4NJDA

Structure of p21-activated kinase 4 with a novel inhibitor ky-04031
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
291
structure length
290
Chain Sequence
MSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
publication title Discovery and the structural basis of a novel p21-activated kinase 4 inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4njdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4njdA01
4D2TA 3WF7A 4USEA 5K9IA 3FKNA 1O6LA 5EFQA 2Y0AA 3ZXZA 3PLAE 4CT2A 2C5VA 1YHVA 2JKOA 2UUEA 3KMWA 4IFGA 4KIKA 4EORA 4OTDA 2GDOA 4O86A 5FWKK 3EQBA 1NXKA 3H9FA 3D5VA 5AV4A 3RNIA 5A46A 5TT7A 3VUKA 4PX6A 3D4QA 3HDNA 3A7IA 3QF9A 5HOAA 2Z7RA 3QBNA 5DT4A 3BWFA 5K3YA 5IMXA 3D2IA 3FZOA 2R0IA 2QOIA 4FKUA 4UMTA 2XK3A 2ZVAA 3R71A 5IQCA 2XMYA 3QQJA 2ZMDA 2WQMA 3O50A 4FICA 4C4JA 4LGHA 5ANKA 3WYXA 4DFNA 5KHXA 4RIOA 5CENA 4HVHA 4FIFA 1JKLA 2OJFE 2JIUA 1WBPA 5KNJA 3QRJA 3Q32A 4U43A 4G5PA 4YNOA 4DEBA 1TVOA 3FHIA 5D1JA 4XCUA 4XG4A 4BDGA 3UTOA 3U9CA 4F7JA 2YAKA 1Q8YA 2ACXA 3D94A 1RQQA 3VUHA 4BDIA 4BY9E 2PVMA 4KAOA 3FQSA 4G3DA 4BBMA 3NX8A 4D5KA 3AT4A 3PVBA 2J9MA 4Q5EA 1KUTA 3DAKA 3LAUA 3C0IA 5EYDA 4YJVA 5C1QB 4FV9A 4YJSA 3UOHA 2BZHB 2WOUA 5AR5A 4YP8A 5AP1A 3BLQA 2Y6OA 3NUXA 4QMSA 3UVQA 4MYGA 4ANBA 2JDTA 2PWLA 2OJIA 2I7QA 4EH5A 4LG4A 4XRJA 4C61A 4CV9A 2QLUA 2HY0A 3FMNA 4RX9A 4PMSA 5KE0A 3QXPA 4PPAA 4K33A 5AEPA 4FR4A 4F09A 3VUMA 3DB8A 3TWJA 1QCFA 1OB3A 2C3IB 4D4RA 5HTBA 4TWCA 3DCVA 3Q9YA 3P5KA 4O1PA 5TR6A 3RTPA 4MAOA 3NYVA 4GG5A 2SRCA 4AW5A 4F0FA 3DXQA 4LUDA 3FLSA 3BCEA 2QD9A 4FODA 3IW7A 5AX3A 2XNMA 2R3NA 3R21A 4F0GA 4JBOA 2NRYA 3LXNA 3QD3A 4MQ1A 5IH4A 5I9VA 3LFAA 4LL5A 4TYIA 3R7YA 4O7RA 2WTIA 4O7YA 4I6FA 4X6QC 2NO3A 4O21A 5K5XA 2C3JA 2P2IA 2WMTA 1KE6A 1H01A 3FPQA 2UZNA 4BKZA 2J5FA 4GU6A 4CLIA 4F64A 3CQUA 5L8JA 3VUIA 3A62A 2I0EA 1M14A 3AMYA 2XVDA 3KKVA 4JQ7A 3HX4A 5CSHA 4L7FA 5BYYA 2W5BA 5J7BA 1ERKA 4DC2A 5M51A 4Y85A 5AA8A 3SG9A 3KA0A 2OO8X 5EHOA 2X6DA 4MXZA 5J87A 3D5UA 5CT0A 2GNJA 2B0QA 3OW4A 4GMYA 4FSMA 3ID6C 3K3JA 3ZO2A 3ZH8A 4I5HA 4OBQA 3W18A 1KE9A 4C62A 3BHHA 3PWDA 4DG0E 5J8IA 1UNGA 3FZPA 2WIPA 4GK2A 4OAVB 1WAKA 4H58A 4PNIA 4QP6A 2CDZA 5CI7A 2PVRA 2BIKB 3ANRA 3QX2A 5HZNA 3KXNA 3PIXA 5IUGA 4A4OA 3PSBA 4FL3A 1OKZA 4YSJA 1CMKE 2ITVA 3P86A 2YIYA 4RMZA 4QP8A 5KHWA 3V5PA 2BRHA 1F5QA 2VGPA 4EHGA 3D7ZA 4D2WA 4JBPA 3OZ6A 4DFUA 2HZIA 3S95A 4AW0A 4KSPA 4W4XA 4LV8A 4CYIA 4FTTA 4HNFA 4NL0A 4D58A 1RW8A 3R2YA 4B8LA 3TUBA 4RWLA 2CKQA 3HLLA 5LMBA 3PA3A 3ORLA 4IACA 3IW4A 3QAME 3E3BX 3GNIB 2YISA 4KSQA 1BLXA 5AFVA 3UC3A 2XM9A 3OUNB 4UV0A 2QC6A 3PPZA 5DR9A 2C6MA 3DT1A 1Z57A 4NTTA 2PPQA 4E4NA 3PY3A 4P5ZA 3CIKA 4GIHA 5JN2A 2GSFA 4ZS4A 3PY0A 2BTRA 2V62A 3OWPA 4OUCA 4X2FA 2QOOA 5AR2A 3MTLA 3FJQE 4EOMA 2OXDA 4BDEA 5J79A 3MH1A 4M13A 5DYJA 1PKDA 2H96A 3OBGA 4JLCA 3SV0A 5HU9A 3QU0A 2YJRA 2XNEA 2OW3A 1E1VA 3AMBA 3JYAA 4FVRA 4BZNA 2W06A 3K2LA 3QYZA 3TZ8A 4E5BA 2F57A 2X1NA 2WMAA 3ZEPA 5CNNA 3FY2A 5JFWA 3CS9A 3C4FA 4F7SA 1MRUA 1T46A 2AUHA 4OT5A 4ZAUA 3OP5A 3DNEA 3OEFX 5A54A 3WZUA 2Z8CA 3BLHA 4ARKA 4GG7A 3UZPA 1BX6A 5KZIA 3W2RA 2XS0A 5AR3A 5ETFA 4WHZA 1G8AA 3JY0A 4FIEA 2BAKA 4YTFA 4CT1A 4DF3A 2PK9A 3COHA 4CD0A 4ZP5A 4W8DA 3S2PA 2JBOA 3EHAA 4GRBA 5M4CA 2C3KA 4G9RA 1Y6AA 3FKOA 2BIYA 3TNPC 5TO8A 3TNWA 4RJ4A 4ZK5A 5KKRC 2QG7A 4WG3A 5ACKA 2UW8A 4V05A 2PZIA 3QA8A 2B52A 3SXRA 2A4LA 4IW0A 1XO2B 1ZRZA 4KRDA 5HU3A 4ACMA 5KZ0A 4CRSA 4ONAA 3IS5A 4GSBA 2EWAA 1XH7A 2JGZA 2FH9A 1KV2A 4R3RA 3SW7A 3N4UA 4PPBA 3W2PA 4U44A 5D7VA 2A27A 1JSTA 3A7FA 3HUBA 4YZ9A 4BWKA 5ETAA 3BHVA 3QCQA 3VS4A 3FMMA 3DXNA 4QYEA 3O0GA 4CRLA 3JUHA 4B7TA 5HI2A 3CGOA 3FXXA 2W99B 4MXAA 3UYSA 3QALE 4PRJA 4XNEA 5ANOA 3A7HA 3ZDIA 4E6DA 3EQGA 3DJ6A 1AD5A 4J98A 4QMQA 1YI4A 2PMNX 5EM8A 3PA4A 2WAJA 4M8TA 4OTPA 3GCUA 2FSMX 4F6SA 3ZM9A 4XOYA 4FTJA 1Q99A 2WEVA 3ZONA 2XNBA 3HA8A 2Z02A 1YI3A 2WMRA 4ERKA 3I5ZA 4BN1A 3DJ5A 3QQLA 3B8QA 3KC3A 5G1XA 4LI5A 2BMCA 3KGAA 3A4OX 3DPKA 5K4IA 4R5YA 3KRXA 3U9NA 2X0GA 3VULA 4ZY5A 4JG7A 5IG1A 5KUPA 4DFYA 3FSKA 4MD8E 5HBHA 4FKIA 1YOMA 5JT2A 3CQWA 2JKQA 4F9CA 3V6RA 4EOOA 5FQDC 5TKDA 4TTHB 4YLJA 2VUWA 5FDXA 2QOQA 4G17A 4FL2A 3UIUA 4GUBA 1DAWA 2YDKA 3QX4A 4RFZA 4YJRA 5AM7A 1S9JA 3MIAA 4QPMA 5J1VA 4R6VA 1SVHA 2W17A 1H28A 3R1QA 1W7HA 3TUDA 4L46A 2EXEA 4FZDB 4ERWA 1PXOA 3CKXA 4AX8A 2P4IA 4KRCA 1YRPA 1GIIA 2QI8A 3PP1A 3RPRA 2V5QA 2WMVA 2VWBA 2WO6A 4PDPA 4XRLA 5C4KA 4EBVA 4CQEA 3KRWA 3N4TA 3RNYA 4GT5A 4JDKA 2J0MB 4N0SA 4E26A 3R8PA 3QQUA 1I09A 3FXWA 4F1TA 4QQ5A 4FKGA 4IJ9A 4O0SA 5DVRA 4ZOGA 3I5NA 4UBAA 3B2WA 2VTQA 4RIXB 3GP0A 3DKFA 3K3IA 2P2HA 4CG9A 2P0CA 3VS1A 2CHLA 3R63A 4L3JA 2ITNA 2UZWE 2ZM1A 5DR6A 2VO7A 1XBCA 4F63A 4DGMA 4CKIA 2ITPA 3DA6A 3UC4A 4OAUC 1ZY4A 4ALUA 3H0ZA 1OKYA 4WNPA 3VWAA 1V0PA 2CCHA 3RWPA 3PPKA 5AP7A 2WZJA 5J1WA 3L9NA 2QOLA 2X2LA 4U80A 1Q8TA 3OTVA 2C4GA 4M15A 4CFFA 3LE6A 5H9BA 3FPMA 4O0YA 4K77A 4WUAA 4D28A 2VX3A 2VTSA 4F6UA 2WQEA 2EB3A 3EYHA 4BF2A 2C5YA 4D0XA 1UKHA 5C8KA 3N4VA 3WZJA 4M0YA 2PE0A 3HMOA 2XRUA 2XIZA 4W4YA 3CR0A 4PDYA 2VWZA 4I21A 2IO6A 1QPDA 2W4JA 3LMIA 