4NJDA

Structure of p21-activated kinase 4 with a novel inhibitor ky-04031
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
291
structure length
290
Chain Sequence
MSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Discovery and the structural basis of a novel p21-activated kinase 4 inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4njdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4njdA01
2CHLA 3BU3A 2J5FA 4C36A 3BLHA 5FXRA 3DK7A 4FIHA 3KN6A 5KMNA 1JSVA 4NT4A 4OTWA 4RJ8A 3Q9ZA 3NLBA 3H4JA 3UO5A 2ZV2A 3RCJA 3LFAA 2C5VA 5CF5A 4AGCA 4I23A 2R3PA 2YLEA 2WIHA 4BCMA 4QP2A 5AP5A 4F9AA 2F7EE 3HNGA 3ZU7A 4FTNA 5CI6A 3A8WA 4QTCA 3CY2A 4U3YA 2HK5A 5D7AA 1DI8A 4O7NA 4F1OA 4CFWA 3RJCA 4MXYA 1GNGA 4MYGA 3WF5A 3ODYX 5IQDA 3FYKX 5EM5A 3FLQA 4KD1A 2ZDUA 2VTLA 4LYNA 4FBXA 4CYJA 4A9SA 4F7NA 2W4OA 4C34A 1UKIA 3CC6A 3IGGA 4QP9A 3EQPA 5HE0A 4FTKA 4ANNA 3CP9A 2O3PA 5IUIA 3EN4A 3ROYA 1V1KA 2E2BA 3P7CA 5BMMA 5M55A 5JK3A 3H0YA 5A9UA 4RIWA 5DBXA 3OROA 3VS7A 5BUEA 5EKOA 4IX5A 4B8MA 3QX4A 4DGMA 5CVGA 3UIMA 1ZYLA 4BDGA 5BNJA 4XH6A 1ZZLA 3MGYA 4YPDA 4OAUC 1PXIA 2XK3A 5JMSA 2UUEA 3UO4A 1TVOA 2P2HA 5CI7A 4ANBA 3EQBA 3G5DA 4C4EA 4YLLA 4EK3A 4EOJA 3FPQA 4ANQA 4RA5A 5TE0A 1K9AA 4AT4A 3E62A 3UZPA 3FI4A 2G2FA 3F2AA 3MVJA 4UY9A 2C30A 5CWZA 1YWNA 3DLSA 4YC6A 3BQCA 2VTOA 4JQ7A 2QC6A 2B53A 4A9TA 2ETRA 5A4QA 5JFXA 2ZJWA 3LE6A 4TPTA 3WF7A 3FY0A 3EJ1A 1JAMA 4WKQA 4H1MA 2C5NA 3GUBA 4C0TA 4R77A 2CNQA 1JSUA 3WF8A 4PMSA 2QU5A 3FWQA 3RGFA 3R7OA 2IWIA 5HU9A 2UZEA 2C3LA 2UVYA 4UB7A 3MBLA 3ORTA 5I9UA 3KGAA 2GQRA 3OY3A 5EH0A 2W9ZB 3FEGA 5GJFA 4FZAB 3EQGA 3TM0A 4MD7E 2HZNA 3PG1A 2Z7LA 4F6SA 4TYEA 4ZAUA 3NAYA 3DNEA 2VX0A 4F9CA 4L43A 5HOAA 2JIVA 2VWZA 1WBWA 3ATSA 4NTTA 5DR6A 2VWYA 3CLYA 1OPJA 5CVFA 5DT3A 2VNWA 4IACA 4L42A 1R78A 4JBOA 4XCUA 4EQMA 2ONLC 2F49A 3L9MA 3NSZA 5EDQA 4DEGA 4KBKA 1OMWA 5FRIA 3O8PA 4RVMA 5M44A 5FTQA 4FEXA 3R00A 1XR1A 4JI9A 4GU9A 5D10A 1FBNA 4CYIA 5G1XA 2O2UA 4IAAA 4GKHA 1TKIA 3C4ZA 3LCKA 3EOCA 4BIBA 3SG9A 3CD3A 1YQJA 3LIJA 3PJ8A 5AP3A 2NO3A 3S0OA 2QR8A 3FV8A 2GPHA 3ACKA 3IW5A 2YA9A 3FMDA 4J1RA 2GTNA 3VO3A 2W5BA 3V04A 4FKLA 5E9EA 2QKRA 3L9PA 4I6QA 5IF1A 1E1VA 4FOBA 4RZVA 1ATPE 1XH6A 4PV0A 2GFCA 3S4QA 4M12A 2EWAA 1Q62A 4BRXA 3H9OA 5M56A 3P4KA 3PPKA 4QO9A 4EHVA 3EIDA 2VGPA 3MIYA 5M4UA 4IDVA 5AAGA 2P55A 3KXZA 1JBPE 1ZMUA 4RVTA 2J9MA 3UOJA 2YCQA 4O6EA 2WMRA 4QPSA 2AC3A 4O0WA 3E7VA 3VS2A 4BZNA 4X0MA 2YISA 3UG2A 3A99A 5BUJA 3RWQA 4D0XA 2HW7A 1Q99A 2QOLA 2BIKB 3CIKA 2HYYA 2B4SB 2ZAZA 4FUYA 4CMTA 4EUUA 3C4CA 4A06A 4MXZA 4NUSA 3SAYA 5IISA 4M66A 1KV1A 4I4FA 4Y46A 3HMMA 4O7VA 4C3FA 3GCVA 4GCJA 1XWSA 3BYOA 3R1NA 3QRJA 3KA0A 2YDKA 5J8IA 2QURA 5M4IA 2HELA 5HCYA 3UO6A 3EQRA 2OXXA 2CGVA 2YCFA 4FIGA 4IZ5A 4Z55A 2Y4IC 3ROCA 4ITJA 4BKYA 5GIOE 2OLCA 3G6HA 3TWJA 3DXQA 5LMKC 3I5NA 2HAKA 2VV9A 3RK7A 3ZLXA 3PDTA 3ETAA 1J1BA 2H9VA 5FBNC 4O7RA 2WKMA 4NW6A 1JPAA 5EI8A 3LCTA 2R5TA 3QHRA 4GFGA 4Q9SA 3HA8A 4BZOA 5LWMA 3TZ8A 4BCJA 4EOPA 3W2SA 2QI8A 4UMTA 3L8XA 4IFCA 2VZ6A 1STCE 3NUUA 4D1ZA 5IDPA 5IH5A 4I24A 4OTDA 5KNJA 5IZFA 3NRMA 2J0LA 4QQJA 5I4NA 1P2AA 1YI3A 2PVHA 2CKQA 1Y8YA 4MBLA 2C5OA 3OEZA 4S30A 4OGRA 2OG8A 4YO4A 1F0QA 3TTJA 3TUDA 2ONLA 4UXLA 4G3FA 4NSTA 3HV3A 3QRUA 3KK9A 3U9NA 3V5JA 4WO5A 3KXMA 5EHOA 1MQBA 4L9IA 4Y72A 5E8SA 4AOIA 2BUJA 2CGXA 4P90A 3DAJA 5HD7A 2XKEA 3SXFA 4BCHA 3DBEA 4TWNA 4CZUA 4IM2A 3BYSA 1SNXA 3PXKA 3U6IA 2Y4IB 2IVUA 2XVDA 3LW0A 3QZIA 4G6NA 3E5AA 2UZNA 4RFMA 2V7AA 1R3CA 3JUHA 3VBQA 5HBHA 4FKJA 3LFQA 3FMEA 2W05A 2X7GA 3RAWA 2YWPA 4JNWA 4YR8A 3KQ7A 4BYIA 5I9XA 3AC3A 1M7NA 2QOHA 4NKSA 4QMNA 3D5VA 1UNHA 3PIXA 2JIUA 5H9BA 4BICA 4YGAA 4ENXA 3BEAA 4FKVA 3DBCA 2X4FA 4D2RA 2OU7A 1JQHA 3UQFA 5HNGA 5CEIA 3EL8A 3G90X 2H6DA 3ORZA 2YZLA 3BCEA 4LOPA 4I21A 5LVPA 5HLPA 3MIAA 4TYHA 4CMUA 4TRLA 3PVWA 5AP0A 2IZUA 5AEPA 4QNYA 2ITTA 2YZAA 1MQ4A 3OWKA 4KKEA 4PL5A 1R39A 3RKBA 4FT3A 5E7RA 1U46A 3PE1A 4QMZA 4RC3A 1ZYDA 1WBNA 4LI5A 4Y83A 2BRGA 3OMVA 5EG3A 5AUXA 3NW5A 3AT4A 2W1EA 3TV4A 4IB3A 2YM5A 4RX9A 2BKKA 4L44A 5F20A 4AZFA 4JBPA 2XA4A 3NVKI 3QCQA 4FMQA 3ENMA 3AMYA 3GQLA 4V04A 4TYJA 3MN3A 4O2ZA 5CQUA 3CKXA 5KBQA 4Z16A 5FM3A 4AUAA 5K5NA 3HL7A 5CS6A 3VW6A 3KRLA 3QTZA 2X4ZA 5BVNA 3MJ2A 1IASA 4BYJA 1OUKA 3COKA 3QWJA 3MH0A 4FZ7A 3CE3A 4HZRA 3DS6A 4G31A 2BTRA 4L67A 4LRKA 5CAUA 3FLYA 5EDRA 3CSVA 2VTRA 4HYUA 4IIRA 3N4TA 4JVGA 3QTWA 5LMKA 4RT7A 2YFXA 4BCQA 1E9HA 1P5EA 3NS9A 5HLNA 1V0OA 4HPTE 1L3RE 4Z7HA 4JG6A 2RKUA 1ZYSA 2BZHB 3ORLA 3V6SA 3ZTXA 4CZYB 4XG2A 2JBPA 4O21A 4S34A 5AR4A 5FTOA 3HAMA 4R7HA 5C4LA 2B9JA 3EWHA 1WVXA 1WMKA 5D41A 1Q5KA 3QLGA 4K8AA 3TXOA 2IZSA 4YJRA 5M06A 3OBGA 3ALNA 4EQCA 5I9ZA 3RPVA 4C38A 3UC3A 1UWJA 3NCZA 5JT2A 4A4OA 2ITZA 3IOPA 1VEBA 1G3NA 4XG3A 4E4LA 3U4UA 5DRBA 3VN9A 2WAJA 2A19B 3R8LA 3UZTA 3F82A 3VC4A 4IB1A 2PZYA 3VS4A 3R8MA 4EH9A 4AACA 5IEYA 1TQIA 2XUUA 3AT3A 4BCNA 5J5SA 5FTGA 4X3JA 5C8NA 2HZ0A 4BKJA 3P9JA 3CPBA 3UIBA 3JY0A 2X8DA 2XNMA 3QALE 2VO7A 3RCDA 4BHNA 4D2SA 4EORA 1LR4A 4S33A 3ZUVA 1QPEA 1PXJA 4DEIA 3DAEA 1OZ1A 2XBJA 4PX6A 5IA2A 2Q0BA 1JNKA 