4FRFA

Structural studies and protein engineering of inositol phosphate multikinase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
237
structure length
214
Chain Sequence
EIEVKFYESFSSNTEVPEHIHRYFPVYHGTMMVLENLLAEYTKPSVMDVKMGSRTWYPDASEEYIQKCLKKDTGTTTVSSGFRISGFEVYDHKESSFWKPERKLLRGLDVDGARLTLRKFVSSNSLPDSAFASSVYGGSHGILTQLLELKTWFENQTLYHFNSCSILMVYENESDARPQVKLVDFAHVLDGNGVIDHNFLGGLCSFINFIREIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol polyphosphate multikinase alpha
publication title Structural studies and protein engineering of inositol phosphate multikinase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 64
structure length 214
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.1.140: Inositol-tetrakisphosphate 5-kinase.
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4frfA00
2A98A 1W2DA 2IEWA 4O4DA 1W2FA 4O4FA 1TZDA 1W2CA 4O4BB 4O4CA 2AQXA 4O4EA 2IF8A 4FRFA
chains in the Genus database with same CATH superfamily
2QVSE 3V6RA 5A4QA 2CHLA 2NO3A 3F61A 4XBRA 3COKA 2VTTA 2LGCA 3GVUA 4FIHA 2G1TA 5TE0A 3Q9WA 2W06A 3ZMMA 4JT3A 5J9YA 3D4QA 5FRIA 3SX9A 4L43A 2VTNA 2UZTA 5I9WA 3EIDA 5GZ9A 3CD8A 2HW6A 2WMQA 5EOLA 4AUAA 3FSFA 2VWBA 2VV9A 4QMMA 4D2WA 4BYJA 2OO8X 4BVUA 3HDMA 3TN8A 3FC2A 4USDA 5I3RA 3IQ7A 3NUUA 3QD4A 4FVPA 3QUEA 1U54A 1IRKA 4LMNA 1O6LA 4O22A 2JITA 2ZVAA 4BC6A 4UMPA 4CYJA 4G16A 5AP3A 5BMSA 3RINA 2X8DA 4GV1A 5BUEA 4EC9A 4A9RA 4GG7A 2W5HA 2J6MA 1A06A 4W4WA 5BUIA 1QPCA 5GZAA 1MP8A 2C3IB 3TKHA 5AV0A 3A61A 5TO8A 4GK3A 1CM8A 2AQXA 5CASA 3T3UA 2WQOA 2PVJA 2F49A 2YIXA 2XNBA 3F2NA 3LCDA 4QYEA 4XG4A 2BKZA 4QMLA 5CEIA 3VO3A 1EH4A 1PXJA 4BBMA 3D7TB 4JAJA 2P2HA 5A46A 3TZ7A 2XNEA 4TWNA 1MRYA 3ZLWA 5AP5A 3ZEWA 4F6UA 4RJ5A 4CXAA 3R0TA 3RKBA 3KMUA 3I60A 3BU5A 3W8QA 4GFOA 4G6NA 3RPVA 4ZLOA 1P4OA 5M57A 4R3CA 3NX8A 2JKQA 4M0YA 4NEUA 5CT7A 4IWQA 4ANQA 2UZLA 4ASZA 4EK6A 3D2KA 2XCHA 2B4SB 5F20A 2OF2A 4YU2A 4M12A 3IOKA 1KE5A 3UPXA 3VS3A 4IB0A 3JXWA 3C1XA 1Y6BA 5C01A 5L2IA 4PTCA 3W2RA 5CEKA 2UW5A 3Q4ZA 4RIOA 4RLKA 1YW2A 3MY5A 4MNFA 3I79A 2OIBA 4BDGA 4I0TA 5LXMA 4M97A 3M1SA 4MH7A 3V5JA 3MYGA 3QZGA 2I6LA 4OT5A 4QPAA 4EQMA 4QRCA 4UWBA 4X6QC 5ANEA 4BTMA 1PF8A 3OCBA 2C30A 4JNWA 3NYVA 5CSPA 3DU8A 4APPA 4ITIA 3UG2A 2QONA 3R8UA 4QQCA 4XV1A 1LR4A 4AN2A 3ORMA 5HIBA 2JIVA 3JPVA 4CFWA 4ZLYA 4XBUA 1YXSA 2XA4A 4Y5QA 2Y4IB 4AOTA 2W1IA 5IA1A 4XOYA 1U5QA 5EI8A 5DNRA 5JFSA 4HGTA 3MFSA 2JEDA 5BYZA 4DFZE 4TYHA 4QNAA 4F70A 5IA5A 2BVAA 3C4XA 4K18A 4II5A 2HK5A 3PFQA 4EK8A 4L3JA 3KCFA 4J7BA 4NM0A 5EH0A 3R83A 4JR3A 3QD0A 2CJMA 2VO3A 4U41A 4ZJVA 3TKUA 3PXKA 4M69B 1HOWA 4F9CA 4RGJA 4PL3A 1SVEA 1S9JA 4CV8A 1Y6AA 2FA2A 1OIQA 2C6KA 1Q8WA 1OL5A 3VN9A 1W8CA 5CAUA 2WMUA 4WT6A 1WBNA 4JX3A 4AOIA 4C57A 1FGKA 2R9SA 1Q3WA 4ZTQA 4FTUA 2RFSA 2XMYA 3RNYA 2GS7A 1HCLA 2X7OA 4RVKA 3TXOA 2YCSA 4D9TA 3FUPA 4FV0A 5E8XA 3ZFMA 4BCIA 2W0JA 3AMYA 4YLJA 5LQFA 2OICA 3CQWA 2R3FA 3F3ZA 3L8XA 5HGIA 3TT0A 4Z7GA 3CPCA 3R9HA 4CFMA 1NY3A 5HE0A 3K2LA 2O3PA 3R9DA 1R3CA 4AZVA 3WILA 1Z57A 3CTQA 1S9IA 4ZZOA 3BQCA 5M53A 4CYIA 5DFPA 4TNDA 5IH6A 3A8XA 4J52A 3KEXA 5E8VA 2X81A 4WIHA 2F4JA 2PE2A 4WG3A 5IMXA 2YDJA 3GP0A 4MNEA 5L2TA 2HCKA 4FTRA 3ZSHA 5LWMA 2VO7A 4CQEA 2B1PA 3BLRA 3NCGA 3R9OA 2YDKA 3EJ1A 3EQBA 4ANMA 4F65A 4YTCA 4WRGA 3KXGA 4MX9A 2QNJA 3VUGA 4KNBA 4E4XA 2J0LA 3R8PA 2CLQA 4HCUA 4D1XA 4R6VA 4FVRA 4OAUC 2RL5A 5EKOA 4TW9A 4EHVA 2WMWA 4U81A 2VTIA 4RX8A 3UTOA 2ETRA 4YLLA 5TF9A 1V1KA 4BWPA 5DVRA 2B9IA 2GQGA 3LCSA 2DYLA 4E93A 4DH5A 3LPBA 4R5SA 4UYAA 3RVGA 1OITA 2Y9QA 2J5FA 4PNKA 1F3MC 2PVFA 3WF7A 4AA4A 1GJOA 4IVCA 2CN8A 3R7EA 4DEGA 4QMYA 3ZDIA 4G34A 5CU6A 5DE2A 3QF9A 3Q9XA 5JGDA 1FVVA 4ERWA 4FSZA 2ZV9A 3W2PA 5M4CA 5TKDA 4DLIA 4U0IA 3FDNA 1VJYA 5D7VA 4LRJA 3ZXTA 4BKYA 4E1ZA 4B9DA 2UW4A 3AD4A 1QCFA 4KB8A 4KSQA 3ROYA 4D2SA 1PXPA 4BCMA 2O63A 2CGXA 3CTJA 3MI9A 3IW5A 5CALA 5J5SA 2OF4A 3OCGA 4GH2A 1QMZA 4O96A 4PF4A 4XV3A 4QMUA 3UYTA 2ZAZA 3CD3A 3K3JA 3PG1A 4N4SA 3T3VA 3ZRMA 3RI1A 5JH6A 3TV4A 5CENA 4DC2A 4L9IA 3KVXA 1PJKA 4A9TA 2QHNA 2J5EA 4BICA 3NLBA 4RA5A 4F6WA 5BVNA 4F7SA 4FIFA 4FNYA 5AP2A 4F63A 2JFLA 1W2CA 4MF1A 5EW3A 4FSMA 4L7SA 3DGKA 2YACA 5LMKC 1JKKA 4YO6A 4O21A 2XJ2A 1PYEA 3HV7A 4KA3A 4PL4A 4O4BB 5HG8A 4HZSA 4L45A 5HVJA 4L3PA 4LRMA 5EKNA 3SOAA 3Q53A 4YJSA 3EHAA 3DB8A 4DEBA 3LCTA 3ZM4A 4HZRA 4BCHA 3GC8A 4PV0A 5I0BA 4ENYA 4LOQA 3QRJA 4GG5A 4KINA 2W7XA 3FLZA 4AWIA 1IA8A 3FLNC 5A9UA 3ITZA 4CT1A 1YOJA 4C61A 5C03A 1DI8A 1ZXEA 5CSWA 1JSUA 2IJMA 3KRWA 3DNEA 2YAKA 1UU9A 3NRMA 2R3MA 1H1SA 2VNWA 3ERKA 1XBBA 3KRXA 2C3KA 4JG8A 4O0WA 3D7ZA 3FMLA 4JBVA 3QWKA 5EYCA 4FV7A 4GVAA 1CKIA 2V0DA 1VZOA 4AN3A 2RFDA 3E5AA 3KC3A 2IZUA 3D7TA 3MY0A 2PZPA 4C3PA 3V6SA 2XKFA 3MFRA 2BR1A 2XM9A 2VWIA 2G2HA 4D4SA 4IW0A 3PXZA 4PMTA 2R5TA 4J71A 4W9WA 3OD6X 4G3EA 4JG7A 1QPJA 4JDHA 4KSPA 2UW9A 3RP9A 5LCJA 3C4FA 3R8ZA 3NUXA 3R7GA 4EC8A 4GUBA 4QTEA 3WYXA 2ITXA 3WZUA 2PUUA 4EOIA 5KHWA 4JX7A 3OMVA 4X7QA 5E92A 2J7TA 3L8VA 4JS8A 4M67A 4YMJA 3NAYA 1E9HA 1LP4A 5J7HA 3KMWA 1YKRA 2YIWA 4FMQA 4O4CA 4MVFA 4EZ3A 2QOLA 3FLSA 1SVGA 3A4OX 3BZ3A 5AX3A 3QXPA 4U80A 1WBWA 1YI3A 1L3RE 3QQKA 3ORTA 2F2CB 2JIUA 3WE8A 4F7LA 3CP9A 5LCKA 5IMEA 2VX1A 2C6EA 3ACJA 3KN5A 2XUUA 3A7FA 2FH9A 5J95A 3R1SA 2R3QA 3TUCA 3UDBA 3WZDA 3AT2A 3K5VA 4WD5A 4NT4A 3NUYA 4IAAA 1VYZA 2B52A 4F9WA 1B38A 3ZSGA 1CSNA 3I81A 4YNEA 3PXRA 4BCJA 5ACBC 1RQQA 5IEYA 3DKGA 3ET7A 3I7CA 3OWLA 2BPMA 2XK3A 3VHKA 3QFVA 2YJRA 2W5BA 2P3GX 3PVGA 3L9MA 4AT5A 4BBFA 4MWHA 3IGGA 3ZO4A 4EOSA 2IVVA 4XS2A 4YPSA 2OK1A 4X2KA 5AV2A 4F08A 3ORXA 5LVNA 3LAUA 2XIXA 4E5WA 4X0MA 4EBVA 3R9NA 4MXCA 5I9VA 3RK9A 4ACHA 4CCUA 3UOKA 2EWAA 3ZUTA 3FXWA 3BU3A 1PW2A 4RX7A 1ZYDA 5FXRA 2B9HA 4M69A 2XYNA 4BGGA 3DKOA 4EEVA 1QPEA 3IW7A 3S1HA 3R28A 3QQGA 2J4ZA 3VUKA 3L9NA 3QGWA 4UB7A 4EUTA 1H01A 2QOKA 2X0OA 4R8QA 3TUDA 2XRWA 4WNOA 4YTIA 5KBRA 3NW6A 4BCOA 5JZJA 2R3GA 2ITUA 1RE8A 2WU7A 3CQEA 3BGPA 2QURA 4AA0A 4TYGA 2WQBA 3EH9A 3OXZA 2ZM4A 1OKWA 2WOTA 3ZCLA 4F9AA 5HX8A 5L8KA 1QPDA 3NS9A 4O0RA 3KXNA 5HLPA 3V5LA 1W2FA 1Q8YA 1WZYA 4EWHA 4HGLA 3VQUA 5CNOA 4BFMA 4F1TA 2WFYA 4UWYA 5HE1A 3I1AA 3P79A 3R7OA 2X9FA 1GZKA 4E3CA 5CXZA 4WUAA 1SNXA 1XQZA 3VUMA 4C38A 5M56A 2XK6A 2ZB1A 4CCBA 4FIEA 4IB1A 1MRUA 2E9UA 4Q5EA 4WUNA 4BGQA 5BVOA 3GQLA 4YZBA 5IEVA 3PA3A 2W1DA 3PWDA 2FSOX 2J50A 4HYSA 3BQRA 4C35A 3G6GA 1E1VA 3W16A 3OOGA 3QTZA 4ASXA 1ZRZA 5A54A 3GXLA 3MY1A 4O2ZA 1M17A 3PIXA 4YP8A 4U8ZA 4FKTA 2YHVA 1Z5MA 2VWWA 3RK5A 5AR4A 4IBMA 3V8WA 3W2CA 3UVQA 5A14A 3ZHPC 4U9AA 4TXCA 5IUIA 2ZYBA 3CBLA 4EYMA 4CSVA 4FSNA 4Y5HA 4HJOA 4C2WA 5AAEA 4I22A 4XLVA 4BCFA 2QOHA 4JBQA 3HEGA 4S33A 4EH3A 3DXNA 3R02A 4TYIA 4MYGA 4YC8A 5AM6A 5KNJA 3QTQA 2Z60A 3OTUA 3EFLA 4LOPA 2G2IA 2X39A 4C36A 4BZOA 1R1WA 3QGYA 2G01A 3AD5A 3V8TA 5L4QA 4BIDA 2XK8A 3WIGA 3QLGA 5J79A 4FSUA 4XRLA 1LEZA 2OFUA 2PSQA 1BL6A 5HZNA 4XV2A 3EL8A 5GJDA 1J91A 4IB3A 5J1WA 4FSQA 2VX3A 3PYYA 2Z7QA 4GT5A 1ZYSA 4BBEA 1JNKA 2NRUA 2VD5A 3MH1A 3D83A 4K2RA 4NU1A 4ACMA 4FKJA 3QA0A 3DBQA 3OEFX 3HVCA 5DG5A 3ZLXA 5AIKA 3P4KA 1FQ1B 3PRFA 4CFVA 3PVUA 4D5KA 4EKKA 4EOKA 4JQEA 3LW0A 5AUXA 5FD2A 5JFVA 5BVKA 3H9OA 4NJDA 2BZIB 3BE9A 4FUYA 4EH8A 5AA8A 4I21A 4PPAA 2W05A 2WEIA 4FTNA 2QD9A 5HLWA 1OM1A 5I9XA 2REIA 2UZOA 3FC1X 4I93A 3WBLA 4DEEA 1OKVA 4H3BA 5ICPA 5ETAA 4EI4A 3FXXA 3L8PA 4G2FA 4V05A 4NW6A 3UO4A 4FRFA 3EFWA 3M2WA 3WARA 5AJQA 3Q5ZA 4ITJA 3FHIA 5BMMA 3EN9A 3R1NA 4DH1A 2PVMA 5AA9A 3CXWA 3O8UA 3P1AA 5HE2A 3UNKA 4S30A 4XG9A 2C6MA 2QU6A 2JAMA 4NIFB 4QMSA 2VU3A 3DK7A 5IA3A 2CMWA 3QKMA 3P7BA 4C4FA 2OH0E 3BHHA 2HW7A 5CVFA 4LOOA 4FT0A 4ALVA 4IWPA 3B8QA 5KX8A 3UC4A 4ONAA 5K0XA 3OWJA 5EK7A 3RPOA 4H1MA 4N0SA 2ZDTA 3F3UA 3FYJX 3GUBA 2YM4A 4KIPA 4X21A 1PHKA 4QYHA 5EW9A 5TOZA 5TT7A 4A7CA 2JDTA 3MA6A 3QTIA 4FOBA 3UNJA 2CPKE 2IVSA 3FZSA 3KK8A 4KS8A 5CI6A 5JGBA 3S00A 2O5KA 2I0HA 3HA8A 4BKJA 2HY0A 1MUOA 5J87A 2E9OA 2H8HA 4QP9A 2ITVA 4QP8A 4PPBA 3SW7A 1XH5A 4M0ZA 3VBWA 5KBQA 2Z7RA 5EDQA 5M4UA 4F9YA 4JIKA 4QMTA 3SC1A 4ZAUA 4FT5A 5JFWA 2H34A 1FPUA 2XB7A 3I5ZA 3E63A 3CKXA 4QYFA 2FSTX 3DJ5A 4JL9A 4O6LA 4RC4A 4BDAA 2ITPA 4PRJA 1GZNA 2WD1A 1YXVA 3FI2A 4ANOA 4E6AA 1Q97A 1WVXA 4Y73A 5JQ8A 2WNTA 