3VC4A 1SZMA 3KXGA 4K6ZA 4ZLOA 4UMUA 5LOHA 1H00A 4NKAA 4MBIA 4HW7A 1L3RE 5I4NA 5LMKC 2OSCA 2HELA 1Q8WA 4ZS0A 4X3FB 5J7HA 3PIZA 2QOFA 3BGZA 5EYMA 3U54A 1Y8GA 4G16A 1FVRA 3G9NA 2O8YA 3REPA 2XK4A 3FYJX 1Q5KA 1VZOA 3FMDA 4QMLA 5GJDA 2ZYBA 5AP3A 4RA5A 4L53A 3SC1A 1RJBA 3I6UA 1GIHA 2GQSA 4AQCA 1E9HA 5IF1A 2CGVA 4FUXA 1PMUA 3OY1A 2B53A 2HXQA 4HGLA 3VBXA 2QO7A 2OH0E 4DG2E 1HCLA 4A7CA 3DGKA 3TJDA 2XK6A 5A14A 4NM0A 2O2UA 1UU8A 3ZBFA 2IVSA 2QURA 2NNWB 3U51A 4IVBA 5BYZA 5I5ZA 4CG8A 4ANSA 2JIVA 3TV4A 3O8TA 4QTDA 1Q4LA 4FZ7A 2JKKA 2AC3A 1S9IA 3TJCA 3RKBA 4ENXA 1R39A 3DBEA 4RIXA 2YHVA 4BCMA 5JQ8A 5C4LA 2Y4PA 1PXIA 4EOLA 2GNHA 2OIDA 1YDSE 4J8MA 4RA4A 5L2WA 3GC0A 3K54A 4RIWB 4G6OA 4IB5A 4P2KA 4JX7A 3EL8A 5AUVA 4AZSA 3U4WA 4I22A 4MXXA 3D15A 3L9PA 2PZPA 5K0XA 1CSNA 4RFMA 5GZ9A 5JRSA 1Q24A 3I60A 3MTFA 3GVUA 3BV2A 4OT6A 2LAVA 4FV8A 1XH6A 4XOZA 3I7BA 3C4CA 3QC9A 5AAGA 2VWIA 4J96A 3QC4A 3D2KA 2W05A 2HZNA 3UMXA 4H3PA 4EH7A 5LQFA 3WF8A 4CV8A 4KINA 1HOWA 3CD8A 5DBXA 3Q04A 4FYOA 2QODA 3KVXA 3PXYA 2EVAA 3DBDA 3FMLA 4O0UA 2PZRA 4RX8A 3R8ZA 5HESA 5A4QA 3TDVA 4QP2A 5JH6A 5IEXA 3ZRMA 4DTKA 5KMLA 4OW8A 4FT0A 4JR3A 1B6CB 3DOGA 2WMXA 2BKZA 1OL1A 2ZV8A 1XQZA 4TYEA 4PTEA 3PG3A 4WIHA 4X3FA 3FDNA 4EH4A 3EWHA 4NK9A 4JAJA 2C30A 3LM5A 4O0TA 4ALVA 3GB2A 3C9WA 3SX9A 1YHWA 2BHEA 3F5UA 2KULA 4A9TA 5AV0A 5M08A 2XJ0A 3V51A 4J53A 4KIQA 2F7XE 5HICA 3KK9A 5J9YA 1JOWB 5HNGA 3PTGA 1O9UA 4QMWA 5HG5A 2WGJA 2IVVA 4RVLA 4EK8A 2JAVA 3Q4ZA 2VNYA 3DFAA 3HNGA 2GFCA 1H24A 3BRBA 2CKOA 3U55A 1PMVA 3BQCA 3NPCA 5DOSA 4FV1A 3FLWA 5AUWA 1GAGA 4E6QA 4FKJA 4WBBB 5CEMA 1PY5A 3QZGA 2BDFA 4YUQA 1PYXA 3QCYA 1FBNA 4O27B 2ETKA 5I9UA 4ASEA 3L8XA 3KXHA 1BI8A 4C4HA 1IAJA 3ORPA 3PYYA 5AP0A 5JK3A 2QU5A 4IC7A 4U40A 2GS6A 4C8BA 3R6XA 2J0KA 2YM5A 1OZ1A 2OU7A 3A7JA 2J0IA 3NLBA 2BZJA 3QHRA 4YMJA 2VD5A 3ZUUA 2QU6A 4QMTA 4APCA 1FVVA 2VRXA 2QOCA 4L45A 4RIWA 4DITA 4WBOA 4O84A 1MUOA 2J50A 4XV3A 5HIBA 3MW1A 2XH5A 4O0WA 4F1OA 1UU9A 4FV6A 4F08A 3QTSA 4QTBA 4O0VA 4Y5QA 4ZSJA 4H39A 5HG9A 4EOQA 5JRQA 5E90A 4HVIA 5CF8A 5KBQA 3VW8A 5ANGA 5DE2A 4O91A 5JFVA 4TYGA 5T6KA 3GQLA 3HV5A 3NRMA 1J7LA 1SNUA 4IIRA 1JQHA 4XG8A 4C35A 4IX4A 5HVJA 3RAKA 3BHTA 5C9CA 5HLWA 2JDVA 1ZZLA 4GW8A 4JOAA 4X3JA 4AOTA 4PTGA 5E8VA 3ORMA 1W8CA 3VF8A 5KMIA 4DTBA 1PHKA 4NU1A 4PUZA 1P4OA 3LFFA 4V0GB 3MFRA 5AAFA 3LMGA 1JAMA 1JVPP 3HECA 1BL7A 3RINA 2JD5A 5EW8A 3ZBXA 3PDTA 3DU8A 1PW2A 3CCNA 1V0OA 1NVQA 5AR4A 2ITXA 5BUIA 2J0LA 3R04A 1Q3WA 1SVGA 5IMEA 4C2WA 3EFKA 3OEZA 2VWXA 3PXZA 3KF7A 3H3CA 2BILB 5M44A 3GU8A 2VTAA 2W1CA 4MWIA 2OFUA 3QGWA 3IK3A 1VEBA 4FSZA 1XH9A 3FQHA 1ZXEA 3FV8A 4R7HA 5KMMA 5E8ZA 3VUDA 4BWPA 3EQHA 3EZRA 4LQMA 4OTQA 2NP8A 4YLLA 5HCZA 3NIEA 2HXLA 3LXLA 5HG7A 3AQVA 2JFMA 3ZXTA 1AQ1A 4K11A 5CXHA 2WQOA 4FMQA 2LGCA 4FZ6A 3UG1A 3K5UA 3BEGA 3O71A 3I79A 2ZJWA 4RFYA 5DRDA 3IOKA 2BFYA 3NR9A 3E93A 4MK0A 4DH5A 5KKRB 1NVRA 3HUCA 4ZTLA 3BZ3A 3MIYA 3PJCA 4LOQA 5IDPA 1CKIA 4FNXA 3S00A 3TKIA 3H9OA 3Q6WA 2Y9QA 5EI2A 1PXLA 4P5QA 2BR1A 3MVMA 4WUNA 3F82A 4KIKB 2OIBA 2VAGA 2HZ0A 3R7UA 3S0OA 3BU5A 3NNVA 3VRZA 4D1XA 2VGOA 2PTKA 2Z7LA 4L01A 4ITIA 2WTDA 4ZZNA 4CGAA 2VTHA 3ORXA 3P08A 3BIZA 5CAQA 4WKQA 2J5EA 2WTWA 3ROCA 4Y95A 5CANA 4IE9A 3P7BA 3HYHA 3PA5A 4DBNA 4HGEA 3FMHA 3P78A 5BNJA 3NAXA 4RJ5A 5LVLA 4H1JA 5AR7A 4JRNA 4RGJA 3ET7A 2CKPA 5IQAA 1KOBA 4AA0A 3I0QA 3PE1A 1CM8A 4FKWA 3V01A 4O38A 4AGCA 2QKWB 4A9RA 4OGRA 2KTYA 4WA9A 2VWYA 4BI2A 3E88A 4XS2A 4X7QA 4YPSA 3BBWA 5ETCA 4C57A 3NAYA 4FKPA 4UZDA 2R3JA 5JEBA 3ACJA 5I3RA 2HIWA 2QO9A 5L3AA 3ZRKA 3QTIA 3TV6A 5CAUA 3P23A 4KWPA 4RZVA 2YFXA 4E20A 4EHEA 2RSVA 3RK9A 5CZIA 3ZSGA 4C37A 4UALA 5FP5A 1YXXA 3Q3BA 5F4NA 4R7IA 5A4EA 3CC6A 4R78A 3WARA 2XRWA 3IDBA 2YCSA 3FKLA 5AIKA 4JL9A 3NUAA 3C4ZA 3OCGA 4O96A 4MNEA 2NPQA 4H3BA 4G3CA 2PULA 4M97A 2GTMA 3VVHA 4RIYA 5JGDA 3QXOA 3C7QA 3EL7A 4L67A 2QOKA 4TL0A 2I6LA 4L44A 4USDA 4LRJA 1YW2A 3QD2B 2W1EA 3IW6A 5FEEA 4PNKA 2V7OA 3SDJA 3V5LA 2WIHA 1KSWA 3RPVA 5BYLA 4FC0A 4IEBA 5E1SA 1PXNA 3FHRA 2ITTA 1GZOA 3R28A 4G3GA 1NT2A 1UVRA 3RCJA 3PVUA 2VTPA 4K1BA 4YHTA 3I0OA 2Y4IC 4U0IA 3SHEA 1UV5A 4I5MA 3UDBA 1ZMUA 3AC8A 2PSQA 5AUUA 2R5TA 4JDJA 4F0IA 3SG8A 3IW5A 1YDRE 2HZ4A 3F2NA 4X3FC 5CU3A 3QTQA 4I3ZA 3TIYA 3MH3A 4NSTA 4F9AA 4EBWA 4AXAA 2W5HA 2R3MA 3NNUA 3P79A 3FC1X 4QRCA 5AV3A 2RFNA 5AV2A 4DT8A 5CF5A 2XEZA 4R8QA 3UMWA 1OPLA 4ZMFA 2R3HA 4RVMA 2W5AA 5DGZA 3E8CA 2RL5A 3NWWA 2VTMA 2UW4A 1P2AA 3DLZA 4I24A 4BCHA 5HO7A 4IX3A 2ETMA 4S31A 3NVKI 2YDJA 2WQNA 4NCTA 3U8WA 3V5JA 4EONA 3UYTA 3LZBA 2VO3A 4Q9SA 4FE2A 1Z5MA 3E8NA 4EH6A 2F49A 4X0MA 2X39A 4CSVA 2XJ1A 3I1AA 1DM2A 3VS7A 4ACCA 2V22A 4IAAA 4Z3VA 4R3CA 3VRYA 1R1WA 1GJOA 5GINE 4IJPA 5M56A 4DBXA 3MDYA 5BMSA 3CTHA 4KS8A 3PZHA 5DHJA 1YDTE 1TQPA 2BDJA 3AC5A 5DA3A 5ANEA 4CEGA 5LVPA 3KL8A 3ITZA 4IZ5A 1OUKA 3LJ0A 4HNIA 4AZTA 4CXAA 3R9RA 5HIEA 2GHLA 3TTIA 3G15A 4EOSA 2DUVA 2QR8A 3NMUF 1WZYA 4HYSA 2XYUA 2R2PA 1WFCA 2A0CX 5AP6A 4AFEA 3COKA 5I9WA 2C5NA 3S3IA 2Y6MA 2BRBA 4PP9A 4IVAA 3TTJA 2ITWA 4D4YA 4XX9A 1GY3A 3TNHA 4RQVA 3KB7A 2B55A 3HEGA 4E6AA 2CNVA 2EB2A 1OIUA 4FIJA 