2YWVA 4I5MA 2WMTA 4JL9A 4YJVA 2W1ZA 4DFLA 5ETCA 3KMWA 4F63A 5A6OA 1WBTA 4BGGA 4BY9E 4F0GA 2P0CA 2BFYA 3QD4A 4I5CA 2A1AB 4TYGA 3EQDA 5BX0A 4O0YA 4BR3A 1Z5MA 2VO6A 4GJ3A 3NW6A 3UVQA 2R3OA 4EH4A 1HCKA 3F5UA 2VUWA 4ALVA 2XK6A 5HNBA 3NIEA 4H39A 2E9OA 4QTEA 3Q4CA 3V01A 3U54A 2CN8A 4BL1A 4XOYA 2BILB 3BEGA 5F1ZA 4HNIA 5DHJA 2JAMA 1YOJA 2DWBA 1YXSA 3H3CA 4GFOA 2GSFA 5EM6A 3K3JA 3QQUA 4P7EA 3SD0A 5LXMA 2DUVA 2RFDA 5BYZA 4DT8A 3T8OA 3AD5A 4BDKA 2YDIA 3MVMA 5AIKA 2R4BA 4NJDA 3PUPA 5EW9A 4BGQA 4J97A 3TACA 4RWLA 4CVAA 1WBOA 2V22A 5T68A 4E6QA 3A2CA 1XH5A 4RIOA 4M0ZA 3KULA 3QQGA 3ZONA 3ZXTA 3WOWA 4ZIMA 4HVIA 3R63A 2JDOA 5CLPA 5EQEA 3PXYA 2Y6OA 3WZJA 1IG1A 1Y91A 4FKTA 3QGWA 3KK8A 3K2LA 3PA3A 4M0YA 4C4HA 4C62A 2GNHA 4G17A 3A7GA 4FNZA 4LL0A 4O6LA 4IVBA 3PIYA 2AC5A 4Y85A 3NUSA 1YVJA 5HG5A 5DG5A 3MV5A 4D0WA 2OIQA 4CLIA 4FNXA 4MBJA 3QQHA 2VWUA 4R78A 4G16A 3BHTA 5LMAA 1CKIA 2YJRA 3C0HA 3UMWA 3HUBA 3FC2A 3PXFA 4LOOA 3SHEA 3MWUA 3ZZEA 5E90A 1LUFA 2JBOA 4CKJA 4BCOA 3L9NA 4WNKA 1QPJA 3W2PA 4BC6A 4E3CA 3ET7A 3QA0A 4GG5A 3KRXA 2ITOA 4X7QA 1URWA 4ZTLA 2X81A 4YURA 1GZNA 3TJCA 1O6KA 1GIHA 5B2LA 4U40A 1OECA 1A48A 1REJA 3I7CA 4MBIA 4MCVA 5GNKA 2LGCA 2BAQA 2REIA 2QO2A 4UMRA 3C51A 3WILA 1PXKA 4DEBA 3VW8A 4QP8A 4O83A 4WNOA 3IOKA 3QTXA 4XG9A 3OTUA 3FI8A 3FMHA 4H58A 2ZV7A 2CSNA 1PXPA 1YDTE 3GB2A 3VBXA 2BKZA 5HBJA 1IAJA 4LOQA 4YJOA 3VBWA 5HZNA 3OTVA 5IA4A 4P4CA 3IGOA 3QC9A 5DWRA 2VWBA 4OTHA 2WMVA 2YERA 3ZO3A 1U5QA 4RWKA 5CEMA 3E92A 2CCHA 2XKFA 4QMUA 3CEKA 3ENHA 4XV1A 3T3VA 4L7FA 4AOTA 1YKRA 2VX1A 2X1NA 5EHLA 5LVMA 3R04A 4TKSA 4PP9A 1CM8A 4A07A 3V6RA 3QUEA 4OT6A 5HX8A 1J7LA 2B1PA 3KL8A 2WMWA 4JX7A 4V05A 3OF0A 4DGGA 4FEWA 2W7XA 4O7SA 3DT1A 3T9IA 1CMKE 2JGZA 2R3GA 3R9RA 4QMXA 3OCGA 3QCYA 2FA2A 3QQJA 5ANJA 2QQ7A 2UV2A 4JRVA 2YN8A 3PWDA 3LFNA 4JX3A 1IEPA 4PP7A 2DS1A 4WRSA 1JKTA 5CALA 3T3UA 3KF4A 3ZSIA 1H1RA 2B9FA 2ITYA 3G2FA 3E8NA 4UV0A 3AQVA 4AF3A 5JGAA 4U8ZA 4D4VA 5CZHA 5HCZA 2Z7RA 2JEDA 3Q60A 2VRXA 2XZSA 5EYMA 4DN5A 3SA0A 2CLXA 4DBXA 5A14A 4I6HA 1IR3A 3PY1A 4NW5A 3RHXA 1WVYA 4IZ7A 3N9XA 4F09A 2BIYA 2VTHA 4B6LA 1WBVA 4ZTMA 5EYCA 3HMOA 4MQ1A 3EHAA 1WCCA 1J1CA 2C6OA 4BHZA 2JDRA 1PYXA 3QQLA 4FT5A 2OSCA 3K5UA 2KULA 3BU6A 4UYNA 2J50A 2XK4A 1GOLA 3NPCA 2RGPA 3BHUA 1KOBA 3FPMA 3COMA 3E3BX 5AJQA 5E4HA 1DI9A 2R3NA 2R3LA 2CDZA 4I0SA 3MFTA 1EH4A 4YBJA 3F3TA 3DTWA 3JYAA 3NNVA 3GC8A 1JKKA 2UW4A 3DZOA 4EZ5A 3PJ2A 4M15A 4O7YA 3UPZA 4ZJIA 3KCKA 3EZRA 1OL2A 1OM1A 3HEGA 5DEWA 5KMKA 2ITQA 4FV2A 5I5ZA 3A4OX 3UOLA 5JFVA 3A62A 2X2KA 2YDJA 4U81A 5ETFA 3KY2A 4JXFA 3RWPA 3BX5A 2WU6A 4WT6A 1UNLA 2HY81 2A2AA 3D7TB 4BWPA 2I0HA 2PL0A 4E5AX 1MRUA 4U3ZA 1YWRA 2ERZE 3DLZA 5EOLA 3PSBA 5IUGA 2VTMA 4JIKA 1PXNA 3GENA 3ZO2A 4NZWB 3GT8A 1CTPE 3S00A 3QGYA 4EI4A 3RAKA 5IMXA 5KBRA 3DA6A 2WQMA 3V5TA 4DGNA 4BTKA 3ORPA 4LGDA 1RQQA 2X8EA 2Z60A 2PPQA 3GOPA 4F6WA 2GQSA 3H0ZA 4OBPA 2FGIA 5IKWA 3BYVA 3MFUA 2W5AA 4HZSA 4IZAA 1YOLA 3NZ0A 5J7HA 3TZ7A 3VRZA 5CSVA 1Y8GA 5CU3A 2F7XE 2X7FA 3R2BA 3DKGA 2QONA 4GMYA 3ZBXA 2VO3A 4IZYA 3KXXA 4O0RA 3E93A 4U45A 2PUPA 3UP7A 4C4FA 2YIRA 5ANEA 4EC9A 3R7IA 4FF8A 5LWNA 5IMEA 3NCGA 5L2QA 2VTPA 3HLLA 5D9HA 4QD6A 4XP2A 4O82A 5CASA 2FH9A 2B9IA 2E9VA 3MA6A 2PZRA 1H8FA 2ESMA 4E5BA 2OICA 1SVHA 3WF6A 2BVAA 3DBFA 3PVGA 5E1EA 3IPHA 4EYJA 4RIYB 4O7TA 5LQFA 4J8MA 5DOSA 5ITAA 3D7TA 4EH8A 4DEEA 3MH2A 2NNWB 5BVOA 5IEXA 4F9YA 5I3OA 3BI6A 3VJNA 4ARKA 3BWJA 2B9HA 3ZLSA 1YI4A 1X8BA 4Q5HA 4ZSGA 3FL5A 1M2RA 3EN7A 3MW1A 4CGAA 2I1MA 4OAVB 2J51A 4LUDA 4KAOA 4YSMA 4FTLA 1XH7A 3F7WA 1H4LA 4L3JA 3MB6A 4CRSA 4DLJA 4EOKA 3IKAA 5E8WA 5HEZA 2I40A 4A9YA 2FO0A 5CT0A 4EJ7A 1UKHA 1ZRZA 4DGLC 3ZC6A 2XF0A 4BI0A 4D4SA 5HE2A 2QHNA 5H2UA 1M17A 4Y5HA 2WTJA 3F9NA 1GZ8A 4MWHA 5M09A 2XCKA 3PG3A 2AUHA 2YM4A 2OJGA 4FKRA 4AA5A 4MAOA 4QMPA 2X9EA 5JRSA 4BDDA 3E63A 3I81A 4MQ2A 4MTAA 1CDKA 5D1JA 3F3ZA 3EH9A 5DPVA 4DH7A 1F5QA 3OW3A 4FSTA 4I93A 3VQUA 4D28A 2PU8A 3C9WA 1Y6BA 2FVDA 4I4EA 4CEGA 1APME 4FEQA 2NP8A 4I20A 3TV6A 4ZSAA 5IQAA 3JS2A 5CU6A 4C57A 5AV0A 3IDBA 3IW6A 4PDPA 4IAFA 4QMOA 4U43A 5AV4A 5DYJA 4FV7A 5CEOA 3BKBA 3D5UA 2ZM4A 4XLVA 2QOQA 3SVVA 2RFNA 5M57A 4YPSA 3QC4A 4JBVA 4WNPA 4BBMA 1V0PA 4W8DA 4Z3VA 2UZTA 3P78A 4FTUA 4JJRA 3OZ6A 4ASEA 4H3QA 4F08A 4ZY4A 4V0GB 4X3FC 4UMUA 3NYNA 5E92A 4BBFA 4I94A 2YLFA 3QTRA 3FXXA 3R9HA 3TIYA 2H34A 4FYNA 4L3LA 4ZY5A 2R3KA 4O0SA 5HE1A 3Q53A 3O2MA 2YEXA 4V01A 1Q3DA 1QMZA 5C1QB 3WE8A 3WYXA 3JPVA 4RPVA 4G3EA 2C68A 4GRBA 4ERWA 4O96A 5C9CA 4IADA 4PTGA 2EB3A 4BDHA 5TOZA 1XO2B 3PSDA 1Q8UA 2G2HA 3FMKA 5M07A 3TZ9A 2BR1A 2RFEA 4R6VA 4EOMA 5CAPA 3ZM9A 5H8EA 5AA9A 1BL7A 4WG3A 4C59A 2BCJA 4DTBA 1DM2A 4FSYA 4YJNA 5DEYA 4O0UA 2R2PA 2X2LA 2XJ2A 4FKSA 3HGKA 4M97A 1MUOA 2B55A 4DITA 4QRCA 4FICA 3C13A 4EZ3A 4JT3A 3ZRLA 2BZIB 3QAME 2QHMA 1M2PA 3EN9A 1IRKA 3EZVA 2WNTA 4XBRA 4ASZA 1FVRA 4L45A 3UZRA 4USEA 3ZS5A 3LJ2A 5AADA 5M4FA 4FE2A 3G9LX 3U9CA 1R0EA 5FGKA 1PMVA 2BAJA 3JVRA 3OHTA 4S2ZA 4UMQA 4BCKA 4DTKA 3N4VA 4X2KA 4DFZE 3FLZA 4D4YA 4J71A 2R9SA 3N4UA 4X3FB 3ZLYA 2PUUA 4R5YA 4C61A 3TKIA 1YHSA 3MPTA 3M11A 4EKLA 