA 2R4BA 2QI8A 3C51A 5DPVA 3Q9XA 4O7LA 3W0OA 2X1NA 5DHJA 2HZIA 2HELA 1H07A 5LWNA 1XH4A 4FTIA 2YZAA 4QMVA 1ZOHA 2JD5A 3CTJA 1GZNA 2BZJA 2G9XA 3V04A 4BB4A 4BGGA 5AUUA 1GNGA 4DH1A 4BDJA 2ITPA 5B2KA 3C7QA 5FUTA 4I22A 3UDTA 1ZYDA 2XCKA 5EK7A 4BDGA 3OTUA 5E1EA 2I0HA 4DFLA 3PP0A 1CSNA 3PE2A 4X3JA 4HJOA 4KIOA 4E20A 4FTCA 3ZRMA 3UYSA 3UQCA 4V01A 4CKIA 2YHVA 3PA5A 4BCQA 4JDHA 4QMLA 5M4IA 3TV7A 3IECA 3KVWA 1QCFA 3BYMA 4I93A 3IW6A 4LL5A 3W0QA 2I6LA 2VD5A 3RPYA 4IE9A 3MTFA 3W2QA 5A14A 2BKKA 4BFMA 4EH5A 3FHRA 3THBA 4CD0A 2JKOA 4HGEA 4IM0A 4O0XA 3PG3A 4IAZA 1TVOA 4RWKA 3I6UA 5GZ8A 4UEUA 5J9ZA 1XKKA 5M55A 4WO5A 2P3GX 3DB8A 2YAAA 3WBLA 3O7LD 4YR8A 2B9IA 3ORTA 3ZEPA 4DHJA 2W4JA 2JKKA 4F9BA 2C3IB 3VS6A 2XEZA 4CLJA 3WIKA 4ERKA 5CANA 4XG8A 4JL9A 1XH7A 5BYLA 3QX4A 3NCGA 4O96A 5L2WA 5BVEA 4L67A 2QG7A 3E8DA 1ERKA 3ETAA 5JFWA 4FKJA 3BL7A 4EQCA 5DT4A 2QKWB 5CZHA 4QP8A 4NK9A 5LQFA 4OAVB 4RX5A 1H1RA 1Q3WA 4IANA 4YHFA 4MNFA 3VWAA 3W0RA 3F3ZA 1QPDA 3EJ1A 4V0GA 4E6QA 4CYIA 3TWJA 2C6TA 4MEDA 3IO7A 3W2PA 4K1BA 4YLJA 3CQUA 4E4MA 3GQLA 2W0JA 2IPXA 3E92A 5ETIA 1W2CA 3VJOA 1YXVA 4DEGA 1SNUA 2QOKA 2X2KA 4Q9ZA 4XG7A 2QLUA 2JDOA 3C5IA 3GFWA 2R3QA 3A7FA 2RGPA 3ZS5A 5BMMA 5I0BA 1UNGA 2QOIA 4FKQA 3TNQB 4IB1A 4YZDA 4AA4A 5JN2A 5GIPE 4MQ2A 1LPUA 4TZRA 3ZTXA 5CWZA 1A9UA 5EHLA 3BYVA 2W5AA 4EZ7A 5JZJA 2XKCA 3M11A 3OWLA 3UDZA 2JAMA 4WNMA 3SXSA 2FGIA 4ZY4A 1OB3A 5CEPA 2CPKE 3AT4A 3HYHA 4IM3A 2FO0A 5CSWA 3TJDA 2VWWA 4PWNA 3S1HA 4UB7A 4YLKA 5KMJA 3HA8A 2IVTA 4BTKA 1GIIA 4HCVA 4CFNA 4YTHA 4CKJA 3C4ZA 4C4GA 3NX8A 4X21A 3DNDA 3QA0A 2OWBA 4AT5A 4F08A 4IVBA 4HGTA 3Q4CA 3O8UA 5CNNA 5HE0A 4GG7A 3SX9A 4WD5A 5DT3A 2VTMA 3KRXA 5J79A 3HV3A 4IAAA 4FVRA 3SOCA 1Q3DA 2C3KA 5I9XA 2C5XA 4IQ6A 4IZ5A 