5ACBC 5FDPA 2H9VA 2I0YA 5GIPE 4BIDA 3V6SA 4QO9A 4QTAA 4L68A 5IA1A 3UJGA 4QQTA 4J52A 4UEUA 2PVYA 3ZLXA 2PMLX 4OTFA 1PMNA 3LXKA 5DWRA 5M4UA 4IAFA 1M17A 3DKOA 4CFMA 4DEHA 1FINA 2XIRA 4KD1A 4IVCA 3UNJA 3E3PA 4O1OA 5LWMA 3BI6A 2QG5A 3BLRA 4I20A 4WO5A 3DK3A 3MB7A 5DMZA 3CPBA 5DFPA 1W84A 4OTIA 1YWRA 2BALA 2WQBA 3GGFA 1WBWA 3RPYA 4S34A 1ZZ2A 3QTZA 4CQGA 3QHWA 1KE5A 5HG8A 4U9AA 3RBWA 2IW9A 5CAVA 4WD5A 3F3WA 3P7AA 4QP4A 5DG5A 4EK6A 4DHFA 5A6NA 2V0DA 4EHVA 4W9WA 4NTSA 5BX0A 3L9MA 3FAAA 1H25A 3VUGA 3MVLA 3POOA 4JJRA 3R8MA 2XIKA 2C0IA 2R4BA 5J9ZA 4BTFA 1W82A 1Y8YA 4MTAA 3TZMA 5FRIA 3PXQA 5F20A 5LXMA 3VQUA 5IPJA 3QCSA 5DT0A 2JAMA 4PQNA 4XYFA 5CSVA 2VTLA 4K18A 3R9HA 5H3QA 1H07A 4GEOA 2XK7A 3MA3A 4TWOA 2W1FA 1YI6A 3U6IA 2PVNA 3GT8A 2GFSA 2OBJA 4LGDA 5H2UA 1CKJA 3DLSA 4O0XA 4ZIMA 4S30A 4XHKB 3SW4A 1U5QA 4G6NA 2XEYA 3EN4A 4K0YA 4HPTE 3OXZA 1J7UA 3SRVB 1H1QA 5AADA 2UW6A 4FT9A 3DS6A 4EQMA 3QKLA 3RALA 5HNBA 2FB8A 4DFBA 4FSUA 4N6YA 1IAHA 5J5TA 5BUJA 2AC5A 3KMUA 3MPTA 4FV0A 2ITQA 4G1WA 4E3CA 4AT3A 3FLNC 5BPYA 5CWZA 5E8TA 3IG7A 3UO5A 3NZ0A 1H27A 3KFAA 3G0EA 3AG9A 3ZO4A 4FKQA 4LL0A 4N57A 2BVAA 3FE3A 4O7ZA 4JR7A 4IZYA 4P4CA 4AT5A 3OVVA 4RC3A 1FGIA 4MX9A 2J4ZA 3RHXA 4MXCA 2W7XA 1VYZA 2YWPA 4KA3A 4NEUA 4UY9A 2AYPA 4F7NA 3WBLA 4CVAA 2XK9A 1BMKA 3ORIA 4YNEA 4QQCA 5CVFA 5EW3A 3UNKA 2OGVA 5KMJA 4NW6A 1W98A 4XMOA 3PXFA 4IDTA 3A8XA 5L2IA 4ZTRA 2YLFA 4AE9A 4FEXA 1XH4A 4CKJA 4CTCA 4DFXE 2OXYA 5JKGA 2RG6A 5D41A 5F95A 3EJ1A 5EG3A 2DWBA 2CKEA 2IZRA 3VIDA 2O5KA 3JPVA 4D2SA 5IQDA 1FGKA 5GIOE 3KRJA 3TKHA 3FI2A 2CGXA 5L4QA 4M12A 4FTUA 4YBKA 4ITHA 1BI7A 1P14A 4LOPA 5CTPA 4LFIA 2UZUE 5DH3A 1V1KA 5AM6A 4IH8A 4DGNA 4EOJA 1OBDA 3MH0A 1OMWA 2B1PA 1ZWSA 3DKGA 1P5EA 3NS9A 5IQGA 3OOGA 3PZEA 1SMHA 3G51A 3C1XA 3KRLA 3R1SA 4HVSA 4FI1A 1U54B 2ESMA 4NFNA 4QTEA 4FL1A 4S2ZA 3NW6A 4NH1A 3PE2A 4X21A 4BHNA 3BYMA 3F7ZA 3KU2A 4FTLA 4FT3A 4FV4A 2YCRA 3MH2A 2YIQA 4RRVA 5FEDA 2X9FA 3WE4A 4BDJA 4UB7A 4FG9A 1QL6A 3SRVA 3UGCA 4QMYA 4D1ZA 5HE2A 3WOWA 5D7AA 1FQ1B 5C8NA 5HO6A 2H8HA 3NDMA 4RLKA 2J0JA 3T3UA 5B2MA 4BCFA 3BHUA 3BELA 3ENHA 5A4LA 3F69A 5JZNA 2WHBA 4FSQA 3TZ7A 4F6WA 4NCTC 4PV0A 4NZWB 5EHYA 3MI9A 4EC9A 3BE2A 3NYXA 4NFMA 2OK1A 2B4SB 5AUTA 3UZTA 3EQDA 1Q8ZA 1YXTA 3GC8A 3G6HA 1WVWA 3N9XA 1E1XA 3BV3A 2X2MA 2XK8A 3UP7A 3II5A 2G2IA 2UW9A 2BHHA 2QNJA 4I4EA 4F65A 1OBGA 4TKSA 4U81A 3C4EA 4BZDA 4ZJVA 3NEWA 3O96A 3LFNA 3RP9A 2X4FA 4Z7HA 2C6LA 2HW7A 4C33A 1M7QA 2VWVA 4B9DA 5EQEA 3WZDA 2UZEA 4DEGA 2XKEA 4J99A 4FTAA 3WZKA 5CYIA 5LVNA 3U87A 3KN5A 3CY3A 4AGWA 3Q52A 2O3PA 3R83A 4CCBA 2C6DA 2IWIA 1YVJA 5EHLA 3OT8A 3ZHPC 4H3QA 5IH5A 3NUYA 4O7LA 4JDIA 3ZOSA 4YR8A 1UKIA 4EH2A 3HAVA 3QA0A 4IWDA 2BAQA 1H8FA 3QLFA 3TT0A 2FSOX 3ZYAA 5IA3A 2UW3A 5HTCA 4BI0A 2PMOX 4O7WA 2X4ZA 2ZDTA 3LFCA 2FYSA 4MEDA 3TACA 4WOVA 1KWPA 5HHWA 4MQ2A 4B6LA 2J90A 5CQUA 1OIRA 5LVOA 2YM8A 2E9OA 5E8XA 1XH5A 2ZM4A 3DAEA 4GT4A 2R3LA 3EIDA 4I0RA 2JKMA 4TT7A 3ZLSA 3U6HA 3OCTA 1L8TA 4KB8A 1W0XC 1YOLA 2P33A 2PL0A 5L8KA 3FMEA 3QQKA 4JVGA 4FEVA 3CTJA 1MRVA 1U54A 1A06A 3R2BA 4NT4A 4RC2A 4YTIA 3RVGA 3VHKA 1XKKA 3F61A 2XIXA 3Q6UA 3QD4A 3AC2A 4KBAA 3ODZX 2VTOA 4IAKA 4ANOA 4BCOA 2GQGA 4CZTA 4RBLA 2PVJA 3TG1A 3QLGA 4DINA 4E73A 3DY7A 2VO0A 3IQ7A 4FGBA 2WTVA 3EYGA 1G5SA 5JFXA 3GFEA 1Q3DA 2O64A 4YJQA 3FSFA 3O2MA 2GHMA 4E8AA 3F7WA 4JG8A 4I0TA 4BIEA 2FSLX 1XR1A 1KE7A 1M2RA 4JNWA 2QVSE 4O81A 2BZIB 5EI8A 4A9SA 3LFSA 4FOCA 3ZEWA 4Y72A 4FTKA 1K9AA 4PL4A 4ZLZA 4D9UA 1IA9A 3FI4A 3VBVA 4DT9A 3WZEA 4HZRA 4UX9A 4UWYA 3LM0A 4YHFA 4FNYA 1PXPA 1KE8A 1QPCA 2WD1A 5FGKA 3F9NA 5A6OA 5B7VA 4ZSAA 2E9NA 3BHYA 2C3LA 2Q0NA 3QTUA 2CN5A 4BGQA 3MJ2A 3DAJA 3ALOA 4TYHA 3E7VA 2C1AA 2BPMA 1WVXA 3AT3A 4EH8A 3OBJA 4G3EA 2Y4IB 4IM2A 5M4FA 2PUIA 4APPA 4IDVA 2XBAA 2XB7A 2R7IA 3E87A 4ZY4A 5AAEA 3L8VA 3PXKA 2IJMA 5IDNA 2OIQA 3GCPA 2ZV2A 3UQGA 2BKKA 2FO0A 1SYKA 2JFLA 3VBQA 4J97A 4GKHA 3PLSA 4BDCA 2RFSA 4FKOA 4EUTA 4FTQA 2OG8A 3RI1A 3WF6A 2XNPA 4QYGA 4M67A 3ZM4A 2JEDA 4LOOA 4MD9E 3P4KA 3FZRA 4C0TA 4A4LA 5K4JA 2HK5A 3QKKA 3DV3A 2Y8OA 3RZFA 3GEQA 2PUNA 3O7LD 3UPZA 5JQ5A 1REKA 2XF0A 4D9TA 1OM1A 4GFMA 5I9ZA 2A2AA 3R01A 2PVLA 4J8NA 4BCQA 1ZAOA 3R00A 5IEVA 3RK5A 4E5AX 4PL5A 4HVDA 2VV9A 1TQMA 4QMOA 4F70A 3VBTA 3CY2A 4ASDA 3DBFA 3DQXA 1X8BA 2I0HA 5JSMA 4BTMA 4AA4A 3LQ5A 5AX9A 4KABA 4CNHA 2BRNA 4HCVA 1GNGA 2CN8A 4HGTA 4YC6A 5C8MA 1OL7A 4AW1A 5JFSA 4UMPA 4A07A 4FG8A 2XIYA 3QZHA 2YCFA 4FEUA 3V5TA 3W16A 2H34A 1ZOGA 4LUEA 2NRUA 5ITAA 3LLAA 4FZFB 3GU4A 4EYJA 1OITA 4CKRA 1ZYCA 1Y91A 3TCPA 1CDKA 5H8EA 3ZLWA 1GZNA 1IEPA 4YO4A 4F7LA 3P1AA 5D9HA 3MS9A 3LFQA 3D5XA 3QZIA 3Q5IA 2G2HA 5CSWA 5EOLA 4AGUA 4EZ5A 1Q61A 3C0HA 2A19B 3FZ1A 3B8RA 4C2VA 5AIRA 2JLDA 5KMOA 3MPMA 4BDAA 4F9WA 4FSYA 4FT5A 3U4UA 4L8MA 4Q9ZA 4Q2AA 3SGCA 2IVTA 5EDRA 3CQEA 3QYWA 3VS0A 4E7WA 3Q4CA 4C02A 5M06A 2C6TA 3WYYA 2BFXA 2GS7A 1JKSA 4UWBA 4X6RA 4XP3A 4RJ7A 4S32A 2OICA 3C50A 4X2GA 3C51A 3E63A 1MQBA 3B2TA 4FIHA 4P7EA 3UIXA 4AT4A 4U42A 4UMQA 5K5NA 3GU5A 3AGLA 2DS1A 4GVJA 4N6ZA 4IBMA 2IZUA 1IG1A 4AN3A 3W1FA 1J91A 1OI9A 4IAZA 4I23A 4JX3A 4HJOA 3LQ8A 