3RM7A 5DRDA 3TCPA 2BRMA 2WGJA 4HJOA 4CTCA 4ZJJA 2WMBA 2JD5A 5M51A 1Q61A 3Q9XA 2VWWA 4II5A 1KOAA 1Q24A 1WBSA 4IWOA 5KMLA 3FSKA 1TQMA 2GMXA 2Y9QA 4QMMA 3ZFXA 4F9BA 1SZMA 4FR4A 5K3YA 3DB6A 3GU7A 5CXHA 2IW9A 4CQGA 3PZEA 4DFXE 2ACXA 1FOTA 2JKKA 4FV5A 4KIKB 4E4XA 2JDVA 3BHHA 4QNAA 4BIDA 3I60A 3TUBA 3JY9A 2XKCA 4YJPA 2YJSA 5BQ0A 5CSWA 5E1SA 3HV4A 3E7OA 4FEUA 4JG8A 2X9FA 3SDJA 2XIXA 5ETIA 3HKOA 4ZSEA 3TZMA 4Z7GA 2NPQA 1J7IA 3OXTA 5E8ZA 3AT2A 4O84A 3MESA 3GEQA 3KMUA 3BE2A 2W9FB 3CTHA 5DMZA 4R3CA 1HOWA 5I0BA 2YM6A 4F4PA 5IQEA 5J79A 4C33A 2PMNX 4BB4A 4ALUA 2BRBA 2Q0NA 4JDJA 4RLLA 4NTSA 4LG4A 4UBAA 3F7ZA 2BZKB 5CF8A 4QMVA 4X3FA 5BVEA 5KZIA 3DCVA 1OBGA 4H1JA 4CFFA 5E91A 3EQFA 2ZYBA 3SGCA 3DB8A 4E93A 2R7BA 2WO6A 3R8ZA 2XKDA 1PF8A 2V5QA 2WZJA 3QL8A 4WSYA 4C37A 1ERKA 2OWBA 4OTIA 4BI2A 4DH8A 3CGOA 3OT3A 5HG9A 3O23A 4G9CA 4M8TA 1PXMA 3PFQA 2HWPA 4AW1A 4NIFB 3UPXA 3TNQB 3M42A 4MNEB 5CU0A 3LCOA 5DR9A 3TN8A 2HIWA 2C0OA 4FSRA 2OIDA 4TYIA 5IDNA 4HPUE 3QLFA 3KC3A 3FZTA 3QYZA 4FIEA 2BDFA 3GU8A 1UU9A 3FDNA 3N51A 3COHA 5A4CA 4L68A 4DC2A 5E8UA 3DDPA 3ZO1A 1OGUA 3LVPA 1OKWA 2JKOA 3D0EA 4NYEA 2YCRA 3LLAA 5L2WA 3HV7A 4DLIA 1XBBA 3Q4ZA 3P0MA 3C4EA 3C4FA 3EFJA 2GFSA 4YO6A 3HDNA 5DNRA 4C7TA 3ZO4A 5J1WA 2WD1A 4IAYA 3CJFA 4ASXA 2AYPA 5F95A 1OITA 1QPDA 4WNMA 4DBNA 2VD5A 4IWPA 1W7HA 4FV0A 4QMTA 4HVDA 4RWJA 3TEIA 1MP8A 3I0OA 3VUHA 3VUKA 4EJNA 4EH3A 1RDQE 2XM8A 3BGQA 4DGOA 3MH1A 4J8NA 4IB0A 3QQKA 4CCUA 1V0BA 3R2YA 3CQEA 4K0YA 3TTIA 3PXZA 4QYEA 3SOAA 2C4GA 3QUPA 2C3IB 4NFNA 4UWYA 3BHVA 3FY2A 4XV2A 1Y57A 3ZDUA 4PL3A 5JH6A 4MNEA 3FC1X 3D7ZA 4RFYA 2UZVA 5C26A 4OTGA 2RG5A 2EXMA 4YHJA 4PDSA 3E8CA 3P79A 4YJTA 3VAPA 4A4XA 1UV5A 2GHLA 4GK3A 2CPKE 3KB7A 4ACCA 5FQDC 2YIQA 1XJDA 3W10A 2C6LA 2W5HA 2VN9A 4QOXA 3REPA 2YAAA 3E3PA 3KRRA 4XV3A 4CCBA 3U51A 2VTTA 4H05A 2XYNA 4R1VA 3R8UA 2CNUA 5AR2A 3S3IA 3WF9A 3PJCA 2V0DA 1GY3A 3EKKA 3O17A 3RK9A 1PMUA 3RNIA 3ZMMA 5L8LA 1G5SA 4J53A 4WOVA 2I0YA 4ANMA 4K1BA 4X2NA 4IANA 4ITIA 5HORA 1OPKA 2BFXA 5AIRA 3R73A 5HESA 2WTCA 2PVLA 1P4FA 2WB8A 5AR7A 3OWLA 4M69B 5ICPA 1JLUE 5FEDA 1A06A 4QYYA 3R30A 5AP7A 3UMXA 4MXCA 3DPKA 1BI7A 1KE6A 4OR5A 3SW4A 3KCFA 1S9JA 2JC6A 2PY3A 2YIWA 4U44A 2J5EA 3LFEA 5EI6A 4UALA 3F2NA 4NEUA 3FQEA 3KRWA 4JR3A 4C4JA 2XBAA 4H3PA 5BMSA 2QNJA 1H0WA 2PVYA 4N70A 1FPUA 4K6ZA 1OB3A 1YRPA 4OBOA 4P5QA 3SXSA 2R3RA 2F2UA 1OL7A 1U4DA 2QOOA 1W0XC 2Y0AA 3QUDA 1OIUA 3LZBA 5LCJA 5EDPA 4F0FA 2R3JA 4OTFA 1O6LA 4HYIA 4N4SA 4YZMA 2WEVA 2G9XA 5JZNA 2B52A 4QYFA 3VF8A 4GJ2A 5KUPA 4IXPA 1PW2A 3Q52A 2CKOA 3PXRA 3F3WA 2PYWA 3BGZA 1KE9A 4F9WA 1CKPA 4YNOA 4FUXA 2XK7A 4GL9A 4D9TA 4FI1A 4IMYA 4WBOA 4Q2AA 3G33A 5AV1A 4BVUA 3F66A 5EM7A 2W1IA 4YZCA 2PWLA 3HMNA 4EOOA 2XS0A 5KX8A 5CF6A 3EN6A 4QP6A 3MTFA 4QP7A 5HX6A 2BHEA 2OW3A 3NNWA 3QTIA 4FTCA 3W1FA 4I0RA 4XG8A 3OOMA 4AGWA 1KWPA 4BBEA 4C3RA 1J7UA 5DGZA 3FKLA 4W4WA 3B8RA 5HU3A 3R8PA 2OFVA 4S31A 2C6DA 5CSXA 1W83A 1SVEA 2ITNA 2KTYA 2H8HA 4D4RA 3THBA 3KU2A 3TT0A 2DQ7X 5DFPA 1YXVA 5C03A 3V5QA 5TF9A 1QCFA 4YBKA 3BHYA 5EYDA 4DFBA 2JITA 5L3AA 3CQWA 3G9NA 1PJKA 2PVFA 4AW0A 3HV5A 2O0UA 4P2KA 5LJJA 4ZMEA 3EN5A 1YXUA 2BDWA 3Q3BA 5EOBA 4PMMA 1TQPA 4Q5EA 4WG5A 5BVDA 3A7FA 5L6WL 3QZGA 2P4IA 3DJ7A 1OKZA 3DBQA 4RG0A 2UZLA 4ACHA 5IUHA 4YP8A 4CSVA 3NYOA 4HGLA 3W32A 4ZTRA 4FSUA 5AUWA 4CFMA 5K4IA 5CEPA 5I9VA 1FINA 4XG4A 2XCHA 3PIZA 4LQMA 4FYOA 5LOHA 3BPRA 3KN5A 5GIPE 4AZVA 3E8DA 2QOCA 5EKNA 1H08A 2GHMA 4KABA 3UJGA 3KMMA 4EOQA 5KCVA 3SKCA 4FOCA 5FLFA 1LEWA 3QTQA 4GFMA 5JKGA 1XH8A 3SW7A 2HWOA 2R3HA 3ELJA 4FKGA 4NM3A 3ATTA 3QKKA 4TN6A 1W82A 3TDWA 1A9UA 3DFAA 2IVVA 3L1SA 1ZMWA 4EWHA 1AD5A 1ZLTA 4FSMA 1JVPP 2X2MA 4I92A 4JQEA 4HCTA 4I0TA 4AFEA 3V3VA 4BWXA 4I22A 2OJJA 1VYWA 3DQWA 5CXZA 1SMHA 5EFQA 1I09A 4FKOA 4TNBA 4L53A 1Q97A 3NWWA 1H28A 1B6CB 4BDBA 1U59A 3VUIA 3R7EA 2W0JA 1OBDA 5HHWA 5TR6A 3PYYA 4Q9ZA 1U54B 3Q9WA 4ZEGA 4JDIA 4MKCA 3O8TA 2XEYA 5HD4A 1RJBA 1AQ1A 5FBOA 4F6UA 3Q04A 3FI2A 5AR8A 4QP1A 5AUUA 3KVWA 2UZOA 2R7IA 3FXZA 2X0GA 4M14A 3OUNB 2WMXA 5D11A 4CRLA 4RWIA 4O2PA 3GQIA 2WU7A 3LQ8A 3RM6A 4TXCA 4LRMA 4QYHA 2BHHA 4H36A 5HVKA 4PNKA 1CKJA 4AT3A 5IQHA 3C0GA 4MD9E 5L8JA 3QA8A 3LMIA 5JGBA 2VNYA 2BDJA 2WHBA 3QXPA 3FKOA 3D14A 4UZHA 4W9XA 3TJDA 4D2TA 4QQTA 4N57A 4LMNA 3FBVA 3U55A 5AFVA 3D4QA 4EOLA 5KHWA 3SOCA 5HIDA 4X6RA 2W4JA 4IAZA 5AWMA 5CF4A 4C2VA 3OXIA 4C4IA 4TZRA 3WE4A 4O81A 2X8IA 3P86A 4MVFA 3PXQA 3U8WA 2PMOX 1E1XA 2W1DA 4CZTA 5DVRA 2YHVA 5H8GA 2UW0A 4ZSLA 3FQHA 2NRUA 2ZV9A 2H96A 4JBQA 4IM0A 1SVGA 4AZSA 3VULA 4YJSA 4AN2A 4Y73A 1GAGA 5KMMA 3UNJA 4GIIA 1AGWA 4HYHA 3LCSA 3WARA 4Y8DA 4IM3A 3R9DA 1BI8A 4J7BA 1Y6AA 5F4NA 3V8SA 2O65A 2Y6MA 5HG8A 5BPYA 2VGOA 3GGFA 3ACJA 3AXWA 4RMZA 2GS2A 2W06A 3ZUTA 2UW9A 3O7LD 3B8QA 4FKUA 3UGCA 2GHGA 2PVNA 3AMAA 4LMUA 4S32A 3UIXA 1NT2A 4IX4A 1U5RA 3KF7A 3K54A 4LRJA 4XX9A 2E9PA 2GNFA 4DG0E 1UU7A 2ZMCA 4EKKA 1KE8A 3HMPA 3NEWA 4K18A 2PE1A 1PHKA 3CXWA 2FSMX 4KBCA 3BIZA 3H9FA 5ANOA 4B99A 4L00A 4OUCA 4TWOA 4FC0A 1BL6A 5AAFA 5LVNA 5C01A 3ZH8A 3PLAE 5AV3A 4AP7A 5J7BA 3BWFA 3ZXZA 3Q32A 3VBYA 4JAIA 4KWPA 2W17A 