4FRFA

Structural studies and protein engineering of inositol phosphate multikinase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
237
structure length
214
Chain Sequence
EIEVKFYESFSSNTEVPEHIHRYFPVYHGTMMVLENLLAEYTKPSVMDVKMGSRTWYPDASEEYIQKCLKKDTGTTTVSSGFRISGFEVYDHKESSFWKPERKLLRGLDVDGARLTLRKFVSSNSLPDSAFASSVYGGSHGILTQLLELKTWFENQTLYHFNSCSILMVYENESDARPQVKLVDFAHVLDGNGVIDHNFLGGLCSFINFIREIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Inositol polyphosphate multikinase alpha
publication title Structural studies and protein engineering of inositol phosphate multikinase.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 64
structure length 214
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.1.140: Inositol-tetrakisphosphate 5-kinase.
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4frfA00
4O4CA 2A98A 4O4DA 4FRFA 1W2FA 1W2CA 2AQXA 4O4BB 4O4EA 2IF8A 2IEWA 4O4FA 1W2DA 1TZDA
chains in the Genus database with same CATH superfamily
5LCJA 4GSBA 1JKSA 2BROA 4FICA 4J95A 1GIJA 3RZBA 2PMIA 2QOHA 4XCUA 4DAWA 3D2KA 4WHZA 5CNOA 4EONA 1WBPA 4L8MA 4OTHA 4BICA 2CSNA 4K18A 5FD2A 4EQUA 1O6YA 3BHTA 4LRJA 4KKGA 5J7BA 3H9OA 3HV4A 3KFAA 3SV0A 4DGOA 3HECA 3TUDA 2A2AA 2WO6A 4D0XA 4D1ZA 4QQTA 2YWPA 1XJDA 4L9IA 3MS9A 3E3BX 4ASEA 4WKQA 2F7EE 2HXQA 4ARKA 3D7ZA 2GS2A 4XEYA 2A0CX 3RAWA 4C3RA 4QP1A 3KEXA 4BDIA 4DLJA 2YHVA 5CSVA 4RSSA 4IAYA 4S31A 5EI8A 4QYGA 5CF6A 3HV6A 3UMWA 4IC8A 4HYIA 1ZOGA 3OXTA 5AUUA 2QHNA 3BHVA 4KRCA 1FGKA 2Y4PA 2YIXA 4J98A 4P5ZA 4U79A 2G01A 5AUXA 4AG8A 4FKWA 3C13A 2VTAA 1XH6A 1M14A 2Y4IB 3SRVB 4JQEA 5EHLA 4MAOA 4XP0A 4HPTE 4L68A 5BVFA 4JQ8A 4WBBB 3DK7A 3K54A 3MJ2A 4PL5A 4H1JA 5A6OA 2NO3A 3F7WA 3GUBA 2UW3A 4GVAA 3QQKA 4F70A 2YAAA 2J5EA 3ZC6A 1XBAA 1M52A 4WBOA 3QCXA 4ITHA 5LARA 4HNFA 4O2PA 5M51A 4EH7A 3ZLSA 3OEZA 4I5CA 2J90A 2GFCA 3EFWA 1CKJA 1OB3A 2B52A 2IVUA 2O8YA 1XH9A 3FZ1A 3F69A 2QO2A 1OMWA 1IASA 4H3PA 4Y85A 5DI1A 3KK8A 5IA4A 1VYWA 2WB8A 2PMOX 3LCTA 3RVGA 1GZOA 2XM9A 5J9YA 2C47A 3G6GA 3FQEA 3MJ1A 3DU8A 4I0SA 3VC4A 3FLWA 4F9CA 5JK3A 3ZUTA 4ANLA 5HVJA 4EOMA 4X0MA 3QRTA 3QTSA 3UPZA 5J1VA 2IVSA 1VEBA 3AC8A 4YTHA 3EQRA 3IDPA 5J8IA 4AGCA 3R8LA 1H1PA 3EH9A 2HOGA 3TV4A 2KULA 2J0LA 2RIOA 2UW0A 3PSDA 4QP4A 3ZRLA 4A4LA 1Y8GA 1YKRA 5EYDA 3F5UA 5HQ0A 2OFVA 3ZLYA 4TW9A 1GJOA 3HL7A 2Y9QA 3UGCA 2YIWA 4EC8A 4MHAA 4Z16A 2BZIB 2VTPA 1H07A 4IX6A 1KE5A 5CT7A 3CTJA 3QHWA 3QXOA 4AGWA 4V04A 5CXHA 5JZJA 3P86A 5L6OA 4CRLA 1BX6A 3UZPA 4YTIA 3E92A 3RAIA 3FMMA 3GXLA 3ORNA 4Y95A 3DFCB 4D58A 4EBWA 5LMKC 4IJ9A 5EH0A 4ACGA 3HDNA 4F9AA 1WBNA 4MF0A 4AT5A 3PY1A 4TNDA 1YDRE 2GHGA 3O50A 4AWIA 5AV3A 3JS2A 3GBZA 4RZWA 4ZLYA 3PRFA 3GOPA 4BWXA 1ZZLA 4LQMA 5H8EA 2XB7A 2WMWA 3C1XA 2IEWA 2YM5A 5IDNA 2X6EA 4NM5A 4UMQA 4XJ0A 4BDAA 4M8TA 4FKOA 3OTVA 5DN3A 3WZKA 5CZHA 3TZ8A 3W8LA 2WMSA 1H1WA 2Q0BA 3UVQA 4IDVA 5CAPA 5D7VA 2XRUA 3VAPA 5HX8A 1FMKA 2RG5A 4QMNA 5FTOA 4D28A 4TYGA 4YZCA 4MXOA 1RDQE 4GEOA 4DCEA 4MCVA 3TJDA 5BVDA 4HCTA 5IA3A 2X2KA 3BZ3A 4IANA 4A9TA 4F1OA 4OT6A 1MQ4A 3NSZA 3GCUA 4PNKA 3MWUA 3QKLA 5E8VA 2PVKA 3HP5A 4E6AA 1NVRA 3QF9A 2J7TA 3V5LA 3WARA 3KA0A 5AAGA 1ZYLA 3R1SA 2V7OA 5H3QA 4YHJA 2QONA 3W18A 4C4EA 5IF1A 3CXWA 3R63A 4BI1A 3MYGA 2XEYA 2OW3A 4JIKA 3L9NA 3WI6A 3NX8A 3OFMA 4RBLA 3SKCA 4HVSA 4U8ZA 3AT4A 1W83A 3O23A 3MFRA 3ORLA 5D12A 3BKBA 4JVGA 1YWVA 4H1MA 1Y8YA 4X2GA 1GAGA 4FTKA 4XMOA 4FR4A 3PVWA 4MXYA 5K9IA 1J3HA 4C37A 3UP2A 4FBXA 4BFMA 5EOBA 4R8QA 2A19B 4DTKA 4UB7A 2UUEA 2W1FA 4QTBA 2XRWA 3NIEA 2C6OA 4Q5HA 4CV9A 4RJ8A 2BHHA 1XH7A 2BTRA 5CAOA 2J0MB 2W1IA 4BL1A 4EI4A 4B9DA 1Q3DA 1ZWSA 2C0OA 4G6NA 4R7IA 2WMAA 4XG7A 3ZCLA 5CEMA 5CAQA 4MX9A 4IX4A 3RK5A 2OIBA 2PZYA 4QMWA 3TIZA 5M55A 1PKGA 4FV8A 1ZAOA 5LVPA 1Q97A 4I0TA 4BCHA 3R01A 4D2PA 3CCNA 3FY0A 2ITWA 5DA3A 5LMBA 3FL4A 4QMSA 4D4YA 5JN2A 4GYIA 3TCPA 1Z9XA 4FUXA 1YOMA 4RMZA 1T45A 3CQWA 4F7SA 3ETAA 5ACBC 2H8HA 1GZKA 4X6RA 1NA7A 3ORPA 4WO5A 3VF8A 4PDPA 4MXXA 1U54B 4OGRA 4PNIA 4P90A 3QWJA 3VBVA 3WOWA 5AMNA 4DYMA 4FA2A 2QNJA 4QQCA 2X7GA 3RPVA 3BEAA 4JLCA 3E8DA 3KKVA 2YA9A 3FZOA 5FP6A 3I0OA 3SXSA 2CMWA 2X0PA 3DKFA 5C26A 3II5A 4S32A 5HORA 5LVMA 4R3RA 5IMXA 2WEVA 4U40A 3S3IA 4A4OA 5I3RA 3NUUA 3C7QA 2PMNX 3SXFA 4XG8A 4BCMA 2R2PA 1OKYA 3V51A 3OCBA 4ZY6A 4ANOA 4AA5A 2EB2A 4A4XA 5A9UA 5TO8A 4G9CA 4S34A 4YGAA 5HBEA 1H27A 3EQIA 3S0OA 3AQVA 3D5XA 4ANSA 1W8CA 4AX8A 5HE1A 5FLFA 3WYXA 4ZXTA 1MUOA 2OJIA 2F9GA 4L53A 5FXRA 1Z5MA 4UWYA 5B2MA 3ZFYA 4EH4A 4FTAA 2WD1A 3RNYA 1Y57A 5IA0A 4RJ4A 3TV7A 5BVKA 1IA8A 5CEPA 3AT2A 3IK3A 5AA8A 2VWWA 3L8PA 