3OW3A 3KN6A 5DEWA 3E62A 2JC6A 2VNWA 3UO6A 4CFWA 1CTPE 3EN9A 1R78A 4JG6A 2WTKB 4ID7A 4C7TA 2OZAB 3NNWA 3LFBA 4K8AA 5E8YA 4O7NA 4R77A 3A99A 1JSUA 1BUHA 3EZVA 4KIOA 4C38A 4J71A 5AUXA 1APME 4QYYA 5L8LA 4LGGA 5I3OA 4IADA 2J7TA 4IVDA 5HLNA 3ANQA 5IUIA 3RWQA 4A9YA 3ZO3A 2CPKE 1IRKA 1KOAA 1YXVA 2C6EA 4EQCA 3FQEA 4O7VA 4YZBA 2YJSA 3KCFA 5AP4A 5FEQA 4MXYA 4EWHA 3O51A 5ANIA 4H05A 3FI3A 3CSVA 4JS8A 4KIPA 4XV9A 1OVEA 4AACA 4Y73A 2WEIA 1ZOEA 3C5IA 5M55A 2CLQA 4JAIA 3L1SA 4ZSEA 5E8SA 3WI6A 1XJDA 4C3FA 3U6JA 2GHGA 1M52A 3A4PA 4FTNA 5DLSA 4ACGA 5C03A 4DLIA 1ZOHA 2E2BA 3SA0A 3N51A 3ZFXA 3NYNA 5EM7A 1JKKA 2PMIA 5CVHA 3UNZA 1J3HA 5HVKA 3OCBA 4G5JA 3OC1A 3NIZA 3F66A 4UN0C 3RPSA 4ALWA 1WBNA 5ICPA 4BGHA 4ACDA 3TXOA 5AJQA 2IPXA 4YJPA 3AT2A 4DA5A 4QTCA 2YM6A 1OIQA 3LOKA 4I94A 4CMOA 4GK4A 5IA5A 3F88A 2JDRA 4L9IA 3R7OA 3E5AA 1ZMVA 1ZYSA 3AXWA 2WOTA 3OOMA 3QRKA 3O17A 3PSDA 3QUEA 4MNFA 4H1MA 5L6OA 4WSYA 3R30A 1PRYA 3TDWA 2I1MA 5EK7A 3OS3A 4PMMA 4PPCA 4U5JA 3FLQA 1DS5A 4GYGA 4TPTA 3JS2A 3LVPA 4DH3A 4M7IA 4TXCA 2XKFA 4Y8DA 4PY1A 4AZWA 2PU8A 1OL6A 1LEWA 3CKWA 1LP4A 2B7AA 2VN9A 1DAYA 2WMBA 3EKNA 4IB3A 2F7EE 4MNEB 2HOGA 2R3RA 4MVFA 3G5DA 1JPAA 2UZDA 2OZAA 4RIYB 4IM0A 5TF9A 3FZTA 1WBOA 4PF4A 5FBNC 4TN6A 4U3ZA 3NCGA 4XH6A 5E8UA 4TWPA 5C01A 4CFNA 1H1WA 2CMWA 2ETRA 3VF9A 3S4QA 2XNGA 3ZMMA 1WCCA 3I81A 5E7RA 4RQKA 4IMYA 4OR5A 2Z7QA 1NY3A 2VTTA 4EOKA 2XZSA 4WSQA 1SNXA 4IHPA 3BX5A 4IC8A 4RWIA 2O0UA 3EQIA 2W1DA 4YPDA 4PDSA 3TUCA 4DN5A 2PVFA 3LHJA 5EOBA 5A4TA 3GCSA 2GPHA 5CEQA 3IGOA 3VQHA 5CX9A 3NSZA 2BTSA 3PP0A 1ZYJA 4GUEA 1GZKA 2EUFB 2F2CB 2WU7A 3DTCA 5E91A 4IX6A 4U79A 5M53A 4F1MA 3HMPA 4NM7A 4QT1A 5AMNA 3K5VA 3GCQA 4IXPA 2YERA 4IWOA 5HO8A 1JNKA 2OJ9A 4U97A 4RPVA 4DEDA 4CLJA 2X7GA 4QMNA 1OECA 2XCHA 4K9YA 3O8UA 4ZSGA 1WBVA 3CP9A 2W1GA 4FOBA 1IR3A 4FKLA 2ZM3A 4IQ6A 4YHJA 3DFCB 3WIGA 2R3FA 4TZRA 2C1BA 4RJ8A 2H6DA 2HY81 3HVCA 2PYWA 4YJTA 5CF6A 5JZJA 2WMUA 1QPJA 4DH7A 4N70A 3ZC6A 3MSSA 1CKPA 5CXZA 1ZYLA 3WE8A 3G9LX 3R9DA 2Z2WA 3Q4TA 3FC2A 2W96B 3E7OA 4IZ7A 3VBYA 1REJA 3ZLYA 2QOHA 3LFDA 2GQRA 4CYJA 4PMTA 5DT3A 3R22A 4G2FA 4UMRA 5DIAA 4O2PA 4UYAA 2OF2A 3PUPA 4FTCA 4A9UA 4EL9A 1GZ8A 3AC4A 3BE9A 5KCVA 4GFOA 3ZSIA 1Y6BA 4QMPA 2W9ZB 4YZNA 5CEKA 3A7GA 3CJFA 4BCPA 3R73A 3H10A 5I9XA 1YWNA 3LKMA 2XKCA 4GL9A 4I6QA 3T9TA 2IZTA 2RGPA 3Q60A 2ZB0A 3DDPA 2UZLA 4QP9A 2WMSA 3P7CA 3NGAA 2ITZA 4PTCA 5DNRA 4AWIA 3G90X 3OMVA 4BB4A 3RM7A 2C0OA 3CLYA 4NIFB 2JDOA 4YSMA 5CEIA 5CU4A 4YURA 5HX6A 1AGWA 3IW8A 3R7GA 5HD7A 2JITA 4FG7A 1H1RA 3I6WA 3DBCA 4EWQA 5B2LA 4PMPA 3MFTA 1I44A 2C0TA 3AMAA 3BPRA 4QP7A 3T3VA 3HV4A 1SM2A 3HMIA 4JRVA 2GMXA 3C4WA 1RE8A 3LXPA 4L3LA 4TYJA 3R9NA 1QPEA 4I92A 4BBFA 1JSVA 5CT7A 2BCJA 5IEYA 1YWVA 4V04A 5IA2A 3MESA 3VW6A 3GQIA 4YZMA 3SVVA 5E9EA 3A8WA 2UVXA 5HKMA 3Q2MA 2XCKA 2W9FB 5EW9A 5IQHA 4DFZE 3Q5ZA 2HENA 3SQQA 4Z55A 4XUFA 4EK4A 4WNOA 4GFGA 4PWNA 5FM2A 5CF4A 3V8TA 5IQFA 4KUJA 3CBLA 5CQWA 4NM5A 2YDIA 2VWWA 2VU3A 4ANMA 3KXMA 1JBPE 2G9XA 2VTIA 3F5PA 4W8EA 4FEQA 2FGIA 3BQRA 4NW5A 3LCDA 1URCA 4G31A 4EOIA 5E1EA 4V01A 4C4FA 1UU3A 5J9LA 3H9RA 2GU8A 4ENYA 4CCUA 4G9CA 2YM4A 2UVYA 4XP0A 3E64A 4FTMA 2UW7A 3RMFA 4D1SA 4E5WA 3V8WA 3SKCA 1G3NA 3HAMA 4B99A 2ZB1A 4FTIA 2J2IB 4ZLYA 4R7BA 5HLPA 3E8EA 4RJ6A 1BKXA 4JDHA 3EQPA 3CXWA 3LJ2A 4FT7A 4JQEA 3ZRLA 2UV2A 3IECA 4C4IA 4TWNA 3FI8A 3H0YA 3D7TA 3HV6A 2RFEA 3L9LA 3KK8A 3ERKA 4OTHA 4XG2A 1A9UA 1SVEA 2BAJA 5GJGA 4ZY6A 3CEKA 4M3QA 2CNUA 5M09A 5DR2A 4MCVA 4KKHA 2XM8A 4GVAA 3LQ3A 4GKIA 1LPUA 3PJ2A 5BVOA 3BYVA 1H26A 3L8SA 1UWJA 2GTNA 2PUUA 1NA7A 3LCOA 3R1NA 4FK3A 4BKJA 4NIFA 2PUPA 4JT3A 5E92A 3D9VA 4QP1A 4M69A 2BRMA 4J7BA 2WB8A 4FZAB 1ND4A 1LUFA 4QMZA 2C68A 3G33A 1WBTA 4BWXA 4L43A 3RPOA 4DYMA 5HQ0A 1Q62A 2XYNA 3C5UA 5LWNA 3VS6A 4BCIA 3GC9A 1PKGA 5DI1A 5HBEA 3GI3A 4L7SA 1PJKA 3DQWA 4LYNA 4U7ZA 4K2RA 2GNLA 3EQFA 4BGGA 4I4FA 4IZAA 3FL4A 4DCAA 5E8WA 3A61A 3UODA 4FKVA 3ROYA 4O7SA 3UG2A 3COIA 4YTCA 1PMEA 2WFYA 2X8IA 4RX7A 3KCKA 2VX0A 4LRMA 2WTKC 2UVZA 3ETAA 4NM3A 4FKTA 4HCTA 3THBA 3R8VA 1FOTA 3AGMA 4OTRA 3LIJA 3NW7A 4D0WA 2X7OA 2CLXA 2G15A 4RLLA 1M2QA 5G6VA 3JR1A 3UOJA 2VWUA 4GH2A 5GJFA 4RT7A 4HPUE 3V8SA 4DGOA 1DI9A 4QYFA 4BYJA 4CTBA 4EZ7A 5BVDA 3TEIA 2EXCX 3MY0A 2EXMA 4HVGA 3AC1A 4MF0A 1F0QA 1U5RA 2UZBA 3GFWA 3EOCA 3L8PA 3DZOA 1WMKA 4P90A 3PSCA 3C4XA 4BDKA 5E4HA 4ZEGA 4FSNA 4U8ZA 5TE0A 3DNDA 5A3XA 1FMOE 3W2SA 5L6WL 4BCGA 5HGIA 4EK5A 2QHNA 3PRFA 3UIMA 2P55A 3ZFYA 4ZZOA 5EQYA 1NVSA 2WKMA 5L2TA 4ZMEA 4FKSA 1PXJA 5FTQA 4WRGA 3ZTXA 2IVUA 1MQ4A 2OJJA 3V5QA 4DH1A 3RHKA 3FXZA 3KQ7A 4YU2A 4RZWA 5D10A 2ONLA 5CAOA 1M2PA 3PRIA 4FNZA 1STCE 1UU7A 2UZVA 5EQPA 5IQEA 2OLCA 5GZ8A 3D5WA 3QFVA 4AGDA 3CJGA 1YOJA 3PVWA 3TZ9A 4FUYA 3QQGA 1JWHA 2CGUA 3AD5A 5KMNA 4C3PA 2JIIA 3KEXA 3LCTA 2IG7A 5J5SA 3E92A 4IANA 1OKVA 5HTIA 2IZSA 4BDDA 2QLQA 4A06A 4M14A 4X2JA 5AA9A 1Z9XA 1TQIA 2YCQA 4RG0A 5BVNA 2E9PA 3ENMA 5LMAA 1O6YA 2R0UA 3NNXA 5LMKA 4KBKA 4MF1A 4FIGA 4LMNA 2FVDA 4B4LA 4BYIA 3QL8A 5CU6A 3T8OA 3WILA 2R3KA 2VX1A 3NVMB 4IM3A 3HDMA 2CSNA 3AD4A 4HYUA 3RM6A 1FMKA 3BU6A 1OKWA 3LLTA 