5BVFA 3Q6WA 4EBWA 3QZFA 4F70A 4G3GA 4KIOA 3CKWA 4YTIA 1YDSE 4I1ZA 4PDOA 3GI3A 3VS6A 4DH5A 3VS3A 4AN9A 4C58A 4IW0A 1DAYA 4EL9A 5I9YA 5M4CA 4MXOA 3KVXA 1KE7A 4RJ5A 5HCXA 3W2RA 3ORMA 4I3ZA 4E6AA 5A4TA 4HGTA 3DK6A 3ORIA 2XIZA 4EK8A 2QOBA 4FA2A 2QOIA 4CV8A 1NVSA 3ZM4A 3QRIA 2XRWA 3C5UA 3EKNA 4AN3A 5A4LA 3DU8A 2PMIA 1YDRE 4CV9A 4ERKA 4BWKA 1UWHA 3FUPA 4UX9A 2QR7A 2WOUA 2XRUA 4DCAA 5AX3A 4IAKA 3JVSA 3NR9A 5KMIA 2OKRA 2ZB0A 2ZDTA 3NVMB 3GU6A 3Q5ZA 4G34A 1SM2A 3FE3A 1NVRA 3ZBFA 1H24A 3D94A 1H07A 2R3FA 2IVSA 3FKNA 4NFMA 3RALA 4DH1A 3AC8A 2DYLA 4UN0C 4G5PA 2GNIA 3FZSA 4MH7A 2R0IA 3PE2A 4L8MA 2PZPA 2HENA 2X39A 2ZVAA 4RBLA 2PZ5A 4BCGA 1REKA 4CFVA 4HVSA 3MA3A 1XKKA 1H25A 3R1YA 3ZRKA 4D2WA 1Q8YA 2NRYA 2JKMA 5HE3A 3OC1A 4ZTSA 3VJOA 4CXAA 2BROA 5GINE 2GNGA 3MH3A 5K9IA 4KNBA 4Y95A 3Q5IA 4WA9A 3NDMA 3PJ3A 4FK6A 1JWHA 2GS7A 4O1PA 4QMSA 4DAWA 3Q4TA 3PVUA 4ID7A 3T9TA 4USDA 3KREA 4X6QC 4BDCA 3QRKA 3EFLA 4PY1A 4AZWA 4DINA 1H1WA 3U87A 3R9OA 4MHAA 5IA5A 1VJYA 3WIGA 4FNWA 4XP0A 4CFXA 2WTDA 5EW3A 1ZAOA 4YTCA 4FV9A 2SRCA 3BV3A 4NJ3A 4W8EA 3G6GA 5C8MA 3F3UA 4AZEA 2Q83A 1MRVA 5HG7A 2I7QA 3EL7A 3PY3A 3AC2A 3PSCA 1PMEA 4TWCA 5E8YA 5HNIX 3A61A 1YOMA 3D5XA 4RC2A 4GYGA 4ANOA 4FTTA 4E4MA 3CGFA 4BCIA 1ND4A 2CKPA 3RI1A 4GH2A 4FKWA 4NKAA 3SQQA 2F9GA 4TWPA 2OXDA 1I44A 2OZAB 2CLQA 4WG4A 4FL3A 5ANDA 3EFKA 3UDBA 2XIKA 4RIXB 3UOHA 1FVTA 4IVDA 2C3JA 2W99B 4ZP5A 4JS8A 4IJPA 4FT7A 5L6OA 3FXWA 4BIEA 4HGEA 5A3XA 4TL0A 1GIJA 3K5VA 4FODA 2PULA 4GV1A 3BLRA 4R7BA 1WZYA 3S1HA 3GC7A 4BZDA 4G3CA 4WBBB 2HXQA 1ZMVA 3Q6UA 4KA3A 4YJQA 3LCDA 4CNHA 2F7ZE 3LKMA 2W1HA 4EBVA 4W9WA 5EQYA 3BRBA 4FKIA 5K4JA 4FIFA 5TT7A 3AC5A 5IU2A 4DFNA 3V5WA 4IVCA 1MRYA 1OKYA 2B54A 3IO7A 4FV8A 1YW2A 3G0EA 5TKDA 4U42A 3DJ5A 5JQ5A 1VR2A 2PVKA 3SXRA 1Q3WA 5IH6A 3OWPA 4GU6A 3VBVA 4YTHA 3FJQE 5DI1A 2UZBA 3OP5A 4WRGA 1KSWA 3RAHA 3MFRA 4AT5A 2ZM1A 2EXCX 4TTHB 2UZWE 1Z9XA 1BYGA 3DTCA 3K3IA 3QHWA 4DEAA 1OKVA 4OTRA 5GJDA 3TV7A 2BAKA 2BTSA 2PUIA 3A4PA 4MWIA 3DQXA 3LOKA 4AW5A 2XB7A 4R3RA 3NYXA 2VTNA 1OL5A 2OZAA 4RQKA 4G1WA 3B2WA 3RP9A 3IDCA 5KMOA 4E73A 4XP3A 3R7GA 4AAAA 3MY0A 2WMUA 3O7LB 5CU4A 3QFVA 4DEHA 3PA4A 3E8EA 4A7CA 4P5ZA 4E26A 3R8VA 2ETKA 3CCNA 5E8TA 3ANQA 4YU2A 1ZOEA 5IA1A 4FVRA 3ID6C 4WSQA 2VO0A 4FTRA 4RIYA 3EQIA 5FXQA 4EOSA 2WIPA 5J1VA 4RVLA 4C2WA 5GHVA 4ORKA 2WEIA 3F5GA 3HVCA 2YCSA 3BELA 3QKMA 3FZPA 2BZJA 3UVPA 2W1FA 4FK3A 4GSBA 4U0IA 2WQEA 3R71A 3BE9A 4IX6A 4LM5A 3NX8A 2Y7JA 2I6LA 2WFYA 5HBEA 3ZZWA 3BV2A 4PTCA 2I0VA 4E4NA 3I79A 5I3RA 4NWMA 3OCTA 4L7SA 4O0VA 5A6NA 4G2FA 3VHKA 3NIZA 3FZOA 4IE9A 2B0QA 4NM5A 3VS0A 4FSNA 3AGMA 5BYYA 4HW7A 3GOKA 4BTJA 4FTQA 3RMFA 4XEYA 2B7AA 2YABA 5HICA 5KZ0A 2VTSA 3TNPC 2LAVA 4HVGA 2GS6A 2UW8A 4WD5A 1B39A 5CAOA 5FDPA 3OVVA 4YHTA 4JIAA 4O91A 1XBAA 4GG7A 4H3BA 4HNFA 5CYIA 4YJUA 4HYSA 4FEVA 4AWIA 4DH3A 3CQUA 3ULZA 4QP3A 3HP5A 1KUTA 1NW1A 5B0XA 3O50A 4DE4A 3E87A 2R64A 4O7ZA 3QZHA 1K3AA 3RHKA 2VWVA 3F3VA 4FIIA 2GNLA 3ORNA 5L2SA 2WQNA 2WTWA 3OWJA 2XNEA 4RJ7A 2OH0E 3NW7A 4ZS4A 3SX9A 3BBWA 4XRLA 5DA3A 4OTQA 4KSPA 2XJ0A 5EW8A 4DFYA 4AA4A 3I7BA 1JKLA 4QTDA 3FLNC 3R7VA 1L8TA 5JRQA 5CEQA 1CSNA 4BI1A 3D5WA 4YLJA 5CTPA 3UC4A 4C02A 4V0GA 1YWVA 2UW6A 3F5PA 1H27A 3F88A 2PE0A 3UP2A 3QTSA 3U6HA 2QD9A 4QPMA 3V8WA 3TUCA 5GZAA 4FG9A 1RE8A 3W16A 5JSMA 3EFWA 4MK0A 3PRFA 2ITVA 3IW7A 4U5JA 5IA0A 5AAEA 5AR3A 3EB0A 3RK5A 4KBAA 2WTVA 2G01A 3M2WA 3NUPA 1OVEA 4TW9A 4M13A 3OXZA 1J91A 4Y5QA 5CVHA 3HAVA 4YC8A 4DT9A 3O0GA 3D83A 3R83A 3GFEA 4DHFA 5FUTA 1W98A 3ZSGA 1G8SA 5M08A 3MFSA 2XMYA 4N0SA 4WUNA 5AP2A 1FMKA 3GNIB 5EI2A 4K11A 2YACA 1H01A 4QQ5A 2G1TA 4GEOA 4MXAA 3GC9A 3C7QA 4DTAA 2XP2A 4OW8A 2OJFE 5H8BA 5ANGA 5CSPA 4MF1A 2XIRA 2C1AA 4MX9A 4FGRA 1W84A 2GCDA 5C27A 4NL0A 3RZFA 4U79A 5M53A 4KS8A 3QYWA 5HTBA 5AUVA 5HTCA 4ITHA 4JAJA 4KSQA 4QYGA 5LMBA 5EHYA 5KMJA 3I5ZA 4ZY6A 3FZ1A 2J0IA 2R3IA 4PPCA 5HIEA 2CGWA 1OIYA 5G6VA 4F7LA 2CCIA 2EB2A 2YM7A 5L2IA 4DG3E 4QTBA 3RPOA 3I6WA 3RPYA 4FGBA 4KRDA 3E64A 4RJ3A 3V8TA 2HW6A 4OTPA 3ZC5A 4L46A 3R7UA 4JLCA 5EQPA 4PMTA 2PUNA 2VWXA 3DY7A 3P23A 4RJ4A 5JN2A 3AD6A 4I6BA 1OL1A 3ERKA 5ETAA 4RRVA 4YZDA 3IK3A 2JLDA 5IQIA 4AE9A 1PYEA 2WPAA 1T46A 1Q8TA 3QKLA 3LLTA 4XHKB 5ACKA 2QLQA 5E8XA 1WFCA 3TKHA 3ZYAA 5J95A 3OW4A 2GU8A 3LMGA 2BRNA 2JDSA 4U97A 1XQZA 5AUZA 4ZZOA 5L8KA 4KIKA 2UW5A 4IDTA 2UW3A 3DOGA 4ACMA 3MJ1A 1KV2A 2W4KA 3CR0A 2IG7A 1H1PA 2HXLA 3FMJA 2BALA 4FNYA 3P7BA 4L52A 3IS5A 2J0JA 3GCUA 4PUZA 3OY1A 3WZEA 4E5WA 4GKIA 3ORKA 2C0IA 4FTJA 3JXWA 4O7WA 5HGIA 4FT9A 5AA8A 3LAUA 3HMIA 3L9LA 2GQGA 4AX8A 3OG7A 2IW6A 2WXVA 5ANIA 1PKDA 4I5HA 2IN6A 4M84A 2WELA 3IG7A 3IONA 4EH5A 4I41A 3LXKA 4FV6A 2XH5A 3LXLA 4PF4A 2C1BA 3HECA 4RSSA 3QXOA 1UU3A 4W4XA 4YLKA 4FV3A 4PQNA 4DEDA 1P4OA 5AP1A 3MVLA 3SC1A 4AOJA 3R6XA 3DV3A 3VUGA 5A46A 4UWCA 4FKPA 4X2FA 5F9EA 3UG1A 2ITWA 3FSFA 4NCTC 5DH3A 4EYMA 4IB5A 2HCKA 5HO6A 5C4KA 3FMLA 1G8AA 4ZTHA 3LMHA 4FTAA 4E1ZA 4XG7A 5J9ZA 4KUJA 4N6ZA 4E6DA 2YIYA 2EVAA 3A60A 2FSTX 4FTIA 3P08A 4FV4A 2UW7A 4KIQA 4RQVA 2FSLX 2OK1A 2CJMA 2QU6A 2YAKA 3F69A 4L3PA 3VS1A 1BLXA 4GW8A 