5D11A 1U59A 1BYGA 1YW2A 3CQEA 3TEIA 5CF4A 2X4FA 2UZWE 4AZWA 4C34A 4AOTA 3FLQA 4CFUA 5LWMA 2HZ0A 4TN6A 4M0YA 4RLLA 4EHEA 5DIAA 4BZDA 4IB5A 3ENHA 2XIYA 2VX1A 2B54A 2R3RA 3Q6UA 5EM7A 3W2SA 4KRDA 1OKZA 4X2JA 3F2NA 1H25A 1YVJA 2PE1A 4UALA 4PDOA 5AAFA 2ITNA 3C4WA 3E7VA 5CEOA 5KMMA 2A4LA 3EHAA 3OROA 4X21A 4G9RA 3PJ2A 2BAQA 4R5YA 1OL2A 4KBAA 5DRDA 4PP9A 1PXJA 5BX0A 3BWJA 1LEZA 2UW5A 3E93A 2WMTA 3ZS5A 3K2LA 3NYXA 4MNEB 2VTJA 3MH2A 2BMCA 4G5PA 4BVUA 1YI4A 5H8GA 4Y5HA 1FOTA 4FSYA 2ZV7A 5EKOA 1EH4A 3OWKA 2VWYA 3W2PA 5EKNA 1U54A 5AIKA 3KN5A 3IGOA 3EN6A 1XH5A 3R7IA 5FM3A 4FIEA 3QALE 5D1JA 1ZOEA 5L3AA 4RQKA 3I7BA 4WG4A 4FV3A 2EUFB 2UVXA 3A7HA 2IZTA 4AN9A 4FC0A 4QPMA 4YU2A 1PKDA 2XIRA 3CJGA 4H3BA 4DGNA 2YAKA 3EKKA 2PVHA 3CJFA 4I92A 3V8SA 3R7VA 3H0YA 2XYNA 3P7CA 3EQGA 2IZUA 2UVYA 4WA9A 1UWJA 4R6VA 4E7WA 4QMQA 1Q5KA 4BC6A 1H01A 3JY9A 1NVQA 2WXVA 3IDBA 5GJGA 4RIXB 2VAGA 4ZZNA 2P2IA 1TQMA 2ZV8A 3HLLA 4EEVA 5CT0A 4I6BA 2QKRA 4ASDA 3COHA 4RWJA 4LL5A 1YXSA 4IZ7A 4DHFA 3AOXA 3MV5A 1FPUA 2I1MA 4JQ7A 5M57A 4OTFA 3ORKA 4UMTA 5ETCA 5CASA 2JEDA 4IAAA 2BPMA 3F2AA 2UZBA 3ZDIA 3VUMA 4ZZMA 4PRJA 4CQGA 4CYJA 3PVGA 2BRMA 3NAXA 2C5VA 5K5NA 4JR7A 1H0VA 1F0QA 2YERA 4I4FA 4IB1A 4NSTA 4F7NA 3BEGA 3R04A 1XQZA 1U4DA 2JIIA 4LYNA 1YHVA 2OBJA 4W8EA 4YPSA 5F95A 3V04A 2PE2A 3UIBA 2ZM3A 2YISA 3CGFA 3QFVA 4JG7A 4LMUA 3UOLA 4ZTHA 4AOJA 4YZNA 5BQ0A 4FOCA 2VTRA 2UW8A 3ITZA 2YCFA 3E63A 1KE7A 5EDQA 3NS9A 3RI1A 4BN1A 4YJPA 3FC1X 5LVLA 4CCUA 2X81A 1YXVA 3QWKA 2BAJA 3HYHA 3R02A 4JRVA 4PDSA 3VBTA 4YP8A 3PIYA 5CI6A 4DEAA 2WOUA 5CU4A 4Y5QA 4IXPA 2G2HA 3RK9A 3V5WA 2RGPA 4O1PA 4BDDA 4Z9LA 1BUHA 5LWNA 5A46A 4U6RA 4G3EA 5JRSA 3WYYA 4LV8A 3HKOA 4X3JA 3VF9A 4BKYA 2CN5A 3DBDA 4OT5A 2HELA 1IRKA 2F2UA 3GCSA 2QVSE 4WNOA 5JGAA 3VVHA 4DLIA 4O27B 5AWMA 4PUZA 4EK8A 3ZC5A 4OBPA 3THBA 4KIKB 1QPCA 2WMVA 4V0GA 2OG8A 3F3UA 3I5ZA 4RIWB 5IUGA 4I21A 3PJ1A 1PY5A 5AA9A 5JFXA 2XBJA 2V0DA 2GHMA 2IVTA 4JAIA 4IW0A 5CI7A 5HCZA 4B7TA 2BUJA 2OJJA 4XOZA 4RVKA 2WQBA 2BZHB 4AW1A 1PXIA 3N9XA 4F6SA 5A4TA 2YIYA 3W2QA 2EXCX 2QOKA 3OD6X 2OWBA 4F9YA 4AQCA 2WTIA 5KMKA 1H8FA 4UMUA 2PE0A 3KY2A 3RALA 5EW3A 3CQUA 1I44A 4YLJA 3WZEA 2I6LA 4TKSA 2X4ZA 2DYLA 3H30A 2XK9A 4IVCA 4BWKA 3QCYA 3JYAA 3E8CA 3ORXA 3RHKA 4JRNA 5A3XA 4FYOA 4FGBA 4S30A 4FG9A 2WQMA 5HGIA 3BPRA 1XHAA 2W96B 2QHMA 4O6EA 5FEEA 1YHWA 3FI4A 4A06A 2BRHA 4YBKA 1AD5A 3OVVA 1RE8A 4EYJA 5AUYA 2JKOA 3OUKA 3UODA 4FNYA 2VO0A 3KC3A 2F4JA 1JPAA 2O2UA 4C8BA 3QD4A 4HZSA 1UNLA 4APCA 2X8EA 5AP7A 4NCTC 4ZTMA 3T3UA 2WPAA 1QPDA 3RTPA 4P2KA 4CKIA 2YACA 4ZTSA 5DRBA 1DM2A 1YI3A 5DHJA 3W33A 5KKRC 5ETIA 3AT3A 3VWAA 4F64A 3R30A 3OY1A 4OLIA 2X8IA 1M7NA 4GCJA 3KRXA 3TWJA 5FBOA 3BYUA 1YI6A 2YZAA 3E8NA 4LGGA 1OPKA 5J5TA 4UY9A 3BELA 3W32A 3OCGA 3UVRA 1Y6BA 1OL7A 1WBOA 4RJ6A 2F7ZE 3SD0A 5J9ZA 4RIWA 4QPSA 1Z57A 4QP8A 5AP5A 4HCVA 3DV3A 5GNKA 4WNKA 4G16A 3QYZA 3LFFA 5KE0A 3FZPA 3DB6A 2YCRA 2QD9A 5FP5A 2EXEA 2PVLA 3CIKA 2YM8A 4XS2A 1PW2A 5JH6A 3A4OX 3DDPA 3M42A 4RWLA 5A54A 3ZTXA 1OPLA 3CR0A 2CKEA 4YHTA 3SHEA 3CD3A 1XKKA 4XG3A 3L8VA 4YUQA 5E7RA 3RZFA 4CVAA 1UKHA 3R8UA 4GIIA 2XJ1A 4F65A 2W4JA 1M2QA 2QURA 2HY0A 5DR2A 3HZTA 3QZFA 3GQIA 3RBWA 5CEIA 1JSVA 2XNPA 1YHSA 5GJFA 4C2WA 4RGJA 1WMKA 4F7JA 3OY3A 5IUHA 3AC4A 4QP2A 2VWUA 3UG2A 4CFNA 4EOPA 4UWCA 4TNBA 4EH6A 4I5PA 2OH4A 4FTIA 4AA4A 1W84A 2ZOQA 3CTHA 4D2WA 4IHPA 3EQCA 2C0IA 2XNMA 1MRYA 3E62A 5J87A 3TKHA 1JKLA 2JDSA 3QD2B 1XO2B 4W4XA 4RVLA 1YWNA 3CPCA 1P5EA 3OCTA 2HWOA 4LG4A 5DMZA 3DK3A 1SNXA 5EW9A 1Q61A 3DJ6A 4CEGA 2PL0A 4WT6A 2HCKA 5ACKA 4H58A 4I22A 5H2UA 1W98A 3UNZA 3POZA 3QKMA 3HMPA 2WU6A 3GU4A 3MTFA 4AN3A 3ZRKA 4FV6A 3TKUA 2ZV9A 1V0OA 1R39A 1ZLTA 4MD8E 4CFXA 3DBFA 2WZJA 4AT4A 3UVPA 2C6MA 4YJOA 3VUIA 4A9RA 1NVSA 3QL8A 2GNJA 5HG8A 3NCZA 5KO1A 2ZM1A 4BZNA 2C6LA 4LUDA 4R1VA 2EB3A 5DOSA 3AD6A 3QKKA 3AMYA 3P79A 3POOA 1FVTA 3NCGA 3FWQA 4HVDA 5F1ZA 2QR7A 4H39A 1R1WA 4ZY4A 4TWPA 2B9HA 4BRXA 3IG7A 2R0IA 4OBQA 3V5TA 2WTVA 4EK4A 1G5SA 2GDOA 2JLDA 3W2CA 3CKXA 1J1CA 4RLKA 4CNHA 2HXLA 5LOHA 3U6JA 3I79A 3LJ2A 4Q5EA 4ZSAA 2R64A 2YCQA 1WVYA 1KWPA 5IU2A 2GFSA 4IX5A 2JAMA 3QA0A 3UQGA 4V01A 3MDYA 4PP7A 4D4VA 5JT2A 4Y73A 5I9YA 5CX9A 3UQFA 2IJMA 3CKWA 2YEXA 3DBEA 3MW1A 5E1SA 5HNGA 3ZYAA 3HV7A 4KD1A 3VUHA 4TXCA 3EJ1A 4F7LA 3DAKA 3PSBA 5HOAA 1H08A 4USEA 1QMZA 3LFNA 3GU8A 3EQFA 2ITYA 3NAYA 4L43A 2CGXA 3W55A 5AM6A 1S9JA 1H4LA 3FPMA 4TT7A 3QTUA 4YZBA 2W7XA 3QLFA 3F88A 4MVFA 4YJUA 4RX7A 1Q8WA 5CLPA 4CRSA 2Z60A 1TZDA 4BIDA 5A4EA 2EU9A 2DQ7X 4I0RA 5HKMA 3QX2A 2ONLC 3RMFA 1F5QA 2X39A 3KXZA 3CGOA 3MIAA 