3NUNA 4IWOA 5JZNA 2WMSA 4CZYB 3DA6A 5T68A 4GFMA 1WVYA 1Q5KA 4J97A 4AOJA 3NWWA 4D2TA 3F7WA 3BBWA 3Q9YA 5EYKA 3ENMA 2XZSA 4N6YA 2OJGA 3KULB 4BHNA 2EVAA 4FL3A 4H36A 5ETFA 2YJSA 3LFBA 1JOWB 5B2LA 2WMTA 3F5UA 4IM3A 5CVGA 5IPJA 5L3AA 3S4QA 4G6LA 4FG8A 3SXRA 2HZ4A 4GJ3A 3UOHA 4LGGA 2O64A 3C4EA 2VWXA 5I3OA 3VVHA 2JLDA 2UVZA 4X3JA 4O0XA 3RCDA 3DOGA 4IZ5A 3DDPA 4BDKA 3P5KA 5FG8A 2WB8A 4AW0A 4AT4A 3OHTA 3R63A 5M51A 1A9UA 4JDJA 4YTHA 1AGWA 3C5UA 3GU5A 4X2NA 4B99A 4U79A 3CLYA 4AZTA 4YSMA 2CDZA 4RVTA 5D10A 5KMIA 3C0IA 5JSMA 3POZA 3QCQA 5H8EA 4EH5A 2BILB 2C1BA 4XG8A 3EOCA 2C5NA 2ONLC 2X2LA 2BDJA 2JBOA 3CE3A 4Q9SA 2XVDA 5EI2A 3HV6A 1OPKA 1ZZ2A 3HP5A 4CNHA 1REKA 2VTJA 4RWKA 4DN5A 1YDRE 3UZTA 4EBWA 4QD6A 2Q0BA 3FQSA 2UW6A 4MQ2A 4TT7A 4LYNA 5DT4A 2XIZA 3EN5A 3E64A 3H0ZA 3IDBA 2OZOA 5JMSA 1H1WA 2R4BA 5FWKK 3E3BX 4IJPA 2EUFB 4KBCA 4QP3A 4R7IA 2W4OA 3F9NA 4NFNA 1BKXA 3O8PA 3PLSA 2PVLA 3PSCA 4PDOA 2X8IA 4QMOA 5K9IA 2PMLX 5B0XA 2GHLA 3P86A 4E6DA 2WQEA 4C2VA 3A7JA 4OGRA 3R2BA 1NVRA 5FXQA 3RPYA 5DBXA 3MPAA 3VC4A 3FZ1A 4C59A 5LMKA 2XKDA 3DTWA 3DQWA 3EQHA 3LFQA 2PE0A 3ODYX 2FO0A 2PK9A 3KF4A 4F1MA 5DWRA 2WZJA 3BV3A 3U51A 4G3CA 4Q9ZA 4FK3A 3FLQA 1WBVA 3O96A 4GT4A 4JQ7A 4RX5A 1MQBA 2VTMA 3QX2A 3RPSA 4NH1A 5GJGA 3PXQA 2YABA 2RKUA 3L9PA 5A3XA 3TNWA 3DFCB 3QRKA 5CVHA 3UP2A 3WE4A 3Q3BA 4HGEA 3VF9A 4D2VA 5LJJA 1JKLA 4M13A 3D0EA 5T3QA 5L6PA 2QHMA 1SM2A 4IAFA 1ZOHA 3ZEPA 1V0PA 4DFYA 2ACXA 3G2FA 2JKMA 2W9ZB 2WELA 4BDBA 5L6WL 5A4EA 4CFUA 3B8RA 5FM3A 4U43A 2WMBA 1XR1A 3IPHA 2B9JA 3ZC6A 4Y8DA 2EXMA 4E4MA 3KN6A 4IC8A 4CRLA 2F2UA 4L53A 3MVHA 1J1CA 3F6XA 3UQGA 3DZOA 3HV4A 2UZUE 5EHLA 1CKJA 2BHEA 3VW6A 2QI8A 2QR7A 5EG3A 5DPVA 2ESMA 4CQGA 5H2UA 4F6SA 3KMMA 3NEWA 3JS2A 3AMBA 5AUUA 5HTBA 5L2WA 4L8MA 4CVAA 4IFCA 3FPQA 4AZFA 2ZJWA 4NM5A 5AV1A 1DAWA 4FUXA 1GY3A 1B6CB 2WTWA 4MBJA 1OECA 4AW1A 1JVPP 3CEKA 4L68A 2ZMCA 1OKYA 5I9UA 4ZTMA 5A6OA 5LWNA 3C7QA 3LJ0A 3GENA 4D5HA 3A7IA 4I3ZA 5HIDA 2HWPA 1FMOE 2PE1A 3RHKA 1UWHA 1B39A 4S31A 5EM8A 1JQHA 3NIEA 5HVKA 2X2KA 4DGMA 4CFXA 2UV2A 3BEGA 1BLXA 4LUEA 2OKRA 4IDVA 2H9VA 4RSSA 2P55A 4FNXA 3SA0A 1H0WA 2ITNA 4BIEA 3WF9A 3RTPA 4DEAA 2I0VA 2XNNA 2JAVA 4JDIA 5J5TA 1JAMA 3BYSA 1OL2A 3COHA 5JEBA 4OTIA 4HYIA 1UA2A 4F7NA 4CFFA 4AS0A 3D5VA 5FEDA 5JK3A 4LL0A 4RVLA 2A98A 2OI4X 2HXLA 5DR9A 4NK9A 2A2AA 1T45A 1XH4A 4R1YA 2B53A 1BUHA 4I4EA 3MVLA 4XUFA 5IISA 2E9PA 1OB3A 4C3FA 5AUVA 3DS6A 3ORIA 2PTKA 3R7IA 4FIGA 4NIFA 1SVHA 2G9XA 4GIHA 3UO6A 4IE9A 4YC3A 5D41A 2W1HA 4YNOA 5HE3A 3E93A 4FIIA 2XK9A 1ZAOA 4OBQA 3U9CA 1BX6A 3E62A 1Q8ZA 1VR2A 2IZRA 4U3ZA 5JRSA 4XEYA 4DEDA 4RIXB 1VEBA 3GCUA 3H4JA 2R3LA 3GQIA 4FL1A 4DFNA 2H96A 1Q4LA 3QQFA 3QTUA 4RIYB 4YZCA 4ZOGA 4U45A 5AP7A 1W83A 2R3KA 2Z2WA 2VWYA 2WMVA 1TZDA 3E8NA 3PZEA 4XX9A 4QMWA 3KK9A 4LRKA 1G3NA 3CGOA 3GCQA 4A9SA 4AA5A 2WTVA 4WBOA 5L8JA 4C4HA 2ZM3A 3PE2A 3GU4A 3NUPA 1K9AA 4I41A 4CT2A 3WZEA 3JVSA 4L52A 3BEAA 1K2PA 5K3YA 5CF4A 1H8FA 3G0FA 3FKNA 3NYXA 1Y8GA 4FTKA 2HAKA 1FVRA 3OT3A 4IH8A 3FI4A 3NGAA 3ORPA 1KSWA 4EH4A 5AAGA 3FAAA 4XNEA 5AV3A 2WTKC 4YJRA 3LXKA 1GAGA 4TNBA 4FI1A 5AUWA 4C8BA 3HUCA 2ITQA 2IZTA 3MVJA 4EH7A 3KULA 5HVYA 5HQ0A 3EMGA 3DQXA 1PXMA 2GFCA 4ZJJA 3TCPA 2WMXA 4D2PA 5C1QB 1OIUA 4RJ6A 5DT0A 3OUKA 3UQFA 3T9TA 4I92A 3OWKA 4ZTNA 2YM8A 3UC3A 3WF8A 4YBKA 4Z3VA 3FMDA 4OAVB 3DBCA 2GDOA 3AOXA 4XH6A 3UO5A 4IM0A 1OGUA 2ZOQA 3PIYA 1XJDA 4BN1A 1YVJA 5JFXA 4C02A 3IDPA 3FMHA 5CEQA 4DAWA 3VBQA 4AN9A 1WMKA 4U3YA 3C0HA 3LM5A 4HNFA 4IVAA 3CPBA 3AGMA 3DTCA 2BHHA 4UALA 4W4YA 4BDJA 3FYKX 3W2QA 1BI7A 3ZSIA 3G6HA 1BI8A 2PZYA 4H58A 4I4FA 5CQUA 5DIAA 4FV3A 3ENHA 3PY3A 3DY7A 4KAOA 4EKLA 2XKEA 1KOAA 3EKNA 5F9EA 3GU6A 5IF1A 2FSLX 4EOOA 5IH5A 3S2PA 4IADA 2CCIA 3WZKA 4O0TA 4BDDA 5FGKA 5GHVA 3RBWA 3UODA 4RQVA 3QRUA 2GPHA 2WOUA 3MV5A 4BCPA 4R3RA 4NFMA 4AZSA 3IK3A 5J1VA 3CS9A 3FZOA 4FNZA 5CXHA 3QHRA 3O0GA 4G3DA 2XP2A 4ZY6A 3BKBA 4H3PA 2R7IA 4MHAA 3QZFA 4O2PA 5HORA 2YIYA 1KE9A 3OOMA 4IACA 4JRVA 5B2KA 1GOLA 4UN0C 5KMNA 3H30A 4NCTA 4XJ0A 3VUIA 2VTQA 3P78A 3FKOA 4O38A 5EYMA 2XK4A 3FL5A 4DFLA 2X1NA 4EZ5A 2QKWB 4BF2A 4QMNA 3E7VA 3FV8A 4EK3A 3W8LA 3VNTA 4KIOA 3W55A 1ZYJA 4IVBA 3NNWA 4IMYA 2XIYA 2WMRA 4LL5A 3ULIA 4FX3A 4C7TA 1YWVA 3LQ5A 3QX4A 4JR7A 3VRYA 5L8LA 2QODA 3S3IA 4KKGA 4ASDA 3ZXZA 3BYMA 2UZNA 2OXYA 2J0IA 5EYDA 4BTKA 3AC3A 3BU6A 4PL5A 4V0GB 5IUHA 2VO6A 3KA0A 4EONA 3QL8A 4M68A 4AE9A 2CGUA 4FV6A 2C3LA 2CSNA 2JD5A 2ZMDA 2C6OA 3I6UA 3UVPA 1AQ1A 2UW7A 3GB2A 3MFUA 3R21A 4AE6A 5IA2A 2XCKA 3KKVA 3VULA 5EI6A 5CAQA 4FZDB 4ARKA 4FEQA 3R1YA 3HMNA 5HCZA 4GYGA 4MD9E 3O23A 3D94A 3F3TA 3QZIA 4ZY4A 3HMMA 3LHJA 5HO6A 4ZZNA 5JN2A 2EXCX 3I0OA 4U97A 4ANNA 4IEBA 4ZEGA 2JKKA 2B7AA 4BZDA 5HESA 4LMUA 4XP2A 4V01A 3PRIA 2YLFA 3CY2A 4Q5HA 3ZZEA 5HICA 4W8EA 4LFIA 3RPRA 3WIKA 2H6DA 2YEXA 3PPZA 4MTAA 4BI1A 3JYAA 2XK7A 3WI6A 1YQJA 1H08A 3N9XA 4FV5A 4J8MA 4ZK5A 4F0IA 3GI3A 4IJ9A 3QUDA 3GOKA 4FSWA 2BDFA 3TACA 4IDTA 2GNLA 4QYGA 2JFMA 4N6ZA 4A4OA 2W17A 3CJFA 2FUMA 3E8DA 4WRSA 3PTGA 5AWMA 5LARA 3R8MA 3ZUUA 4PP7A 3PY1A 3EYHA 3G9LX 3VIDA 4YUQA 2PY3A 3ZO1A 3U87A 4AW2A 3S0OA 4EHZA 1O6KA 3A7HA 3FE3A 4TYJA 3W18A 1Y8YA 1FOTA 4MAOA 4GCJA 3AD6A 3QQHA 1Q8TA 3R1QA 3H0YA 3QWJA 5CLPA 3W1FA 3BYOA 3UIMA 1SZMA 3PIZA 1W98A 1URCA 4K33A 4IX3A 4NTSA 4WNKA 4YLKA 5DEYA 3KXXA 2VWUA 4HVDA 5AUZA 4QP7A 4FG9A 4FV8A 5KCVA 4YJNA 2XM8A 1ZY5A 4FZ7A 1H1RA 3FY0A 3EN7A 3C13A 2BAJA 4YJOA 1M2RA 4MKCA 5KKRC 2XKCA 4DH3A 3DFAA 2ETKA 2R3JA 3VS2A 4TL0A 2WEVA 4FZ6A 2VUWA 4XG2A 2JDOA 3POOA 2F7XE 2PZ5A 2GU8A 3QC4A 4Y72A 4P5QA 2GSFA 1ERKA 4YPDA 4BCKA 3LFNA 3R2YA 2FYSA 4RIXA 2GS6A 4ZP5A 3NYNA 2F7EE 2QOFA 3EQFA 4G3FA 4RIYA 2O8YA 1Q99A 2GHGA 2IVUA 3MFTA 2ZB0A 3AXWA 3BGQA 4TRLA 5DT3A 3U8WA 2J0JA 5HG5A 5CU2A 3EQGA 3E87A 1XHAA 3CJGA 4BHZA 5HNIX 3THBA 4AP7A 3AG9A 3BCEA 2X8EA 5F95A 1W7HA 3LOKA 2EXEA 1ZMWA 3BELA 5LMAA 3R7VA 2ITOA 3AC2A 4BGHA 2YWPA 4XG6A 4K11A 5KO1A 4FTJA 4D4YA 3CIKA 3COMA 2QLUA 5D7AA 4UMQA 4GT3A 4G9CA 3MN3A 4EH6A 4JI9A 5BNJA 3T8OA 4QT1A 5J7BA 1TQIA 1ZYCA 2C6LA 2DWBA 2W5AA 3QQLA 3VJNA 2IVTA 4RRVA 3BLQA 3VS4A 3ZFXA 5CEOA 4IX4A 1YWNA 1DI9A 4DH7A 2XS0A 2XYUA 4FF8A 5FDPA 4ASEA 4EWQA 4QQ5A 4L46A 3EYGA 3V5QA 2XNGA 5GNKA 1TQMA 3M42A 1J3HA 3VQHA 1JKSA 5DEWA 2YCQA 5AAFA 3NW5A 1W0XC 2OSCA 2BUJA 4ZTSA 4F1OA 2UW3A 4QPMA 5DOSA 2P4IA 3TZMA 4IAKA 1STCE 2RGPA 4YJQA 4RG0A 3ORKA 1P2AA 4LGDA 2R3RA 4KS7A 4PDSA 4HW7A 4DYMA 4AGUA 2ITYA 3IW6A 2QOIA 3ZOSA 2F57A 1MQ4A 3UP7A 2VTRA 4IX5A 3HMPA 5JKGA 2UVYA 1QL6A 1OL1A 4M7IA 3OCSA 4JJRA 4PY1A 2AYPA 4C4EA 4LG4A 2FVDA 3TNPC 2BRHA 3FMKA 1Q41A 3QD3A 2R64A 1ZYLA 4O91A 3C0GA 1P4FA 4I20A 2ERKA 5ANGA 5LMBA 1PY5A 4PQNA 1Q3DA 2BFYA 3O50A 1XH9A 2J2IB 3P08A 4WKQA 5CT0A 4UXQA 4W4XA 2UVXA 1XO2B 3TNHA 4M84A 3EZVA 4QNYA 2B54A 2WAJA 4KRDA 3KY2A 5KZIA 3H9FA 4UBAA 4K0YA 3F7ZA 3BBTB 4FKPA 4BDFA 3KXHA 4AXAA 3C51A 2P0CA 5CTPA 5DI1A 4U7ZA 1KE6A 2F7ZE 3WYYA 4I23A 4GFGA 1LPUA 4HOKA 3RALA 4CFNA 2R0UA 3IGOA 3NIZA 4AW5A 4F99A 3RNIA 4NSTA 2V55A 2AC5A 3ALNA 3TUBA 4ZTRA 2QC6A 2BTSA 2PMOX 5EM7A 4P4CA 3BV2A 5DR2A 3DAEA 5AP4A 4RA4A 2VN9A 3OS3A 3O71A 3C4CA 4FK6A 4GMYA 3Q52A 1OPJA 3MH0A 3F5PA 3UMWA 3RGFA 4LM5A 4FTCA 4IAYA 3EKKA 4X3FC 1SMHA 3NPCA 2JIIA 1PKDA 4MQ1A 3TTJA 5ANKA 3KB7A 4PNIA 3UQCA 3DBDA 3PY0A 3BI6A 3BIZA 4QMQA 3MWUA 3KRJA 3GOPA 3MW1A 3KRRA 4FVQA 2WIHA 4V0GA 4QTDA 5H8BA 2VAGA 1H27A 2RIOA 3BYVA 4W4VA 3GCPA 3NNVA 4C4GA 3EQDA 3QQJA 4IXPA 4NM7A 3MTFA 4QOXA 4DGNA 5E8WA 2A4LA 4YJTA 4J8NA 3Q32A 2AUHA 3TTIA 2BROA 3LFCA 4WG4A 3ZTXA 4FTQA 4RFMA 2YM6A 2VTAA 3OXIA 4K1BA 4XCUA 1YDSE 2YIRA 5DGZA 3BHUA 1OL7A 1NVSA 1OUKA 5HBEA 1UU8A 4EHEA 3ORZA 3Q96A 3RAIA 5HU3A 2FB8A 1CKPA 5C27A 2YCFA 3QUPA 2J51A 4MBIA 4BCNA 2QO2A 2O2UA 3OFMA 3FQEA 4UMTA 4Z55A 2OW3A 2Z7SA 5HKMA 4D55A 3TNQB 5A4CA 3U4UA 2XIRA 5HO7A 2HZ0A 1XH8A 1WBSA 3LQ8A 2HXQA 1TQPA 3F69A 3VUHA 1H00A 2XBAA 4HGSA 3SD0A 4EHGA 4EJNA 4DG0E 3MH3A 5TR6A 5C9CA 2GNFA 5ANIA 4DG2E 4AACA 3VBXA 4CZTA 2BZHB 3H3CA 3A8WA 4LI5A 1Q61A 3VJOA 4F09A 3ALOA 2WGJA 1XH6A 3PJ2A 4C58A 4NWMA 3MGYA 4FKUA 1OUYA 2XBJA 3A7GA 4BL1A 5K5XA 2ITWA 3E8EA 3Q4UA 4QPSA 4Y46A 4A9YA 4BWXA 3I7BA 3LJ2A 4ITHA 4CEGA 4OTHA 4FGBA 5D12A 2QR8A 2PL0A 1H1PA 1ZARA 2BCJA 3MPTA 