3Q9YA 3W2OA 4NIFA 4AGDA 4E6CA 5CEKA 3DBDA 1H1QA 4OLIA 3ZLWA 1OPLA 3EYGA 3GU5A 4CKIA 2YM3A 5J5TA 4IJ9A 4QQCA 4KRCA 3D9VA 2E9UA 3LHJA 4XOZA 4JRNA 3BZ3A 2RF9A 4ZZNA 3GP0A 1W8CA 2C47A 1YXXA 5LVOA 3CS9A 4LUEA 3MPMA 3OEFX 3R01A 3QCXA 5LCKA 4EK6A 5I9WA 4DFUA 1KE5A 4LL5A 3CTJA 3E88A 3VUTA 2JFMA 2YITA 2UVXA 3H9RA 3MS9A 3Q2MA 3FAAA 4J99A 1Q4LA 4LV8A 4QMLA 2WTKC 2W1CA 4MD8E 4I5PA 4TYHB 5IA3A 1OIQA 3OOGA 5D7VA 3V5LA 3S95A 4ZZMA 4CLJA 2J0KA 4QT1A 4UXQA 4K9YA 3UNZA 3TG1A 1OUYA 4IWDA 2A0CX 4IQ6A 4O1OA 1O9UA 4XJ0A 4NM7A 3RPRA 1YI6A 2XIYA 3KKVA 3W8LA 3UODA 1M14A 3RNYA 4U9AA 1WVWA 1Q8WA 5FXSA 3POOA 3R0TA 5ACBC 2QCSA 2IZRA 3D2IA 3FYJX 5DT4A 3UYSA 2ZMDA 4CT2A 3AG9A 1O6YA 5AV2A 5DT0A 3QU0A 2QG5A 4DG2E 4R7IA 4FZDB 5AX9A 1H1SA 3NUXA 5IQCA 1ZZ2A 3C5IA 4FV1A 3BLQA 3BBTB 1YHVA 3RZBA 3UIUA 4BFMA 4BCFA 4XYFA 3GCSA 3C0IA 4FTOA 2VTAA 2ITUA 4A9RA 2C0TA 4MNFA 3R1SA 4MF0A 4TT7A 4R3PA 3FHIA 4QTAA 4RA4A 4RVKA 3SLSA 4EHGA 2G2IA 3GBZA 4HCVA 4M67A 1VZOA 3QCSA 3HRCA 5L4QA 4U6RA 3LJ0A 3PP0A 3TKUA 4F1TA 3KRJA 3HP2A 4E8AA 3GCPA 5B2KA 2WTKB 3CY3A 2WQBA 4RFZA 3OFMA 3F61A 3EYHA 3LM5A 4IWQA 1JSTA 4XBUA 4GT4A 3VF9A 3GVUA 3QRTA 4RLKA 3AOXA 2FB8A 4BDIA 4LV5A 4X2JA 4ANLA 4E20A 4PNIA 2BMCA 3UTOA 3QF9A 2O8YA 1ZWSA 4K77A 4ZS0A 4CKRA 3NNUA 3A7IA 4YMJA 2Z2WA 4ONAA 4M68A 4APCA 4FVQA 4NCTA 4PPBA 2V55A 5AUTA 3MYGA 4M69A 3DKOA 3P1AA 5CU2A 4ZJVA 3MY1A 4MEDA 4FG7A 4RX7A 2VTJA 5D12A 2GNJA 4ANSA 2C5YA 1PY5A 3R7YA 2PK9A 2PTKA 3GC0A 4FSZA 3MVHA 1H0VA 4USFA 3GU4A 3OCSA 4FVPA 4JQ8A 4JR7A 5BVWA 2IO6A 3VIDA 2VAGA 3IDPA 3ODZX 4G6LA 5EK7A 3VVHA 3QD0A 4U7ZA 4A4LA 1Q8ZA 4IC7A 5GZ9A 4EH6A 2OXYA 3VQHA 4YC3A 4CG9A 3TNWA 3IQ7A 3PA5A 5CQWA 2QVSE 3ITZA 3FZRA 3OD6X 4UMPA 4L6QA 5CAQA 3VHEA 4K33A 4WHZA 4F0IA 2RSVA 4IVAA 3TDVA 2G15A 5HVYA 4G3DA 1F3MC 4CTBA 4KIPA 5JFWA 3WBLA 2RL5A 2JFLA 2OGVA 4U41A 3MDYA 3RAIA 4U80A 3GXLA 5DIAA 4BCPA 4D58A 4ACGA 4B0GA 2EXEA 4RZWA 3G15A 2GTMA 1GJOA 4ZXTA 5FM2A 4J98A 3CJGA 4X21A 2O64A 2PVJA 3BU5A 3ZEPA 1FGIA 1NA7A 3VUDA 2QLUA 3POZA 5AM6A 2PHKA 2QODA 3VRYA 1Z57A 5LARA 4GVJA 4GIHA 4KINA 3KULB 2Z02A 3ALOA 3Q2JA 3ZHPC 3HRFA 4ZK5A 2PSQA 4PTEA 3C1XA 2IW8A 4C35A 2QO7A 4ENYA 3A8XA 1NY3A 1QPCA 2ERKA 3MSSA 4QP4A 3BGPA 3AC1A 4QMYA 2WMQA 2W1GA 4GS6A 4BKZA 2JIIA 4AS0A 3QD2B 3QX2A 5L2TA 2OIBA 3H10A 3QBNA 4C8BA 4D1XA 3EQHA 4BF2A 5B7VA 3H30A 2R3QA 4XLIA 5FEQA 2QO9A 3MPAA 2CN5A 3PTGA 5FP6A 3FMMA 5AUYA 3L8PA 3WYYA 4FZ6A 5IQGA 4YZNA 3LFFA 4GT5A 3U4WA 3PLSA 4EOIA 4R1YA 2J6MA 4AXAA 4B4LA 1GZOA 2R3MA 4XMOA 4XUFA 3AC4A 3HUCA 4K2RA 4BTFA 2Z8CA 3HDMA 4IAIA 5BUIA 5FEEA 3WZUA 5J9LA 4YZ9A 1ZOHA 2YIXA 5BVKA 4DF3A 2Z7SA 3HRBA 5HVJA 1S9IA 3DKCA 1QL6A 3LM0A 4YNEA 1Q41A 1H26A 5AM7A 5F94A 2Y8OA 3NUAA 4IBMA 5HLWA 2PE2A 4GT3A 3KXGA 4GUBA 5CAVA 3UBDA 4EC8A 4XRJA 5K0XA 1PXOA 2WOTA 3HV6A 2R0UA 4FG8A 1DAWA 1M52A 2IJMA 3GFWA 4GK4A 4KKGA 4W4VA 1WBPA 1RW8A 3MB7A 4F1MA 2C69A 2OI4X 1JOWB 5HIBA 5JQ8A 2WQOA 3MY5A 2QKWB 3WZDA 3FLSA 4CQEA 3NUYA 3IECA 3TNIA 3MI9A 4PRJA 2JKQA 3FL4A 1ZY4A 3TI1A 4BTMA 5ANKA 5FWKK 4AZTA 4EHEA 5FP5A 2HY0A 3EQCA 4I6FA 4HOKA 4N6YA 3LFCA 4F64A 2YM8A 5A54A 1K2PA 3ORXA 2A4LA 3PPZA 4E7WA 3NNXA 4RX8A 2PZIA 4KKHA 1PKGA 3ZRMA 4CD0A 3DK3A 1IA9A 4KS7A 1YXTA 2C3KA 2CGUA 3I1AA 4M7IA 1BMKA 4QMQA 5AR5A 5HO8A 3COIA 4LFIA 4EH7A 2C6MA 4J95A 4O27B 4FSWA 4R8QA 2P2IA 1LP4A 2XM9A 4WIHA 2ITPA 4J96A 3CD8A 2FSOX 4AQCA 4CG8A 2C6IA 1IAHA 1U54A 3VWAA 5EM8A 2J4ZA 4RJ6A 2XYUA 3SV0A 4BDJA 5B2MA 4DA5A 4CMOA 1UVRA 2ZM3A 3OT8A 3R28A 4PWNA 2JDTA 1XHAA 1GZKA 2JAVA 4RC4A 4AA0A 5IQBA 4APPA 5HKMA 2C6TA 4TY1A 4J52A 4NM0A 5KE0A 4O0XA 2C6EA 2VX3A 3VNTA 4PDYA 3ZSHA 4AGUA 5KKRC 3KXHA 3S2PA 5HO7A 1SYKA 4NU1A 4ACDA 4F99A 3II5A 2UVZA 1NXKA 2XNOA 4YSJA 5T6KA 4ZTNA 4YUQA 4IX3A 4WUAA 3RINA 5IH4A 5AMNA 1OI9A 2C6KA 3QWKA 3WZKA 1NVQA 3DAKA 3DXPA 4EZ7A 4JDHA 5JZJA 3W2QA 1VYZA 5FD2A 1BX6A 2OJIA 4JG7A 4ZOGA 3LFDA 5C8KA 1GIIA 2A27A 4ZLZA 4PL4A 4BN1A 3L8SA 3TL8A 3ZCLA 4XV9A 4FL2A 2PMLX 3KXNA 5HI2A 2VTQA 2HOGA 1ZOGA 4RGJA 2P3GX 5DLSA 4ZLYA 4D5HA 1H00A 2O5KA 2ZB1A 3LJ1A 3UQGA 3P7AA 3HX4A 1FVVA 2XEZA 3SRVB 5H3QA 2WMSA 2O63A 3AGLA 2CKEA 4BDEA 3FQSA 4EHZA 4CFUA 2OFUA 4EQUA 4RX5A 1SNUA 3PPJA 2XNPA 3R22A 3C4XA 5GJGA 2HZ4A 3G0FA 2XNBA 2P33A 4ZLOA 4HGSA 3DNDA 4B9DA 4ALWA 1OIRA 2QOFA 5BYLA 3DFCB 4DCEA 4IEBA 1R0PA 4EWQA 3CBLA 4CT1A 5CZIA 4JOAA 4FL1A 4O38A 4QPAA 3VBTA 5KKRB 1PMNA 1FGKA 2OF2A 3O51A 2E9NA 3B2TA 3MTLA 3VUMA 4YTFA 4IC8A 3PRIA 4O0TA 4AG8A 2ZOQA 1UU8A 3CPCA 2PVRA 4JDKA 3ZFMA 2IVTA 5KO1A 2RIOA 3LQ5A 4IFGA 3NGAA 4YZBA 5EYKA 3C4WA 4ASDA 3LQ3A 2VWIA 3HA6A 3AMBA 4FT0A 4X2GA 4Z9LA 1PXLA 4ZTQA 4AU8A 3IW4A 4IHPA 2V7OA 1B38A 2C5XA 2OO8X 5K0KA 3W33A 2W96B 4NK9A 4EH2A 3PWYA 4A9UA 3BQRA 4D9UA 3LFSA 2I0EA 5L6PA 5DR2A 4EK4A 4FSQA 3PP1A 4D2VA 3DKFA 5IEVA 1HCLA 5CT7A 1WAKA 3A7HA 2F2CB 3P5KA 5AP4A 3ZUUA 5HQ0A 2XNNA 4MXXA 2Y4PA 5CX9A 3SRVA 3ZDIA 3UNKA 3F2RA 2BPMA 1UNGA 5CENA 3NMUF 3QTUA 2VTIA 4UWBA 1ZXEA 3Q4UA 1M2QA 4TNDA 4UZDA 4AW2A 2F57A 3ZFYA 1PRYA 4GK2A 3OS3A 4R5SA 3JR1A 3RPSA 2ITXA 2OH4A 4UYAA 4GYIA 3WI6A 3PZHA 3D15A 3O96A 5FG8A 5JGDA 3NAXA 4OT5A 2Z7QA 1OL6A 5FDXA 