3TTIA 4KAOA 4YZMA 5CSPA 3EL7A 3TV6A 2ZB1A 3EMGA 4U41A 5BUJA 2ESMA 4QMOA 4C58A 4JDKA 4YJSA 5A6NA 3DK6A 1AQ1A 4K33A 2ITUA 5CQUA 1S9IA 3D7TB 4B0GA 2ZDUA 2W99B 3B2TA 4HZRA 3QUEA 3RNIA 4TYIA 4K77A 4E5WA 2GS6A 3Q4CA 5TT7A 2PZRA 4L7SA 2OK1A 3F3WA 4WIHA 2JDTA 4NU1A 1OITA 4HYHA 1UNHA 5KMOA 2QLQA 2X9FA 2X7OA 4IFGA 1K3AA 4C35A 3S1HA 3QTZA 4YNEA 3D15A 3I0QA 1ZMUA 4PTGA 1Q8UA 2VTOA 3K3IA 4D55A 4E3CA 3DNEA 2WGJA 4DH7A 3OXIA 3VS5A 3OC1A 3PXKA 4WUAA 3DZOA 4FG7A 4O0UA 4FL2A 3FAAA 4GU6A 4L3JA 5AR2A 2YDJA 4FG8A 2O65A 4CLIA 4IAIA 3ZSHA 4CMOA 3IOPA 1JOWB 3TNQB 2FSOX 3EFLA 5F4NA 2P33A 5CEKA 2OH0E 3O8PA 5FRIA 5JFWA 1YOLA 4ZTLA 1NXKA 3H0ZA 1J91A 2JGZA 1RQQA 2C3IB 1KE8A 2B4SB 4BBMA 5AUTA 2R3KA 3BWFA 3T3VA 4B8LA 1PXOA 3DDQA 2J4ZA 4XOYA 3OOMA 2BDFA 3FKNA 4BCOA 1W2FA 3C0GA 4D9UA 2WAJA 4O91A 3KXGA 3W10A 4F08A 5JRQA 3HA6A 4W9XA 4DEIA 3UQCA 3A99A 4J53A 4IWQA 4U43A 3A7GA 5IH5A 1W2CA 5L2SA 4C62A 3QC4A 2RFSA 2WIHA 3SOAA 2WMXA 3OZ6A 3PY0A 3TACA 4L52A 2DUVA 2PZIA 2WMUA 3EYGA 3LXNA 3EQDA 3EZRA 1W0XC 3BIZA 4LGDA 3D7TA 5HCXA 4FTQA 2AC3A 5BVWA 3Q53A 4WOVA 4EKLA 2R3PA 1LUFA 4BCKA 1JSUA 3QQFA 4XHKB 2WTKB 3B2WA 4I41A 4PV0A 1ZZ2A 4BTMA 4E6QA 3FMJA 4EHZA 4CKRA 2RSVA 3F9NA 2C5XA 5A4CA 3TUBA 1PMUA 4U5JA 2WIPA 4K1BA 4Y83A 4YLKA 4FIGA 1A9UA 3C4EA 4FTOA 4MD7E 2UW9A 4RA4A 3TZMA 4DITA 5I9XA 2QLUA 4ENYA 5M4IA 3Q5IA 4RPVA 4Z7HA 4BBEA 3EQPA 1VJYA 4J1RA 3S4QA 5CWZA 3D9VA 3MA3A 3TTJA 4BTKA 3NZ0A 2OFUA 3M2WA 3PA5A 5KCVA 1LP4A 4CMTA 5JQ5A 3ORMA 5KHXA 5FGKA 3LCOA 4G3GA 2R3MA 5JZNA 2OI4X 3GENA 4I23A 4IADA 1JBPE 4YZ9A 4BI2A 2UZTA 3F61A 1HCKA 4U7ZA 4XBUA 5HCYA 4I6HA 2FA2A 5CNNA 3EZVA 4R1YA 4D1XA 4BZOA 4ZSEA 4EOQA 4U3YA 4FIJA 4ZTNA 5AX9A 4BDBA 4C36A 4KIOA 4EWHA 4FTRA 1B38A 2X7FA 4XX9A 4L6QA 3ZLWA 4MXZA 5J9LA 4AXAA 2RG6A 3F6XA 3PXZA 4ANMA 5J7HA 1JNKA 3ZEWA 5F94A 1LR4A 3KF4A 4GIHA 1H1RA 1WFCA 3SW7A 3QZHA 4PMMA 1KSWA 2W9FB 3B8QA 3C0HA 5CSHA 3VS2A 3MH1A 3R9OA 1JQHA 1LPUA 1H00A 2C6EA 4M68A 4AP7A 2EVAA 3HUBA 3OW4A 4ERWA 2UW7A 4A7CA 2HENA 2RFNA 4AN2A 5B0XA 3E8EA 3MVHA 4UWBA 3C4XA 4EOLA 2VTMA 1BI8A 3RK7A 4LOOA 1JAMA 4JJRA 4D4SA 5K3YA 2VTIA 4MBJA 3CD8A 5HTCA 3QYWA 4E4MA 2XF0A 2H6DA 5I9ZA 5CAVA 4F1MA 3MPMA 4NWMA 1PXMA 2Z8CA 1ERKA 4EJNA 3JY0A 4PF4A 4F6UA 4KBKA 5I9UA 1Q24A 4IC7A 3VRYA 5LQFA 5JEBA 1YOJA 4FT9A 3FZRA 2CGWA 3O96A 4EK5A 5I9WA 3E87A 3R1YA 2X0OA 4AZSA 5FDXA 4E8AA 4YSMA 5TOZA 4FV5A 4WG3A 3O0GA 4PTEA 4AW0A 5HLPA 2XNOA 1O6KA 2QOLA 3P08A 3EN7A 4IVBA 2J5FA 5LVNA 5IH4A 3RAKA 2PVJA 4RX5A 5I4NA 3FLYA 4IVDA 5DBXA 2FVDA 2IZSA 4MWIA 3VO3A 2VTLA 4AZFA 4F63A 3Q9YA 3GC8A 2GHLA 2OZOA 3KU2A 2B9FA 4TRLA 4BGQA 3AGLA 2IN6A 3DJ5A 3LQ8A 4FRFA 4I6FA 1UA2A 1A06A 4ZTQA 3R83A 4MF1A 3NNVA 5K4JA 3UO5A 4FX3A 4NJDA 2J6MA 4CTBA 3WE8A 4R3CA 1WCCA 2Q0NA 4EZ5A 3HNGA 3R9HA 2QO7A 4C33A 3V5JA 2P2HA 2PVFA 3QQUA 1KV1A 4C4JA 3C4ZA 2YITA 4LL0A 4FTNA 3LFQA 3ZSIA 3OT3A 4XG9A 5DEYA 2E9VA 1ZY5A 4BCIA 4RJ5A 4DH1A 5JKGA 1ZY4A 3GP0A 2BALA 3ZUVA 2WOTA 4AE9A 3LQ5A 4ANNA 4CT1A 4O6LA 2R9SA 2VWZA 5E90A 2JITA 3HRBA 3ZO3A 2BFXA 3SW4A 3PJ8A 5JFSA 4E6DA 1V0BA 3GGFA 4X2NA 4C4HA 4J71A 3CS9A 1OKVA 4BHZA 3QRIA 4LOQA 4MK0A 2GTNA 4YC6A 1PF8A 4YTCA 4FVPA 3RPYA 3QRKA 4CFWA 2R3JA 4I24A 4G34A 2PHKA 2WEIA 1B39A 1JSTA 1OUYA 1REKA 4DFLA 1UU3A 4FV7A 3TNWA 3DKGA 3WZJA 1W2DA 4QTEA 3S00A 3FQSA 5FTQA 4UEUA 3HMMA 4EL9A 3MN3A 2V5QA 3LCKA 3LZBA 3BBWA 1CKIA 2XK8A 5IA2A 4ASXA 3G2FA 4GT4A 4CMUA 2VGOA 1CKPA 1YWRA 2OO8X 2P0CA 5AV0A 3RM7A 1YXXA 3TNHA 2WU7A 3V8TA 3LXLA 4QP9A 4BIEA 4EH3A 5EDPA 4HGSA 4ZK5A 2EXMA 5C8MA 1FVRA 4I20A 4RQVA 5CVHA 5C8NA 3PPKA 3MVLA 3LM0A 5J5SA 3TZ7A 3K3JA 2F57A 3A61A 4I4EA 2W4KA 2XVDA 2VWXA 2IO6A 3MH0A 3AMBA 3R9NA 3Q32A 1PXKA 4FKIA 3ZONA 2ERZE 1K2PA 3A8XA 3LCSA 3WZDA 2G1TA 4O4FA 4YMJA 2FH9A 3NW5A 1PMVA 3V01A 4L00A 4TTHB 4GVJA 3JPVA 3G9NA 3UO6A 4YJRA 3UE4A 4BCNA 5BMMA 5J79A 1WVWA 3A7FA 5FEQA 4YZDA 3W16A 3PTGA 5KUPA 3D5UA 4HGTA 2XIKA 4NK9A 4NUSA 5DR6A 3ZOSA 5FBNC 4NT4A 4O0VA 4BGGA 1FQ1B 3F5PA 5J95A 4GUEA 1ZYSA 4QMMA 4RFZA 3EFKA 3MFTA 4OTGA 4HVIA 2YLEA 2JDRA 2GNIA 2OICA 3HDMA 3C4FA 4EK3A 3Q9WA 3IW4A 3EWHA 5CVFA 5GJDA 3GC9A 5DPVA 3U8WA 3V5QA 4EBVA 5E8UA 3COMA 4FUYA 2W05A 4FSRA 5CENA 4E4XA 3P1AA 4ITJA 3FZSA 3GFEA 4QPAA 3NGAA 3JUHA 4AW2A 4EUTA 3ZFMA 2HAKA 3KF7A 4FTTA 1OKWA 4DBNA 5DT4A 2QOIA 3ULIA 4DEBA 2QR8A 3OT8A 1UU9A 4LGHA 1CMKE 2FUMA 5KZ0A 2DWBA 2QKWB 4A9UA 4E73A 4F9BA 4MQ1A 4I1ZA 2R3QA 4JDIA 3ODYX 1OIYA 1FGIA 3PA3A 5K4IA 4FOBA 3BYOA 2E9PA 3NUPA 3OS3A 4S33A 3KRWA 3OEFX 5HHWA 4O0XA 3WE4A 4YURA 5JGBA 3RAHA 1SM2A 3PJ3A 5AUZA 4DFNA 2PSQA 3A62A 3L8XA 2B7AA 2UZLA 3PXRA 