2QU5A 1ATPE 3MSSA 1PXNA 3OZ6A 4EL9A 2NP8A 3BPRA 4FR4A 3BWFA 4IB5A 3W2SA 4ZY5A 4JQ8A 3VAPA 5LOHA 4DITA 3QU0A 4GUEA 1I44A 3FJQE 3IDCA 5ACKA 3VUTA 2YFXA 3QBNA 3FMMA 2X2MA 1DS5A 4L00A 5B7VA 3F2AA 4HNIA 1H1QA 2PZRA 1YI4A 2PVHA 5KMJA 4AG8A 3Q4CA 3UG1A 4YJPA 3W33A 4X2FA 3OEZA 4O0SA 4TY1A 4DEIA 5IUGA 5CQWA 4FKLA 3ZYAA 2QO7A 4JVGA 3F82A 1H24A 4XG7A 2BRBA 3JUHA 3LZBA 3QTRA 4EOLA 4MD8E 2UZBA 4TPTA 2C47A 2CLXA 1O9UA 4O0VA 4FA2A 3C4ZA 5E8TA 3KQ7A 4EOMA 5GJFA 3II5A 5HLNA 2VZ6A 3OW3A 3A2CA 4TWCA 1YI6A 4IHPA 5A4TA 5BPYA 5CAVA 4D4VA 2DS1A 3QKKA 2V7AA 5DLSA 5C8KA 3OXTA 3LCKA 4C33A 5JT2A 1FMKA 4H3QA 3V01A 3MA3A 3RHXA 4FTOA 3O51A 4BI2A 2XRUA 3UBDA 1E1XA 5F4NA 1H4LA 3FLWA 3QRIA 1YXTA 4XHKB 5G6VA 4AU8A 3LE6A 5FBNC 1PXIA 3SQQA 2ZM1A 3GFEA 3V5WA 5EHYA 3HRBA 3MJ1A 2WO6A 4YJUA 3G5DA 2W1ZA 4CMOA 4R3PA 4GK4A 5D11A 5M44A 5AR2A 1BL7A 3BYUA 1Q24A 3ZLSA 4HVGA 1IR3A 1ZMVA 1YHVA 4X3FB 3GBZA 4L3LA 4YJVA 3IW8A 3FBVA 4NKAA 1JBPE 1PYXA 3MS9A 2VTLA 3N51A 3ZZWA 1HCKA 3BHTA 1V0BA 2GCDA 3K3IA 3EWHA 5AM7A 4WSQA 5HEZA 4EK4A 4HVHA 3V04A 2QOCA 3OG7A 3RM7A 3BHVA 3CR0A 4QMZA 4C34A 1PXKA 4YHFA 3G33A 3ZBFA 3GEQA 4W8DA 4PMPA 4UX9A 1TKIA 2WQNA 4OLIA 5CYIA 1ZMUA 4NUSA 1GIHA 4CZUA 3NDMA 3GCSA 2ITZA 1V0OA 5CX9A 5AR8A 5HBHA 3V3VA 3V5TA 2BZKB 1YDTE 5EM6A 4FTIA 4CD0A 3G51A 4Z9LA 3GC0A 4NTTA 4D2RA 4AGCA 3EL7A 4HCTA 3ODZX 4MD7E 4ANBA 2BAQA 4YZMA 4UEUA 1UKHA 4O1PA 1YOLA 3PJ3A 4G6OA 5AR5A 2B55A 2QOOA 4LQMA 3PZHA 5FTOA 3MIYA 4MXXA 3ETAA 4A9UA 4XYFA 4FT3A 4ZTHA 4BDHA 4XLIA 1R78A 4U5JA 4G5PA 3PJCA 4EK5A 4RC2A 3HDNA 2ZV7A 4O4DA 3PJ1A 4PP9A 3FQHA 4AFEA 2A19B 2IO6A 1Y57A 4K77A 2WIPA 4AQCA 5CEMA 3CKWA 5HTIA 3KL8A 5L2QA 3IS5A 5HCXA 4FT9A 1KWPA 3CCNA 4OT6A 5EFQA 1Y91A 4OUCA 3DJ6A 3PJ8A 4J99A 2Y6OA 4R7HA 4IWDA 3P23A 4FT7A 4MXZA 4CTBA 4DGOA 1PMUA 4EOQA 1CDKA 3DKCA 4Y85A 2WU6A 5AUYA 3RZFA 4E26A 3E92A 5BX0A 1REJA 2YM3A 4MCVA 1KOBA 2R0IA 3AMAA 4FTMA 2BFXA 2OXDA 4C4JA 3VRZA 3BRBA 3TKIA 2BALA 2J0KA 4NKSA 2C1AA 5CU3A 4FKGA 3ZRLA 5AUTA 3HECA 4GL9A 4GRBA 4LV8A 4E8AA 2RF9A 1H0VA 5FEQA 3KGAA 3HGKA 5DA3A 1BMKA 4J98A 2KULA 4UMUA 2WXVA 4M15A 4GK2A 4C37A 1PXOA 4AZEA 1OKZA 3MIAA 4I1ZA 4PMSA 2GFSA 3W10A 2C6IA 4J1RA 3TV7A 3WOWA 4RWJA 3LIJA 5FQDC 4BYIA 2PHKA 5B2MA 5CZIA 1PKGA 2OU7A 5J9LA 3QHWA 3AT3A 2QKRA 1F5QA 3FWQA 2UZWE 5ETCA 4MXOA 3BX5A 3UMXA 3RZBA 4A06A 4IFGA 3E8CA 4KABA 2VGOA 4FKRA 2R3NA 2OG8A 2YCRA 2HY81 4PPCA 1U4DA 4EQCA 3H10A 3RAKA 5CZHA 2WTIA 4FTLA 3IO7A 1YXXA 4RLLA 5IH4A 3UIBA 3ACKA 2YZAA 3IW4A 3ULZA 1ZOGA 4CRSA 1TVOA 4D0XA 4XV9A 3LFDA 3HP2A 3ELJA 4KBKA 3HKOA 1M7QA 4KKHA 4RZWA 5BQ0A 5HU9A 5E8YA 5KHXA 2IW6A 1OIYA 4L42A 4IM2A 4F9BA 2HIWA 1YHWA 2W96B 4KRCA 4YHTA 4C3RA 2OGVA 4WOVA 5D9HA 3SW4A 5CNNA 1YRPA 2XF0A 3OVVA 3QALE 5FP6A 3RAHA 3WF5A 3IOPA 3PPJA 2PMIA 2YAAA 5AX9A 5K4IA 3MPMA 4FTTA 5KMMA 4GYIA 4QYYA 5EDPA 1Z9XA 3FMJA 1NA7A 2X9EA 4RJ7A 1XBCA 2UW0A 2C5OA 4MWIA 4HYUA 5AP1A 4ACCA 2XJ1A 2C5YA 4O1OA 5CY3A 2QCSA 2NPQA 2HWOA 2VNYA 3EN4A 4JDKA 3DBFA 3IECA 1UKIA 1WVWA 2YA9A 2JC6A 3K54A 5F1ZA 5HCYA 4AX8A 2GNHA 4B6LA 5CF6A 4EOJA 4FKIA 2CGVA 5CF8A 4BCGA 5FTQA 3C9WA 1CTPE 4FG7A 4M66A 5I5ZA 5DMZA 2X0GA 2GTNA 3F66A 3CTHA 3H9RA 4FICA 3SV0A 5FXSA 4AFJA 4OTQA 2CCHA 2X0QA 4GU6A 1GZ8A 2X0PA 3PVWA 3CC6A 2Z8CA 3CGFA 1U59A 1FGIA 4PTGA 4EZ7A 4JG6A 3ORNA 1ZZLA 2JDSA 2PMNX 4IIRA 4WBBB 2BRNA 2ZDUA 4DEHA 5LVMA 2YITA 2OJFE 2R3OA 4ZLZA 4L7FA 3DKFA 3OBGA 1MRVA 4YR8A 4AAAA 2J90A 2VWVA 5HX6A 4A4LA 1LEWA 3UYSA 1J1BA 2VO0A 2XNPA 3BE2A 3I6WA 1W2DA 3AT4A 5EM5A 4AZWA 4E4LA 3ZS5A 5K5NA 1JWHA 1WBTA 4IZYA 1PXLA 4CKJA 3G9NA 4RJ3A 1UVRA 4RBLA 5IKWA 2I0YA 4ID7A 2QO9A 4MEDA 4Y95A 2W4KA 3G90X 2GTMA 3E3PA 3QAME 4RQKA 3HNGA 4WA9A 4D1SA 2IF8A 3MH2A 4W9XA 4DFXE 2YM7A 4HPUE 4G9RA 4DGLC 2UZEA 4RC3A 4DGGA 3NZ0A 5F94A 3Q04A 5ANDA 4RFZA 2W1FA 3C50A 4O0UA 3FMNA 4BRXA 4USEA 2GS2A 3OTVA 3ZFYA 1GZOA 4YO4A 3UGCA 3F88A 5IA0A 4B0GA 4NW5A 3A4PA 3QZHA 4AF3A 1JLUE 2X6EA 4FV4A 1WBPA 4TKSA 4E6CA 4B4LA 5E1SA 1APME 2FGIA 2F9GA 4XOZA 3ZU7A 2X4ZA 4DTKA 4XP0A 5KMOA 4X3FA 2BDWA 4QP2A 4G1WA 4P90A 5J8IA 5BVDA 3KRLA 2P33A 4I6BA 4QP1A 3ZRKA 2O0UA 2BIKB 1M52A 3QTWA 3C4WA 5CSXA 4FSTA 4LV5A 3ZO2A 3DAJA 4P5ZA 5L2SA 3O17A 3QYZA 1GIIA 2GNIA 4OBPA 4DG3E 5A6NA 2UZVA 4TTHB 5FDXA 4DINA 4YHJA 3R7YA 1YWRA 3QKLA 4GIIA 2RSVA 3B2WA 2W1CA 2EB3A 2C0TA 3F3VA 3I4BA 4PMMA 5CI7A 2GMXA 3QXOA 4BB4A 3Q4TA 3O7LB 4FL2A 2I40A 3ZDUA 3TWJA 4A07A 4RJ8A 5CWZA 4FKOA 3DT1A 3FZTA 4ZSGA 3O8TA 3RM6A 5H9BA 2A27A 5DRDA 4FKSA 5BVFA 3D9VA 3HV3A 3A99A 4JAIA 3SKCA 4O4EA 4J96A 3OUNB 2JGZA 5BVWA 4MK0A 4F0GA 2JKOA 4JOAA 1JKTA 3E88A 1M7NA 3LXPA 4RFYA 3SXFA 2C3JA 3PA4A 2HOGA 3V8SA 4RJ4A 4UZHA 2EU9A 4RPVA 3R71A 2WMAA 4IAZA 3QTSA 4J95A 4FBXA 4YGAA 5LVPA 4GW8A 3SVVA 3KVWA 4ZSJA 4C4IA 3KF7A 3D5WA 5E90A 2HZIA 5IA4A 3V5PA 1SNUA 2W9FB 4BI0A 3D2IA 4BWKA 5AEPA 4EH9A 3Q5IA 1IASA 2G2FA 3NW7A 4P2KA 4ZTLA 5I9ZA 2WTKB 2RFNA 3QRTA 3ZLYA 3HMOA 3R73A 3NNXA 4FODA 2ITTA 2OZAB 5CU4A 2SRCA 3R8LA 3R00A 1NVQA 3W32A 2WTJA 2WTDA 5LVLA 2VX0A 2R2PA 3ANQA 2C68A 2ETMA 5GZ8A 4P7EA 3P0MA 4NM3A 5M4FA 1KV2A 4OTPA 4FKVA 5EHOA 3W2OA 4U44A 2XH5A 3OY1A 3OP5A 4APCA 4FV2A 3MJ2A 4I0RA 3SXSA 4AGDA 3QQUA 2P2IA 3COIA 3Q6UA 4I94A 4CTCA 4V04A 4DLJA 4E4NA 3PP0A 4KIKB 4IAIA 5JQ5A 4YBJA 3EZRA 4LUDA 3RCJA 5AIRA 2PZIA 2JDRA 4KWPA 1W82A 2V22A 1WBOA 2W1EA 4ACGA 4OW8A 2UZDA 3OC1A 4Y83A 3EFKA 4X2GA 3CQUA 3QCSA 2G15A 4FIJA 3DNDA 4R1VA 4XRJA 3VBTA 4BKZA 5HBJA 2PVYA 4QMPA 5FEEA 3KU2A 3ROCA 1OPLA 3TI1A 2Y8OA 3REPA 2RFEA 2IZSA 1DM2A 2C69A 2NRYA 3LJ1A 3TL8A 4QTBA 5DH3A 5AR7A 5E1EA 3DJ7A 2ONLA 1YOMA 2XEZA 3HV5A 3PSDA 3Q2MA 4KD1A 3SRVB 1OZ1A 3D15A 3DK3A 4C62A 4OTFA 2A0CX 2ERZE 5AMNA 3OBJA 2C5XA 4I0SA 2IW9A 4IX6A 5D1JA 4D4RA 4FYOA 3LCOA 5FBOA 2PWLA 3E7OA 5ANOA 3JY9A 4K6ZA 4CLIA 1AD5A 5HO8A 3NSZA 4QMVA 2HENA 2X7FA 2PVRA 4N70A 1U5RA 2I0EA 5H3QA 4UXLA 4ANLA 3GU8A 2O65A 2X4FA 5CF5A 3SAYA 2QOBA 1XH7A 3VUDA 1I09A 2DUVA 2V62A 3ZBXA 4F0FA 4I5HA 4M3QA 4WSYA 3SLSA 4UZDA 1U46A 4Z7HA 3OCTA 4ZSEA 4GJ2A 4JLCA 4RVMA 4O4FA 2OJJA 2HYYA 3DAKA 4G17A 5E8ZA 3RMFA 4ANSA 3PP1A 4WO5A 1KE8A 4X2JA 4CV9A 3HRCA 3FSKA 3DLSA 1UNGA 1R0PA 3OROA 5AP6A 3PVBA 1IG1A 4KKEA 4F7JA 2XNMA 4GVJA 1RJBA 3K5UA 2E2BA 3QCYA 4IZAA 4U6RA 1OI9A 3RK7A 3SOCA 3FZPA 4PWNA 1Q62A 3R22A 4ALWA 4ZIMA 4H1JA 4JRNA 3AC8A 2DQ7X 2Z7LA 2C4GA 3GFWA 3HL7A 5AP0A 3FMEA 4O27B 4BCQA 4HVIA 3AC1A 4EH2A 3A62A 4BDEA 3QA8A 1O6YA 3UZPA 4AGWA 1OMWA 3AGLA 4I24A 2AC3A 3B2TA 4S32A 4TWOA 3UIXA 5BUJA 3GC7A 2BAKA 1XWSA 1R0EA 3IG7A 4BZNA 1UNLA 2Y4PA 3L1SA 5KMLA 4RWIA 4CLJA 1M2QA 4I6QA 1NXKA 1T46A 4FZAB 2IEWA 4C0TA 2C0IA 4GU9A 3HLLA 4I5PA 1UU3A 3QC9A 3WZJA 4CMTA 3ZC5A 1X8BA 3UVRA 1FINA 3PXFA 3GCVA 5CU0A 4RIWB 5HIEA 2PVNA 3LFEA 3HZTA 5IDPA 3O2MA 4FKWA 1BYGA 4QTAA 4CKIA 1RDQE 5BVEA 3BGZA 1URWA 4EQUA 4E7WA 5JRQA 1M14A 2YERA 1SYKA 4BDCA 2B9FA 3FLYA 5CAPA 2OIQA 5HD4A 1ZLTA 2VTHA 2VTPA 3LFFA 3FY2A 4BIBA 2W1GA 3TZ9A 4I5CA 4ACDA 4OTGA 3FKLA 4QP4A 3GU7A 3U6IA 4QP6A 4YSJA 3DV3A 3ZONA 3LMGA 4O6EA 4YTFA 4DBNA 4ZXTA 2RG6A 5KMKA 3PXYA 3DZQA 3EQCA 4M14A 3HRFA 4G5JA 4GSBA 2E9NA 3VW8A 3VWAA 3PG3A 4EOPA 3HMIA 5BYYA 3OF0A 4I6HA 2VTOA 2OXXA 4ALUA 5H8GA 2XNOA 4MF0A 2V5QA 1YXUA 3TG1A 5IG1A 4BTFA 3UNZA 3GGFA 3VS1A 1R39A 3LM0A 3SDJA 3PPKA 5E91A 3ZO3A 4CMUA 1ZY4A 5HTCA 4QTCA 3U4WA 4FSRA 1U54B 2ZV2A 4O0YA 1P14A 2C0OA 3LXNA 2A1AB 3FZRA 4NZWB 1GNGA 4WNPA 3ORLA 3RWQA 2WPAA 3AC5A 3TIYA 3D5UA 4R5YA 5HNGA 1PMVA 3MVMA 5ETIA 5KKRB 1FVTA 1CMKE 3BHYA 4DHFA 4HVSA 2OH4A 4FC0A 5T6KA 2Y6MA 3OT8A 2J0MB 4E5AX 2R7BA 2XEYA 4J53A 4PDPA 4M8TA 4TN6A 3KCKA 4XP3A 4FTAA 5HG7A 3RAWA 3UIUA 5HOAA 3VS6A 3LVPA 3ZH8A 3BWJA 4KBAA 2WQMA 3LXLA 3MDYA 3VBYA 3MBLA 3UPZA 1ZWSA 4OTWA 2BZJA 2QQ7A 3NR9A 3NUSA 3AC4A 2BIYA 4OR5A 2PVKA 3HA6A 4WHZA 2OBJA 4L01A 4YZ9A 3EQIA 1H07A 3I5NA 3OY3A 4USFA 2QLQA 4D28A 1PMEA 5KE0A 5EOBA 3VS7A 4FKQA 2VTSA 2X7GA 2W99B 3R01A 4D1ZA 1F0QA 2W4JA 2X6DA 3V51A 5K4JA 5E7RA 3MB7A 4L6QA 1OVEA 5I4NA 4ZSAA 5DR6A 4IZ7A 3I0QA 1YHSA 4JIAA 5FLFA 4AT3A 5AADA 3QD2B 4QQTA 4S2ZA 3TJCA 2Y7JA 3U6JA 4IQ6A 4IVDA 4MBLA 3SHEA 3G0EA 3A60A 3F3WA 2XIKA 3U6HA 3IKAA 4NCTC 4TZRA 5CAOA 1WFCA 3PWYA 3EFJA 3P7AA 4JBPA 2E9VA 3OWPA 3R30A 3FPMA 2WTCA 4FV9A 5L6OA 4ZJIA 2OZAA 1OIRA 4D58A 3Q9ZA 