5AP6A 3LPBA 3PVBA 4XG6A 5CNNA 5JEBA 5DN3A 1BUHA 5IQFA 4BDAA 4QMWA 3FMNA 4PMPA 1ZYCA 1ZY5A 2QOKA 2X6DA 3WIKA 3TIZA 2XNGA 4DYMA 5CANA 3SG8A 1M7QA 3QD3A 4BDFA 4C3PA 3RTPA 4B8LA 5JFSA 2RFSA 2FYSA 4G6OA 3L8VA 5T3QA 5J9YA 3NYVA 4UEUA 4EEVA 4F7JA 2PVMA 3W18A 2UZUE 2WTIA 3I4BA 3DGKA 3PY0A 3W55A 2OBJA 3V51A 4F65A 3C50A 3EMGA 1XBCA 3G51A 4EK5A 3LXPA 4LGGA 4XNEA 5KHXA 3NUNA 2GDOA 2OZOA 3HYHA 1T45A 4AE6A 2IZTA 1DS5A 5CNOA 3HZTA 3FI3A 4B7TA 2X6EA 5LVLA 1R1WA 4AFJA 4EUTA 2J2IB 4GUEA 3R9NA 3DJ6A 4BGHA 3RVGA 3BYMA 3V5PA 3W2CA 2J7TA 1XH4A 3D2KA 3FLWA 4KB8A 3R02A 3CTQA 3ANRA 4D1SA 2CMWA 3LXNA 2QG7A 4O7LA 3U6JA 1P14A 3UQCA 3FHRA 3ULIA 4F7SA 3Q96A 2FUMA 4ZMFA 3BYUA 4EONA 1J3HA 1URCA 4IH8A 3OCBA 4FTMA 3I0QA 4C4GA 3A7JA 4O86A 4XS2A 3TNHA 2XJ1A 4HVHA 1LPUA 1JKSA 2J0MB 3UE4A 3VS5A 5E8VA 3UVRA 3UYTA 3LFBA 3R1QA 2XK8A 4LGHA 5IG1A 2VU3A 2V62A 4RIXA 1FMOE 4CFNA 2EUFB 2RG6A 4M3QA 3IW8A 5GZ8A 2BRHA 3QQFA 3F5XA 4L01A 2X7OA 3RBWA 3DZQA 1UA2A 3AD4A 4HCUA 4G5JA 4G9RA 3W8QA 4FX3A 2WMAA 3O8UA 3ZOSA 3DDQA 4FIJA 4YHFA 1FQ1B 5DE2A 4OBQA 5CY3A 5K5XA 3DXNA 3KEXA 3UOKA 3OUKA 5TO8A 5IPJA 2F4JA 3KFAA 2ZV8A 3O71A 3PJ1A 5HTIA 2CNVA 4O22A 1ZARA 2HZIA 1IA8A 3GCQA 1BKXA 4FKQA 4PPAA 4W4YA 5A4EA 2IPXA 3F6XA 2J90A 4ZSJA 4NH1A 2OJ9A 4GVAA 4RIWB 1LEZA 3M1SA 3I6UA 3OBJA 2EU9A 3ZEWA 4D2PA 4FZFB 2UZDA 4D55A 2OF4A 4D5KA 1YHWA 1XH9A 5J87A 5CSHA 2XK9A 1ZYJA 2ETMA 3R21A
chains in the Genus database with same CATH superfamily
3ML1A 2CHLA 3BU3A 2J5FA 4C36A 3BLHA 5FXRA 3DK7A 4FIHA 3KN6A 5KMNA 1JSVA 4NT4A 4OTWA 4RJ8A 3Q9ZA 3NLBA 3H4JA 3UO5A 2ZV2A 3RCJA 3LFAA 2C5VA 5CF5A 4AGCA 4I23A 2R3PA 2YLEA 2WIHA 4BCMA 4QP2A 5AP5A 4F9AA 2F7EE 3HNGA 3ZU7A 4FTNA 5CI6A 3A8WA 4QTCA 3CY2A 4U3YA 2HK5A 5D7AA 1DI8A 4O7NA 4F1OA 4CFWA 3RJCA 4MXYA 1GNGA 4MYGA 3WF5A 3ODYX 5IQDA 3FYKX 5EM5A 3FLQA 4KD1A 2ZDUA 2VTLA 4LYNA 4FBXA 4CYJA 4A9SA 4F7NA 2W4OA 4C34A 1UKIA 3CC6A 3IGGA 4QP9A 3EQPA 5HE0A 4FTKA 4ANNA 3CP9A 2O3PA 5IUIA 3W0MA 3EN4A 3ROYA 1V1KA 2E2BA 2AQXA 3P7CA 5BMMA 5M55A 5JK3A 3H0YA 5A9UA 4RIWA 5DBXA 3OROA 3VS7A 5BUEA 5EKOA 4IX5A 4B8MA 3QX4A 4DGMA 5CVGA 3UIMA 1ZYLA 4BDGA 5BNJA 4XH6A 1ZZLA 3MGYA 4YPDA 4OAUC 1PXIA 2XK3A 5JMSA 2UUEA 1W2CA 1TVOA 2P2HA 5CI7A 3UO4A 3EQBA 3G5DA 4ANBA 4YLLA 4C4EA 4EK3A 4EOJA 3FPQA 4ANQA 4RA5A 5TE0A 1K9AA 4AT4A 3E62A 3UZPA 3FI4A 2G2FA 3F2AA 3MVJA 4UY9A 2C30A 5CWZA 1YWNA 1ST4A 3DLSA 4YC6A 3BQCA 2VTOA 4JQ7A 2QC6A 2B53A 4A9TA 2ETRA 5A4QA 5JFXA 2ZJWA 3LE6A 4TPTA 3WF7A 3FY0A 3EJ1A 1JAMA 4WKQA 4H1MA 2C5NA 3GUBA 4C0TA 4R77A 2CNQA 1JSUA 3WF8A 4PMSA 2QU5A 3FWQA 3RGFA 3UDZA 3R7OA 2IWIA 5HU9A 2UZEA 2C3LA 2UVYA 4UB7A 3MBLA 3ORTA 5I9UA 3KGAA 2GQRA 3OY3A 5EH0A 2W9ZB 3FEGA 5GJFA 4FZAB 3EQGA 1ST0A 3TM0A 4MD7E 2HZNA 3PG1A 2Z7LA 4F6SA 4TYEA 4ZAUA 3NAYA 3DNEA 2VX0A 4F9CA 4L43A 5HOAA 2JIVA 2VWZA 1WBWA 3ATSA 4NTTA 5DR6A 2VWYA 3CLYA 1OPJA 5CVFA 5DT3A 2VNWA 4IACA 4L42A 1R78A 4JBOA 4XCUA 4EQMA 2ONLC 2F49A 3L9MA 3NSZA 5EDQA 4DEGA 4KBKA 1OMWA 5FRIA 3O8PA 4RVMA 5M44A 5FTQA 1G8KA 3R00A 1XR1A 4JI9A 4FEXA 4GU9A 5D10A 1FBNA 4CYIA 5G1XA 2O2UA 4IAAA 4GKHA 1TKIA 3C4ZA 3LCKA 3EOCA 4BIBA 3SG9A 3CD3A 1YQJA 3LIJA 3PJ8A 5AP3A 2NO3A 3S0OA 2QR8A 3FV8A 2GPHA 3ACKA 3IW5A 2YA9A 3FMDA 4J1RA 2GTNA 3VO3A 2W5BA 3V04A 4FKLA 5E9EA 2QKRA 3L9PA 4I6QA 5IF1A 1E1VA 4FOBA 4RZVA 1ATPE 1XH6A 4PV0A 2GFCA 3S4QA 4M12A 2EWAA 1Q62A 4BRXA 3H9OA 5M56A 3P4KA 3PPKA 4QO9A 4EHVA 3EIDA 2VGPA 3MIYA 5M4UA 4IDVA 5AAGA 2P55A 3KXZA 1JBPE 1ZMUA 4RVTA 2J9MA 3UOJA 2YCQA 4O6EA 2WMRA 4QPSA 2AC3A 4O0WA 3E7VA 3VS2A 4BZNA 4X0MA 2YISA 3UG2A 3A99A 5BUJA 3RWQA 4D0XA 2HW7A 1Q99A 2QOLA 2BIKB 3CIKA 4DDGA 2HYYA 2B4SB 2ZAZA 4FUYA 4CMTA 4EUUA 3C4CA 3W0RA 4A06A 4MXZA 4NUSA 3SAYA 5IISA 4M66A 1KV1A 4I4FA 4Y46A 3HMMA 4O7VA 4C3FA 3GCVA 4GCJA 1XWSA 3BYOA 3R1NA 3BL7A 3QRJA 3KA0A 2YDKA 5J8IA 2QURA 5M4IA 2HELA 5HCYA 3UO6A 3EQRA 2OXXA 2CGVA 2YCFA 4FIGA 4IZ5A 4Z55A 2Y4IC 3ROCA 4ITJA 4BKYA 5GIOE 2OLCA 3G6HA 3TWJA 3DXQA 5LMKC 3I5NA 2HAKA 2VV9A 4O4BB 3RK7A 3ZLXA 3PDTA 3ETAA 1J1BA 2H9VA 5FBNC 4O7RA 2WKMA 4NW6A 1JPAA 5EI8A 3LCTA 2R5TA 3QHRA 4GFGA 4Q9SA 3HA8A 4BZOA 5LWMA 3TZ8A 4BCJA 4EOPA 3W2SA 2QI8A 4UMTA 3L8XA 4IFCA 2VZ6A 1STCE 3NUUA 4D1ZA 5IDPA 5IH5A 4I24A 4OTDA 5KNJA 5IZFA 3NRMA 2J0LA 4QQJA 5I4NA 1P2AA 1YI3A 2PVHA 2CKQA 1Y8YA 4MBLA 2C5OA 3OEZA 4S30A 4OGRA 2OG8A 4YO4A 1F0QA 3TTJA 3TUDA 2ONLA 4UXLA 4G3FA 4NSTA 3HV3A 3QRUA 3KK9A 3U9NA 3V5JA 4JMQA 4WO5A 3KXMA 5EHOA 1MQBA 4L9IA 4Y72A 5E8SA 4AOIA 2BUJA 2CGXA 4P90A 3DAJA 5HD7A 2XKEA 3SXFA 4BCHA 3DBEA 4TWNA 4CZUA 4IM2A 3BYSA 1SNXA 3PXKA 3U6IA 2Y4IB 2IVUA 2XVDA 3LW0A 3QZIA 4G6NA 3E5AA 2UZNA 4RFMA 2V7AA 1R3CA 3JUHA 3VBQA 5HBHA 4FKJA 3LFQA 3FMEA 2W05A 2X7GA 3RAWA 2YWPA 4JNWA 4YR8A 3KQ7A 4BYIA 5I9XA 3AC3A 1M7NA 2QOHA 4NKSA 4QMNA 3D5VA 1UNHA 3PIXA 2JIUA 5H9BA 4BICA 4YGAA 4ENXA 3BEAA 4FKVA 3DBCA 2X4FA 4D2RA 2OU7A 1JQHA 3UQFA 5HNGA 5CEIA 3EL8A 3G90X 2H6DA 3ORZA 2YZLA 3BCEA 4LOPA 4I21A 5LVPA 5HLPA 3MIAA 4TYHA 4CMUA 4TRLA 3PVWA 5AP0A 2IZUA 5AEPA 4QNYA 2ITTA 2YZAA 1MQ4A 3OWKA 4KKEA 4PL5A 1R39A 3RKBA 4FT3A 5E7RA 1U46A 3PE1A 4QMZA 4RC3A 1ZYDA 1WBNA 4LI5A 