4O96A 2OU7A 4BDEA 1FMOE 4N0SA 5AUWA 3VBWA 3TNIA 4M7IA 3DY7A 3QUPA 3DA6A 3IONA 2FSLX 4MNFA 4WD5A 2YDKA 3HRFA 4X3FC 5E8ZA 2ZMCA 4IMYA 1GNGA 3BYSA 2ZDTA 4BTFA 5HO8A 3RWQA 4ENXA 5HTIA 4ANBA 2C3KA 4V0GB 1QCFA 2C69A 4EZ7A 3L1SA 4RT7A 3SX9A 3UTOA 4Z3VA 3KULB 2C6KA 3BHYA 3G51A 2PZPA 3QD3A 5GZAA 3P23A 5CU2A 4GRBA 2ITPA 2GSFA 4G1WA 4TWCA 5C9CA 2ZM4A 4E6CA 4BCFA 3ZRMA 4OAVB 2VO6A 3WF7A 3JVRA 3PLSA 4TWOA 3MGYA 3Q4ZA 2VWVA 3VQHA 5CF5A 4D2RA 5HLNA 3NYVA 5TE0A 1SVHA 3QC9A 4C4GA 1XWSA 2OF2A 3KB7A 3DS6A 3UIXA 3D14A 4IVAA 3VHKA 1H1SA 3PWDA 4ZP5A 2UZNA 2XIZA 4CZTA 4DFZE 4MH7A 5C03A 2JFMA 2Y0AA 4M0ZA 4R7HA 3PG1A 5EFQA 3DAEA 5HD4A 2GNFA 2ITOA 1X8BA 4I3ZA 4AF3A 1JKTA 2XS0A 4HGEA 5AR7A 2A27A 4QP7A 5C27A 5FXQA 2XNNA 4Q2AA 4PQNA 2BRGA 3ORZA 4LFIA 5EI6A 4C0TA 3NUYA 3O8UA 5I3OA 3OWPA 4FKGA 5HESA 4HVGA 4TWNA 1CSNA 5IDPA 4NW6A 3R1NA 4XG2A 3PJCA 1I09A 3PA4A 4ANQA 3R9DA 4EOKA 1W7HA 3R7EA 1R0EA 5EM6A 3I7CA 1SVEA 4U44A 4QTAA 3R8MA 5JFVA 2JKMA 2X0QA 3PUPA 3HV3A 3CE3A 4CFMA 1BL7A 3AXWA 4FKQA 4HYSA 5IH6A 4U3ZA 1STCE 2ACXA 3ET7A 5CTPA 3NEWA 1OZ1A 3T9IA 5L8JA 3KRLA 4ZSGA 5E8WA 2XCKA 4YSJA 2VWIA 4IB3A 2Z7QA 3U51A 2KTYA 1GIHA 4PMTA 5BVOA 3DB8A 3T8OA 1VYZA 3IDCA 5M4FA 2VWBA 4YC8A 3KULA 2RL5A 5G6VA 3WBLA 3ZEPA 3O71A 2OXDA 4IAFA 4QRCA 3R7YA 4YJTA 4Q9SA 4WNPA 3ZM4A 3UO4A 3EN5A 3D4QA 2PVMA 3E7OA 3DCVA 3REPA 2GPHA 3RGFA 4A07A 4FKSA 3VS0A 4HNIA 4QMZA 4C2VA 3FSFA 4TYEA 5BVEA 4IBMA 3UOKA 5IUIA 5LMKA 2NP8A 3MBLA 3UOJA 4W4YA 4R3PA 4YC3A 4ZEGA 2YLFA 4YPDA 3T9TA 2VD5A 1MP8A 3DJ7A 3LFEA 1UKIA 4MTAA 2AC5A 3VNTA 2YFXA 3R6XA 3DBCA 1J1BA 5LCKA 4BI0A 4KNBA 5EM5A 4LMNA 3FYKX 3ZZWA 2IWIA 2QU5A 4F09A 4FYNA 4NEUA 2QC6A 2YJRA 3DZQA 2R3GA 4RC2A 2R3IA 4XUFA 3AC5A 2ETKA 3IS5A 2W9ZB 5AP1A 2WQNA 4PPCA 2GCDA 3DGKA 4ITIA 4QMYA 4F0GA 5M44A 5G1XA 4JI9A 4IZ5A 5IISA 2R7BA 2BIKB 4L7FA 2BDWA 2ZV2A 4XLVA 4X7QA 4K9YA 5DVRA 2Z7SA 3G0FA 2AYPA 4KKEA 4QYEA 4NZWB 1QPJA 1SNUA 1E9HA 3O17A 4KB8A 3LFCA 4UN0C 4ZSJA 2VZ6A 3NYNA 3ZBFA 2QODA 3L8SA 3VUGA 3KK9A 4D4RA 3QHRA 2OGVA 4DFYA 2UV2A 2C5OA 4ZTRA 3PE2A 1JKKA 2JDVA 2VTSA 3RPSA 2CN8A 2GNLA 4FKRA 5FG8A 4EQMA 1BLXA 5KNJA 5L6PA 3ZO1A 4ACMA 3U6HA 3HMIA 4KA3A 4C7TA 1O9UA 2Y4IC 4TYHB 4XNEA 2WTDA 4D9TA 3FY2A 5T6KA 2X8DA 4E5BA 1REJA 4I5HA 3BHUA 2C6TA 3IKAA 3FV8A 4DEHA 3NIZA 2I40A 4C61A 3IW6A 2HW6A 2QU6A 2GNGA 2XK7A 3MH3A 4BKZA 1SMHA 3MB6A 3DQWA 5BVNA 4QMTA 4J96A 2UZEA 4FSWA 4O0WA 1V0PA 5HI2A 4DC2A 2CHLA 4BDGA 3HUCA 2XKEA 2W5AA 3Q60A 3PXQA 5HLWA 4FI1A 3R8VA 4HGLA 3VBXA 4JNWA 2UVZA 3IQ7A 2RFDA 3I81A 2JD5A 2VNWA 2E2BA 3KRRA 1ZARA 5HO7A 4G6LA 3BCEA 3LLTA 3LFAA 1UVRA 4JS8A 4NM3A 4RC4A 4PL4A 4C02A 3U9NA 5AX3A 3L9PA 4J99A 3TG1A 5DWRA 4XH6A 2IW6A 4ZAUA 1VR2A 2CCIA 2J50A 4UX9A 2C5YA 3KMMA 2P4IA 1SYKA 2VN9A 4P4CA 3FZTA 5EYKA 5AV1A 3NNWA 2OIDA 5E1EA 5AIRA 3CY2A 4YHFA 5D10A 3LE6A 4HYUA 5CYIA 5IPJA 3WIKA 3ZH8A 4AE6A 4PWNA 5CU6A 3D83A 4JBOA 5ANGA 4O1OA 2XJ0A 3FMHA 4JG6A 5L2TA 4RVTA 5HVYA 4L44A 2X1NA 2XKDA 2F7XE 4JBQA 3PIXA 5AM7A 4M84A 4O0TA 1R78A 5B2LA 2Z7LA 4TYHA 3NYOA 3HV5A 5CQWA 3VJNA 4WRGA 4J8MA 1U5RA 3LFSA 3TI1A 4FV9A 4FTUA 1ZXEA 2ITVA 3QQJA 2LAVA 3FMLA 4EOSA 3C50A 3NR9A 2BTSA 3FMKA 3NW6A 2X2MA 1IR3A 2B9JA 4FTLA 2JDOA 4IIRA 4L45A 2WHBA 2JBOA 1Q8TA 4FT5A 3LJ1A 1DS5A 2H34A 2QCSA 2C6IA 2WELA 4F6WA 3BU3A 3QTIA 4NTTA 5AR4A 4QOXA 1UU8A 4USDA 4IAKA 4J52A 3ZZEA 5ANOA 2IVVA 3NPCA 5D9HA 5BNJA 5L2IA 3SQQA 3A4PA 4ERKA 2WMBA 2YIQA 4ALWA 2XNEA 2LGCA 3KL8A 3R22A 3U4WA 2C68A 4J97A 5EW8A 5KHWA 2H9VA 3QQGA 4FTCA 3LMGA 3W2RA 2XM8A 2Y6OA 4LI5A 1LEWA 3FKOA 1OVEA 3D94A 4O0RA 3ROCA 1ATPE 3O7LD 4GT3A 3DXNA 3R28A 4GFOA 1WAKA 2E9OA 2VGPA 4EORA 3OWJA 4DG3E 3QU0A 3F3ZA 4EC9A 4RZVA 4CXAA 3Q2MA 4FV0A 5HE0A 5CAUA 3ZUUA 2PVNA 3ROYA 2ZAZA 4BHNA 3F3TA 1MRUA 3QX4A 3VS7A 4NKSA 3SDJA 3TIYA 1W82A 5DNRA 4HCUA 1P14A 3BU6A 2R7IA 1E1VA 3AC3A 1KE9A 3FJQE 3NLBA 3PP1A 5FQDC 1PYXA 3DFAA 5JQ8A 3BU5A 3C5UA 5HIEA 2YN8A 3QBNA 5AR5A 2QG5A 5HO6A 4YTFA 4ACHA 2W1DA 2ZYBA 4BCPA 3IW8A 4X3FA 4FIIA 1Y91A 1AGWA 2PVYA 1DAWA 1XH4A 3IW5A 3E5AA 4B99A 1Q62A 3GCQA 3KRJA 3PZHA 4E93A 4K11A 2W17A 3ZMMA 4GJ2A 3O2MA 3P9JA 2AQXA 1XBBA 2YJSA 4DH5A 2C30A 4PY1A 4P5QA 2JIUA 4E4LA 3PZEA 1WBSA 3PVBA 3KVWA 3PRIA 1BI7A 3MA6A 3KVXA 1XBCA 4QTCA 4C57A 5H9BA 2QOBA 4QMLA 4ZY5A 3H9FA 3EYHA 3SC1A 2C6DA 5HG7A 4BCQA 2QOCA 2WFYA 3CBLA 3HRCA 3LFDA 5L8KA 2GQGA 4R5SA 4L46A 4BWPA 2OZAA 2F49A 4C3PA 4OTRA 3HP2A 3OP5A 5EHYA 2XK4A 3BE9A 2IZRA 5HNBA 3QRUA 4U45A 2C1BA 2PY3A 4BDFA 2ZJWA 3OUNB 2XNBA 3Q4TA 3FLSA 2SRCA 4NTSA 3BRBA 2OJFE 3ACKA 4WNMA 2GTMA 4ZJJA 3W1FA 4TL0A 5DLSA 4FKTA 3CLYA 4I6QA 