2GU8A 3CE3A 3V6RA 4DA5A 4MWIA 3T3UA 4QYGA 3ZDUA 3U6JA 3BGPA 5M4CA 2E9PA 4TNBA 4EHVA 5JGDA 4BIEA 2CCIA 3TDVA 4NKAA 1MRUA 3ZUTA 4CRLA 5IZFA 5L8KA 2IZTA 4F78A 3POZA 4APCA 4D4YA 4F6WA 1UVRA 4L42A 3PZHA 4NYEA 5EW3A 4O0RA 5BYZA 3UC4A 3QTQA 4GFGA 3F69A 4O2PA 4O4BB 3UP7A 4BCPA 4CFMA 2G1TA 4J98A 4PL4A 4BDIA 3AKLA 4IX6A 2NPQA 4AUAA 4MD7E 3LZBA 3P7BA 2RG5A 5AP5A 4F9CA 3C4WA 3OW3A 3QD2B 4M68A 3UNZA 1WZYA 3OCGA 2XM9A 4DF3A 5LOHA 4XOZA 4DH5A 2OI4X 5M57A 2JGZA 2CKOA 4XBUA 3E8CA 1QMZA 5GJDA 3VUIA 4L43A 2VAGA 4XX9A 2C6EA 4BCGA 1JLUE 3RPOA 3VNTA 3AC2A 2E9NA 2YDIA 4ASZA 3IS5A 1Q24A 2Y4IC 4FV8A 2BTSA 4RX7A 1FVRA 3ZYAA 4C34A 5DR2A 5HI2A 4FEXA 5EI2A 2YM7A 4FTAA 2VV9A 2WMUA 4WG5A 4RC4A 2WQNA 2FSMX 3W2CA 1ZY5A 4MCVA 3V01A 2H34A 5ACKA 3HAVA 5D41A 2VU3A 3VBYA 3DTWA 5AMNA 4D9TA 3PWYA 5IMEA 4WG3A 1GY3A 4F4PA 3TN8A 3R28A 1FVVA 2ITOA 2QO9A 3NS9A 4IZAA 4L00A 5C8NA 3RK5A 4A7CA 2F57A 3F5UA 3PVWA 4FT9A 5EM7A 2BZHB 1FGIA 3ZXZA 3CGOA 1A48A 1Q62A 2C0TA 2X8EA 3SHEA 5GNKA 3W16A 3A7JA 4FTOA 2W1EA 4KBCA 4WRSA 2W7XA 1AQ1A 3LQ5A 4XV9A 3SXFA 3OZ6A 1U54B 4ANLA 5FBOA 1XQZA 2RSVA 3M42A 4LQMA 4U43A 1R78A 2YAKA 3MWUA 2BCJA 4EBWA 4BDKA 4TN6A 5ETFA 3ODYX 4XG4A 3DBCA 3EN7A 3FHIA 2Y6MA 4IB5A 4Q2AA 4ANMA 4YZMA 3KMUA 2QURA 2RFNA 3PIXA 3GC8A 4H3PA 3I0QA 4Y5QA 3HV7A 3NNWA 4FSMA 3N4VA 3AMAA 2YITA 3HZTA 3L9PA 4I0RA 3M2WA 2XNEA 4J97A 3U6IA 3CGFA 4AA0A 5HIDA 4I23A 4ZSEA 3Q9ZA 3OBJA 3R1YA 4YHJA 3AT2A 2XNGA 5DE2A 3VS1A 2A4LA 3FSKA 3QKLA 3NIZA 4ZS0A 4D2PA 5HEZA 4BHNA 3C0GA 2X8IA 1YOLA 1H1PA 4MTAA 5EYCA 1YW2A 3QYZA 3NCZA 3V8SA 4MKCA 3LCSA 4CYJA 3BQCA 2ITXA 3W0PA 4DFYA 4R1VA 1Q8TA 1WVWA 2XK9A 4J95A 3FZSA 5AA9A 1PXLA 2PZ5A 3CD3A 5E90A 3R1QA 4RSSA 4B4LA 2BDFA 5D12A 3F3TA 3UNJA 5AR8A 4D55A 5GZ9A 