4Y83A 2BRGA 3OMVA 5EG3A 5AUXA 2IF8A 3AT4A 2W1EA 3NW5A 4IB3A 2YM5A 4RX9A 3TV4A 2BKKA 4L44A 5F20A 4AZFA 3NFGB 4JBPA 2XA4A 3NVKI 3QCQA 4FMQA 3ENMA 3AMYA 3GQLA 4V04A 4TYJA 3MN3A 4O2ZA 5CQUA 3CKXA 5KBQA 4Z16A 5FM3A 4AUAA 5K5NA 3HL7A 5CS6A 3VW6A 3KRLA 3QTZA 2X4ZA 5BVNA 3MJ2A 1IASA 4BYJA 4QDVA 1OUKA 3COKA 3QWJA 3MH0A 4FZ7A 3CE3A 4HZRA 3DS6A 4G31A 2BTRA 4L67A 4LRKA 5CAUA 3FLYA 5EDRA 3CSVA 2VTRA 4HYUA 4IIRA 3N4TA 4JVGA 3QTWA 5LMKA 4RT7A 2YFXA 4BCQA 1E9HA 1P5EA 3NS9A 5HLNA 1V0OA 4HPTE 1L3RE 4Z7HA 4JG6A 2RKUA 1ZYSA 2BZHB 3ORLA 3V6SA 3UDSA 3ZTXA 4CZYB 4XG2A 2JBPA 4O21A 4S34A 5AR4A 5FTOA 3HAMA 4R7HA 3VONA 2B9JA 3EWHA 1WVXA 1WMKA 5D41A 1Q5KA 3QLGA 4K8AA 3TXOA 2IZSA 4YJRA 3TYKA 3OBGA 5M06A 3ALNA 4EQCA 5I9ZA 3RPVA 4C38A 3UC3A 1UWJA 3NCZA 5JT2A 4A4OA 2ITZA 3IOPA 1VEBA 1G3NA 4XG3A 4E4LA 3U4UA 5DRBA 3VN9A 2WAJA 2A19B 3R8LA 3UZTA 3F82A 3VC4A 4IB1A 2PZYA 3VS4A 3R8MA 4EH9A 4DDIA 4AACA 5IEYA 1TQIA 2XUUA 3AT3A 4BCNA 5J5SA 5FTGA 4X3JA 5C8NA 2HZ0A 4BKJA 3P9JA 3CPBA 3UIBA 3JY0A 2X8DA 2XNMA 3QALE 2VO7A 3RCDA 4BHNA 4D2SA 4EORA 1LR4A 4S33A 3ZUVA 1QPEA 1PXJA 4DEIA 3DAEA 1OZ1A 2XBJA 4PX6A 5IA2A 2Q0BA 1JNKA 2YWVA 4I5MA 2WMTA 4JL9A 4YJVA 2W1ZA 4DFLA 5ETCA 3KMWA 4F63A 5A6OA 1WBTA 4BGGA 4BY9E 4F0GA 2P0CA 2BFYA 3QD4A 4I5CA 2A1AB 4TYGA 3EQDA 5BV3A 5BX0A 4O0YA 4BR3A 1Z5MA 2VO6A 4GJ3A 3NW6A 3UVQA 2R3OA 4EH4A 1HCKA 3F5UA 2VUWA 4ALVA 2XK6A 5HNBA 3NIEA 4H39A 2E9OA 4QTEA 3Q4CA 3V01A 3U54A 2CN8A 4BL1A 4XOYA 2BILB 3BEGA 5F1ZA 4HNIA 5DHJA 2JAMA 1YOJA 2DWBA 1YXSA 3H3CA 4GFOA 2GSFA 5EM6A 3K3JA 3QQUA 4P7EA 3SD0A 5LXMA 2DUVA 2RFDA 5BYZA 4DT8A 3T8OA 3AD5A 4BDKA 2YDIA 3MVMA 5AIKA 2R4BA 1G8JA 4NJDA 3O5AA 3PUPA 5EW9A 4BGQA 4J97A 3TACA 4RWLA 4CVAA 1WBOA 2V22A 5T68A 4E6QA 3A2CA 1XH5A 4RIOA 4M0ZA 3KULA 3QQGA 3ZONA 3ZXTA 3WOWA 4ZIMA 4HVIA 3R63A 2JDOA 5CLPA 5EQEA 3PXYA 2Y6OA 3WZJA 1IG1A 1Y91A 4FKTA 3QGWA 3KK8A 3K2LA 3PA3A 4M0YA 4C4HA 4C62A 2GNHA 4G17A 3A7GA 4FNZA 4LL0A 4O6LA 4IVBA 3PIYA 2AC5A 4Y85A 3NUSA 1YVJA 5HG5A 5DG5A 3MV5A 4D0WA 2OIQA 4CLIA 4FNXA 4MBJA 3QQHA 2VWUA 4R78A 4G16A 3BHTA 5LMAA 1CKIA 2YJRA 3C0HA 3UMWA 3HUBA 3FC2A 3PXFA 4LOOA 3SHEA 3MWUA 3ZZEA 5E90A 1LUFA 2JBOA 4CKJA 4BCOA 3L9NA 4WNKA 1QPJA 3W2PA 4BC6A 4E3CA 3ET7A 3QA0A 4GG5A 3KRXA 2ITOA 4X7QA 1URWA 4ZTLA 2X81A 4YURA 1GZNA 3TJCA 1O6KA 1GIHA 5B2LA 4U40A 1OECA 1A48A 1REJA 3I7CA 4MBIA 4MCVA 5GNKA 2LGCA 2BAQA 2REIA 2QO2A 4UMRA 3C51A 3WILA 1PXKA 4DEBA 3VW8A 4QP8A 4O83A 4WNOA 3IOKA 3QTXA 4XG9A 3OTUA 3FI8A 3FMHA 4H58A 2ZV7A 2CSNA 1PXPA 1YDTE 3GB2A 3VBXA 2BKZA 5HBJA 1IAJA 4LOQA 4YJOA 3VBWA 5HZNA 3OTVA 5IA4A 4P4CA 3IGOA 3QC9A 5DWRA 2VWBA 4OTHA 2WMVA 2YERA 3ZO3A 1U5QA 4RWKA 5CEMA 3E92A 2CCHA 2XKFA 4QMUA 3CEKA 3ENHA 4XV1A 3T3VA 4L7FA 4AOTA 1YKRA 2VX1A 2X1NA 5EHLA 5LVMA 3R04A 4TKSA 4PP9A 1CM8A 4A07A 3V6RA 3QUEA 4OT6A 5HX8A 4AXDA 1J7LA 2B1PA 3KL8A 2WMWA 4JX7A 4V05A 3OF0A 4DGGA 4FEWA 2W7XA 4O7SA 3DT1A 3T9IA 1CMKE 2JGZA 2R3GA 3R9RA 4QMXA 3OCGA 3QCYA 2FA2A 3QQJA 5ANJA 2QQ7A 2UV2A 4JRVA 2YN8A 3PWDA 3LFNA 4JX3A 1IEPA 4PP7A 2DS1A 4WRSA 1JKTA 5CALA 3T3UA 3KF4A 3ZSIA 1H1RA 2B9FA 2ITYA 3G2FA 3E8NA 4UV0A 3AQVA 4AF3A 5JGAA 4U8ZA 4D4VA 5CZHA 5HCZA 2Z7RA 2JEDA 3Q60A 2VRXA 2XZSA 5EYMA 4DN5A 3SA0A 2CLXA 4DBXA 5A14A 4I6HA 1IR3A 3PY1A 4NW5A 3RHXA 2XARA 1WVYA 4IZ7A 3N9XA 4F09A 2BIYA 2VTHA 4B6LA 1WBVA 4ZTMA 5EYCA 3HMOA 3KIOC 4MQ1A 3EHAA 1WCCA 1J1CA 2C6OA 4BHZA 2JDRA 1PYXA 3QQLA 4FT5A 2OSCA 3K5UA 2KULA 3BU6A 4UYNA 2J50A 5C4LA 2XK4A 1GOLA 3NPCA 2RGPA 3NFFB 3BHUA 1KOBA 3FPMA 3COMA 3E3BX 5AJQA 5E4HA 1DI9A 2R3NA 2R3LA 2CDZA 4I0SA 3MFTA 1EH4A 4YBJA 3F3TA 3DTWA 3JYAA 3NNVA 3GC8A 1JKKA 2UW4A 3DZOA 4EZ5A 3PJ2A 4M15A 4O7YA 3UPZA 4ZJIA 3W0OA 3KCKA 3EZRA 1OL2A 1OM1A 3HEGA 5DEWA 5KMKA 2ITQA 4FV2A 5I5ZA 3A4OX 3UOLA 5JFVA 3A62A 2X2KA 2YDJA 4U81A 5ETFA 3KY2A 4JXFA 3RWPA 3BX5A 2WU6A 4WT6A 1UNLA 2HY81 2A2AA 3D7TB 4BWPA 2I0HA 2PL0A 4E5AX 1MRUA 4U3ZA 1YWRA 2ERZE 3DLZA 5EOLA 3PSBA 5IUGA 2VTMA 4JIKA 1PXNA 3GENA 3ZO2A 4NZWB 3GT8A 1CTPE 3S00A 3QGYA 4EI4A 3RAKA 5IMXA 5KBRA 3DA6A 2WQMA 2XAMA 3V5TA 4DGNA 4BTKA 3ORPA 4LGDA 1RQQA 2X8EA 2Z60A 2PPQA 3GOPA 4F6WA 2GQSA 3H0ZA 4OBPA 2FGIA 5IKWA 3BYVA 3MFUA 2W5AA 4HZSA 4IZAA 1YOLA 3NZ0A 5J7HA 3TZ7A 3VRZA 3PFYA 5CSVA 1Y8GA 5CU3A 2F7XE 2X7FA 3R2BA 3DKGA 2QONA 4GMYA 3ZBXA 2VO3A 4IZYA 3KXXA 4O0RA 3E93A 4U45A 2PUPA 3UP7A 4C4FA 2YIRA 5ANEA 4EC9A 3R7IA 4FF8A 5LWNA 5IMEA 3NCGA 5L2QA 2VTPA 3HLLA 5D9HA 4QD6A 4XP2A 4O82A 5CASA 2FH9A 2B9IA 2E9VA 3MA6A 2PZRA 1H8FA 2ESMA 4E5BA 2OICA 1SVHA 3WF6A 2BVAA 3DBFA 3PVGA 5E1EA 3IPHA 4EYJA 4RIYB 4O7TA 5LQFA 4J8MA 5DOSA 5ITAA 3D7TA 4EH8A 4DEEA 3MH2A 2NNWB 5BVOA 5IEXA 4F9YA 5I3OA 3BI6A 3P5JC 3VJNA 4ARKA 3BWJA 2B9HA 3ZLSA 1YI4A 1X8BA 4Q5HA 4ZSGA 3FL5A 1M2RA 3EN7A 3MW1A 4CGAA 2I1MA 4OAVB 2J51A 4LUDA 4KAOA 4YSMA 4FTLA 1XH7A 3F7WA 1H4LA 4L3JA 3MB6A 4CRSA 4DLJA 4EOKA 3IKAA 5E8WA 5HEZA 2I40A 4A9YA 2FO0A 5CT0A 4I6LA 4EJ7A 1UKHA 1ZRZA 4DGLC 3ZC6A 2XF0A 4BI0A 4D4SA 5HE2A 2QHNA 5H2UA 1M17A 4Y5HA 2WTJA 3F9NA 1GZ8A 4MWHA 5M09A 2XCKA 3PG3A 2AUHA 2YM4A 2OJGA 4FKRA 4AA5A 4MAOA 4QMPA 2X9EA 5JRSA 4BDDA 3E63A 3I81A 4MQ2A 