3FWQA 3R02A 4KBCA 4DGLC 5C27A 1KV1A 1R0PA 2OZOA 1QMZA 3W8QA 4BKYA 3OUKA 3SXSA 3ZUTA 4YJOA 5EYKA 2C6IA 4E4XA 2F7ZE 2ZDUA 4QMXA 4HYIA 2ERKA 2YIWA 4YC8A 3VUTA 1OPKA 3BGPA 3V5WA 2YITA 4L52A 1FVTA 2Y7JA 3PG1A 4DAWA 4TY1A 4O2ZA 2R3GA 2EU9A 2X7FA 4AOJA 4E4MA 3O7LB 3BWJA 5AP2A 3DDQA 2GCDA 4QD6A 4TNBA 4UXLA 4AG8A 5DN3A 4D2PA 4DEIA 3W2OA 1MRYA 3TI1A 2E9UA 3POZA 4QYHA 4W4VA 3COMA 3GENA 4ZTNA 1YXUA 3RJCA 3UPXA 3DK7A 5LARA 4WG4A 4EH3A 3BBTB 3KXZA 4G6LA 4AN2A 3ORTA 3NUSA 3BYUA 4FV2A 5AV1A 3QQHA 3FEGA 4YBJA 5AUZA 4AW2A 4EH9A 4PP7A 3ORNA 3Q9WA 4W4WA 3W8LA 3OD6X 3TIZA 4JXFA 2FSTX 2YLEA 3FY0A 3KMMA 4YO6A 3QRUA 2C6OA 3FLYA 3V3VA 4LV5A 5HE3A 3TM0A 1XBAA 3OHTA 3EN7A 3FMKA 4XJ0A 2BROA 5D12A 1IASA 4QP3A 1ZYDA 1OIYA 3TNIA 4Z7GA 2QQ7A 3MVHA 5CNOA 5CZHA 1XH8A 5ANDA 3F2AA 5T68A 3UQFA 3OWKA 1XBBA 3FUPA 4XLIA 5LJJA 2DYLA 5H8GA 1XWSA 4U6RA 4XG9A 4I5CA 4BVUA 4NUSA 4FV5A 3ULIA 3EN5A 1JLUE 3EFLA 4U45A 3SAYA 2J51A 3Q96A 3VJOA 2R7BA 4XG7A 2XJ2A 3ZDUA 2VTNA 5FG8A 2GNIA 4WT6A 3VNTA 2WTCA 4OBPA 1K2PA 1Q41A 3MGYA 4GT3A 5I0BA 1UNLA 4QQJA 3W10A 5AP5A 3BYOA 3WF5A 4ZTMA 2HYYA 2ITOA 3MV5A 1EH4A 4FVQA 2XP2A 4FYNA 1YKRA 3F3VA 4X2NA 5K0KA 4TYHB 3LW0A 2PVKA 3OY3A 4UYNA 5IISA 1NW1A 2CJMA 4J95A 1JKTA 2J6MA 3IGGA 4OTGA 4O83A 3KRRA 3OT3A 3W2QA 3M2WA 2BZKB 3EQCA 2W1ZA 4GCJA 4QNYA 3A2CA 4FVPA 4FTRA 5IKWA 1U46A 3SOAA 3KY2A 4MBJA 4R1VA 5HEZA 3ALNA 1GOLA 1URWA 3CD3A 4C34A 4FA2A 1YXSA 2YEXA 5B2KA 5HX8A 5FM3A 4OLIA 4O0RA 3PWYA 3P9JA 5AWMA 3IDPA 3H30A 3G6GA 1BYGA 5D11A 3ZC5A 4OTWA 3FZSA 2X8EA 3KULB 3MPAA 3TL8A 4O7TA 4U3YA 4CMTA 4F4PA 4II5A 3FYKX 4LM5A 4Q5HA 3TKUA 4EQUA 1OUYA 3ODYX 4C58A 5HD4A 5HBJA 1ZARA 3MA6A 4AZFA 5BVWA 4C4GA 4Z16A 1BL6A 3LCSA 4FSTA 3LPBA 2BUJA 5EM5A 1OL5A 2B9HA 1J1BA 2YAAA 3HA6A 4EI4A 2PHKA 1VYWA 3BGQA 2X2KA 1OL2A 4ITJA 2PZ5A 5FXQA 5C26A 4ANQA 3RGFA 3QTRA 4S33A 4QPAA 4BCKA 3HRFA 1TKIA 5IU2A 5CASA 3C0GA 5CY3A 5JGAA 4L3PA 3HV7A 3HP2A 4CMUA 1M7NA 3VN9A 3MJ1A 4ZTQA 2Q83A 3G0FA 5B0XA 5CEPA 4DE4A 4AUAA 1ZY5A 3RAHA 2JDSA 3QRTA 4XG6A 1YQJA 2HWOA 4FKRA 2B9IA 3AD6A 4IAIA 4YZDA 4YGAA 2F2UA 3ZZEA 5LCKA 1PXKA 4Y83A 4BZOA 2ERZE 4J1RA 5HCYA 4EOPA 4BL1A 1PF8A 4Y5HA 4ZTSA 4H36A 3UIBA 5M57A 2WXVA 2OXXA 3ULZA 4NWMA 4ZZMA 3LCKA 4FK6A 4X2KA 4I6BA 2XNNA 3QUPA 3JVSA 1O6KA 5DEYA 4A4XA 2CCIA 3JVRA 2OH4A 2B9JA 4L00A 2XA4A 2BRGA 3VBWA 1Q97A 3EMGA 3O8PA 2WNTA 4RWKA 4U41A 4AS0A 5EKNA 3ORKA 3FBVA 3WIKA 4BICA 5KMKA 3F3ZA 3QTWA 4GIIA 4XLVA 5A9UA 4R1YA 2ONLC 3DTWA 4MXOA 3UQCA 4ZTHA 2UW0A 2UZOA 3F5GA 3PJ8A 2PE2A 5IQBA 3M11A 2WU6A 4ANLA 1FPUA 2B54A 2PE1A 3GU6A 4M0ZA 2ZAZA 2PZYA 5IUHA 4FSRA 3ZU7A 4C4EA 3MYGA 4XP2A 2XBJA 1A48A 4HYHA 3R7IA 2C69A 3KULA 3QCXA 5FBOA 5AR8A 3W33A 3R7VA 1VJYA 4USFA 3ZO1A 4AA5A 4QNAA 5F94A 2I0VA 3F6XA 1K3AA 3MBLA 4RVKA 4XBRA 5FD2A 3W2CA 3DB6A 3QUDA 4E93A 1OPJA 2R3IA 4XG3A 2QKRA 2ZMCA 2RKUA 5BVKA 2JBPA 5FTOA 3JY9A 4BCNA 2YN8A 4ACHA 2YIXA 3QQFA 4B0GA 1H08A 4E6CA 3I7CA 2W1IA 3PPJA 4MKCA 3KVWA 3Q4UA 2XKDA 1H0WA 2REIA 1R0EA 3OCSA 2C5OA 1B38A 4M66A 4FX3A 4C36A 1F3MC 1PXMA 3SLSA 2RF9A 2QONA 2ZV9A 5IH6A 5FLFA 3OG7A 4KS7A 3QTXA 3QWKA 4DLJA 4QOXA 3GCVA 4AF3A 2QOBA 4XBUA 4BDFA 4FSWA 4YJUA 3DXPA 5GNKA 5EI6A 2C5XA 1H1PA 4BBEA 3PXRA 5HIDA 3DBQA 2IW8A 4NJDA 4W9XA 3UBDA 4DG3E 3PJ1A 3JXWA 5KX8A 2GNGA 5HE0A 3R0TA 5JGBA 3IO7A 2OWBA 4TRLA 4AE6A 3P0MA 4DTAA 1LEZA 4O6EA 4AN9A 3OXTA 4AOIA 3EH9A 4KNBA 5HE1A 3RZBA 2I40A 5ETIA 4WRSA 3DK6A 4EKKA 2YZAA 2QO2A 5CEOA 3OWLA 3ZZWA 5HCXA 4AAAA 4BDBA 3GU7A 2XNOA 5FTGA 3OF0A 3UOLA 4IAYA 1UWHA 3PJ3A 3UZRA 4HOKA 1UNHA 2QR7A 2CGWA 3QD0A 3D83A 5IQIA 2HCKA 4IB1A 3Q9XA 3PFQA 3Q53A 3IOPA 4GV1A 3F5XA 4BTKA 3F3TA 3BKBA 5HNIX 4BHZA 4FV7A 4IFCA 3GOKA 4LRKA 3C13A 4EEVA 2CNQA 1WVYA 5EH0A 4ZSLA 4DEEA 4GJ2A 4JI9A 3VO3A 2RFDA 3QRIA 2VTJA 3KREA 4ANNA 3UE4A 3ATSA 2GS2A 2R3OA 4MBLA 5CU2A 4JQ8A 2IN6A 4EKLA 4GU9A 4Y46A 3LFEA 2UZTA 1ATPE 3ATTA 2X6EA 4WNMA 2Q0BA 2ZV7A 2R3QA 3EFJA 3UOKA 4UWCA 3R8LA 4AFJA 4CFXA 3F2RA 2VO6A 5DPVA 4YC3A 3TNQB 4I0SA 5EYCA 2UW5A 2C47A 3MB6A 4UXQA 4IB0A 2WMWA 2C6KA 3EKKA 3VJNA 4CZUA 2QHMA 2QCSA 3HRCA 3HL7A 4BR3A 2DQ7X 5L2SA 2F9GA 3QKMA 5FXSA 3ELJA 3CE3A 5ANJA 4DCEA 3NUNA 4CFUA 3MY5A 5FUTA 2OFVA 2E9VA 4O6LA 4HGSA 4CFVA 3ZFMA 3RK7A 2R64A 2IW6A 5HORA 3BYSA 3MWUA 4JBVA 3GXLA 5CAPA 1Y57A 4IWQA 1J1CA 2WMQA 4EJ7A 1H0VA 3IPHA 4TNDA 4G3FA 4HCUA 3EQRA 5AUYA 3R7EA 4I5PA 2HAKA 2W4KA 2YM3A 3ORZA 4FV3A 4DFLA 3RCDA 4FF8A 5IZFA 3RAIA 5LVMA 3CTQA 4FTOA 5M4IA 2X9EA 3BEAA 4C3RA 3WF9A 2VTRA 2OF4A 2W4OA 3NW5A 3HKOA 2PVHA 3FL5A 3ACKA 4DH8A 3DJ7A 3PY1A 4R5SA 4AZVA 5M07A 2YM7A 2G01A 4FNWA 3RAWA 2GNFA 4EUUA 3DKCA 3SOCA 5I9YA 2ITUA 4D5HA 2WELA 4ASZA 5BVEA 4E1ZA 4EZ3A 2YZLA 4FGRA 3OROA 3ZCLA 4XV2A 4R3PA 2HWPA 4GJ3A 2F4JA 2RIOA 4O22A 4GYIA 3TN8A 5KO1A 4AU8A 5BUEA 4G34A 3UVRA 1WBSA 4NKSA 4MHAA 2BDWA 2O65A 4JBQA 5A4CA 4BI1A 4FBXA 2R3PA 4M84A 4ORKA 2G2FA 4UZHA 4MWHA 4HZSA 4MH7A 5EKOA 4EJNA 4I93A 4GS6A 4EC8A 5CALA 5BMMA 2B9FA 5IA0A 3IKAA 4PL3A 1T45A 3GOPA 3GUBA 4RSSA 4I41A 5IA4A 3HGKA 2FA2A 3DZQA 4DGGA 4I1ZA 3MFSA 3R9OA 4KKGA 4M68A 4WNKA 4AP7A 3E8DA 3VS3A 4XEYA 5T3QA 4TW9A 3SXFA 