4UZDA 4BDCA 2OJ9A 2PWLA 5KMJA 4AW5A 5CU0A 4YLLA 3MPTA 3U4UA 4GU9A 3Q52A 4FSUA 3TZ9A 3BQRA 3LHJA 4HW7A 4L01A 3L9LA 4OR5A 3COIA 4WSYA 5B2KA 4DGLC 4O2ZA 2OKRA 1PJKA 4QP6A 4X2KA 4XLIA 1CM8A 1T46A 4BF2A 5HBHA 2W5BA 1YRPA 1OL1A 4TZRA 4GW8A 3BV3A 4K0YA 5TKDA 2CDZA 3EOCA 5KKRB 1BMKA 4D2VA 1V1KA 4O4EA 4AS0A 5C1QB 3BGZA 5KBQA 2HYYA 3NDMA 4M12A 3MSSA 2B55A 1PHKA 2RFEA 2CPKE 5HD7A 4UBAA 1PMEA 1R3CA 2G9XA 5KMNA 4M97A 5KMIA 3QA8A 4NH1A 1OL6A 3F5GA 3G90X 2XYUA 3QCSA 4ZOGA 4BCGA 2YDIA 4K6ZA 3LCDA 3OF0A 4FNXA 5E92A 4AT3A 1MQBA 3NW7A 1CTPE 4ONAA 4EHVA 3SAYA 3H3CA 3UPXA 3DPKA 2DS1A 1Q99A 4DGMA 4JG8A 4X2FA 5E91A 2PUUA 4BYIA 2YCSA 3TKIA 4KKHA 4NIFA 1KOAA 5CSWA 2GU8A 5M53A 3S95A 4CZYB 3Q4UA 3EN4A 3FLZA 5AEPA 2W1GA 3D0EA 4D2TA 4RX9A 4DH8A 5D41A 5ITAA 2OXXA 2HIWA 3QTRA 4O38A 4D2SA 3F66A 5AV4A 2R3HA 3G33A 5C01A 4M13A 3QTWA 5EOLA 3QZIA 5ANDA 5KMLA 3UOHA 2J2IB 4O0SA 4DGGA 4DEEA 4EZ3A 5H8BA 4LRKA 3HA8A 3VHEA 4JDJA 1OECA 1TKIA 3FMDA 1TQIA 2W06A 4W8DA 5IG1A 2PK9A 5T68A 4AU8A 4BDHA 1TVOA 5HG5A 1SVGA 3OW3A 3FXXA 4U9AA 3QCQA 4NCTA 2XEZA 3FLNC 4RA5A 2O63A 3MY0A 2J51A 3WF8A 2ZB0A 4FEQA 1BKXA 1ZMWA 3HVCA 5T3QA 5DE2A 3LOKA 3VJOA 5JGDA 2R0UA 1K9AA 3M1SA 4M67A 4RWIA 4EWQA 3KCKA 3PPJA 2BCJA 2I0YA 5ANJA 2WQOA 2XBAA 4C4IA 1WBWA 1APME 1Y6AA 3OXZA 2J0IA 5HIBA 1ZOHA 2ITZA 1JWHA 4JOAA 4JXFA 4APPA 4KSQA 5CZIA 4IX3A 3RM6A 4UYAA 1XR1A 4B6LA 5CEQA 2FSMX 4JX7A 5L2QA 1CDKA 3C4CA 5L6WL 2WMRA 4FV2A 3R8PA 3SRVA 3BV2A 1PYEA 3BYMA 2ERKA 4XV1A 4BDJA 4BTJA 1H24A 3FI3A 3C0IA 2PMLX 3OBGA 4YO6A 5TR6A 4FODA 1JLUE 3FUPA 2WTCA 4IB0A 4XRJA 4O22A 3E3PA 4MXAA 4GG7A 2WQEA 4JAJA 4L3LA 3BE2A 5EYMA 3VUDA 3NUSA 2BIYA 2C5NA 2XA4A 4FKVA 3GC7A 3QTQA 3UMXA 4ZLZA 4GV1A 4QMPA 2FSTX 3R7GA 3FL5A 3MY5A 3F82A 1ZYJA 3A60A 4FIHA 5E8YA 5HICA 3FE3A 3I6WA 3K5UA 4XG6A 4G31A 4RIYA 2OF4A 2UW4A 3QGYA 5LXMA 3RCJA 3ZXTA 4FVRA 2HZIA 3KXHA 3FQHA 3TL8A 1Q8YA 3BYVA 3EKNA 2HZNA 1G3NA 4H3QA 5AR8A 4MXCA 4D5KA 5IMEA 4UXQA 1OL5A 4ACCA 1H0WA 3UP7A 4CD0A 4MKCA 5HEZA 4EYMA 4U42A 3UNKA 2O5KA 5IA1A 3LXPA 4DEDA 3TUCA 3VBQA 5BYZA 4N6ZA 4IAZA 1E1XA 4N4SA 5AP3A 3AGMA 2UZOA 4E4NA 3F3VA 3P0MA 5BUEA 4AGDA 2BDJA 3K5VA 4FKJA 3A8WA 2W0JA 3FHIA 2J0JA 3P5KA 2JKQA 5EG3A 1H26A 4KS7A 3TT0A 3O8TA 4I93A 3RWPA 3VRZA 4FSMA 4FL3A 2UZDA 4O4BB 3UZTA 4KINA 3HX4A 3FSKA 2R3FA 3MY1A 4FV4A 4IACA 4KBCA 3ERKA 4OUCA 3KGAA 5CF8A 3Q96A 4FZ6A 4YO4A 4M14A 1Q41A 3D5WA 4UMPA 4AFJA 3KN6A 3G5DA 4IFCA 4JBPA 3QAME 3UC3A 2J0KA 4FNZA 2OXYA 4K8AA 2VX0A 4GMYA 4TYJA 3RINA 3Q9XA 5HVKA 3ODZX 4FKPA 4GL9A 3RKBA 3DBQA 4GUBA 3I4BA 2QI8A 4GK3A 5EK7A 4RIOA 5K0XA 2XJ2A 5IKWA 4AAAA 3DQXA 4JL9A 5KZIA 4EH5A 3IW7A 3ORIA 4OTQA 4AA0A 1UV5A 3R00A 4EH2A 1ZYDA 4CFFA 3VW8A 3FI2A 3FDNA 4KS8A 4NKAA 4DH3A 4ZJVA 4ID7A 3GVUA 1U46A 2BHEA 2VTQA 3CPBA 4XV3A 3ULZA 4IEBA 4MEDA 3V6SA 1IEPA 2CCHA 4IZYA 1GOLA 2B1PA 4HOKA 3DLSA 3R2BA 2QOQA 4RFYA 5CS6A 2VTHA 3RPOA 4AACA 5EDRA 3NUXA 5L4QA 3FMEA 4LM5A 1DAYA 3WILA 4LOPA 4QTDA 2Y8OA 3H4JA 5DG5A 1Q3WA 3R73A 2BVAA 3D5VA 4HVHA 5I0BA 2I0EA 3PXFA 1M7QA 4FVQA 5E8SA 4ALUA 4QMXA 3ENMA 2YIRA 2R4BA 4G2FA 2YM6A 1O6LA 4QYYA 2V7AA 2ONLA 2JIVA 3PE1A 3LPBA 4FT7A 5CXZA 3LFBA 3P78A 4JT3A 5FEDA 2NPQA 3AMAA 4FK3A 3BGQA 3R8ZA 2XZSA 2IW9A 3UG1A 2VNYA 2ZVAA 4UMRA 5DFPA 5IA5A 1HCLA 4RFMA 4O4CA 2C3LA 4QNAA 2XIXA 3ORTA 4ZJIA 2W1CA 4L67A 1P4OA 3BQCA 3QQLA 1PXPA 3VS3A 3ZSGA 5DEWA 2YM3A 3QUDA 5TF9A 3ZLXA 2CJMA 3C51A 5HE2A 1GZNA 5AADA 2JFLA 4XYFA 3HEGA 5HX6A 5HIDA 1ZYCA 4XP2A 5F20A 4GH2A 3SLSA 3RHXA 3ZFXA 2Z2WA 2B53A 4FZFB 4N70A 4LRMA 3BBTB 3CTQA 3NNXA 4DG2E 3VS6A 3UDBA 2UW6A 3ANRA 4I5MA 4D1SA 2REIA 3VS1A 2BRNA 3VN9A 3LIJA 1KV2A 4AUAA 2BRBA 1OI9A 2QQ7A 3BHHA 3ALNA 2X0GA 3VIDA 4GFMA 3FC2A 4GFGA 1M2PA 3EB0A 2XK6A 3GI3A 3PVUA 4RJ3A 3V5PA 4C3FA 4GG5A 3UJGA 3EN9A 4Y8DA 3BX5A 3GU7A 4GK2A 4FTMA 5M56A 1URWA 3GU6A 5A14A 4F4PA 3BI6A 3A7IA 4GYGA 4YBJA 4XG4A 2PTKA 4FSNA 2FB8A 1OM1A 3UIMA 2I0VA 2XKFA 4CQEA 4IM0A 4JIAA 3PG3A 4FIFA 4N6YA 5I9VA 3L9MA 4AZVA 3R2YA 4NFNA 5KBRA 2GS7A 5HG9A 5EHOA 4F99A 3KMUA 3KCFA 3ACJA 2JAVA 4NFMA 4E1ZA 3R0TA 2IF8A 3MFSA 4CSVA 4ACDA 3GQLA 5IEYA 4U80A 2WTJA 4OBOA 2C0TA 1KE6A 3BGPA 5AP0A 2XUUA 4YJNA 4EUUA 3VULA 4CT2A 1OIQA 1F3MC 3TJCA 3UYTA 2V55A 4AFEA 3OCSA 4OW8A 3A2CA 5M4UA 1M17A 5IEVA 3FXZA 1WVXA 2G2FA 2QO9A 2X9EA 5EYCA 4M69B 4QNYA 1HOWA 5GZ9A 4FT0A 4IE9A 4AZTA 4MBLA 3E88A 4PPAA 4RX8A 5FM2A 2HY81 4KSPA 4AOIA 3WF6A 4MQ2A 4FZAB 5F9EA 4MWHA 4PTCA 2VO7A 3PXYA 2EWAA 2O0UA 5ETAA 3QRJA 4PL3A 2XH5A 3JXWA 2HWPA 4FSQA 3QQHA 5CALA 3D2IA 5DR9A 1DI9A 2X2LA 3TN8A 1KOBA 2RF9A 4FMQA 3IECA 1UU7A 2W1EA 4FF8A 2V22A 