4MTAA 1CDKA 5D1JA 3F3ZA 3EH9A 5DPVA 4DH7A 1F5QA 3OW3A 4FSTA 4I93A 3VQUA 4D28A 2PU8A 3C9WA 1Y6BA 2FVDA 4I4EA 4CEGA 1APME 4FEQA 2NP8A 4I20A 3TV6A 4ZSAA 5IQAA 3JS2A 5CU6A 4C57A 5AV0A 3IDBA 3IW6A 4PDPA 4IAFA 4QMOA 4U43A 5AV4A 5DYJA 4FV7A 5CEOA 3BKBA 3D5UA 2ZM4A 4XLVA 2QOQA 3SVVA 2RFNA 5M57A 4YPSA 3QC4A 4JBVA 4WNPA 4BBMA 1V0PA 4W8DA 4Z3VA 2UZTA 3P78A 4FTUA 4JJRA 1W2FA 3OZ6A 4ASEA 4H3QA 4F08A 4ZY4A 4V0GB 4X3FC 4UMUA 3NYNA 5E92A 4BBFA 4I94A 2YLFA 3QTRA 3FXXA 3R9HA 3TIYA 2H34A 4FYNA 4L3LA 4ZY5A 2R3KA 4O0SA 5HE1A 3Q53A 3O2MA 2YEXA 4V01A 1Q3DA 1QMZA 5C1QB 3WE8A 3WYXA 3JPVA 4RPVA 4G3EA 2C68A 4GRBA 4ERWA 4O96A 5C9CA 4IADA 4PTGA 2EB3A 4BDHA 5TOZA 1XO2B 3PSDA 1Q8UA 2G2HA 3FMKA 5M07A 3TZ9A 2BR1A 2RFEA 4R6VA 4EOMA 5CAPA 3ZM9A 5H8EA 5AA9A 1BL7A 4WG3A 4C59A 2BCJA 4DTBA 1DM2A 4FSYA 4YJNA 5DEYA 4O0UA 2R2PA 2X2LA 2XJ2A 4FKSA 3HGKA 4M97A 1MUOA 2B55A 4DITA 4QRCA 4FICA 3C13A 4EZ3A 4JT3A 3ZRLA 2BZIB 3QAME 2QHMA 1M2PA 3EN9A 1IRKA 3EZVA 2WNTA 4XBRA 4ASZA 1FVRA 4L45A 3UZRA 4USEA 3ZS5A 3LJ2A 5AADA 5M4FA 4FE2A 3G9LX 3U9CA 1R0EA 5FGKA 1PMVA 2BAJA 3JVRA 3OHTA 4S2ZA 4UMQA 4BCKA 4DTKA 3N4VA 4X2KA 4DFZE 3FLZA 4D4YA 4J71A 2R9SA 3N4UA 4X3FB 3ZLYA 2PUUA 4R5YA 4C61A 3TKIA 1YHSA 3MPTA 3M11A 4EKLA 3RM7A 5DRDA 3TCPA 2BRMA 2WGJA 4HJOA 4CTCA 4ZJJA 2WMBA 2JD5A 5M51A 1Q61A 3Q9XA 2VWWA 4II5A 1KOAA 1Q24A 1WBSA 4IWOA 5KMLA 3FSKA 1TQMA 2GMXA 2Y9QA 4QMMA 3ZFXA 4F9BA 1SZMA 4FR4A 5K3YA 3DB6A 3GU7A 5CXHA 2IW9A 4CQGA 3PZEA 4DFXE 2ACXA 1FOTA 2JKKA 4FV5A 4KIKB 4E4XA 2JDVA 3BHHA 4QNAA 4BIDA 3I60A 3TUBA 3JY9A 2XKCA 4YJPA 2YJSA 5BQ0A 5CSWA 5E1SA 3HV4A 3E7OA 4FEUA 4JG8A 2X9FA 3SDJA 2XIXA 5ETIA 3HKOA 4ZSEA 3TZMA 4Z7GA 4AXFA 2NPQA 1J7IA 3OXTA 5E8ZA 3AT2A 4O84A 3MESA 3GEQA 3KMUA 3BE2A 2W9FB 3CTHA 5DMZA 4R3CA 1HOWA 5I0BA 2YM6A 4F4PA 5IQEA 5J79A 4C33A 2PMNX 4BB4A 4ALUA 2BRBA 2Q0NA 4JDJA 4RLLA 4NTSA 4LG4A 4UBAA 3F7ZA 2BZKB 5CF8A 4QMVA 4X3FA 5BVEA 5KZIA 3DCVA 1OBGA 4H1JA 4CFFA 5E91A 3EQFA 2ZYBA 3SGCA 3DB8A 4E93A 2R7BA 2WO6A 3R8ZA 2XKDA 1PF8A 2V5QA 2WZJA 3QL8A 4WSYA 4C37A 1ERKA 2OWBA 4OTIA 4BI2A 4DH8A 3CGOA 3OT3A 5HG9A 3O23A 4G9CA 4M8TA 1PXMA 3PFQA 2HWPA 4AW1A 4NIFB 3UPXA 3TNQB 3M42A 4MNEB 5CU0A 3LCOA 5DR9A 3TN8A 2HIWA 2C0OA 4FSRA 2OIDA 4TYIA 5IDNA 4HPUE 3QLFA 3KC3A 3FZTA 3QYZA 4FIEA 2BDFA 3GU8A 1UU9A 3FDNA 3N51A 3COHA 5A4CA 4L68A 4DC2A 4AXCA 5E8UA 3DDPA 3ZO1A 2XAOA 1OGUA 3LVPA 3AKLA 1OKWA 2JKOA 3D0EA 4NYEA 2YCRA 3LLAA 5L2WA 3HV7A 4DLIA 1XBBA 3Q4ZA 3P0MA 3C4EA 3C4FA 3EFJA 2GFSA 4YO6A 3HDNA 4AXEA 5DNRA 4C7TA 3ZO4A 5J1WA 2WD1A 4IAYA 3CJFA 4ASXA 2AYPA 5F95A 1OITA 1QPDA 4WNMA 4DBNA 2VD5A 4IWPA 1W7HA 4FV0A 4QMTA 4HVDA 4RWJA 3TEIA 1MP8A 3I0OA 3VUHA 3VUKA 4EJNA 4EH3A 1RDQE 2XM8A 3BGQA 4DGOA 3MH1A 4J8NA 4IB0A 3QQKA 4CCUA 1V0BA 3R2YA 3CQEA 4K0YA 3TTIA 3PXZA 4QYEA 3SOAA 2C4GA 3QUPA 2C3IB 4NFNA 4UWYA 3BHVA 3FY2A 4XV2A 1Y57A 3ZDUA 4PL3A 5JH6A 4MNEA 3FC1X 3D7ZA 4RFYA 2UZVA 5C26A 4OTGA 2RG5A 2EXMA 4YHJA 4PDSA 3E8CA 3P79A 4YJTA 3VAPA 4A4XA 1UV5A 2GHLA 4GK3A 2CPKE 3KB7A 4ACCA 5FQDC 2YIQA 1XJDA 3W10A 2C6LA 2W5HA 2VN9A 4QOXA 3REPA 2YAAA 3E3PA 3KRRA 4XV3A 4CCBA 3U51A 2VTTA 4H05A 2XYNA 4R1VA 3R8UA 2CNUA 5AR2A 3S3IA 3WF9A 3PJCA 2V0DA 1GY3A 3EKKA 3O17A 3RK9A 1PMUA 3RNIA 3ZMMA 5L8LA 1G5SA 4J53A 4WOVA 2I0YA 4ANMA 4K1BA 4X2NA 4IANA 4ITIA 5HORA 1OPKA 2BFXA 5AIRA 3R73A 5HESA 2WTCA 2PVLA 1P4FA 2WB8A 5AR7A 3OWLA 4M69B 5ICPA 1JLUE 5FEDA 1A06A 4QYYA 3R30A 5AP7A 3UMXA 4MXCA 3DPKA 1BI7A 1KE6A 4OR5A 3SW4A 3KCFA 1S9JA 2JC6A 2PY3A 2YIWA 4U44A 4QDEA 2J5EA 3LFEA 5EI6A 4UALA 3F2NA 4NEUA 3FQEA 3KRWA 4JR3A 2X0PA 4C4JA 2XBAA 4H3PA 5BMSA 2QNJA 1H0WA 2PVYA 4N70A 1FPUA 4K6ZA 1OB3A 1YRPA 4OBOA 4P5QA 3SXSA 2R3RA 2F2UA 1OL7A 1U4DA 2QOOA 1W0XC 2Y0AA 3QUDA 1OIUA 3LZBA 5LCJA 5EDPA 4F0FA 2R3JA 4OTFA 1O6LA 4HYIA 4N4SA 4YZMA 2WEVA 2G9XA 5JZNA 2B52A 4QYFA 3VF8A 4GJ2A 5KUPA 4IXPA 1PW2A 3Q52A 2CKOA 3PXRA 3F3WA 2PYWA 3BGZA 1KE9A 4F9WA 1CKPA 4YNOA 4FUXA 2XK7A 4GL9A 4D9TA 4FI1A 4IMYA 4WBOA 4Q2AA 3G33A 5AV1A 4BVUA 3F66A 5EM7A 2W1IA 4YZCA 2PWLA 3HMNA 4EOOA 2XS0A 5KX8A 5CF6A 3EN6A 4QP6A 3MTFA 4QP7A 5HX6A 2BHEA 2OW3A 3NNWA 3QTIA 4FTCA 3W1FA 4I0RA 4XG8A 3OOMA 4AGWA 1KWPA 4BBEA 4C3RA 1J7UA 5DGZA 3FKLA 4W4WA 3B8RA 5HU3A 3R8PA 2OFVA 4S31A 2C6DA 5CSXA 1W83A 1SVEA 2ITNA 2KTYA 2H8HA 4D4RA 3THBA 3KU2A 3TT0A 2DQ7X 5DFPA 1YXVA 5C03A 3V5QA 5TF9A 1QCFA 4YBKA 3BHYA 5EYDA 4DFBA 2JITA 5L3AA 3CQWA 3G9NA 1PJKA 2PVFA 4AW0A 3HV5A 2O0UA 4P2KA 5LJJA 4ZMEA 3EN5A 1YXUA 2BDWA 3Q3BA 5EOBA 4PMMA 1TQPA 4Q5EA 4WG5A 5BVDA 3PUFC 3A7FA 5L6WL 3QZGA 2P4IA 3DJ7A 1OKZA 3DBQA 4RG0A 2UZLA 4ACHA 5IUHA 4YP8A 4CSVA 3NYOA 4HGLA 3W32A 4ZTRA 4FSUA 5AUWA 4CFMA 5K4IA 5CEPA 5I9VA 1FINA 4XG4A 2XCHA 3PIZA 4LQMA 4FYOA 5LOHA 3BPRA 3KN5A 5GIPE 4AZVA 3E8DA 2QOCA 5EKNA 1H08A 2GHMA 4KABA 3UJGA 3KMMA 4EOQA 5KCVA 3SKCA 4FOCA 5FLFA 1LEWA 3QTQA 4GFMA 5JKGA 1XH8A 3SW7A 2HWOA 2R3HA 3ELJA 4FKGA 4NM3A 3ATTA 3QKKA 4TN6A 1W82A 3TDWA 1A9UA 3DFAA 2IVVA 3L1SA 1ZMWA 4EWHA 1AD5A 1ZLTA 4FSMA 1JVPP 2X2MA 4I92A 4JQEA 4HCTA 4I0TA 4AFEA 3V3VA 4BWXA 4I22A 2OJJA 1VYWA 3DQWA 5CXZA 1SMHA 5EFQA 1I09A 4FKOA 4TNBA 4L53A 1Q97A 3NWWA