2CKEA 4I6FA 2VGPA 3DB6A 3WF6A 4X6RA 4HPTE 1W84A 3ZUVA 3QTXA 3VS0A 4F4PA 3VS5A 3HYHA 3NNUA 4K9YA 4QQJA 3HUBA 1UNHA 3PA5A 4RT7A 3M11A 3TJDA 3UOJA 3LFAA 3FHRA 4UV0A 1DAYA 1LUFA 4U42A 2YISA 2OFVA 3DLZA 4MXAA 4KIKA 4TYHB 4B7TA 1GIJA 4FSYA 3Q6WA 2KTYA 4LGHA 2R3HA 1JSTA 3F5GA 4U40A 4DCEA 4BTJA 1RW8A 3L9LA 4BDIA 3Q60A 4I5MA 4EORA 3DCVA 2CN5A 1P5EA 2Y0AA 3T9IA 4RX9A 4S34A 4Z16A 2WKMA 5J9ZA 4UYNA 2HELA 5EW8A 2YIQA 4XG3A 4RZVA 2BMCA 4ERKA 3NAXA 5LVOA 3PUPA 4UWCA 5CS6A 4IC7A 2I1MA 3SRVA 1H26A 2R3IA 5K0KA 4HCVA 2UW8A 4OTDA 5DHJA 3UJGA 4D0WA 3GT8A 1G5SA 2UUEA 3VHEA 3O7LD 2J9MA 3QYWA 5HG9A 2YN8A 3S95A 1XKKA 5ITAA 3QLFA 4JXFA 3JVRA 3VBVA 2QG5A 5A4LA 3AQVA 3CY3A 3FXZA 4DH8A 5HD7A 3EN6A 3U9NA 2WHBA 3TIZA 5EDRA 2EB2A 3QCXA 5KUPA 4UY9A 5IU2A 1WAKA 2RG5A 1OL6A 2OWBA 2YDIA 2XJ0A 3TNIA 5I9YA 2OJ9A 2LAVA 2FSMX 2VRXA 2BTRA 2IN6A 3EB0A 1UU7A 5FP5A 4IANA 4KIQA 2HZNA 3LFSA 4TYEA 1WCCA 4GS6A 3TEIA 3UE4A 5IDNA 2IW8A 4L67A 4MNEB 3R6XA 3KXMA 2BRGA 2V7OA 4HYHA 5E8SA 4A4XA 4FYNA 4GEOA 5CSHA 3P9JA 5HI2A 5CANA 2IWIA 5HNBA 5ANJA 4E6QA 4K8AA 4OBOA 2ZV8A 4WG5A 4B8MA 5DN3A 2OJIA 5DRBA 2C6DA 2YLEA 4E5BA 4QO9A 1H28A 3L8SA 5E8UA 4OTRA 3OW4A 3BLHA 4PTEA 1M2PA 3HX4A 2Q0NA 3NYOA 3RJCA 2GHMA 2JDVA 2OIDA 5AR3A 5IZFA 4YZNA 3P7CA 4NJ3A 2R3PA 3F5XA 2C6TA 4E20A 5C26A 5IEXA 4FV1A 1UWJA 5G1XA 1JSVA 4PUZA 1IEPA 3FI3A 3NCZA 5FM2A 4E73A 4Q2AA 4FNWA 4FZFB 4G3GA 4RMZA 3KXZA 2CGWA 4B8LA 4WNMA 3MB6A 4ZS0A 1Q8UA 2Y4IC 5KZ0A 1UV5A 4YZDA 3DBEA 2GNGA 3PSBA 4FOCA 1K3AA 3D14A 3FL4A 5C8NA 3DPKA 5JGAA 2QOQA 4UMRA 5AV4A 3JY0A 4ZSLA 4YURA 1KV1A 2C5VA 3IONA 3PE1A 4YC6A 3UOLA 5HHWA 2VWZA 4RIWA 3R04A 2GNJA 4QMXA 4CKRA 1H25A 3KFAA 3MTLA 5M55A 3TV6A 3DDQA 4XMOA 4EUUA 5CSVA 3ANRA 4D9UA 4H39A 1XBAA 3EQPA 3DK6A 4PX6A 1ZOEA 3VF8A 4F64A 5CEPA 5M4IA 4TWPA 3R7UA 2YM5A 3GNIB 4MXYA 3EQRA 3TZ8A 4ENXA 5C8MA 4ZZMA 1VYWA 2JBPA 1JPAA 1PMNA 3D5XA 3GC9A 3RWPA 3LLTA 4RWLA 1KE7A 2BRMA 4L44A 4EYJA 3R8VA 4JBOA 4G31A
chains in the Genus database with same CATH topology
2A98A 1W2DA 2IEWA 4O4DA 1W2FA 4O4FA 1TZDA 1W2CA 2X0PA 4O4BB 4O4CA 2AQXA 4O4EA 2X0OA 2IF8A 2X0QA 4FRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A98 A;  1W2D A;  2IEW A;  4O4D A;  1W2F A;  4O4F A;  1TZD A;  1W2C A;  4O4B B;  4O4C A;  2AQX A;  4O4E A;  2IF8 A;  4FRF A; 
#chains in the Genus database with same CATH topology
 2QVS E;  3V6R A;  5A4Q A;  2CHL A;  2NO3 A;  3F61 A;  4XBR A;  3COK A;  2VTT A;  2LGC A;  3GVU A;  4FIH A;  2G1T A;  5TE0 A;  3Q9W A;  2W06 A;  3ZMM A;  4JT3 A;  5J9Y A;  3D4Q A;  5FRI A;  3SX9 A;  4L43 A;  2VTN A;  2UZT A;  5I9W A;  3EID A;  5GZ9 A;  3CD8 A;  2HW6 A;  2WMQ A;  5EOL A;  4AUA A;  3FSF A;  2VWB A;  2VV9 A;  4QMM A;  4D2W A;  4BYJ A;  2OO8 X;  4BVU A;  3HDM A;  3TN8 A;  3FC2 A;  4USD A;  5I3R A;  3IQ7 A;  3NUU A;  3QD4 A;  4FVP A;  3QUE A;  1U54 A;  1IRK A;  4LMN A;  1O6L A;  4O22 A;  2JIT A;  2ZVA A;  4BC6 A;  4UMP A;  4CYJ A;  4G16 A;  5AP3 A;  5BMS A;  3RIN A;  2X8D A;  4GV1 A;  5BUE A;  4EC9 A;  4A9R A;  4GG7 A;  2W5H A;  2J6M A;  1A06 A;  4W4W A;  5BUI A;  1QPC A;  5GZA A;  1MP8 A;  2C3I B;  3TKH A;  5AV0 A;  3A61 A;  5TO8 A;  4GK3 A;  1CM8 A;  2AQX A;  5CAS A;  3T3U A;  2WQO A;  2PVJ A;  2F49 A;  2YIX A;  2XNB A;  3F2N A;  3LCD A;  4QYE A;  4XG4 A;  2BKZ A;  4QML A;  5CEI A;  3VO3 A;  1EH4 A;  1PXJ A;  4BBM A;  3D7T B;  4JAJ A;  2P2H A;  5A46 A;  3TZ7 A;  2XNE A;  4TWN A;  1MRY A;  3ZLW A;  5AP5 A;  3ZEW A;  4F6U A;  4RJ5 A;  4CXA A;  3R0T A;  3RKB A;  3KMU A;  3I60 A;  3BU5 A;  3W8Q A;  4GFO A;  4G6N A;  3RPV A;  4ZLO A;  1P4O A;  5M57 A;  4R3C A;  3NX8 A;  2JKQ A;  4M0Y A;  4NEU A;  5CT7 A;  4IWQ A;  4ANQ A;  2UZL A;  4ASZ A;  4EK6 A;  3D2K A;  2XCH A;  2B4S B;  5F20 A;  2OF2 A;  4YU2 A;  4M12 A;  3IOK A;  1KE5 A;  3UPX A;  3VS3 A;  4IB0 A;  3JXW A;  3C1X A;  1Y6B A;  5C01 A;  5L2I A;  4PTC A;  3W2R A;  5CEK A;  2UW5 A;  3Q4Z A;  4RIO A;  4RLK A;  1YW2 A;  3MY5 A;  4MNF A;  3I79 A;  2OIB A;  4BDG A;  4I0T A;  5LXM A;  4M97 A;  3M1S A;  4MH7 A;  3V5J A;  3MYG A;  3QZG A;  2I6L A;  4OT5 A;  4QPA A;  4EQM A;  4QRC A;  4UWB A;  4X6Q C;  5ANE A;  4BTM A;  1PF8 A;  3OCB A;  2C30 A;  4JNW A;  3NYV A;  5CSP A;  3DU8 A;  4APP A;  4ITI A;  3UG2 A;  2QON A;  3R8U A;  4QQC A;  4XV1 A;  1LR4 A;  4AN2 A;  3ORM A;  5HIB A;  2JIV A;  3JPV A;  4CFW A;  4ZLY A;  4XBU A;  1YXS A;  2XA4 A;  4Y5Q A;  2Y4I B;  4AOT A;  2W1I A;  5IA1 A;  4XOY A;  1U5Q A;  5EI8 A;  5DNR A;  5JFS A;  4HGT A;  3MFS A;  2JED A;  5BYZ A;  4DFZ E;  4TYH A;  4QNA A;  4F70 A;  5IA5 A;  2BVA A;  3C4X A;  4K18 A;  4II5 A;  2HK5 A;  3PFQ A;  4EK8 A;  4L3J A;  3KCF A;  4J7B A;  4NM0 A;  5EH0 A;  3R83 A;  4JR3 A;  3QD0 A;  2CJM A;  2VO3 A;  4U41 A;  4ZJV A;  3TKU A;  3PXK A;  4M69 B;  1HOW A;  4F9C A;  4RGJ A;  4PL3 A;  1SVE A;  1S9J A;  4CV8 A;  1Y6A A;  2FA2 A;  1OIQ A;  2C6K A;  1Q8W A;  1OL5 A;  3VN9 A;  1W8C A;  5CAU A;  2WMU A;  4WT6 A;  1WBN A;  4JX3 A;  4AOI A;  4C57 A;  1FGK A;  2R9S A;  1Q3W A;  4ZTQ A;  4FTU A;  2RFS A;  2XMY A;  3RNY A;  2GS7 A;  1HCL A;  2X7O A;  4RVK A;  3TXO A;  2YCS A;  4D9T A;  3FUP A;  4FV0 A;  5E8X A;  3ZFM A;  4BCI A;  2W0J A;  3AMY A;  4YLJ A;  5LQF A;  2OIC A;  3CQW A;  2R3F A;  3F3Z A;  3L8X A;  5HGI A;  3TT0 A;  4Z7G A;  3CPC A;  3R9H A;  4CFM A;  1NY3 A;  5HE0 A;  3K2L A;  2O3P A;  3R9D A;  1R3C A;  4AZV A;  3WIL A;  1Z57 A;  3CTQ A;  1S9I A;  4ZZO A;  3BQC A;  5M53 A;  4CYI A;  5DFP A;  4TND A;  5IH6 A;  3A8X A;  4J52 A;  3KEX A;  5E8V A;  2X81 A;  4WIH A;  2F4J A;  2PE2 A;  4WG3 A;  5IMX A;  2YDJ A;  3GP0 A;  4MNE A;  5L2T A;  2HCK A;  4FTR A;  3ZSH A;  5LWM A;  2VO7 A;  4CQE A;  2B1P A;  3BLR A;  3NCG A;  3R9O A;  2YDK A;  3EJ1 A;  3EQB A;  4ANM A;  4F65 A;  4YTC A;  4WRG A;  3KXG A;  4MX9 A;  2QNJ A;  3VUG A;  4KNB A;  4E4X A;  2J0L A;  3R8P A;  2CLQ A;  4HCU A;  4D1X A;  4R6V A;  4FVR A;  4OAU C;  2RL5 A;  5EKO A;  4TW9 A;  4EHV A;  2WMW A;  4U81 A;  2VTI A;  4RX8 A;  3UTO A;  2ETR A;  4YLL A;  5TF9 A;  1V1K A;  4BWP A;  5DVR A;  2B9I A;  2GQG A;  3LCS A;  2DYL A;  4E93 A;  4DH5 A;  3LPB A;  4R5S A;  4UYA A;  3RVG A;  1OIT A;  2Y9Q A;  2J5F A;  4PNK A;  1F3M C;  2PVF A;  3WF7 A;  4AA4 A;  1GJO A;  4IVC A;  2CN8 A;  3R7E A;  4DEG A;  4QMY A;  3ZDI A;  4G34 A;  5CU6 A;  5DE2 A;  3QF9 A;  3Q9X A;  5JGD A;  1FVV A;  4ERW A;  4FSZ A;  2ZV9 A;  3W2P A;  5M4C A;  5TKD A;  4DLI A;  4U0I A;  3FDN A;  1VJY A;  5D7V A;  4LRJ A;  3ZXT A;  4BKY A;  4E1Z A;  4B9D A;  2UW4 A;  3AD4 A;  1QCF A;  4KB8 A;  4KSQ A;  3ROY A;  4D2S A;  1PXP A;  4BCM A;  2O63 A;  2CGX A;  3CTJ A;  3MI9 A;  3IW5 A;  5CAL A;  5J5S A;  2OF4 A;  3OCG A;  4GH2 A;  1QMZ A;  4O96 A;  4PF4 A;  4XV3 A;  4QMU A;  3UYT A;  2ZAZ A;  3CD3 A;  3K3J A;  3PG1 A;  4N4S A;  3T3V A;  3ZRM A;  3RI1 A;  5JH6 A;  3TV4 A;  5CEN A;  4DC2 A;  4L9I A;  3KVX A;  1PJK A;  4A9T A;  2QHN A;  2J5E A;  4BIC A;  3NLB A;  4RA5 A;  4F6W A;  5BVN A;  4F7S A;  4FIF A;  4FNY A;  5AP2 A;  4F63 A;  2JFL A;  1W2C A;  4MF1 A;  5EW3 A;  4FSM A;  4L7S A;  3DGK A;  2YAC A;  5LMK C;  1JKK A;  4YO6 A;  4O21 A;  2XJ2 A;  1PYE A;  3HV7 A;  4KA3 A;  4PL4 A;  4O4B B;  5HG8 A;  4HZS A;  4L45 A;  5HVJ A;  4L3P A;  4LRM A;  5EKN A;  3SOA A;  3Q53 A;  4YJS A;  3EHA A;  3DB8 A;  4DEB A;  3LCT A;  3ZM4 A;  4HZR A;  4BCH A;  3GC8 A;  4PV0 A;  5I0B A;  4ENY A;  4LOQ A;  3QRJ A;  4GG5 A;  4KIN A;  2W7X A;  3FLZ A;  4AWI A;  1IA8 A;  3FLN C;  5A9U A;  3ITZ A;  4CT1 A;  1YOJ A;  4C61 A;  5C03 A;  1DI8 A;  1ZXE A;  5CSW A;  1JSU A;  2IJM A;  3KRW A;  3DNE A;  2YAK A;  1UU9 A;  3NRM A;  2R3M A;  1H1S A;  2VNW A;  3ERK A;  1XBB A;  3KRX A;  2C3K A;  4JG8 A;  4O0W A;  3D7Z A;  3FML A;  4JBV A;  3QWK A;  5EYC A;  4FV7 A;  4GVA A;  1CKI A;  2V0D A;  1VZO A;  4AN3 A;  2RFD A;  3E5A A;  3KC3 A;  2IZU A;  3D7T A;  3MY0 A;  2PZP A;  4C3P A;  3V6S A;  2XKF A;  3MFR A;  2BR1 A;  2XM9 A;  2VWI A;  2G2H A;  4D4S A;  4IW0 A;  3PXZ A;  4PMT A;  2R5T A;  4J71 A;  4W9W A;  3OD6 X;  4G3E A;  4JG7 A;  1QPJ A;  4JDH A;  4KSP A;  2UW9 A;  3RP9 A;  5LCJ A;  3C4F A;  3R8Z A;  3NUX