4E20A 5CY3A 2BZJA 4O21A 4RC3A 3MVMA 2BILB 2I0HA 3ANQA 2R3OA 1JVPP 4IQ6A 2W5HA 3ZHPC 1U5QA 2P55A 3DLZA 2PVRA 3ALOA 4QQ5A 3U87A 4IDTA 3FMNA 3HMNA 2BFYA 3GEQA 4KIPA 4EK6A 2Y6MA 3GNIB 3DAJA 5K5XA 4K2RA 4MNEA 1MRVA 1PMNA 3FPQA 5BPYA 3ZO2A 2CLQA 3S2PA 3NWWA 3PIZA 1OUKA 4IZAA 3IOKA 1YQJA 3QZGA 3UNJA 3VUKA 2WKMA 4C59A 4E26A 3BLRA 4GJ3A 4G3CA 4CV8A 3B8RA 3OWLA 5E8XA 3NUNA 5HU3A 1YXUA 3I60A 3GCPA 4YNOA 4F1TA 4G3FA 5B7VA 4EHGA 2F2CB 4OTDA 4FK6A 4D0WA 1UWHA 3AD5A 4OTIA 3OOGA 3ZDUA 5JMSA 3PFQA 3WZUA 5AJQA 2E9NA 2XNGA 2NRUA 5ANEA 1ZMVA 2VTNA 4USFA 4A9SA 2R5TA 1ZRZA 4BYJA 3ZXZA 4EQCA 4GT5A 4Z7GA 3QD0A 4ZZOA 1B6CB 5HNIX 5LVOA 1WBTA 5CSXA 4QQJA 3ELJA 4OAUC 4M69A 2JC6A 5K0KA 4D5HA 5FXSA 5HZNA 4RIYB 3GT8A 5ETFA 4RIXA 3RP9A 4U97A 2JKKA 5ANKA 3ZO4A 5M4CA 2ETMA 2YM4A 3R1QA 4EOJA 3MB7A 3OMVA 5EI2A 4UYNA 4DINA 3LVPA 2OJGA 2HW7A 2O3PA 4F9WA 2BZKB 3M11A 4TPTA 4AZEA 2XK3A 4RWKA 4L3PA 4B8MA 3DOGA 4YR8A 3VS4A 2OIQA 3MPAA 4UZHA 5AP4A 3A7JA 3G6HA 1QPEA 4FSTA 1Q4LA 3CY3A 3MI9A 2NRYA 2R3LA 4HPUE 1P2AA 4ALVA 2PZ5A 1IG1A 3N51A 4FV1A 4M15A 3KXMA 4JDHA 5HBJA 3GB2A 3R7OA 4EH9A 1FINA 4L42A 2CGVA 4DN5A 5E8TA 4PX6A 2H96A 2VO3A 2E9UA 3PPZA 1P4FA 3EQHA 3GFWA 4E5AX 3U6IA 4FSZA 3EFJA 4GS6A 5LMAA 2QOFA 3H10A 4JBVA 5I5ZA 2Z7RA 4FKLA 4PMSA 3E64A 2VU3A 2Y7JA 4J7BA 4Z55A 1M2RA 1OIUA 3EIDA 5EM8A 3U9CA 1BL6A 1YDTE 3OHTA 1YDSE 2WTKC 2ETRA 4QT1A 1TQPA 3IPHA 2GNHA 4J8NA 3KMWA 3VQUA 3DT1A 3GOKA 4WRSA 3F7ZA 5DH3A 4CFVA 4WUNA 2VRXA 5AV2A 4BKJA 3P4KA 4FNWA 2HK5A 3CC6A 4XRLA 4MBIA 3JVSA 4KIKA 3G0EA 4BIBA 3PWYA 4RG0A 3UC4A 5IZFA 1Q8ZA 3R21A 2VTTA 4FL1A 4W4VA 4II5A 2BKZA 1URCA 4I94A 4IJPA 2A98A 5AP6A 4BBFA 4F0IA 2B9IA 5FWKK 3GU5A 3Q3BA 3WIGA 3TNPC 3PY3A 3FKLA 4A9YA 4QD6A 4KABA 3RCDA 5DGZA 4QP3A 3OTUA 1SZMA 3COKA 4KIQA 3SVVA 3PYYA 4IWOA 4Q9ZA 3UBDA 5BMSA 4M3QA 5AP2A 3O7LB 4WG5A 1DI8A 2A1AB 4NM0A 4IWDA 4P7EA 4LUEA 2HZ4A 1UNGA 3I5NA 4DG0E 3DKCA 2WNTA 4EKKA 1GZ8A 5IEXA 5J1WA 1WBVA 3PSCA 4H36A 5D7AA 1RW8A 1H1QA 1WZYA 5CANA 3VUTA 4QMVA 3VW6A 2W4OA 3OG7A 4ZLOA 3FYJX 4FZ7A 3LXKA 1PXLA 3FXWA 4ZIMA 3MFUA 3W8QA 3MIYA 3ZBXA 3EQBA 3IO7A 3SA0A 2W1HA 3IGGA 4QYFA 4X3FB 1XH8A 3I6UA 4JR3A 3BLQA 4B4LA 2XP2A 3V3VA 3R7UA 3RJCA 3CP9A 4NJ3A 2CGUA 2BAKA 2JBPA 4M66A 3VBYA 2UZUE 3UIUA 2J9MA 2ITQA 5DT0A 4IM3A 5BUIA 5LJJA 2G15A 4EOIA 1OPJA 2OSCA 4XBRA 4G3DA 4ZSLA 4EOOA 3I1AA 3LJ0A 3MVJA 4MYGA 5KX8A 5HE3A 4PMPA 2AUHA 4C38A 3KQ7A 4G5JA 2C3JA 1R0PA 4TY1A 3FBVA 2QOOA 4PPBA 5AUVA 3GC0A 2GMXA 5L8LA 3OBJA 5DT3A 2WMQA 4V05A 5HTBA 3LW0A 3QXPA 5AAEA 1NY3A 4OTWA 4ZS0A 4BGHA 2OZAB 4QO9A 4Y72A 2FYSA 3AG9A 1FVVA 3TXOA 4DFXE 3SOCA 4FZDB 5GZ8A 3V6RA 1YXTA 2YM7A 3FHRA 2C4GA 3Q6WA 2ITTA 5CU3A 4CCBA 4NM7A 1VZOA 3DKOA 4O0YA 3QTXA 3DNDA 4Y46A 4YJVA 4CYIA 2ITXA 5A4QA 4FTJA 1RJBA 5FDPA 4RJ7A 4XV2A 3QLGA 4EH8A 4W9WA 3DTCA 3R71A 4U0IA 2BR1A 2WTWA 2YABA 3CEKA 2ZMDA 4IM2A 2XMYA 4S2ZA 5L2WA 3ZU7A 4FT3A 1OIRA 2UZVA 4O4DA 4YJQA 3EL8A 3AD4A 4KWPA 1GY3A 3DTWA 3F5XA 3SXRA 4BCJA 4FKUA 5ANIA 4NW5A 4G6OA 4W4WA 2IW8A 2X6DA 4MD9E 4JX3A 5AR3A 2VX3A 3AC1A 5ICPA 2P3GX 4F0FA 4DEGA 2C1AA 3MTLA 4HJOA 3LAUA 5C8KA 4CLJA 4LV5A 2XCHA 4CKJA 2R3NA 5GHVA 3G9LX 3H9RA 4IH8A 4OTPA 3WF5A 1PXNA 3HMOA 4CZUA 5JSMA 4UV0A 2FGIA 4G17A 3NNUA 3C9WA 1OGUA 1QL6A 2W1ZA 4GK4A 4U81A 5CVGA 4CTCA 4XP3A 2O64A 1GIIA 2FO0A 2V62A 3KXXA 3NRMA 3KXNA 4QYHA 3PP0A 2VUWA 4QMUA 3Q9ZA 3HGKA 4AGUA 2G2IA 4C4FA 5HU9A 3W2OA 4WSQA 3UYSA 4BDKA 3AC2A 3O51A 4BB4A 3WF9A 2XKCA 3V8WA 2RKUA 4IWPA 4NIFB 4ASZA 4RRVA 2CLXA 4UXLA 4RVMA 5A4LA 4XV9A 1H28A 3QGWA 3RPRA 3BLHA 3P7AA 1L3RE 3Q04A 3P7BA 3Q5ZA 5BYYA 4X6QC 3LM5A 3GCVA 2VV9A
chains in the Genus database with same CATH topology
4O4CA 2A98A 4O4DA 2X0OA 4FRFA 2X0PA 1W2FA 1W2CA 2AQXA 4O4BB 4O4EA 2IF8A 2IEWA 2X0QA 4O4FA 1W2DA 1TZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O4C A;  2A98 A;  4O4D A;  4FRF A;  1W2F A;  1W2C A;  2AQX A;  4O4B B;  4O4E A;  2IF8 A;  2IEW A;  4O4F A;  1W2D A;  1TZD A; 
#chains in the Genus database with same CATH topology