4QTEA 3HMIA 4K0YA 5E8XA 1SMHA 4BDFA 2XIYA 3Q4ZA 3QTZA 4FSQA 2X2MA 4EHEA 4IVDA 2NO3A 4QMPA 3VQHA 2O2UA 3HNGA 5FM3A 4FV2A 3ZSHA 4IWPA 4KUJA 4ZZOA 4N57A 3ZM9A 3NUNA 4C57A 1H08A 4NCTC 2PU8A 1H24A 1CKJA 3CPBA 4RWJA 3FZ1A 5BYYA 5J5SA 2PYWA 4XG3A 3R30A 1UU3A 3RP9A 4YC3A 3UIUA 3TUDA 2F7ZE 2YM3A 5IH4A 4P4CA 3FMHA 3QC4A 4KSPA 4RZWA 4YBJA 4BI0A 5HVKA 4MUQA 3QD3A 4KINA 2GS2A 4R5YA 4NM7A 2OIBA 4PTCA 5KHWA 2SRCA 2UW6A 1YXUA 1XR1A 2WPAA 1PYXA 1Q8YA 2YIYA 5BQ0A 3PSDA 2CN8A 1SM2A 1YXXA 2PVRA 3F5PA 3R1SA 1FMKA 1OUYA 2JITA 3EQGA 2QU6A 1BLXA 4FK6A 3ET7A 4FTQA 4G16A 4XV2A 5E8WA 2JKMA 4BL1A 2VTOA 3QA8A 5LVNA 4DAWA 3HP5A 3QCXA 4IX4A 4M8TA 4BCIA 4U45A 3BV2A 2E9UA 1IRKA 2W99B 4FV1A 4IAFA 4BZOA 2WOUA 4GG5A 5FXSA 1H27A 4WHZA 4EBVA 3RZFA 4Z7GA 2RL5A 3TKHA 4RLLA 3VUDA 4F0FA 1H0WA 3EOCA 4UMRA 2HWPA 2VGPA 3L8XA 4GVJA 4J52A 4BYJA 1P4FA 3HV5A 2UW9A 2F9GA 3UMXA 4D1SA 5CX9A 2Q0NA 2XNMA 4K33A 3AGMA 3EN6A 5T6KA 5CYIA 4FV7A 3GI3A 3UO6A 4YJSA 2ERKA 2PZPA 4RFMA 5E1SA 3LXKA 2FSTX 3FI3A 3MVLA 2QR7A 4FTUA 3MW1A 2ZMDA 5EOLA 3OROA 1KE5A 3F7ZA 3E7OA 3QCYA 5HICA 1GOLA 5KO1A 4HNIA 4AGDA 4L9IA 2YWPA 4C38A 5IA2A 3EN5A 3NUPA 3R22A 4ERWA 3P5JC 3I7CA 4D58A 3PXQA 4B6LA 3PYYA 1OKWA 3SLSA 4GFMA 4TRLA 3HP2A 1APME 4BDDA 2IVSA 4W4VA 3VUKA 2XNNA 3NMUF 4O1PA 3D2KA 2XKEA 4XRJA 5DGZA 5LXMA 3BX5A 4X6RA 4O0UA 2PK9A 3DKCA 2XAOA 3A8WA 1VZOA 3HRCA 5CEIA 3D15A 5DH3A 2X0OA 5B7VA 3DAJA 4F1TA 2J0LA 3VRYA 4AQKA 3U87A 2C6KA 4AE9A 2R3NA 1U59A 3DCVA 3LFFA 5AADA 4F1OA 1W84A 3PY1A 2GTMA 3LQ8A 1V0OA 4FOBA 2ZOQA 4GU6A 4RA5A 1KOBA 4WG4A 5CU6A 5LCJA 3BL9A 5DI1A 3NVMB 3GCSA 3QHRA 4U3ZA 3GCQA 4JIAA 1Z57A 4BCJA 3SXRA 3A60A 5CF8A 5AIKA 4F7NA 2OKRA 3ZH8A 2R7BA 3AC5A 3F7WA 5C01A 4EKKA 4F0GA 3MB7A 4EH9A 1PMUA 4XG6A 