A;  3R7G A;  4EC8 A;  4GUB A;  4QTE A;  3WYX A;  2ITX A;  3WZU A;  2PUU A;  4EOI A;  5KHW A;  4JX7 A;  3OMV A;  4X7Q A;  5E92 A;  2J7T A;  3L8V A;  4JS8 A;  4M67 A;  4YMJ A;  3NAY A;  1E9H A;  1LP4 A;  5J7H A;  3KMW A;  1YKR A;  2YIW A;  4FMQ A;  4O4C A;  4MVF A;  4EZ3 A;  2QOL A;  3FLS A;  1SVG A;  3A4O X;  3BZ3 A;  5AX3 A;  3QXP A;  4U80 A;  1WBW A;  1YI3 A;  1L3R E;  3QQK A;  3ORT A;  2F2C B;  2JIU A;  3WE8 A;  4F7L A;  3CP9 A;  5LCK A;  5IME A;  2VX1 A;  2C6E A;  3ACJ A;  3KN5 A;  2XUU A;  3A7F A;  2FH9 A;  5J95 A;  3R1S A;  2R3Q A;  3TUC A;  3UDB A;  3WZD A;  3AT2 A;  3K5V A;  4WD5 A;  4NT4 A;  3NUY A;  4IAA A;  1VYZ A;  2B52 A;  4F9W A;  1B38 A;  3ZSG A;  1CSN A;  3I81 A;  4YNE A;  3PXR A;  4BCJ A;  5ACB C;  1RQQ A;  5IEY A;  3DKG A;  3ET7 A;  3I7C A;  3OWL A;  2BPM A;  2XK3 A;  3VHK A;  3QFV A;  2YJR A;  2W5B A;  2P3G X;  3PVG A;  3L9M A;  4AT5 A;  4BBF A;  4MWH A;  3IGG A;  3ZO4 A;  4EOS A;  2IVV A;  4XS2 A;  4YPS A;  2OK1 A;  4X2K A;  5AV2 A;  4F08 A;  3ORX A;  5LVN A;  3LAU A;  2XIX A;  4E5W A;  4X0M A;  4EBV A;  3R9N A;  4MXC A;  5I9V A;  3RK9 A;  4ACH A;  4CCU A;  3UOK A;  2EWA A;  3ZUT A;  3FXW A;  3BU3 A;  1PW2 A;  4RX7 A;  1ZYD A;  5FXR A;  2B9H A;  4M69 A;  2XYN A;  4BGG A;  3DKO A;  4EEV A;  1QPE A;  3IW7 A;  3S1H A;  3R28 A;  3QQG A;  2J4Z A;  3VUK A;  3L9N A;  3QGW A;  4UB7 A;  4EUT A;  1H01 A;  2QOK A;  2X0O A;  4R8Q A;  3TUD A;  2XRW A;  4WNO A;  4YTI A;  5KBR A;  3NW6 A;  4BCO A;  5JZJ A;  2R3G A;  2ITU A;  1RE8 A;  2WU7 A;  3CQE A;  3BGP A;  2QUR A;  4AA0 A;  4TYG A;  2WQB A;  3EH9 A;  3OXZ A;  2ZM4 A;  1OKW A;  2WOT A;  3ZCL A;  4F9A A;  5HX8 A;  5L8K A;  1QPD A;  3NS9 A;  4O0R A;  3KXN A;  5HLP A;  3V5L A;  1W2F A;  1Q8Y A;  1WZY A;  4EWH A;  4HGL A;  3VQU A;  5CNO A;  4BFM A;  4F1T A;  2WFY A;  4UWY A;  5HE1 A;  3I1A A;  3P79 A;  3R7O A;  2X9F A;  1GZK A;  4E3C A;  5CXZ A;  4WUA A;  1SNX A;  1XQZ A;  3VUM A;  4C38 A;  5M56 A;  2XK6 A;  2ZB1 A;  4CCB A;  4FIE A;  4IB1 A;  1MRU A;  2E9U A;  4Q5E A;  4WUN A;  4BGQ A;  5BVO A;  3GQL A;  4YZB A;  5IEV A;  3PA3 A;  2W1D A;  3PWD A;  2FSO X;  2J50 A;  4HYS A;  3BQR A;  4C35 A;  3G6G A;  1E1V A;  3W16 A;  3OOG A;  3QTZ A;  4ASX A;  1ZRZ A;  5A54 A;  3GXL A;  3MY1 A;  4O2Z A;  1M17 A;  3PIX A;  4YP8 A;  4U8Z A;  4FKT A;  2YHV A;  1Z5M A;  2VWW A;  3RK5 A;  5AR4 A;  4IBM A;  3V8W A;  3W2C A;  3UVQ A;  5A14 A;  3ZHP C;  4U9A A;  4TXC A;  5IUI A;  2ZYB A;  3CBL A;  4EYM A;  4CSV A;  4FSN A;  4Y5H A;  4HJO A;  4C2W A;  5AAE A;  4I22 A;  4XLV A;  4BCF A;  2QOH A;  4JBQ A;  3HEG A;  4S33 A;  4EH3 A;  3DXN A;  3R02 A;  4TYI A;  4MYG A;  4YC8 A;  5AM6 A;  5KNJ A;  3QTQ A;  2Z60 A;  3OTU A;  3EFL A;  4LOP A;  2G2I A;  2X39 A;  4C36 A;  4BZO A;  1R1W A;  3QGY A;  2G01 A;  3AD5 A;  3V8T A;  5L4Q A;  4BID A;  2XK8 A;  3WIG A;  3QLG A;  5J79 A;  4FSU A;  4XRL A;  1LEZ A;  2OFU A;  2PSQ A;  1BL6 A;  5HZN A;  4XV2 A;  3EL8 A;  5GJD A;  1J91 A;  4IB3 A;  5J1W A;  4FSQ A;  2VX3 A;  3PYY A;  2Z7Q A;  4GT5 A;  1ZYS A;  4BBE A;  1JNK A;  2NRU A;  2VD5 A;  3MH1 A;  3D83 A;  4K2R A;  4NU1 A;  4ACM A;  4FKJ A;  3QA0 A;  3DBQ A;  3OEF X;  3HVC A;  5DG5 A;  3ZLX A;  5AIK A;  3P4K A;  1FQ1 B;  3PRF A;  4CFV A;  3PVU A;  4D5K A;  4EKK A;  4EOK A;  4JQE A;  3LW0 A;  5AUX A;  5FD2 A;  5JFV A;  5BVK A;  3H9O A;  4NJD A;  2BZI B;  3BE9 A;  4FUY A;  4EH8 A;  5AA8 A;  4I21 A;  4PPA A;  2W05 A;  2WEI A;  4FTN A;  2QD9 A;  5HLW A;  1OM1 A;  5I9X A;  2REI A;  2UZO A;  3FC1 X;  4I93 A;  3WBL A;  4DEE A;  1OKV A;  4H3B A;  5ICP A;  5ETA A;  4EI4 A;  3FXX A;  3L8P A;  4G2F A;  4V05 A;  4NW6 A;  3UO4 A;  4FRF A;  3EFW A;  3M2W A;  3WAR A;  5AJQ A;  3Q5Z A;  4ITJ A;  3FHI A;  5BMM A;  3EN9 A;  3R1N A;  4DH1 A;  2PVM A;  5AA9 A;  3CXW A;  3O8U A;  3P1A A;  5HE2 A;  3UNK A;  4S30 A;  4XG9 A;  2C6M A;  2QU6 A;  2JAM A;  4NIF B;  4QMS A;  2VU3 A;  3DK7 A;  5IA3 A;  2CMW A;  3QKM A;  3P7B A;  4C4F A;  2OH0 E;  3BHH A;  2HW7 A;  5CVF A;  4LOO A;  4FT0 A;  4ALV A;  4IWP A;  3B8Q A;  5KX8 A;  3UC4 A;  4ONA A;  5K0X A;  3OWJ A;  5EK7 A;  3RPO A;  4H1M A;  4N0S A;  2ZDT A;  3F3U A;  3FYJ X;  3GUB A;  2YM4 A;  4KIP A;  4X21 A;  1PHK A;  4QYH A;  5EW9 A;  5TOZ A;  5TT7 A;  4A7C A;  2JDT A;  3MA6 A;  3QTI A;  4FOB A;  3UNJ A;  2CPK E;  2IVS A;  3FZS A;  3KK8 A;  4KS8 A;  5CI6 A;  5JGB A;  3S00 A;  2O5K A;  2I0H A;  3HA8 A;  4BKJ A;  2HY0 A;  1MUO A;  5J87 A;  2E9O A;  2H8H A;  4QP9 A;  2ITV A;  4QP8 A;  4PPB A;  3SW7 A;  1XH5 A;  4M0Z A;  3VBW A;  5KBQ A;  2Z7R A;  5EDQ A;  5M4U A;  4F9Y A;  4JIK A;  4QMT A;  3SC1 A;  4ZAU A;  4FT5 A;  5JFW A;  2H34 A;  1FPU A;  2XB7 A;  3I5Z A;  3E63 A;  3CKX A;  4QYF A;  2FST X;  3DJ5 A;  4JL9 A;  4O6L A;  4RC4 A;  4BDA A;  2ITP A;  4PRJ A;  1GZN A;  2WD1 A;  1YXV A;  3FI2 A;  4ANO A;  4E6A A;  1Q97 A;  1WVX A;  4Y73 A;  5JQ8 A;  2WNT A;  3NUN A;  4IWO A;  5JZN A;  2WMS A;  4CZY B;  3DA6 A;  5T68 A;  4GFM A;  1WVY A;  1Q5K A;  4J97 A;  4AOJ A;  3NWW A;  4D2T A;  3F7W A;  3BBW A;  3Q9Y A;  5EYK A;  3ENM A;  2XZS A;  4N6Y A;  2OJG A;  3KUL B;  4BHN A;  2EVA A;  4FL3 A;  4H36 A;  5ETF A;  2YJS A;  3LFB A;  1JOW B;  5B2L A;  2WMT A;  3F5U A;  4IM3 A;  5CVG A;  5IPJ A;  5L3A A;  3S4Q A;  4G6L A;  4FG8 A;  3SXR A;  2HZ4 A;  4GJ3 A;  3UOH A;  4LGG A;  2O64 A;  3C4E A;  2VWX A;  5I3O A;  3VVH A;  2JLD A;  2UVZ A;  4X3J A;  4O0X A;  3RCD A;  3DOG A;  4IZ5 A;  3DDP A;  4BDK A;  3P5K A;  5FG8 A;  2WB8 A;  4AW0 A;  4AT4 A;  3OHT A;  3R63 A;  5M51 A;  1A9U A;  4JDJ A;  4YTH A;  1AGW A;  3C5U A;  3GU5 A;  4X2N A;  4B99 A;  4U79 A;  3CLY A;  4AZT A;  4YSM A;  2CDZ A;  4RVT A;  5D10 A;  5KMI A;  3C0I A;  5JSM A;  3POZ A;  3QCQ A;  5H8E A;  4EH5 A;  2BIL B;  2C1B A;  4XG8 A;  3EOC A;  2C5N A;  2ONL C;  2X2L A;  2BDJ A;  2JBO A;  3CE3 A;  4Q9S A;  2XVD A;  5EI2 A;  3HV6 A;  1OPK A;  1ZZ2 A;  3HP5 A;  4CNH A;  1REK A;  2VTJ A;  4RWK A;  4DN5 A;  1YDR E;  3UZT A;  4EBW A;  4QD6 A;  2Q0B A;  3FQS A;  2UW6 A;  4MQ2 A;  4TT7 A;  4LYN A;  5DT4 A;  2XIZ A;  3EN5 A;  3E64 A;  3H0Z A;  3IDB A;  2OZO A;  5JMS A;  1H1W A;  2R4B A;  5FWK K;  3E3B X;  4IJP A;  2EUF B;  4KBC A;  4QP3 A;  4R7I A;  2W4O A;  3F9N A;  4NFN A;  1BKX A;  3O8P A;  3PLS A;  2PVL A;  3PSC A;  4PDO A;  2X8I A;  4QMO A;  5K9I A;  2PML X;  5B0X A;  2GHL A;  3P86 A;  4E6D A;  2WQE A;  4C2V A;  3A7J A;  4OGR A;  3R2B A;  1NVR A;  5FXQ A;  3RPY A;  5DBX A;  3MPA A;  3VC4 A;  3FZ1 A;  4C59 A;  5LMK A;  2XKD A;  3DTW A;  3DQW A;  3EQH A;  3LFQ A;  2PE0 A;  3ODY X;  2FO0 A;  2PK9 A;  3KF4 A;  4F1M A;  5DWR A;  2WZJ A;  3BV3 A;  3U51 A;  4G3C A;  4Q9Z A;  4FK3 A;  3FLQ A;  1WBV A;  3O96 A;  4GT4 A;  4JQ7 A;  4RX5 A;  1MQB A;  2VTM A;  3QX2 A;  3RPS A;  4NH1 A;  5GJG A;  3PXQ A;  2YAB A;  2RKU A;  3L9P A;  5A3X A;  3TNW A;  3DFC B;  3QRK A;  5CVH A;  3UP2 A;  3WE4 A;  3Q3B A;  4HGE A;  3VF9 A;  4D2V A;  5LJJ A;  1JKL A;  4M13 A;  3D0E A;  5T3Q A;  5L6P A;  2QHM A;  1SM2 A;  4IAF A;  1ZOH A;  3ZEP A;  1V0P A;  4DFY A;  2ACX A;  3G2F A;  2JKM A;  2W9Z B;  2WEL A;  4BDB A;  5L6W L;  5A4E A;  4CFU A;  3B8R A;  5FM3 A;  4U43 A;  2WMB A;  1XR1 A;  3IPH A;  2B9J A;  3ZC6 A;  4Y8D A;  2EXM A;  4E4M A;  3KN6 A;  4IC8 A;  4CRL A;  2F2U A;  4L53 A;  3MVH A;  1J1C A;  3F6X A;  3UQG A;  3DZO A;  3HV4 A;  2UZU E;  5EHL A;  1CKJ A;  2BHE A;  3VW6 A;  2QI8 A;  2QR7 A;  5EG3 A;  5DPV A;  2ESM A;  4CQG A;  5H2U A;  4F6S A;  3KMM A;  3NEW A;  3JS2 A;  3AMB A;  5AUU A;  5HTB A;  5L2W A;  4L8M A;  4CVA A;  4IFC A;  3FPQ A;  4AZF A;  2ZJW A;  4NM5 A;  5AV1 A;  1DAW A;  4FUX A;  1GY3 A;  1B6C B;  2WTW A;  4MBJ A;  1OEC A;  4AW1 A;  1JVP P;  3CEK A;  4L68 A;  2ZMC A;  1OKY A;  5I9U A;  4ZTM A;  5A6O A;  5LWN A;  3C7Q A;  3LJ0 A;  3GEN A;  4D5H A;  3A7I A;  4I3Z A;  5HID A;  2HWP A;  1FMO E;  2PE1 A;  3RHK A;  1UWH A;  1B39 A;  4S31 A;  5EM8 A;  1JQH A;  3NIE A;  5HVK A;  2X2K A;  4DGM A;  4CFX A;  2UV2 A;  3BEG A;  1BLX A;  4LUE A;  2OKR A;  4IDV A;  2H9V A;  4RSS A;  2P55 A;  4FNX A;  3SA0 A;  1H0W A;  2ITN A;  4BIE