 5LCJ A;  4GSB A;  1JKS A;  2BRO A;  4FIC A;  4J95 A;  1GIJ A;  3RZB A;  2PMI A;  2QOH A;  4XCU A;  4DAW A;  3D2K A;  4WHZ A;  5CNO A;  4EON A;  1WBP A;  4L8M A;  4OTH A;  4BIC A;  2CSN A;  4K18 A;  5FD2 A;  4EQU A;  1O6Y A;  3BHT A;  4LRJ A;  4KKG A;  5J7B A;  3H9O A;  3HV4 A;  3KFA A;  3SV0 A;  4DGO A;  3HEC A;  3TUD A;  2A2A A;  2WO6 A;  4D0X A;  4D1Z A;  4QQT A;  2YWP A;  1XJD A;  4L9I A;  3MS9 A;  3E3B X;  4ASE A;  4WKQ A;  2F7E E;  2HXQ A;  4ARK A;  3D7Z A;  2GS2 A;  4XEY A;  2A0C X;  3RAW A;  4C3R A;  4QP1 A;  3KEX A;  4BDI A;  4DLJ A;  2YHV A;  5CSV A;  4RSS A;  4IAY A;  4S31 A;  5EI8 A;  4QYG A;  5CF6 A;  3HV6 A;  3UMW A;  4IC8 A;  4HYI A;  1ZOG A;  3OXT A;  5AUU A;  2QHN A;  3BHV A;  4KRC A;  1FGK A;  2Y4P A;  2YIX A;  4J98 A;  4P5Z A;  4U79 A;  2G01 A;  5AUX A;  4AG8 A;  4FKW A;  3C13 A;  2VTA A;  1XH6 A;  1M14 A;  2Y4I B;  3SRV B;  4JQE A;  5EHL A;  4MAO A;  4XP0 A;  4HPT E;  4L68 A;  5BVF A;  4JQ8 A;  4WBB B;  3DK7 A;  3K54 A;  3MJ2 A;  4PL5 A;  4H1J A;  5A6O A;  2NO3 A;  3F7W A;  3GUB A;  2UW3 A;  4GVA A;  3QQK A;  4F70 A;  2YAA A;  2J5E A;  3ZC6 A;  1XBA A;  1M52 A;  4WBO A;  3QCX A;  4ITH A;  5LAR A;  4HNF A;  4O2P A;  5M51 A;  4EH7 A;  3ZLS A;  3OEZ A;  4I5C A;  2J90 A;  2GFC A;  3EFW A;  1CKJ A;  1OB3 A;  2B52 A;  2IVU A;  2O8Y A;  1XH9 A;  3FZ1 A;  3F69 A;  2QO2 A;  1OMW A;  1IAS A;  4H3P A;  4Y85 A;  5DI1 A;  3KK8 A;  5IA4 A;  1VYW A;  2WB8 A;  2PMO X;  3LCT A;  3RVG A;  1GZO A;  2XM9 A;  5J9Y A;  2C47 A;  3G6G A;  3FQE A;  3MJ1 A;  3DU8 A;  4I0S A;  3VC4 A;  3FLW A;  4F9C A;  5JK3 A;  3ZUT A;  4ANL A;  5HVJ A;  4EOM A;  4X0M A;  3QRT A;  3QTS A;  3UPZ A;  5J1V A;  2IVS A;  1VEB A;  3AC8 A;  4YTH A;  3EQR A;  3IDP A;  5J8I A;  4AGC A;  3R8L A;  1H1P A;  3EH9 A;  2HOG A;  3TV4 A;  2KUL A;  2J0L A;  2RIO A;  2UW0 A;  3PSD A;  4QP4 A;  3ZRL A;  4A4L A;  1Y8G A;  1YKR A;  5EYD A;  3F5U A;  5HQ0 A;  2OFV A;  3ZLY A;  4TW9 A;  1GJO A;  3HL7 A;  2Y9Q A;  3UGC A;  2YIW A;  4EC8 A;  4MHA A;  4Z16 A;  2BZI B;  2VTP A;  1H07 A;  4IX6 A;  1KE5 A;  5CT7 A;  3CTJ A;  3QHW A;  3QXO A;  4AGW A;  4V04 A;  5CXH A;  5JZJ A;  3P86 A;  5L6O A;  4CRL A;  1BX6 A;  3UZP A;  4YTI A;  3E92 A;  3RAI A;  3FMM A;  3GXL A;  3ORN A;  4Y95 A;  3DFC B;  4D58 A;  4EBW A;  5LMK C;  4IJ9 A;  5EH0 A;  4ACG A;  3HDN A;  4F9A A;  1WBN A;  4MF0 A;  4AT5 A;  3PY1 A;  4TND A;  1YDR E;  2GHG A;  3O50 A;  4AWI A;  5AV3 A;  3JS2 A;  3GBZ A;  4RZW A;  4ZLY A;  3PRF A;  3GOP A;  4BWX A;  1ZZL A;  4LQM A;  5H8E A;  2XB7 A;  2WMW A;  3C1X A;  2IEW A;  2YM5 A;  5IDN A;  2X6E A;  4NM5 A;  4UMQ A;  4XJ0 A;  4BDA A;  4M8T A;  4FKO A;  3OTV A;  5DN3 A;  3WZK A;  5CZH A;  3TZ8 A;  3W8L A;  2WMS A;  1H1W A;  2Q0B A;  3UVQ A;  4IDV A;  5CAP A;  5D7V A;  2XRU A;  3VAP A;  5HX8 A;  1FMK A;  2RG5 A;  4QMN A;  5FTO A;  4D28 A;  4TYG A;  4YZC A;  4MXO A;  1RDQ E;  4GEO A;  4DCE A;  4MCV A;  3TJD A;  5BVD A;  4HCT A;  5IA3 A;  2X2K A;  3BZ3 A;  4IAN A;  4A9T A;  4F1O A;  4OT6 A;  1MQ4 A;  3NSZ A;  3GCU A;  4PNK A;  3MWU A;  3QKL A;  5E8V A;  2PVK A;  3HP5 A;  4E6A A;  1NVR A;  3QF9 A;  2J7T A;  3V5L A;  3WAR A;  3KA0 A;  5AAG A;  1ZYL A;  3R1S A;  2V7O A;  5H3Q A;  4YHJ A;  2QON A;  3W18 A;  4C4E A;  5IF1 A;  3CXW A;  3R63 A;  4BI1 A;  3MYG A;  2XEY A;  2OW3 A;  4JIK A;  3L9N A;  3WI6 A;  3NX8 A;  3OFM A;  4RBL A;  3SKC A;  4HVS A;  4U8Z A;  3AT4 A;  1W83 A;  3O23 A;  3MFR A;  3ORL A;  5D12 A;  3BKB A;  4JVG A;  1YWV A;  4H1M A;  1Y8Y A;  4X2G A;  1GAG A;  4FTK A;  4XMO A;  4FR4 A;  3PVW A;  4MXY A;  5K9I A;  1J3H A;  4C37 A;  3UP2 A;  4FBX A;  4BFM A;  5EOB A;  4R8Q A;  2A19 B;  4DTK A;  4UB7 A;  2UUE A;  2W1F A;  4QTB A;  2XRW A;  3NIE A;  2C6O A;  4Q5H A;  4CV9 A;  4RJ8 A;  2BHH A;  1XH7 A;  2BTR A;  5CAO A;  2J0M B;  2W1I A;  4BL1 A;  4EI4 A;  4B9D A;  1Q3D A;  1ZWS A;  2C0O A;  4G6N A;  4R7I A;  2WMA A;  4XG7 A;  3ZCL A;  5CEM A;  5CAQ A;  4MX9 A;  4IX4 A;  3RK5 A;  2OIB A;  2PZY A;  4QMW A;  3TIZ A;  5M55 A;  1PKG A;  4FV8 A;  1ZAO A;  5LVP A;  1Q97 A;  4I0T A;  4BCH A;  3R01 A;  4D2P A;  3CCN A;  3FY0 A;  2ITW A;  5DA3 A;  5LMB A;  3FL4 A;  4QMS A;  4D4Y A;  5JN2 A;  4GYI A;  3TCP A;  1Z9X A;  4FUX A;  1YOM A;  4RMZ A;  1T45 A;  3CQW A;  4F7S A;  3ETA A;  5ACB C;  2H8H A;  1GZK A;  4X6R A;  1NA7 A;  3ORP A;  4WO5 A;  3VF8 A;  4PDP A;  4MXX A;  1U54 B;  4OGR A;  4PNI A;  4P90 A;  3QWJ A;  3VBV A;  3WOW A;  5AMN A;  4DYM A;  4FA2 A;  2QNJ A;  4QQC A;  2X7G A;  3RPV A;  3BEA A;  4JLC A;  3E8D A;  3KKV A;  2YA9 A;  3FZO A;  5FP6 A;  3I0O A;  3SXS A;  2CMW A;  2X0P A;  3DKF A;  5C26 A;  3II5 A;  4S32 A;  5HOR A;  5LVM A;  4R3R A;  5IMX A;  2WEV A;  4U40 A;  3S3I A;  4A4O A;  5I3R A;  3NUU A;  3C7Q A;  2PMN X;  3SXF A;  4XG8 A;  4BCM A;  2R2P A;  1OKY A;  3V51 A;  3OCB A;  4ZY6 A;  4ANO A;  4AA5 A;  2EB2 A;  4A4X A;  5A9U A;  5TO8 A;  4G9C A;  4S34 A;  4YGA A;  5HBE A;  1H27 A;  3EQI A;  3S0O A;  3AQV A;  3D5X A;  4ANS A;  1W8C A;  4AX8 A;  5HE1 A;  5FLF A;  3WYX A;  4ZXT A;  1MUO A;  2OJI A;  2F9G A;  