5CSXA 4XV1A 3NYOA 1VR2A 3W55A 4CZYB 1B39A 3HZTA 3VS5A 5KBRA 4D2VA 3MN3A 2VZ6A 1HCKA 3QGYA 3HRBA 3EFWA 5HVYA 5L6PA 2ITYA 3NUUA 3HMMA 1DI8A 2Z60A 3HP5A 4QMUA 1LR4A 3LMHA 4WG5A 4FEWA 4ZXTA 2WPAA 1R3CA 5EM6A 4O82A 2OJGA 2YABA 4QMVA 1V0BA 2YACA 4BCJA 3ZSHA 5DRBA 2XUUA 3MY1A 4BC6A 5F9EA 1W83A 2W0JA 3FMJA 4IX5A 3EN6A 3T9IA 4YLKA 4FIIA 3MFUA 3MVJA 4BDHA 1Q8UA 4L6QA 3Q2JA 2V55A 3HMNA 4RWJA 3KF4A 2WTJA 3IONA 5CI6A 2HW6A 5EDPA 3PVGA 1YHSA 2YIRA 2O63A 1OGUA 1ZMWA 3GC7A 2G1TA 4ZJJA 5BQ0A 4C59A 3EB0A 5L2QA 4RC4A 4YZCA 1MP8A 3ZUVA 4QMMA 4NYEA 1H4LA 5TOZA 4I6HA 5H8BA 4L42A 2R9SA 2W1HA 4BFMA 4D55A 5FXRA 4QPSA 3QZFA 1H1SA 2OKRA 3Q9ZA 3UVPA 4E4LA 4N4SA 4EK3A 1G8SA 3D7TB 3LJ1A 3OXIA 4PDOA 4AZEA 4D4VA 3GBZA 4JIAA 3TV7A 5J95A 2A1AB 1J7IA 4ZJIA 2P3GX 5JMSA 3SD0A 3ZS5A 1P4FA 2RG5A 4RX5A 2Z7SA 3M1SA 3S1HA 4OBOA 1U4DA 4NJ3A 2PY3A 3G2FA 3HV3A 3AC3A 4V0GA 4YJNA 4RVTA 4ASXA 3F3UA 4GK3A 4BTJA 5FP6A 3H4JA 3UO4A 4KKEA 5BVFA 3M42A 1UA2A 3KXXA 3NCZA 1IA8A 3VHEA 2YWVA 4MD7E 1U59A 2ZOQA 4IWPA 3PIYA 3IDCA 4D2RA 3CPCA 4M69B 3A60A 4EHZA 4D4SA 1ZLTA 4Z9LA 5EDQA 4B8MA 5CS6A 3D0EA 3W32A 4YTHA 4F9BA 3FLZA 3D14A 3V04A 4F99A 3I4BA 2FUMA 4BRXA 5GZAA 1GIJA 1RDQE 5GHVA 3R8UA 4DEAA 2OI4X 3O23A 3R1YA 4LMUA 4BIBA 2V7AA 3OTUA 3OWJA 4RJ3A 3UP2A 3VS2A 3NUPA 3OFMA 5F1ZA 2YA9A 1XHAA 5CU0A 3BU3A 3QWJA 5CLPA 5CVGA 5CSPA 4EYMA 3CGFA 3AOXA 4JIKA 4F9YA 2X81A 1PYEA 3VAPA 5LCJA 2X8DA
chains in the Genus database with same CATH superfamily
4D2TA 3WF7A 4USEA 5K9IA 3FKNA 1O6LA 5EFQA 2Y0AA 3ZXZA 3PLAE 4CT2A 2C5VA 1YHVA 2JKOA 2UUEA 3KMWA 4IFGA 4KIKA 4EORA 4OTDA 2GDOA 4O86A 5FWKK 3EQBA 1NXKA 3H9FA 3D5VA 5AV4A 3RNIA 5A46A 4AQKA 5TT7A 3VUKA 3PFYA 4PX6A 3D4QA 3HDNA 3A7IA 3QF9A 5HOAA 2Z7RA 3QBNA 5DT4A 3BWFA 5K3YA 5IMXA 3D2IA 3FZOA 2R0IA 2QOIA 4FKUA 4UMTA 2XK3A 2ZVAA 3R71A 5IQCA 2XMYA 3QQJA 2ZMDA 2WQMA 3O50A 4FICA 4C4JA 4LGHA 5ANKA 3WYXA 4DFNA 5KHXA 4RIOA 5CENA 4HVHA 4FIFA 1JKLA 2OJFE 1ST4A 3TMOA 2JIUA 1WBPA 5KNJA 3QRJA 3Q32A 4U43A 4G5PA 4YNOA 4DEBA 1TVOA 3FHIA 5D1JA 4XCUA 4XG4A 4BDGA 3UTOA 3U9CA 4F7JA 2YAKA 1Q8YA 2ACXA 3D94A 1RQQA 3VUHA 4BDIA 4BY9E 2PVMA 4KAOA 3FQSA 4G3DA 4BBMA 3NX8A 4D5KA 3AT4A 3PVBA 2J9MA 4Q5EA 1KUTA 3DAKA 3LAUA 3C0IA 5EYDA 4YJVA 5C1QB 4DHZA 4FV9A 4YJSA 3UOHA 2BZHB 2WOUA 5AR5A 4YP8A 5AP1A 3BLQA 2Y6OA 3NUXA 4QMSA 3UVQA 4MYGA 4ANBA 2JDTA 2PWLA 2OJIA 2I7QA 4EH5A 4LG4A 4XRJA 4C61A 4CV9A 2QLUA 2HY0A 3FMNA 4RX9A 4PMSA 5KE0A 3QXPA 4PPAA 4K33A 5AEPA 4FR4A 4F09A 3VUMA 3DB8A 3TWJA 1QCFA 1OB3A 2C3IB 4D4RA 5HTBA 4TWCA 3DCVA 3Q9YA 3P5KA 4O1PA 5TR6A 3RTPA 4MAOA 3NYVA 4GG5A 2SRCA 4AW5A 4F0FA 3DXQA 4LUDA 3FLSA 3BCEA 2QD9A 4FODA 3IW7A 5AX3A 2XNMA 2R3NA 3R21A 4F0GA 4JBOA 2NRYA 3LXNA 3QD3A 4MQ1A 5IH4A 5I9VA 3LFAA 4LL5A 4TYIA 3R7YA 4O7RA 2WTIA 4O7YA 4I6FA 4X6QC 2NO3A 4O21A 5K5XA 2C3JA 2P2IA 2WMTA 1KE6A 1H01A 3FPQA 2UZNA 4BKZA 2J5FA 4GU6A 4CLIA 4F64A 3CQUA 5L8JA 3VUIA 3A62A 2I0EA 1M14A 3AMYA 2XVDA 3KKVA 4JQ7A 3HX4A 5CSHA 4L7FA 5BYYA 2W5BA 5J7BA 1ERKA 4DC2A 5M51A 4Y85A 5AA8A 3SG9A 3KA0A 2OO8X 5EHOA 2X6DA 4MXZA 5J87A 3D5UA 5CT0A 2GNJA 2B0QA 3OW4A 4GMYA 4FSMA 3ID6C 3K3JA 3ZO2A 3ZH8A 4I5HA 4OBQA 3W18A 1KE9A 4C62A 3BHHA 3PWDA 4DG0E 5J8IA 1UNGA 3FZPA 2WIPA 4GK2A 4OAVB 3W0QA 1WAKA 4H58A 4PNIA 4QP6A 2CDZA 5CI7A 2PVRA 2BIKB 3ANRA 3QX2A 5HZNA 3KXNA 3PIXA 5IUGA 4A4OA 4JMQA 3PSBA 4FL3A 1OKZA 4YSJA 1CMKE 2ITVA 3P86A 2YIYA 4RMZA 4QP8A 5KHWA 3V5PA 2BRHA 1F5QA 2VGPA 3W0NA 4EHGA 3D7ZA 4D2WA 4JBPA 3OZ6A 4DFUA 2HZIA 3S95A 4AW0A 4KSPA 4W4XA 4LV8A 4CYIA 4FTTA 4HNFA 4NL0A 4D58A 1RW8A 3R2YA 4B8LA 3TUBA 4RWLA 2CKQA 3HLLA 5LMBA 3PA3A 3ORLA 4IACA 3IW4A 3QAME 3E3BX 3GNIB 2YISA 4KSQA 1BLXA 5AFVA 3UC3A 2XM9A 3OUNB 4UV0A 2QC6A 3PPZA 5DR9A 2C6MA 3DT1A 2XANA 1Z57A 4NTTA 2PPQA 4E4NA 3PY3A 4P5ZA 3CIKA 4GIHA 5JN2A 2GSFA 4ZS4A 3PY0A 2BTRA 2V62A 3OWPA 4OUCA 4X2FA 2QOOA 5AR2A 3MTLA 3FJQE 4EOMA 2OXDA 4BDEA 5J79A 3MH1A 4M13A 5DYJA 1PKDA 2H96A 3OBGA 4JLCA 3SV0A 5HU9A 3QU0A 2YJRA 2XNEA 2OW3A 1E1VA 3AMBA 3JYAA 4FVRA 4BZNA 2W06A 3K2LA 3QYZA 3TZ8A 4E5BA 2F57A 2X1NA 2WMAA 3ZEPA 5CNNA 3FY2A 5JFWA 3CS9A 3C4FA 4F7SA 1MRUA 1T46A 2AUHA 4OT5A 4ZAUA 3OP5A 3DNEA 3OEFX 5A54A 3WZUA 2Z8CA 3BLHA 4ARKA 4GG7A 3UZPA 1BX6A 5KZIA 3W2RA 2XS0A 5AR3A 5ETFA 4WHZA 1G8AA 3JY0A 4FIEA 2BAKA 4YTFA 4CT1A 4DF3A 2PK9A 3COHA 4CD0A 4ZP5A 4W8DA 3S2PA 2JBOA 3EHAA 4GRBA 5M4CA 2C3KA 4G9RA 1Y6AA 3FKOA 2BIYA 3TNPC 5TO8A 3TNWA 4RJ4A 4ZK5A 5KKRC 2QG7A 4WG3A 5ACKA 2UW8A 4V05A 2PZIA 3QA8A 2B52A 3SXRA 2A4LA 4IW0A 1XO2B 1ZRZA 4KRDA 5HU3A 4ACMA 5KZ0A 4CRSA 4ONAA 3IS5A 4GSBA 2EWAA 1XH7A 2JGZA 2FH9A 1KV2A 4R3RA 3SW7A 3N4UA 4PPBA 3W2PA 4U44A 5D7VA 2A27A 1JSTA 3A7FA 3HUBA 4YZ9A 4BWKA 5ETAA 3BHVA 3QCQA 3VS4A 3FMMA 3DXNA 4QYEA 3O0GA 4CRLA 3JUHA 4B7TA 5HI2A 3CGOA 3FXXA 2W99B 4MXAA 3UYSA 3QALE 4PRJA 4XNEA 5ANOA 3A7HA 3ZDIA 4E6DA 3EQGA 3DJ6A 1AD5A 4J98A 4QMQA 1YI4A 2PMNX 5EM8A 2IEWA 3PA4A 2WAJA 4M8TA 4OTPA 3GCUA 2FSMX 4O4BB 4F6SA 3ZM9A 4XOYA 4FTJA 1Q99A 2WEVA 3ZONA 2XNBA 3HA8A 2Z02A 1YI3A 2WMRA 4ERKA 3I5ZA 4BN1A 3DJ5A 3QQLA 3B8QA 3KC3A 5G1XA 4LI5A 2BMCA 3KGAA 3A4OX 3DPKA 5K4IA 4R5YA 3KRXA 3U9NA 