A;  3WF9 A;  3RTP A;  4DEA A;  2I0V A;  2XNN A;  2JAV A;  4JDI A;  5J5T A;  1JAM A;  3BYS A;  1OL2 A;  3COH A;  5JEB A;  4OTI A;  4HYI A;  1UA2 A;  4F7N A;  4CFF A;  4AS0 A;  3D5V A;  5FED A;  5JK3 A;  4LL0 A;  4RVL A;  2A98 A;  2OI4 X;  2HXL A;  5DR9 A;  4NK9 A;  2A2A A;  1T45 A;  1XH4 A;  4R1Y A;  2B53 A;  1BUH A;  4I4E A;  3MVL A;  4XUF A;  5IIS A;  2E9P A;  1OB3 A;  4C3F A;  5AUV A;  3DS6 A;  3ORI A;  2PTK A;  3R7I A;  4FIG A;  4NIF A;  1SVH A;  2G9X A;  4GIH A;  3UO6 A;  4IE9 A;  4YC3 A;  5D41 A;  2W1H A;  4YNO A;  5HE3 A;  3E93 A;  4FII A;  2XK9 A;  1ZAO A;  4OBQ A;  3U9C A;  1BX6 A;  3E62 A;  1Q8Z A;  1VR2 A;  2IZR A;  4U3Z A;  5JRS A;  4XEY A;  4DED A;  4RIX B;  1VEB A;  3GCU A;  3H4J A;  2R3L A;  3GQI A;  4FL1 A;  4DFN A;  2H96 A;  1Q4L A;  3QQF A;  3QTU A;  4RIY B;  4YZC A;  4ZOG A;  4U45 A;  5AP7 A;  1W83 A;  2R3K A;  2Z2W A;  2VWY A;  2WMV A;  1TZD A;  3E8N A;  3PZE A;  4XX9 A;  4QMW A;  3KK9 A;  4LRK A;  1G3N A;  3CGO A;  3GCQ A;  4A9S A;  4AA5 A;  2WTV A;  4WBO A;  5L8J A;  4C4H A;  2ZM3 A;  3PE2 A;  3GU4 A;  3NUP A;  1K9A A;  4I41 A;  4CT2 A;  3WZE A;  3JVS A;  4L52 A;  3BEA A;  1K2P A;  5K3Y A;  5CF4 A;  1H8F A;  3G0F A;  3FKN A;  3NYX A;  1Y8G A;  4FTK A;  2HAK A;  1FVR A;  3OT3 A;  4IH8 A;  3FI4 A;  3NGA A;  3ORP A;  1KSW A;  4EH4 A;  5AAG A;  3FAA A;  4XNE A;  5AV3 A;  2WTK C;  4YJR A;  3LXK A;  1GAG A;  4TNB A;  4FI1 A;  5AUW A;  4C8B A;  3HUC A;  2ITQ A;  2IZT A;  3MVJ A;  4EH7 A;  3KUL A;  5HVY A;  5HQ0 A;  3EMG A;  3DQX A;  1PXM A;  2GFC A;  4ZJJ A;  3TCP A;  2WMX A;  4D2P A;  5C1Q B;  1OIU A;  4RJ6 A;  5DT0 A;  3OUK A;  3UQF A;  3T9T A;  4I92 A;  3OWK A;  4ZTN A;  2YM8 A;  3UC3 A;  3WF8 A;  4YBK A;  4Z3V A;  3FMD A;  4OAV B;  3DBC A;  2GDO A;  3AOX A;  4XH6 A;  3UO5 A;  4IM0 A;  1OGU A;  2ZOQ A;  3PIY A;  1XJD A;  4BN1 A;  1YVJ A;  5JFX A;  4C02 A;  3IDP A;  3FMH A;  5CEQ A;  4DAW A;  3VBQ A;  4AN9 A;  1WMK A;  4U3Y A;  3C0H A;  3LM5 A;  4HNF A;  4IVA A;  3CPB A;  3AGM A;  3DTC A;  2BHH A;  4UAL A;  4W4Y A;  4BDJ A;  3FYK X;  3W2Q A;  1BI7 A;  3ZSI A;  3G6H A;  1BI8 A;  2PZY A;  4H58 A;  4I4F A;  5CQU A;  5DIA A;  4FV3 A;  3ENH A;  3PY3 A;  3DY7 A;  4KAO A;  4EKL A;  2XKE A;  1KOA A;  3EKN A;  5F9E A;  3GU6 A;  5IF1 A;  2FSL X;  4EOO A;  5IH5 A;  3S2P A;  4IAD A;  2CCI A;  3WZK A;  4O0T A;  4BDD A;  5FGK A;  5GHV A;  3RBW A;  3UOD A;  4RQV A;  3QRU A;  2GPH A;  2WOU A;  3MV5 A;  4BCP A;  4R3R A;  4NFM A;  4AZS A;  3IK3 A;  5J1V A;  3CS9 A;  3FZO A;  4FNZ A;  5CXH A;  3QHR A;  3O0G A;  4G3D A;  2XP2 A;  4ZY6 A;  3BKB A;  4H3P A;  2R7I A;  4MHA A;  3QZF A;  4O2P A;  5HOR A;  2YIY A;  1KE9 A;  3OOM A;  4IAC A;  4JRV A;  5B2K A;  1GOL A;  4UN0 C;  5KMN A;  3H30 A;  4NCT A;  4XJ0 A;  3VUI A;  2VTQ A;  3P78 A;  3FKO A;  4O38 A;  5EYM A;  2XK4 A;  3FL5 A;  4DFL A;  2X1N A;  4EZ5 A;  2QKW B;  4BF2 A;  4QMN A;  3E7V A;  3FV8 A;  4EK3 A;  3W8L A;  3VNT A;  4KIO A;  3W55 A;  1ZYJ A;  4IVB A;  3NNW A;  4IMY A;  2XIY A;  2WMR A;  4LL5 A;  3ULI A;  4FX3 A;  4C7T A;  1YWV A;  3LQ5 A;  3QX4 A;  4JR7 A;  3VRY A;  5L8L A;  2QOD A;  3S3I A;  4KKG A;  4ASD A;  3ZXZ A;  3BYM A;  2UZN A;  2OXY A;  2J0I A;  5EYD A;  4BTK A;  3AC3 A;  3BU6 A;  4PL5 A;  4V0G B;  5IUH A;  2VO6 A;  3KA0 A;  4EON A;  3QL8 A;  4M68 A;  4AE9 A;  2CGU A;  4FV6 A;  2C3L A;  2CSN A;  2JD5 A;  2ZMD A;  2C6O A;  3I6U A;  3UVP A;  1AQ1 A;  2UW7 A;  3GB2 A;  3MFU A;  3R21 A;  4AE6 A;  5IA2 A;  2XCK A;  3KKV A;  3VUL A;  5EI6 A;  5CAQ A;  4FZD B;  4ARK A;  4FEQ A;  3R1Y A;  3HMN A;  5HCZ A;  4GYG A;  4MD9 E;  3O23 A;  3D94 A;  3F3T A;  3QZI A;  4ZY4 A;  3HMM A;  3LHJ A;  5HO6 A;  4ZZN A;  5JN2 A;  2EXC X;  3I0O A;  4U97 A;  4ANN A;  4IEB A;  4ZEG A;  2JKK A;  2B7A A;  4BZD A;  5HES A;  4LMU A;  4XP2 A;  4V01 A;  3PRI A;  2YLF A;  3CY2 A;  4Q5H A;  3ZZE A;  5HIC A;  4W8E A;  4LFI A;  3RPR A;  3WIK A;  2H6D A;  2YEX A;  3PPZ A;  4MTA A;  4BI1 A;  3JYA A;  2XK7 A;  3WI6 A;  1YQJ A;  1H08 A;  3N9X A;  4FV5 A;  4J8M A;  4ZK5 A;  4F0I A;  3GI3 A;  4IJ9 A;  3QUD A;  3GOK A;  4FSW A;  2BDF A;  3TAC A;  4IDT A;  2GNL A;  4QYG A;  2JFM A;  4N6Z A;  4A4O A;  2W17 A;  3CJF A;  2FUM A;  3E8D A;  4WRS A;  3PTG A;  5AWM A;  5LAR A;  3R8M A;  3ZUU A;  4PP7 A;  3PY1 A;  3EYH A;  3G9L X;  3VID A;  4YUQ A;  2PY3 A;  3ZO1 A;  3U87 A;  4AW2 A;  3S0O A;  4EHZ A;  1O6K A;  3A7H A;  3FE3 A;  4TYJ A;  3W18 A;  1Y8Y A;  1FOT A;  4MAO A;  4GCJ A;  3AD6 A;  3QQH A;  1Q8T A;  3R1Q A;  3H0Y A;  3QWJ A;  5CLP A;  3W1F A;  3BYO A;  3UIM A;  1SZM A;  3PIZ A;  1W98 A;  1URC A;  4K33 A;  4IX3 A;  4NTS A;  4WNK A;  4YLK A;  5DEY A;  3KXX A;  2VWU A;  4HVD A;  5AUZ A;  4QP7 A;  4FG9 A;  4FV8 A;  5KCV A;  4YJN A;  2XM8 A;  1ZY5 A;  4FZ7 A;  1H1R A;  3FY0 A;  3EN7 A;  3C13 A;  2BAJ A;  4YJO A;  1M2R A;  4MKC A;  5KKR C;  2XKC A;  4DH3 A;  3DFA A;  2ETK A;  2R3J A;  3VS2 A;  4TL0 A;  2WEV A;  4FZ6 A;  2VUW A;  4XG2 A;  2JDO A;  3POO A;  2F7X E;  2PZ5 A;  2GU8 A;  3QC4 A;  4Y72 A;  4P5Q A;  2GSF A;  1ERK A;  4YPD A;  4BCK A;  3LFN A;  3R2Y A;  2FYS A;  4RIX A;  2GS6 A;  4ZP5 A;  3NYN A;  2F7E E;  2QOF A;  3EQF A;  4G3F A;  4RIY A;  2O8Y A;  1Q99 A;  2GHG A;  2IVU A;  3MFT A;  2ZB0 A;  3AXW A;  3BGQ A;  4TRL A;  5DT3 A;  3U8W A;  2J0J A;  5HG5 A;  5CU2 A;  3EQG A;  3E87 A;  1XHA A;  3CJG A;  4BHZ A;  5HNI X;  3THB A;  4AP7 A;  3AG9 A;  3BCE A;  2X8E A;  5F95 A;  1W7H A;  3LOK A;  2EXE A;  1ZMW A;  3BEL A;  5LMA A;  3R7V A;  2ITO A;  3AC2 A;  4BGH A;  2YWP A;  4XG6 A;  4K11 A;  5KO1 A;  4FTJ A;  4D4Y A;  3CIK A;  3COM A;  2QLU A;  5D7A A;  4UMQ A;  4GT3 A;  4G9C A;  3MN3 A;  4EH6 A;  4JI9 A;  5BNJ A;  3T8O A;  4QT1 A;  5J7B A;  1TQI A;  1ZYC A;  2C6L A;  2DWB A;  2W5A A;  3QQL A;  3VJN A;  2IVT A;  4RRV A;  3BLQ A;  3VS4 A;  3ZFX A;  5CEO A;  4IX4 A;  1YWN A;  1DI9 A;  4DH7 A;  2XS0 A;  2XYU A;  4FF8 A;  5FDP A;  4ASE A;  4EWQ A;  4QQ5 A;  4L46 A;  3EYG A;  3V5Q A;  2XNG A;  5GNK A;  1TQM A;  3M42 A;  1J3H A;  3VQH A;  1JKS A;  5DEW A;  2YCQ A;  5AAF A;  3NW5 A;  1W0X C;  2OSC A;  2BUJ A;  4ZTS A;  4F1O A;  2UW3 A;  4QPM A;  5DOS A;  2P4I A;  3TZM A;  4IAK A;  1STC E;  2RGP A;  4YJQ A;  4RG0 A;  3ORK A;  1P2A A;  4LGD A;  2R3R A;  4KS7 A;  4PDS A;  4HW7 A;  4DYM A;  4AGU A;  2ITY A;  3IW6 A;  2QOI A;  3ZOS A;  2F57 A;  1MQ4 A;  3UP7 A;  2VTR A;  4IX5 A;  3HMP A;  5JKG A;  2UVY A;  1QL6 A;  1OL1 A;  4M7I A;  3OCS A;  4JJR A;  4PY1 A;  2AYP A;  4C4E A;  4LG4 A;  2FVD A;  3TNP C;  2BRH A;  3FMK A;  1Q41 A;  3QD3 A;  2R64 A;  1ZYL A;  4O91 A;  3C0G A;  1P4F A;  4I20 A;  2ERK A;  5ANG A;  5LMB A;  1PY5 A;  4PQN A;  1Q3D A;  2BFY A;  3O50 A;  1XH9 A;  2J2I B;  3P08 A;  4WKQ A;  5CT0 A;  4UXQ A;  4W4X A;  2UVX A;  1XO2 B;  3TNH A;  4M84 A;  3EZV A;  4QNY A;  2B54 A;  2WAJ A;  4KRD A;  3KY2 A;  5KZI A;  3H9F A;  4UBA A;  4K0Y A;  3F7Z A;  3BBT B;  4FKP A;  4BDF A;  3KXH A;  4AXA A;  3C51 A;  2P0C A;  5CTP A;  5DI1 A;  4U7Z A;  1KE6 A;  2F7Z E;  3WYY A;  4I23 A;  4GFG A;  1LPU A;  4HOK A;  3RAL A;  4CFN A;  2R0U A;  3IGO A;  3NIZ A;  4AW5 A;  4F99 A;  3RNI A;  4NST A;  2V55 A;  2AC5 A;  3ALN A;  3TUB A;  4ZTR A;  2QC6 A;  2BTS A;  2PMO X;  5EM7 A;  4P4C A;  3BV2 A;  5DR2 A;  3DAE A;  5AP4 A;  4RA4 A;  2VN9 A;  3OS3 A;  3O71 A;  3C4C A;  4FK6 A;  4GMY A;  3Q52 A;  1OPJ A;  3MH0 A;  3F5P A;  3UMW A;  3RGF A;  4LM5 A;  4FTC A;  4IAY A;  3EKK A;  4X3F C;  1SMH A;  3NPC A;  2JII A;  1PKD A;  4MQ1 A;  3TTJ A;  5ANK A;  3KB7 A;  4PNI A;  3UQC A;  3DBD A;  3PY0 A;  3BI6 A;  3BIZ A;  4QMQ A;  3MWU A;  3KRJ A;  3GOP A;  3MW1 A;  3KRR A;  4FVQ A;  2WIH A;  4V0G A;  4QTD A;  5H8B A;  2VAG A;  1H27 A;  2RIO A;  3BYV A;  4W4V A;  3GCP A;  3NNV A;  4C4G A;  3EQD A;  3QQJ A;  4IXP A;  4NM7 A;  3MTF A;  4QOX A;  4DGN A;  5E8W A;  2A4L A;  4YJT A;  4J8N A;  3Q32 A;  2AUH A;  3TTI A;  2BRO A;  3LFC A;  4WG4 A;  3ZTX A;  4FTQ A;  4RFM A;  2YM6 A;  2VTA A;  3OXI A;  4K1B A;  4XCU A;  1YDS E;  2YIR A;  5DGZ A;  3BHU A;  1OL7 A;  1NVS A;  1OUK A;  5HBE A;  1UU8 A;  4EHE A;  