3JUHA 4RJ6A 3MFUA 5FM2A 4CCUA 2QOBA 1ZYLA 5CXHA 3ULIA 2ZFYA 2FSLX 2OFVA 3B2WA 4CT2A 3RM7A 3QTXA 3PXZA 1NW1A 3DQXA 1UKHA 5AUWA 1RDQE 2VTPA 3OCTA 5FP5A 3VBVA 5E9EA 5TR6A 2ONLA 4ZTNA 5H9BA 1G8AA 3F2AA 4O7YA 4H3QA 3FLYA 4IAYA 3VF8A 3ZC6A 2G2FA 5CSVA 1MQ4A 3RM6A 5EH0A 3PSCA 3OG7A 3FE3A 2VWIA 2RG6A 1SZMA 2Y9QA 4UWCA 2AQXA 2C5VA 2X0PA 4V04A 4DFXE 1LP4A 4C61A 5JMSA 4FJVA 3DK3A 4TY1A 4V05A 4APPA 5I3RA 3NUXA 4FEUA 4ASDA 2P2IA 4FC0A 2OXYA 3VUMA 3ZO2A 3RCJA 3OHTA 3HRFA 4KRCA 2WIPA 2YCRA 1OKYA 3HVCA 4K6ZA 4ZP5A 2UZEA 3OWPA 5KZ0A 3V8WA 2UZOA 2VO6A 4QYHA 3VS4A 4C7TA 3LCOA 5IUHA 4JDJA 2BHEA 3FSFA 4FNXA 1OITA 4FSUA 2KTYA 4TYGA 3VW6A 3ZOSA 3SRVA 5AV4A 5AEPA 2O64A 3LOKA 4EOLA 4GS6A 3NNUA 4IBMA 2WTWA 1KE8A 3QQJA 4II5A 5DG5A 4LRMA 4E7WA 4UMUA 2JKQA 5AR7A 4Z3VA 2PMNX 4ZZNA 5IA3A 1GIJA 5HG9A 3QBNA 2IW6A 2R2PA 2PZIA 3OWKA 3EQIA 4QP9A 1V0BA 5HE2A 1ZOEA 3GU5A 4ZJVA 3A4OX 3QZFA 4C4JA 5M4UA 3QQLA 4MK0A 4ZSLA 5C8MA 4YPSA 3QD4A 4PDOA 1KV1A 3QRKA 5AP0A 2XRWA 4LV7A 5CNOA 4BCNA 3PJ8A 4L3LA 1R0PA 3IW4A 5A4LA 3O96A 2XCHA 2X0GA 4H3BA 4I5PA 4LRJA 3EFLA 5CQUA 1YWNA 2J4ZA 3RBWA 4NJ3A 4MXOA 4OTHA 5HCYA 2W1HA 3LVPA 4L3PA 1P2AA 3IDBA 4FIHA 4M0YA 1PXJA 5K5NA 1PMVA 2ZV7A 3G2FA 3SGCA 3G33A 4DH8A 2PZRA 4LG4A 4X3FA 5CSHA 5HCXA 5AM6A 3A7GA 3V3VA 3R71A 5IUGA 5EOBA 5KMLA 1VYZA 4IH8A 4BBEA 2VN9A 4RJ5A 4QQCA 5HG7A 1SNXA 4EK5A 4WBOA 3FLSA 5I9WA 4QMNA 1OKZA 4ZY6A 4IX3A 3NFGB 4UMPA 2XF0A 1IAHA 2XZSA 3IKAA 2UZLA 3A61A 2OXXA 3MA6A 3L1SA 3PY3A 2EU9A 1CKIA 3RPVA 2WMRA 4CKRA 5BVFA 5HZNA 4BGHA 1RQQA 4HVHA 5CI7A 2XK6A 5K4JA 3D5VA 4IJPA 1ZWSA 2GMXA 4U7ZA 1NY3A 3WIGA 4AGWA 4AX8A 1W83A 4B8LA 5AA8A 1XBCA 2R3FA 3PJ1A 4XYFA 4ITJA 3GB2A 5EDQA 4CFWA 2BZIB 1IG1A 4BDEA 4C0TA 5CEQA 1RE8A 3REPA 3I5NA 