2X0GA 3VULA 4ZY5A 4JG7A 5IG1A 5KUPA 4DFYA 3FSKA 4MD8E 5HBHA 4FKIA 1YOMA 5JT2A 3CQWA 2JKQA 4F9CA 3V6RA 4EOOA 5FQDC 5TKDA 4TTHB 4YLJA 2VUWA 5FDXA 2QOQA 4G17A 4FL2A 3UIUA 4GUBA 1DAWA 2YDKA 3QX4A 4RFZA 4YJRA 5AM7A 1S9JA 3MIAA 4QPMA 5J1VA 4R6VA 1SVHA 2W17A 1H28A 3R1QA 1W7HA 3TUDA 4L46A 2EXEA 4FZDB 4ERWA 1PXOA 3CKXA 4AX8A 2P4IA 4KRCA 1YRPA 1GIIA 2QI8A 3PP1A 3RPRA 2V5QA 2WMVA 2VWBA 2WO6A 4FRFA 4PDPA 4XRLA 5C4KA 4EBVA 4CQEA 3KRWA 3N4TA 3RNYA 4GT5A 4JDKA 2J0MB 4N0SA 4E26A 3R8PA 3QQUA 1VLRA 1I09A 3FXWA 4F1TA 4QQ5A 4FKGA 4IJ9A 4O0SA 5DVRA 4ZOGA 3I5NA 4UBAA 3B2WA 2VTQA 4RIXB 3GP0A 3DKFA 3K3IA 2P2HA 4CG9A 2P0CA 3VS1A 2CHLA 3R63A 4L3JA 2ITNA 2UZWE 2ZM1A 5DR6A 2VO7A 1XBCA 4F63A 4DGMA 4CKIA 2ITPA 3DA6A 3UC4A 4OAUC 1ZY4A 4ALUA 3H0ZA 1OKYA 4WNPA 3VWAA 3UDZA 1V0PA 2CCHA 3RWPA 3PPKA 5AP7A 2WZJA 5J1WA 3L9NA 2QOLA 2X2LA 4U80A 1Q8TA 3OTVA 2C4GA 4M15A 4CFFA 3LE6A 5H9BA 3FPMA 4O0YA 4K77A 4WUAA 4D28A 2VX3A 2VTSA 4F6UA 2WQEA 2EB3A 3EYHA 4BF2A 2C5YA 4D0XA 1UKHA 5C8KA 3N4VA 3WZJA 4M0YA 2PE0A 3HMOA 2XRUA 2XIZA 4W4YA 3CR0A 4PDYA 2VWZA 4I21A 2IO6A 1QPDA 2W4JA 3LMIA 3VC4A 4AXEA 1SZMA 3KXGA 4K6ZA 4ZLOA 4UMUA 5LOHA 1H00A 4NKAA 4MBIA 4HW7A 1L3RE 5I4NA 5LMKC 2OSCA 2HELA 1Q8WA 4ZS0A 4X3FB 5J7HA 3PIZA 2QOFA 3BGZA 5EYMA 3U54A 1Y8GA 4G16A 1FVRA 3G9NA 2O8YA 3REPA 3PUFC 2XK4A 3FYJX 1Q5KA 1VZOA 3FMDA 4QMLA 5GJDA 2ZYBA 4AXCA 5AP3A 4RA5A 4L53A 3SC1A 1RJBA 3I6UA 1GIHA 2GQSA 4AQCA 1E9HA 5IF1A 2CGVA 4FUXA 1PMUA 3OY1A 2B53A 2HXQA 4HGLA 3VBXA 2QO7A 2OH0E 4DG2E 1HCLA 4A7CA 3DGKA 3TJDA 2XK6A 5A14A 4NM0A 2O2UA 1UU8A 3ZBFA 2IVSA 2QURA 2NNWB 3U51A 4IVBA 5BYZA 5I5ZA 4CG8A 4ANSA 2JIVA 3TV4A 3O8TA 4QTDA 1Q4LA 4FZ7A 2JKKA 2AC3A 1S9IA 3TJCA 3RKBA 4ENXA 3BL7A 1R39A 3DBEA 4RIXA 2YHVA 4BCMA 5JQ8A 5C4LA 2Y4PA 1PXIA 4EOLA 2GNHA 2OIDA 1YDSE 4J8MA 4RA4A 5L2WA 3GC0A 3K54A 4RIWB 4G6OA 4IB5A 4P2KA 4JX7A 3EL8A 5AUVA 4AZSA 3U4WA 4I22A 4MXXA 3D15A 3L9PA 2PZPA 5K0XA 1CSNA 4RFMA 5GZ9A 5JRSA 1Q24A 3I60A 3MTFA 3GVUA 3BV2A 4OT6A 2LAVA 4FV8A 1XH6A 4XOZA 3I7BA 3C4CA 3QC9A 5AAGA 3P5JC 2VWIA 4J96A 3QC4A 3D2KA 2W05A 2HZNA 3UMXA 4H3PA 4EH7A 5LQFA 3WF8A 4CV8A 4KINA 1HOWA 3CD8A 5DBXA 3Q04A 4FYOA 2QODA 3W0MA 3KVXA 3PXYA 2EVAA 3DBDA 3FMLA 4O0UA 2PZRA 4RX8A 3R8ZA 5HESA 5A4QA 3TDVA 4QP2A 5JH6A 5IEXA 3ZRMA 4DTKA 5KMLA 4OW8A 4FT0A 4JR3A 1B6CB 3DOGA 2WMXA 2BKZA 1OL1A 2ZV8A 1XQZA 4TYEA 4PTEA 3PG3A 4WIHA 4X3FA 3FDNA 4EH4A 3EWHA 4NK9A 4JAJA 2C30A 3LM5A 4O0TA 4ALVA 3GB2A 3C9WA 3SX9A 1YHWA 2BHEA 3F5UA 2KULA 4A9TA 5AV0A 5M08A 2XJ0A 3V51A 4J53A 4KIQA 2F7XE 5HICA 3KK9A 5J9YA 1OGYA 1JOWB 5HNGA 3PTGA 1O9UA 4QMWA 5HG5A 2WGJA 2IVVA 4RVLA 4EK8A 2JAVA 3Q4ZA 2VNYA 3DFAA 3HNGA 2GFCA 1H24A 3BRBA 2CKOA 3U55A 1PMVA 3BQCA 3NPCA 5DOSA 4FV1A 3FLWA 5AUWA 1GAGA 4E6QA 4FKJA 4WBBB 5CEMA 1PY5A 3QZGA 2BDFA 4YUQA 1PYXA 3QCYA 1FBNA 4O27B 2ETKA 5I9UA 4ASEA 3L8XA 3KXHA 1BI8A 4C4HA 1IAJA 3ORPA 3PYYA 5AP0A 5JK3A 2QU5A 4IC7A 4U40A 3UDSA 2GS6A 4C8BA 3R6XA 2J0KA 2YM5A 1OZ1A 2OU7A 3A7JA 2J0IA 3NLBA 2BZJA 3QHRA 4YMJA 2VD5A 3ZUUA 2QU6A 4QMTA 4APCA 1FVVA 2VRXA 2QOCA 4L45A 4RIWA 4DITA 4WBOA 4O84A 1MUOA 2J50A 4XV3A 5HIBA 3MW1A 2XH5A 4O0WA 4F1OA 1UU9A 4FV6A 4F08A 3QTSA 4QTBA 4O0VA 4Y5QA 4ZSJA 4H39A 5HG9A 4EOQA 5JRQA 5E90A 4HVIA 5CF8A 5KBQA 3VW8A 5ANGA 5DE2A 4O91A 5JFVA 4TYGA 5T6KA 3GQLA 3HV5A 3NRMA 1J7LA 1SNUA 4IIRA 1JQHA 4XG8A 4C35A 4IX4A 5HVJA 3RAKA 3BHTA 5C9CA 5HLWA 2JDVA 1ZZLA 4GW8A 4JOAA 4X3JA 4AOTA 4PTGA 5E8VA 3ORMA 1W8CA 3VF8A 5KMIA 4DTBA 1PHKA 4NU1A 4PUZA 1P4OA 3LFFA 4V0GB 3MFRA 5AAFA 3LMGA 1JAMA 1JVPP 3HECA 4BJJB 1BL7A 3RINA 2JD5A 5EW8A 3ZBXA 3PDTA 3DU8A 1PW2A 3CCNA 1V0OA 1NVQA 5AR4A 2ITXA 5BUIA 2J0LA 3R04A 1Q3WA 1SVGA 5IMEA 4C2WA 3EFKA 3OEZA 2VWXA 3PXZA 3KF7A 3H3CA 2BILB 1ST0A 5M44A 3GU8A 2VTAA 2W1CA 4MWIA 2OFUA 3QGWA 3IK3A 1VEBA 4FSZA 1XH9A 3FQHA 1ZXEA 3FV8A 4R7HA 5KMMA 5E8ZA 3VUDA 4BWPA 3EQHA 3EZRA 4LQMA 4OTQA 2NP8A 4YLLA 5HCZA 3NIEA 2HXLA 3LXLA 5HG7A 3AQVA 2JFMA 3ZXTA 3W0SA 1AQ1A 4K11A 5CXHA 2WQOA 4FMQA 2LGCA 4FZ6A 3UG1A 3K5UA 3BEGA 3O71A 3I79A 2ZJWA 4RFYA 5DRDA 3IOKA 2BFYA 3NR9A 3E93A 4MK0A 4DH5A 5KKRB 1NVRA 3HUCA 4ZTLA 3BZ3A 3MIYA 3PJCA 4LOQA 5IDPA 1CKIA 4FNXA 3S00A 3TKIA 3H9OA 3Q6WA 2Y9QA 5EI2A 1PXLA 4P5QA 2BR1A 3MVMA 4WUNA 3F82A 4KIKB 2OIBA 2VAGA 2HZ0A 3R7UA 3S0OA 3BU5A 3NNVA 3VRZA 4D1XA 2VGOA 2PTKA 2Z7LA 4L01A 4ITIA 2WTDA 4ZZNA 4DHJA 4CGAA 2VTHA 3ORXA 3P08A 3BIZA 5CAQA 4WKQA 2J5EA 2WTWA 3ROCA 4Y95A 5CANA 4IE9A 3P7BA 3HYHA 3PA5A 4DBNA 4HGEA 3FMHA 3P78A 5BNJA 3NAXA 4RJ5A 5LVLA 4H1JA 5AR7A 4JRNA 4RGJA 3ET7A 2CKPA 5IQAA 1KOBA 4AA0A 3I0QA 3PE1A 1CM8A 4FKWA 3V01A 4O38A 4AGCA 2QKWB 4A9RA 1W2CA 4OGRA 2KTYA 4WA9A 2VWYA 4BI2A 3E88A 4XS2A 4X7QA 4YPSA 3BBWA 5ETCA 4C57A 4I6LA 3NAYA 4FKPA 4UZDA 2R3JA 5JEBA 3ACJA 5I3RA 2HIWA 2QO9A 5L3AA 3ZRKA 3QTIA 3TV6A 5CAUA 3P23A 4KWPA 4RZVA 2YFXA 4E20A 4EHEA 2RSVA 3RK9A 5CZIA 3ZSGA 4C37A 4UALA 5FP5A 1YXXA 3Q3BA 5F4NA 4R7IA 4LDTA 5A4EA 3CC6A 4R78A 3WARA 2XRWA 3IDBA 2YCSA 3FKLA 5AIKA 4JL9A 3NUAA 3C4ZA 3OCGA 4O96A 4MNEA 2NPQA 4H3BA 4G3CA 2PULA 4M97A 2GTMA 3VVHA 4RIYA 5JGDA 3QXOA 3C7QA 3EL7A 4L67A 2QOKA 4TL0A 2I6LA 4L44A 