3ORZ A;  3Q96 A;  3RAI A;  5HU3 A;  2FB8 A;  1CKP A;  5C27 A;  2YCF A;  3QUP A;  2J51 A;  4MBI A;  4BCN A;  2QO2 A;  2O2U A;  3OFM A;  3FQE A;  4UMT A;  4Z55 A;  2OW3 A;  2Z7S A;  5HKM A;  4D55 A;  3TNQ B;  5A4C A;  3U4U A;  2XIR A;  5HO7 A;  2HZ0 A;  1XH8 A;  1WBS A;  3LQ8 A;  2HXQ A;  1TQP A;  3F69 A;  3VUH A;  1H00 A;  2XBA A;  4HGS A;  3SD0 A;  4EHG A;  4EJN A;  4DG0 E;  3MH3 A;  5TR6 A;  5C9C A;  2GNF A;  5ANI A;  4DG2 E;  4AAC A;  3VBX A;  4CZT A;  2BZH B;  3H3C A;  3A8W A;  4LI5 A;  1Q61 A;  3VJO A;  4F09 A;  3ALO A;  2WGJ A;  1XH6 A;  3PJ2 A;  4C58 A;  4NWM A;  3MGY A;  4FKU A;  1OUY A;  2XBJ A;  3A7G A;  4BL1 A;  5K5X A;  2ITW A;  3E8E A;  3Q4U A;  4QPS A;  4Y46 A;  4A9Y A;  4BWX A;  3I7B A;  3LJ2 A;  4ITH A;  4CEG A;  4OTH A;  4FGB A;  5D12 A;  2QR8 A;  2PL0 A;  1H1P A;  1ZAR A;  2BCJ A;  3MPT A;  2QU5 A;  1ATP E;  3MSS A;  1PXN A;  3OZ6 A;  4EL9 A;  2NP8 A;  3BPR A;  4FR4 A;  3BWF A;  4IB5 A;  3W2S A;  4ZY5 A;  4JQ8 A;  3VAP A;  5LOH A;  4DIT A;  3QU0 A;  4GUE A;  1I44 A;  3FJQ E;  3IDC A;  5ACK A;  3VUT A;  2YFX A;  3QBN A;  3FMM A;  2X2M A;  1DS5 A;  4L00 A;  5B7V A;  3F2A A;  4HNI A;  1H1Q A;  2PZR A;  1YI4 A;  2PVH A;  5KMJ A;  4AG8 A;  3Q4C A;  3UG1 A;  4YJP A;  3W33 A;  4X2F A;  3OEZ A;  4O0S A;  4TY1 A;  4DEI A;  5IUG A;  5CQW A;  4FKL A;  3ZYA A;  2QO7 A;  4JVG A;  3F82 A;  1H24 A;  4XG7 A;  2BRB A;  3JUH A;  3LZB A;  3QTR A;  4EOL A;  4MD8 E;  2UZB A;  4TPT A;  2C47 A;  2CLX A;  1O9U A;  4O0V A;  4FA2 A;  3C4Z A;  5E8T A;  3KQ7 A;  4EOM A;  5GJF A;  3II5 A;  5HLN A;  2VZ6 A;  3OW3 A;  3A2C A;  4TWC A;  1YI6 A;  4IHP A;  5A4T A;  5BPY A;  5CAV A;  4D4V A;  2DS1 A;  3QKK A;  2V7A A;  5DLS A;  5C8K A;  3OXT A;  3LCK A;  4C33 A;  5JT2 A;  1FMK A;  4H3Q A;  3V01 A;  3MA3 A;  3RHX A;  4FTO A;  3O51 A;  4BI2 A;  2XRU A;  3UBD A;  1E1X A;  5F4N A;  1H4L A;  3FLW A;  3QRI A;  1YXT A;  4XHK B;  5G6V A;  4AU8 A;  3LE6 A;  5FBN C;  1PXI A;  3SQQ A;  2ZM1 A;  3GFE A;  3V5W A;  5EHY A;  3HRB A;  3MJ1 A;  2WO6 A;  4YJU A;  3G5D A;  2W1Z A;  4CMO A;  4R3P A;  4GK4 A;  5D11 A;  5M44 A;  5AR2 A;  1BL7 A;  3BYU A;  1Q24 A;  3ZLS A;  4HVG A;  1IR3 A;  1ZMV A;  1YHV A;  4X3F B;  3GBZ A;  4L3L A;  4YJV A;  3IW8 A;  3FBV A;  4NKA A;  1JBP E;  1PYX A;  3MS9 A;  2VTL A;  3N51 A;  3ZZW A;  1HCK A;  3BHT A;  1V0B A;  2GCD A;  3K3I A;  3EWH A;  5AM7 A;  4WSQ A;  5HEZ A;  4EK4 A;  4HVH A;  3V04 A;  2QOC A;  3OG7 A;  3RM7 A;  3BHV A;  3CR0 A;  4QMZ A;  4C34 A;  1PXK A;  4YHF A;  3G33 A;  3ZBF A;  3GEQ A;  4W8D A;  4PMP A;  4UX9 A;  1TKI A;  2WQN A;  4OLI A;  5CYI A;  1ZMU A;  4NUS A;  1GIH A;  4CZU A;  3NDM A;  3GCS A;  2ITZ A;  1V0O A;  5CX9 A;  5AR8 A;  5HBH A;  3V3V A;  3V5T A;  2BZK B;  1YDT E;  5EM6 A;  4FTI A;  4CD0 A;  3G51 A;  4Z9L A;  3GC0 A;  4NTT A;  4D2R A;  4AGC A;  3EL7 A;  4HCT A;  3ODZ X;  4MD7 E;  4ANB A;  2BAQ A;  4YZM A;  4UEU A;  1UKH A;  4O1P A;  1YOL A;  3PJ3 A;  4G6O A;  5AR5 A;  2B55 A;  2QOO A;  4LQM A;  3PZH A;  5FTO A;  3MIY A;  4MXX A;  3ETA A;  4A9U A;  4XYF A;  4FT3 A;  4ZTH A;  4BDH A;  4XLI A;  1R78 A;  4U5J A;  4G5P A;  3PJC A;  4EK5 A;  4RC2 A;  3HDN A;  2ZV7 A;  4O4D A;  3PJ1 A;  4PP9 A;  3FQH A;  4AFE A;  2A19 B;  2IO6 A;  1Y57 A;  4K77 A;  2WIP A;  4AQC A;  5CEM A;  3CKW A;  5HTI A;  3KL8 A;  5L2Q A;  3IS5 A;  5HCX A;  4FT9 A;  1KWP A;  3CCN A;  4OT6 A;  5EFQ A;  1Y91 A;  4OUC A;  3DJ6 A;  3PJ8 A;  4J99 A;  2Y6O A;  4R7H A;  4IWD A;  3P23 A;  4FT7 A;  4MXZ A;  4CTB A;  4DGO A;  1PMU A;  4EOQ A;  1CDK A;  3DKC A;  4Y85 A;  2WU6 A;  5AUY A;  3RZF A;  4E26 A;  3E92 A;  5BX0 A;  1REJ A;  2YM3 A;  4MCV A;  1KOB A;  2R0I A;  3AMA A;  4FTM A;  2BFX A;  2OXD A;  4C4J A;  3VRZ A;  3BRB A;  3TKI A;  2BAL A;  2J0K A;  4NKS A;  2C1A A;  5CU3 A;  4FKG A;  3ZRL A;  5AUT A;  3HEC A;  4GL9 A;  4GRB A;  4LV8 A;  4E8A A;  2RF9 A;  1H0V A;  5FEQ A;  3KGA A;  3HGK A;  5DA3 A;  1BMK A;  4J98 A;  2KUL A;  4UMU A;  2WXV A;  4M15 A;  4GK2 A;  4C37 A;  1PXO A;  4AZE A;  1OKZ A;  3MIA A;  4I1Z A;  4PMS A;  2GFS A;  3W10 A;  2C6I A;  4J1R A;  3TV7 A;  3WOW A;  4RWJ A;  3LIJ A;  5FQD C;  4BYI A;  2PHK A;  5B2M A;  5CZI A;  1PKG A;  2OU7 A;  5J9L A;  3QHW A;  3AT3 A;  2QKR A;  1F5Q A;  3FWQ A;  2UZW E;  5ETC A;  4MXO A;  3BX5 A;  3UMX A;  3RZB A;  4A06 A;  4IFG A;  3E8C A;  4KAB A;  2VGO A;  4FKR A;  2R3N A;  2OG8 A;  2YCR A;  2HY8 1;  4PPC A;  1U4D A;  4EQC A;  3H10 A;  3RAK A;  5CZH A;  2WTI A;  4FTL A;  3IO7 A;  1YXX A;  4RLL A;  5IH4 A;  3UIB A;  3ACK A;  2YZA A;  3IW4 A;  3ULZ A;  1ZOG A;  4CRS A;  1TVO A;  4D0X A;  4XV9 A;  3LFD A;  3HP2 A;  3ELJ A;  4KBK A;  3HKO A;  1M7Q A;  4KKH A;  4RZW A;  5BQ0 A;  5HU9 A;  5E8Y A;  5KHX A;  2IW6 A;  1OIY A;  4L42 A;  4IM2 A;  4F9B A;  2HIW A;  1YHW A;  2W96 B;  4KRC A;  4YHT A;  4C3R A;  2OGV A;  4WOV A;  5D9H A;  3SW4 A;  5CNN A;  1YRP A;  2XF0 A;  3OVV A;  3QAL E;  5FP6 A;  3RAH A;  3WF5 A;  3IOP A;  3PPJ A;  2PMI A;  2YAA A;  5AX9 A;  5K4I A;  3MPM A;  4FTT A;  5KMM A;  4GYI A;  4QYY A;  5EDP A;  1Z9X A;  3FMJ A;  1NA7 A;  2X9E A;  4RJ7 A;  1XBC A;  2UW0 A;  2C5O A;  4MWI A;  4HYU A;  5AP1 A;  4ACC A;  2XJ1 A;  2C5Y A;  4O1O A;  5CY3 A;  2QCS A;  2NPQ A;  2HWO A;  2VNY A;  3EN4 A;  4JDK A;  3DBF A;  3IEC A;  1UKI A;  1WVW A;  2YA9 A;  2JC6 A;  3K54 A;  5F1Z A;  5HCY A;  4AX8 A;  2GNH A;  4B6L A;  5CF6 A;  4EOJ A;  4FKI A;  2CGV A;  5CF8 A;  4BCG A;  5FTQ A;  3C9W A;  1CTP E;  4FG7 A;  4M66 A;  5I5Z A;  5DMZ A;  2X0G A;  2GTN A;  3F66 A;  3CTH A;  3H9R A;  4FIC A;  3SV0 A;  5FXS A;  4AFJ A;  4OTQ A;  2CCH A;  2X0Q A;  4GU6 A;  1GZ8 A;  2X0P A;  3PVW A;  3CC6 A;  2Z8C A;  3CGF A;  1U59 A;  1FGI A;  4PTG A;  4EZ7 A;  4JG6 A;  3ORN A;  1ZZL A;  2JDS A;  2PMN X;  4IIR A;  4WBB B;  2BRN A;  2ZDU A;  4DEH A;  5LVM A;  2YIT A;  2OJF E;  2R3O A;  4ZLZ A;  4L7F A;  3DKF A;  3OBG A;  1MRV A;  4YR8 A;  4AAA A;  2J90 A;  2VWV A;  5HX6 A;  4A4L A;  1LEW A;  3UYS A;  1J1B A;  2VO0 A;  2XNP A;  3BE2 A;  3I6W A;  1W2D A;  3AT4 A;  5EM5 A;  4AZW A;  4E4L A;  3ZS5 A;  5K5N A;  1JWH A;  1WBT A;  4IZY A;  1PXL A;  4CKJ A;  3G9N A;  4RJ3 A;  1UVR A;  4RBL A;  5IKW A;  2I0Y A;  4ID7 A;  2QO9 A;  4MED A;  4Y95 A;  2W4K A;  3G90 X;  2GTM A;  3E3P A;  3QAM E;  4RQK A;  3HNG A;  4WA9 A;  4D1S A;  2IF8 A;  3MH2 A;  4W9X A;  4DFX E;  2YM7 A;  4HPU E;  4G9R A;  4DGL C;  2UZE A;  4RC3 A;  4DGG A;  3NZ0 A;  5F94 A;  3Q04 A;  5AND A;  4RFZ A;  2W1F A;  3C50 A;  4O0U A;  3FMN A;  4BRX A;  4USE A;  2GS2 A;  3OTV A;  3ZFY A;  1GZO A;  4YO4 A;  3UGC A;  3F88 A;  5IA0 A;  4B0G A;  4NW5 A;  3A4P A;  3QZH A;  4AF3 A;  1JLU E;  2X6E A;  4FV4 A;  1WBP A;  4TKS A;  4E6C A;  4B4L A;  5E1S A;  1APM E;  2FGI A;  2F9G A;  4XOZ A;  3ZU7 A;  2X4Z A;  4DTK A;  4XP0 A;  5KMO A;  4X3F A;  2BDW A;  4QP2 A;  4G1W A;  4P90 A;  5J8I A;  5BVD A;  3KRL A;  2P33 A;  4I6B A;  4QP1 A;  3ZRK A;  2O0U A;  2BIK B;  1M52 A;  3QTW A;  3C4W A;  5CSX A;  4FST A;  4LV5 A;  3ZO2 A;  3DAJ A;  4P5Z A;  5L2S A;  3O17 A;  3QYZ A;  1GII A;  2GNI A;  4OBP A;  4DG3 E;  5A6N A;  2UZV A;  4TTH B;  5FDX A;  4DIN A;  4YHJ A;  3R7Y A;  1YWR A;  3QKL A;  4GII A;  2RSV A;  3B2W A;  2W1C A;  2EB3 A;  2C0T A;  3F3V A;  3I4B A;  4PMM A;  5CI7 A;  2GMX A;  3QXO A;  4BB4 A;  3Q4T A;  3O7L B;  4FL2 A;  2I40 A;  3ZDU A;  3TWJ A;  4A07 A;  4RJ8 A;  5CWZ A;  4FKO A;  3DT1 A;  3FZT A;  4ZSG A;  3O8T A;  3RM6 A;  5H9B A;  2A27 A;  5DRD A;  4FKS A;  5BVF A;  3D9V A;  3HV3 A;  3A99 A;  4JAI A;  3SKC A;  4O4E A;  4J96 A;  3OUN B;  2JGZ A;  5BVW A;  4MK0 A;  4F0G A;  2JKO A;  4JOA A;  1JKT A;  3E88 A;  1M7N A;  3LXP A;  4RFY A;  3SXF A;  2C3J A;  3PA4 A;  2HOG A;  3V8S A;  4RJ4 A;  4UZH A;  2EU9 A;  4RPV A;  3R71 A;  2WMA A;  4IAZ A;  3QTS A;  4J95 A;  4FBX A;  4YGA A;  5LVP A;  4GW8 A;  3SVV A;  3KVW A;  4ZSJ A;  4C4I A;  3KF7 A;  3D5W A;  5E90 A;  2HZI A;  5IA4 A;  3V5P A;  1SNU A;  2W9F B;  4BI0 A;  3D2I A;  4BWK A;  5AEP A;  4EH9 A;  3Q5I A;  1IAS A;  2G2F A;  3NW7 A;  4P2K A;  4ZTL A;  5I9Z A;  2WTK B;  2RFN A;  3QRT A;  