3HMMA 4L68A 5AV2A 4AGCA 5CEMA 1J7UA 2WMVA 3QTUA 3KXXA 1QPEA 3I1AA 5E91A 3DV3A 2OFUA 4RIYB 2ITUA 3AMBA 3BYUA 3Q3BA 2H8HA 5KNJA 4JX3A 3NPCA 3WARA 3GEQA 3HGKA 2XBJA 4TWNA 4ZJIA 4FEQA 2WKMA 3F66A 3MBLA 4PTGA 3G0FA 2R3MA 3AG9A 3QLGA 1SVGA 4FZFB 4NJDA 3PLAE 5AX9A 5BV3A 4Y85A 4YTFA 5AV1A 3BYOA 2W4OA 5HG5A 4P90A 2J0KA 3RAWA 5ANDA 5HOAA 4BR3A 2WXVA 1DM2A 4YJQA 4UWBA 3DAKA 4TYHA 5LVLA 3HUBA 5AP1A 4NKSA 3W55A 3NUAA 3U54A 4JI9A 3OY1A 4BI1A 2VO3A 1YDSE 1NVSA 4RVLA 3EN9A 3KC3A 4IZYA 3BEAA 1M7QA 4CCBA 4QP4A 4KD1A 3BU5A 3O5AA 4NTSA 5CZIA 4BI2A 5CSXA 3LCTA 4AW2A 3AC1A 4DEDA 5EM6A 2B9JA 3U4UA 4QP7A 4WBBB 4FBXA 4XEYA 2WAJA 5F20A 3O23A 3HKOA 5IG1A 2CNQA 3F3VA 3FY0A 2WMWA 3HMOA 2B9FA 1Q97A 2V7AA 5EDPA 3LJ0A 5JZNA 2OZAA 3BU3A 4O84A 3AMYA 2OIDA 4N6YA 3I5ZA 2XKDA 3SG9A 3FMEA 4YZ9A 2QOQA 2RFDA 3HMNA 3ZLSA 3EQBA 4I6QA 4MD8E 4JS8A 3CTQA 2VUWA 4M69A 2QCSA 3COHA 3TKUA 1PKGA 2X7FA 2HY81 2FVDA 3LIJA 5AV3A 3R9HA 4C4FA 1ZXEA 4EK3A 4QMUA 5J7BA 1WBWA 3ORKA 3NDMA 2UW0A 5E8TA 2VGOA 4FIIA 4NTTA 1OVEA 1YI3A 3U4WA 3IDCA 4DCAA 4PL3A 2IZSA 2YDJA 4QD6A 2ZMCA 2XALA 1UKIA 3GUBA 2G2IA 3GC7A 4CMTA 4YTIA 4X2JA 2OBJA 3OC1A 4QQJA 3E64A 3RTPA 4DLJA 5HO7A 2XB7A 4LUEA 1Q4LA 4OTRA 5ANOA 5L3AA 2YM5A 3P23A 4I0SA 3L9LA 4CEGA 3AC4A 3QC9A 3MH0A 4JXFA 3O0GA 3UE4A 2WMTA 2OJ9A 4M0ZA 4EK4A 3TMOA 5K0XA 2F7EE 4GJ3A 4BC6A 3SG8A 3DBFA 1VJYA 4R8QA 2HYYA 3MDYA 1H1WA 4JNWA 4LGDA 5CY3A 2O3PA 3LFSA 2Z7LA 2YLFA 4RVMA 4AT4A 5IA0A 4KKEA 3BZ3A 2VWUA 3QKMA 3R00A 3H30A 4RIWA 4EUTA 4ZIMA 4PMPA 4C33A 4O0VA 3OP5A 3DXNA 3K54A 4HZRA 4CLIA 2GNHA 1F5QA 4UV0A 2JDSA 3OUNB 3TEIA 3LHJA 4KIPA 4NU1A 3UYTA 3MA3A 4AW0A 4D4SA 1W7HA 1WBNA 2ITNA 3B8QA 1V0PA 2Z7QA 4F99A 2YM8A 4BIDA 3P79A 5TKDA 4HNFA 3BU6A 4MF0A 5F95A 4E93A