4USDA 4LRJA 1YW2A 3QD2B 2W1EA 3IW6A 5FEEA 4PNKA 2V7OA 3SDJA 3V5LA 2WIHA 1KSWA 3RPVA 5BYLA 4FC0A 4IEBA 5E1SA 1PXNA 3FHRA 4AXDA 2ITTA 1GZOA 3R28A 4G3GA 1NT2A 1UVRA 3RCJA 3PVUA 2VTPA 4K1BA 4YHTA 3I0OA 2Y4IC 4U0IA 3SHEA 1UV5A 4I5MA 2IF8A 3UDBA 1ZMUA 3AC8A 2PSQA 5AUUA 2R5TA 4JDJA 4F0IA 3SG8A 3IW5A 1YDRE 2HZ4A 3F2NA 4X3FC 5CU3A 3QTQA 4I3ZA 3TIYA 3MH3A 4NSTA 4F9AA 4EBWA 4AXAA 2W5HA 2R3MA 3NNUA 3P79A 3FC1X 4QRCA 5AV3A 2RFNA 5AV2A 4DT8A 5CF5A 2XEZA 4R8QA 3UMWA 1OPLA 4ZMFA 2R3HA 4RVMA 2W5AA 5DGZA 3E8CA 2RL5A 3NWWA 2VTMA 2UW4A 1P2AA 3DLZA 4I24A 4BCHA 5HO7A 4IX3A 2ETMA 4S31A 3NVKI 2YDJA 2WQNA 4NCTA 3U8WA 3V5JA 4EONA 3UYTA 3LZBA 2VO3A 4Q9SA 4FE2A 1Z5MA 3E8NA 4EH6A 2F49A 4X0MA 2X39A 4CSVA 2XJ1A 3I1AA 1DM2A 3VS7A 4ACCA 2V22A 4IAAA 4Z3VA 4LV7A 4R3CA 3VRYA 1R1WA 1GJOA 5GINE 4IJPA 5M56A 4DBXA 3MDYA 5BMSA 3CTHA 4KS8A 3PZHA 5DHJA 1YDTE 1TQPA 2BDJA 3AC5A 5DA3A 5ANEA 4CEGA 5LVPA 3KL8A 3ITZA 4IZ5A 1OUKA 3LJ0A 4HNIA 4AZTA 4CXAA 3R9RA 5HIEA 2GHLA 3TTIA 3G15A 4EOSA 2DUVA 2QR8A 3NMUF 1WZYA 4HYSA 2XYUA 2R2PA 1WFCA 2A0CX 5AP6A 4AFEA 3COKA 5I9WA 2C5NA 3S3IA 2Y6MA 2BRBA 4PP9A 4IVAA 3TTJA 2ITWA 4D4YA 4XX9A 1GY3A 3TNHA 4RQVA 3KB7A 2B55A 3HEGA 4E6AA 2CNVA 2EB2A 1OIUA 4FIJA 5ACBC 5FDPA 2H9VA 2I0YA 5GIPE 4BIDA 3V6SA 4QO9A 4QTAA 4L68A 5IA1A 3UJGA 4QQTA 4J52A 4UEUA 2PVYA 3ZLXA 2PMLX 4OTFA 1PMNA 3LXKA 5DWRA 5M4UA 4IAFA 3NFGB 1M17A 3DKOA 4CFMA 4DEHA 1FINA 2XIRA 4KD1A 4IVCA 3UNJA 3E3PA 4O1OA 5LWMA 3BI6A 2QG5A 3BLRA 4I20A 4WO5A 3DK3A 3MB7A 5DMZA 3CPBA 5DFPA 1W84A 4OTIA 1YWRA 2BALA 2WQBA 3GGFA 1WBWA 3RPYA 4S34A 1ZZ2A 3QTZA 4CQGA 3QHWA 1KE5A 5HG8A 4U9AA 3RBWA 2IW9A 5CAVA 4WD5A 3F3WA 3P7AA 4QP4A 5DG5A 4EK6A 4DHFA 5A6NA 2V0DA 4EHVA 4W9WA 4NTSA 5BX0A 3L9MA 3FAAA 1H25A 3VUGA 3MVLA 3POOA 4JJRA 3R8MA 2XIKA 2C0IA 2R4BA 5J9ZA 4BTFA 1W82A 1Y8YA 4MTAA 3TZMA 5FRIA 3PXQA 5F20A 5LXMA 3VQUA 5IPJA 3QCSA 5DT0A 2JAMA 4PQNA 4XYFA 5CSVA 2VTLA 4K18A 3R9HA 5H3QA 1H07A 4GEOA 2XK7A 3MA3A 4TWOA 2W1FA 1YI6A 3U6IA 2PVNA 3GT8A 2GFSA 2OBJA 4LGDA 5H2UA 1CKJA 3DLSA 4O0XA 4ZIMA 4S30A 4XHKB 3SW4A 1U5QA 4G6NA 2XEYA 3EN4A 4K0YA 4HPTE 3OXZA 1J7UA 3SRVB 1H1QA 5AADA 2UW6A 4FT9A 3DS6A 4EQMA 3QKLA 3RALA 5HNBA 2FB8A 4DFBA 4FSUA 4N6YA 1IAHA 5J5TA 5BUJA 2AC5A 3KMUA 3MPTA 4FV0A 2ITQA 4G1WA 4E3CA 4AT3A 3FLNC 5BPYA 5CWZA 5E8TA 3IG7A 3UO5A 3NZ0A 1H27A 3KFAA 3G0EA 3AG9A 3ZO4A 4FKQA 4LL0A 4N57A 2BVAA 3FE3A 4O7ZA 4JR7A 4IZYA 4P4CA 4AT5A 3OVVA 4RC3A 1FGIA 4MX9A 2J4ZA 3RHXA 4MXCA 2W7XA 1VYZA 2YWPA 4KA3A 4NEUA 4UY9A 2AYPA 4F7NA 3WBLA 4CVAA 2XK9A 1BMKA 3ORIA 4YNEA 4QQCA 5CVFA 5EW3A 3UNKA 2OGVA 5KMJA 4NW6A 1W98A 4XMOA 3PXFA 4IDTA 3A8XA 5L2IA 4ZTRA 2YLFA 4AE9A 4FEXA 1XH4A 4CKJA 4CTCA 4DFXE 2OXYA 3ML1A 5JKGA 2RG6A 5D41A 5F95A 3EJ1A 5EG3A 2DWBA 2CKEA 2IZRA 3VIDA 3BL9A 2O5KA 3JPVA 4D2SA 5IQDA 1FGKA 5GIOE 3KRJA 3TKHA 3FI2A 4FJVA 2CGXA 5L4QA 4M12A 4FTUA 4YBKA 4ITHA 1BI7A 1P14A 4LOPA 5CTPA 4LFIA 2UZUE 5DH3A 1V1KA 5AM6A 4IH8A 4DGNA 4EOJA 1OBDA 3MH0A 1OMWA 2B1PA 1ZWSA 3DKGA 1P5EA 3NS9A 5IQGA 3OOGA 3PZEA 1SMHA 3G51A 3C1XA 3KRLA 3R1SA 4HVSA 4FI1A 1U54B 2ESMA 4NFNA 4QTEA 4FL1A 4S2ZA 3NW6A 4NH1A 3PE2A 4X21A 4BHNA 3BYMA 3F7ZA 5BV3A 3KU2A 4FTLA 4FT3A 4FV4A 2YCRA 3MH2A 2YIQA 4RRVA 5FEDA 2X9FA 3WE4A 4BDJA 4UB7A 4FG9A 1QL6A 3SRVA 3UGCA 4QMYA 4D1ZA 5HE2A 3WOWA 5D7AA 1FQ1B 5C8NA 5HO6A 2H8HA 3NDMA 4RLKA 2J0JA 3T3UA 5B2MA 2XARA 4BCFA 3BHUA 3BELA 3ENHA 5A4LA 3F69A 5JZNA 2WHBA 4FSQA 3TZ7A 4F6WA 4NCTC 1W2FA 4NZWB 4PV0A 5EHYA 3MI9A 4EC9A 3BE2A 3NYXA 4NFMA 2OK1A 2B4SB 5AUTA 3UZTA 3EQDA 1Q8ZA 1YXTA 3GC8A 3G6HA 1WVWA 3N9XA 1E1XA 3BV3A 2X2MA 2XK8A 3UP7A 3II5A 2G2IA 2UW9A 2BHHA 2QNJA 4I4EA 4F65A 1OBGA 4TKSA 4U81A 3C4EA 4BZDA 4ZJVA 3NEWA 3O96A 3LFNA 3RP9A 2X4FA 4Z7HA 2C6LA 2HW7A 4C33A 1M7QA 2VWVA 4B9DA 5EQEA 1TZDA 3WZDA 2UZEA 4DEGA 2XKEA 4J99A 4FTAA 3WZKA 5CYIA 5LVNA 3U87A 3KN5A 3CY3A 4AGWA 3AKKA 3Q52A 2O3PA 3R83A 4CCBA 2C6DA 2IWIA 1YVJA 5EHLA 3OT8A 3ZHPC 4H3QA 5IH5A 3NUYA 4O7LA 4JDIA 3ZOSA 4YR8A 1UKIA 4EH2A 3HAVA 3QA0A 4IWDA 2BAQA 1H8FA 3QLFA 3TT0A 2FSOX 3ZYAA 5IA3A 2UW3A 5HTCA 4BI0A 2PMOX 4O7WA 2X4ZA 2ZDTA 3LFCA 2FYSA 4MEDA 3TACA 4WOVA 1KWPA 5HHWA 4MQ2A 4B6LA 2J90A 5CQUA 1OIRA 5LVOA 3O5AA 2YM8A 2E9OA 5E8XA 1XH5A 2ZM4A 3DAEA 4GT4A 2R3LA 3EIDA 4I0RA 2JKMA 4TT7A 3ZLSA 3U6HA 3OCTA 1L8TA 4KB8A 1W0XC 1YOLA 2P33A 2PL0A 5L8KA 3FMEA 3QQKA 4JVGA 4FEVA 3CTJA 1MRVA 1U54A 1A06A 3R2BA 4NT4A 4RC2A 4YTIA 3RVGA 3VHKA 1XKKA 3F61A 2XIXA 3Q6UA 3QD4A 3AC2A 4KBAA 3ODZX 2VTOA 4IAKA 4ANOA 4BCOA 2GQGA 4CZTA 4RBLA 2PVJA 3TG1A 3QLGA 4DINA 4E73A 3DY7A 2VO0A 3IQ7A 4FGBA 2WTVA 3EYGA 1G5SA 5JFXA 3GFEA 1Q3DA 2O64A 4YJQA 3FSFA 3O2MA 2GHMA 3AKJA 4E8AA 3F7WA 4JG8A 4I0TA 4BIEA 2FSLX 1XR1A 1KE7A 1M2RA 4JNWA 2QVSE 4O81A 2BZIB 5EI8A 4A9SA 3LFSA 4FOCA 3ZEWA 4Y72A 4FTKA 1K9AA 4PL4A 4ZLZA 2ZFYA 4D9UA 1IA9A 3FI4A 3VBVA 4DT9A 3WZEA 4HZRA 4O4EA 4UX9A 4UWYA 3LM0A 4YHFA 4FNYA 1PXPA 1KE8A 1QPCA 2WD1A 5FGKA 3F9NA 5A6OA 5B7VA 4ZSAA 2E9NA 3BHYA 2C3LA 2Q0NA 3QTUA 2CN5A 4BGQA 3MJ2A 3DAJA 3ALOA 4TYHA 3E7VA 2C1AA 2BPMA 1WVXA 3AT3A 4EH8A 3OBJA 4G3EA 2Y4IB 4IM2A 5M4FA 2PUIA 4APPA 4IDVA 2XBAA 2XB7A 2R7IA