3ZLY A;  3HMO A;  3R73 A;  3NNX A;  4FOD A;  2ITT A;  2OZA B;  5CU4 A;  2SRC A;  3R8L A;  3R00 A;  1NVQ A;  3W32 A;  2WTJ A;  2WTD A;  5LVL A;  2VX0 A;  2R2P A;  3ANQ A;  2C68 A;  2ETM A;  5GZ8 A;  4P7E A;  3P0M A;  4NM3 A;  5M4F A;  1KV2 A;  4OTP A;  4FKV A;  5EHO A;  3W2O A;  4U44 A;  2XH5 A;  3OY1 A;  3OP5 A;  4APC A;  4FV2 A;  3MJ2 A;  4I0R A;  3SXS A;  4AGD A;  3QQU A;  2P2I A;  3COI A;  3Q6U A;  4I94 A;  4CTC A;  4V04 A;  4DLJ A;  4E4N A;  3PP0 A;  4KIK B;  4IAI A;  5JQ5 A;  4YBJ A;  3EZR A;  4LUD A;  3RCJ A;  5AIR A;  2PZI A;  2JDR A;  4KWP A;  1W82 A;  2V22 A;  1WBO A;  2W1E A;  4ACG A;  4OW8 A;  2UZD A;  3OC1 A;  4Y83 A;  3EFK A;  4X2G A;  3CQU A;  3QCS A;  2G15 A;  4FIJ A;  3DND A;  4R1V A;  4XRJ A;  3VBT A;  4BKZ A;  5HBJ A;  2PVY A;  4QMP A;  5FEE A;  3KU2 A;  3ROC A;  1OPL A;  3TI1 A;  2Y8O A;  3REP A;  2RFE A;  2IZS A;  1DM2 A;  2C69 A;  2NRY A;  3LJ1 A;  3TL8 A;  4QTB A;  5DH3 A;  5AR7 A;  5E1E A;  3DJ7 A;  2ONL A;  1YOM A;  2XEZ A;  3HV5 A;  3PSD A;  3Q2M A;  4KD1 A;  3SRV B;  1OZ1 A;  3D15 A;  3DK3 A;  4C62 A;  4OTF A;  2A0C X;  2ERZ E;  5AMN A;  3OBJ A;  2C5X A;  4I0S A;  2IW9 A;  4IX6 A;  5D1J A;  4D4R A;  4FYO A;  3LCO A;  5FBO A;  2PWL A;  3E7O A;  5ANO A;  3JY9 A;  4K6Z A;  4CLI A;  1AD5 A;  5HO8 A;  3NSZ A;  4QMV A;  2HEN A;  2X7F A;  2PVR A;  4N70 A;  1U5R A;  2I0E A;  5H3Q A;  4UXL A;  4ANL A;  3GU8 A;  2O65 A;  2X4F A;  5CF5 A;  3SAY A;  2QOB A;  1XH7 A;  3VUD A;  1I09 A;  2DUV A;  2V62 A;  3ZBX A;  4F0F A;  4I5H A;  4M3Q A;  4WSY A;  3SLS A;  4UZD A;  1U46 A;  4Z7H A;  3OCT A;  4ZSE A;  4GJ2 A;  4JLC A;  4RVM A;  4O4F A;  2OJJ A;  2HYY A;  3DAK A;  4G17 A;  5E8Z A;  3RMF A;  4ANS A;  3PP1 A;  4WO5 A;  1KE8 A;  4X2J A;  4CV9 A;  3HRC A;  3FSK A;  3DLS A;  1UNG A;  1R0P A;  3ORO A;  5AP6 A;  3PVB A;  1IG1 A;  4KKE A;  4F7J A;  2XNM A;  4GVJ A;  1RJB A;  3K5U A;  2E2B A;  3QCY A;  4IZA A;  4U6R A;  1OI9 A;  3RK7 A;  3SOC A;  3FZP A;  4PWN A;  1Q62 A;  3R22 A;  4ALW A;  4ZIM A;  4H1J A;  4JRN A;  3AC8 A;  2DQ7 X;  2Z7L A;  2C4G A;  3GFW A;  3HL7 A;  5AP0 A;  3FME A;  4O27 B;  4BCQ A;  4HVI A;  3AC1 A;  4EH2 A;  3A62 A;  4BDE A;  3QA8 A;  1O6Y A;  3UZP A;  4AGW A;  1OMW A;  3AGL A;  4I24 A;  2AC3 A;  3B2T A;  4S32 A;  4TWO A;  3UIX A;  5BUJ A;  3GC7 A;  2BAK A;  1XWS A;  1R0E A;  3IG7 A;  4BZN A;  1UNL A;  2Y4P A;  3L1S A;  5KML A;  4RWI A;  4CLJ A;  1M2Q A;  4I6Q A;  1NXK A;  1T46 A;  4FZA B;  2IEW A;  4C0T A;  2C0I A;  4GU9 A;  3HLL A;  4I5P A;  1UU3 A;  3QC9 A;  3WZJ A;  4CMT A;  3ZC5 A;  1X8B A;  3UVR A;  1FIN A;  3PXF A;  3GCV A;  5CU0 A;  4RIW B;  5HIE A;  2PVN A;  3LFE A;  3HZT A;  5IDP A;  3O2M A;  4FKW A;  1BYG A;  4QTA A;  4CKI A;  1RDQ E;  5BVE A;  3BGZ A;  1URW A;  4EQU A;  4E7W A;  5JRQ A;  1M14 A;  2YER A;  1SYK A;  4BDC A;  2B9F A;  3FLY A;  5CAP A;  2OIQ A;  5HD4 A;  1ZLT A;  2VTH A;  2VTP A;  3LFF A;  3FY2 A;  4BIB A;  2W1G A;  3TZ9 A;  4I5C A;  4ACD A;  4OTG A;  3FKL A;  4QP4 A;  3GU7 A;  3U6I A;  4QP6 A;  4YSJ A;  3DV3 A;  3ZON A;  3LMG A;  4O6E A;  4YTF A;  4DBN A;  4ZXT A;  2RG6 A;  5KMK A;  3PXY A;  3DZQ A;  3EQC A;  4M14 A;  3HRF A;  4G5J A;  4GSB A;  2E9N A;  3VW8 A;  3VWA A;  3PG3 A;  4EOP A;  3HMI A;  5BYY A;  3OF0 A;  4I6H A;  2VTO A;  2OXX A;  4ALU A;  5H8G A;  2XNO A;  4MF0 A;  2V5Q A;  1YXU A;  3TG1 A;  5IG1 A;  4BTF A;  3UNZ A;  3GGF A;  3VS1 A;  1R39 A;  3LM0 A;  3SDJ A;  3PPK A;  5E91 A;  3ZO3 A;  4CMU A;  1ZY4 A;  5HTC A;  4QTC A;  3U4W A;  4FSR A;  1U54 B;  2ZV2 A;  4O0Y A;  1P14 A;  2C0O A;  3LXN A;  2A1A B;  3FZR A;  4NZW B;  1GNG A;  4WNP A;  3ORL A;  3RWQ A;  2WPA A;  3AC5 A;  3TIY A;  3D5U A;  4R5Y A;  5HNG A;  1PMV A;  3MVM A;  5ETI A;  5KKR B;  1FVT A;  1CMK E;  3BHY A;  4DHF A;  4HVS A;  2OH4 A;  4FC0 A;  5T6K A;  2Y6M A;  3OT8 A;  2J0M B;  4E5A X;  2R7B A;  2XEY A;  4J53 A;  4PDP A;  4M8T A;  4TN6 A;  3KCK A;  4XP3 A;  4FTA A;  5HG7 A;  3RAW A;  3UIU A;  5HOA A;  3VS6 A;  3LVP A;  3ZH8 A;  3BWJ A;  4KBA A;  2WQM A;  3LXL A;  3MDY A;  3VBY A;  3MBL A;  3UPZ A;  1ZWS A;  4OTW A;  2BZJ A;  2QQ7 A;  3NR9 A;  3NUS A;  3AC4 A;  2BIY A;  4OR5 A;  2PVK A;  3HA6 A;  4WHZ A;  2OBJ A;  4L01 A;  4YZ9 A;  3EQI A;  1H07 A;  3I5N A;  3OY3 A;  4USF A;  2QLQ A;  4D28 A;  1PME A;  5KE0 A;  5EOB A;  3VS7 A;  4FKQ A;  2VTS A;  2X7G A;  2W99 B;  3R01 A;  4D1Z A;  1F0Q A;  2W4J A;  2X6D A;  3V51 A;  5K4J A;  5E7R A;  3MB7 A;  4L6Q A;  1OVE A;  5I4N A;  4ZSA A;  5DR6 A;  4IZ7 A;  3I0Q A;  1YHS A;  4JIA A;  5FLF A;  4AT3 A;  5AAD A;  3QD2 B;  4QQT A;  4S2Z A;  3TJC A;  2Y7J A;  3U6J A;  4IQ6 A;  4IVD A;  4MBL A;  3SHE A;  3G0E A;  3A60 A;  3F3W A;  2XIK A;  3U6H A;  3IKA A;  4NCT C;  4TZR A;  5CAO A;  1WFC A;  3PWY A;  3EFJ A;  3P7A A;  4JBP A;  2E9V A;  3OWP A;  3R30 A;  3FPM A;  2WTC A;  4FV9 A;  5L6O A;  4ZJI A;  2OZA A;  1OIR A;  4D58 A;  3Q9Z A;  2CKE A;  4I6F A;  2VGP A;  3DB6 A;  3WF6 A;  4X6R A;  4HPT E;  1W84 A;  3ZUV A;  3QTX A;  3VS0 A;  4F4P A;  3VS5 A;  3HYH A;  3NNU A;  4K9Y A;  4QQJ A;  3HUB A;  1UNH A;  3PA5 A;  4RT7 A;  3M11 A;  3TJD A;  3UOJ A;  3LFA A;  3FHR A;  4UV0 A;  1DAY A;  1LUF A;  4U42 A;  2YIS A;  2OFV A;  3DLZ A;  4MXA A;  4KIK A;  4TYH B;  4B7T A;  1GIJ A;  4FSY A;  3Q6W A;  2KTY A;  4LGH A;  2R3H A;  1JST A;  3F5G A;  4U40 A;  4DCE A;  4BTJ A;  1RW8 A;  3L9L A;  4BDI A;  3Q60 A;  4I5M A;  4EOR A;  3DCV A;  2CN5 A;  1P5E A;  2Y0A A;  3T9I A;  4RX9 A;  4S34 A;  4Z16 A;  2WKM A;  5J9Z A;  4UYN A;  2HEL A;  5EW8 A;  2YIQ A;  4XG3 A;  4RZV A;  2BMC A;  4ERK A;  3NAX A;  5LVO A;  3PUP A;  4UWC A;  5CS6 A;  4IC7 A;  2I1M A;  3SRV A;  1H26 A;  2R3I A;  5K0K A;  4HCV A;  2UW8 A;  4OTD A;  5DHJ A;  3UJG A;  4D0W A;  3GT8 A;  1G5S A;  2UUE A;  3VHE A;  3O7L D;  2J9M A;  3QYW A;  5HG9 A;  2YN8 A;  3S95 A;  1XKK A;  5ITA A;  3QLF A;  4JXF A;  3JVR A;  3VBV A;  2QG5 A;  5A4L A;  3AQV A;  3CY3 A;  3FXZ A;  4DH8 A;  5HD7 A;  3EN6 A;  3U9N A;  2WHB A;  3TIZ A;  5EDR A;  2EB2 A;  3QCX A;  5KUP A;  4UY9 A;  5IU2 A;  1WAK A;  2RG5 A;  1OL6 A;  2OWB A;  2YDI A;  2XJ0 A;  3TNI A;  5I9Y A;  2OJ9 A;  2LAV A;  2FSM X;  2VRX A;  2BTR A;  2IN6 A;  3EB0 A;  1UU7 A;  5FP5 A;  4IAN A;  4KIQ A;  2HZN A;  3LFS A;  4TYE A;  1WCC A;  4GS6 A;  3TEI A;  3UE4 A;  5IDN A;  2IW8 A;  4L67 A;  4MNE B;  3R6X A;  3KXM A;  2BRG A;  2V7O A;  4HYH A;  5E8S A;  4A4X A;  4FYN A;  4GEO A;  5CSH A;  3P9J A;  5HI2 A;  5CAN A;  2IWI A;  5HNB A;  5ANJ A;  4E6Q A;  4K8A A;  4OBO A;  2ZV8 A;  4WG5 A;  4B8M A;  5DN3 A;  2OJI A;  5DRB A;  2C6D A;  2YLE A;  4E5B A;  4QO9 A;  1H28 A;  3L8S A;  5E8U A;  4OTR A;  3OW4 A;  3BLH A;  4PTE A;  1M2P A;  3HX4 A;  2Q0N A;  3NYO A;  3RJC A;  2GHM A;  2JDV A;  2OID A;  5AR3 A;  5IZF A;  4YZN A;  3P7C A;  4NJ3 A;  2R3P A;  3F5X A;  2C6T A;  4E20 A;  5C26 A;  5IEX A;  4FV1 A;  1UWJ A;  5G1X A;  1JSV A;  4PUZ A;  1IEP A;  3FI3 A;  3NCZ A;  5FM2 A;  4E73 A;  4Q2A A;  4FNW A;  4FZF B;  4G3G A;  4RMZ A;  3KXZ A;  2CGW A;  4B8L A;  4WNM A;  3MB6 A;  4ZS0 A;  1Q8U A;  2Y4I C;  5KZ0 A;  1UV5 A;  4YZD A;  3DBE A;  2GNG A;  3PSB A;  4FOC A;  1K3A A;  3D14 A;  3FL4 A;  5C8N A;  3DPK A;  5JGA A;  2QOQ A;  4UMR A;  5AV4 A;  3JY0 A;  4ZSL A;  4YUR A;  1KV1 A;  2C5V A;  3ION A;  3PE1 A;  4YC6 A;  3UOL A;  5HHW A;  2VWZ A;  4RIW A;  3R04 A;  2GNJ A;  4QMX A;  4CKR A;  1H25 A;  3KFA A;  3MTL A;  5M55 A;  3TV6 A;  3DDQ A;  4XMO A;  4EUU A;  5CSV A;  3ANR A;  4D9U A;  4H39 A;  1XBA A;  3EQP A;  3DK6 A;  4PX6 A;  1ZOE A;  3VF8 A;  4F64 A;  5CEP A;  5M4I A;  4TWP A;  3R7U A;  2YM5 A;  3GNI B;  4MXY A;  3EQR A;  3TZ8 A;  4ENX A;  5C8M A;  4ZZM A;  1VYW A;  2JBP A;  1JPA A;  1PMN A;  3D5X A;  3GC9 A;  3RWP A;  3LLT A;  4RWL A;  1KE7 A;  2BRM A;  4L44 A;  4EYJ A;  3R8V A;  4JBO A;  4G31 A; 
#chains in the Genus database with same CATH homology
 2A98 A;  1W2D A;  2IEW A;  4O4D A;  1W2F A;  4O4F A;  1TZD A;  1W2C A;  2X0P A;  4O4B B;  4O4C A;  2AQX A;  4O4E A;  2X0O A;  2IF8 A;  2X0Q A;  4FRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...