4L53 A;  5FXR A;  1Z5M A;  4UWY A;  5B2M A;  3ZFY A;  4EH4 A;  4FTA A;  2WD1 A;  3RNY A;  1Y57 A;  5IA0 A;  4RJ4 A;  3TV7 A;  5BVK A;  1IA8 A;  5CEP A;  3AT2 A;  3IK3 A;  5AA8 A;  2VWW A;  3L8P A;  5D11 A;  1U59 A;  1BYG A;  1YW2 A;  3CQE A;  3TEI A;  5CF4 A;  2X4F A;  2UZW E;  4AZW A;  4C34 A;  4AOT A;  3FLQ A;  4CFU A;  5LWM A;  2HZ0 A;  4TN6 A;  4M0Y A;  4RLL A;  4EHE A;  5DIA A;  4BZD A;  4IB5 A;  3ENH A;  2XIY A;  2VX1 A;  2B54 A;  2R3R A;  3Q6U A;  5EM7 A;  3W2S A;  4KRD A;  1OKZ A;  4X2J A;  3F2N A;  1H25 A;  1YVJ A;  2PE1 A;  4UAL A;  4PDO A;  5AAF A;  2ITN A;  3C4W A;  3E7V A;  5CEO A;  5KMM A;  2A4L A;  3EHA A;  3ORO A;  4X21 A;  4G9R A;  3PJ2 A;  2BAQ A;  4R5Y A;  1OL2 A;  4KBA A;  5DRD A;  4PP9 A;  1PXJ A;  5BX0 A;  3BWJ A;  1LEZ A;  2UW5 A;  3E93 A;  2WMT A;  3ZS5 A;  3K2L A;  3NYX A;  4MNE B;  2VTJ A;  3MH2 A;  2BMC A;  4G5P A;  4BVU A;  1YI4 A;  5H8G A;  4Y5H A;  1FOT A;  4FSY A;  2ZV7 A;  5EKO A;  1EH4 A;  3OWK A;  2VWY A;  3W2P A;  5EKN A;  1U54 A;  5AIK A;  3KN5 A;  3IGO A;  3EN6 A;  1XH5 A;  3R7I A;  5FM3 A;  4FIE A;  3QAL E;  5D1J A;  1ZOE A;  5L3A A;  4RQK A;  3I7B A;  4WG4 A;  4FV3 A;  2EUF B;  2UVX A;  3A7H A;  2IZT A;  4AN9 A;  4FC0 A;  4QPM A;  4YU2 A;  1PKD A;  2XIR A;  3CJG A;  4H3B A;  4DGN A;  2YAK A;  3EKK A;  2PVH A;  3CJF A;  4I92 A;  3V8S A;  3R7V A;  3H0Y A;  2XYN A;  3P7C A;  3EQG A;  2IZU A;  2UVY A;  4WA9 A;  1UWJ A;  4R6V A;  4E7W A;  4QMQ A;  1Q5K A;  4BC6 A;  1H01 A;  3JY9 A;  1NVQ A;  2WXV A;  3IDB A;  5GJG A;  4RIX B;  2VAG A;  4ZZN A;  2P2I A;  1TQM A;  2ZV8 A;  3HLL A;  4EEV A;  5CT0 A;  4I6B A;  2QKR A;  4ASD A;  3COH A;  4RWJ A;  4LL5 A;  1YXS A;  4IZ7 A;  4DHF A;  3AOX A;  3MV5 A;  1FPU A;  2I1M A;  4JQ7 A;  5M57 A;  4OTF A;  3ORK A;  4UMT A;  5ETC A;  5CAS A;  2JED A;  4IAA A;  2BPM A;  3F2A A;  2UZB A;  3ZDI A;  3VUM A;  4ZZM A;  4PRJ A;  4CQG A;  4CYJ A;  3PVG A;  2BRM A;  3NAX A;  2C5V A;  5K5N A;  4JR7 A;  1H0V A;  1F0Q A;  2YER A;  4I4F A;  4IB1 A;  4NST A;  4F7N A;  3BEG A;  3R04 A;  1XQZ A;  1U4D A;  2JII A;  4LYN A;  1YHV A;  2OBJ A;  4W8E A;  4YPS A;  5F95 A;  3V04 A;  2PE2 A;  3UIB A;  2ZM3 A;  2YIS A;  3CGF A;  3QFV A;  4JG7 A;  4LMU A;  3UOL A;  4ZTH A;  4AOJ A;  4YZN A;  5BQ0 A;  4FOC A;  2VTR A;  2UW8 A;  3ITZ A;  2YCF A;  3E63 A;  1KE7 A;  5EDQ A;  3NS9 A;  3RI1 A;  4BN1 A;  4YJP A;  3FC1 X;  5LVL A;  4CCU A;  2X81 A;  1YXV A;  3QWK A;  2BAJ A;  3HYH A;  3R02 A;  4JRV A;  4PDS A;  3VBT A;  4YP8 A;  3PIY A;  5CI6 A;  4DEA A;  2WOU A;  5CU4 A;  4Y5Q A;  4IXP A;  2G2H A;  3RK9 A;  3V5W A;  2RGP A;  4O1P A;  4BDD A;  4Z9L A;  1BUH A;  5LWN A;  5A46 A;  4U6R A;  4G3E A;  5JRS A;  3WYY A;  4LV8 A;  3HKO A;  4X3J A;  3VF9 A;  4BKY A;  2CN5 A;  3DBD A;  4OT5 A;  2HEL A;  1IRK A;  2F2U A;  3GCS A;  2QVS E;  4WNO A;  5JGA A;  3VVH A;  4DLI A;  4O27 B;  5AWM A;  4PUZ A;  4EK8 A;  3ZC5 A;  4OBP A;  3THB A;  4KIK B;  1QPC A;  2WMV A;  4V0G A;  2OG8 A;  3F3U A;  3I5Z A;  4RIW B;  5IUG A;  4I21 A;  3PJ1 A;  1PY5 A;  5AA9 A;  5JFX A;  2XBJ A;  2V0D A;  2GHM A;  2IVT A;  4JAI A;  4IW0 A;  5CI7 A;  5HCZ A;  4B7T A;  2BUJ A;  2OJJ A;  4XOZ A;  4RVK A;  2WQB A;  2BZH B;  4AW1 A;  1PXI A;  3N9X A;  4F6S A;  5A4T A;  2YIY A;  3W2Q A;  2EXC X;  2QOK A;  3OD6 X;  2OWB A;  4F9Y A;  4AQC A;  2WTI A;  5KMK A;  1H8F A;  4UMU A;  2PE0 A;  3KY2 A;  3RAL A;  5EW3 A;  3CQU A;  1I44 A;  4YLJ A;  3WZE A;  2I6L A;  4TKS A;  2X4Z A;  2DYL A;  3H30 A;  2XK9 A;  4IVC A;  4BWK A;  3QCY A;  3JYA A;  3E8C A;  3ORX A;  3RHK A;  4JRN A;  5A3X A;  4FYO A;  4FGB A;  4S30 A;  4FG9 A;  2WQM A;  5HGI A;  3BPR A;  1XHA A;  2W96 B;  2QHM A;  4O6E A;  5FEE A;  1YHW A;  3FI4 A;  4A06 A;  2BRH A;  4YBK A;  1AD5 A;  3OVV A;  1RE8 A;  4EYJ A;  5AUY A;  2JKO A;  3OUK A;  3UOD A;  4FNY A;  2VO0 A;  3KC3 A;  2F4J A;  1JPA A;  2O2U A;  4C8B A;  3QD4 A;  4HZS A;  1UNL A;  4APC A;  2X8E A;  5AP7 A;  4NCT C;  4ZTM A;  3T3U A;  2WPA A;  1QPD A;  3RTP A;  4P2K A;  4CKI A;  2YAC A;  4ZTS A;  5DRB A;  1DM2 A;  1YI3 A;  5DHJ A;  3W33 A;  5KKR C;  5ETI A;  3AT3 A;  3VWA A;  4F64 A;  3R30 A;  3OY1 A;  4OLI A;  2X8I A;  1M7N A;  4GCJ A;  3KRX A;  3TWJ A;  5FBO A;  3BYU A;  1YI6 A;  2YZA A;  3E8N A;  4LGG A;  1OPK A;  5J5T A;  4UY9 A;  3BEL A;  3W32 A;  3OCG A;  3UVR A;  1Y6B A;  1OL7 A;  1WBO A;  4RJ6 A;  2F7Z E;  3SD0 A;  5J9Z A;  4RIW A;  4QPS A;  1Z57 A;  4QP8 A;  5AP5 A;  4HCV A;  3DV3 A;  5GNK A;  4WNK A;  4G16 A;  3QYZ A;  3LFF A;  5KE0 A;  3FZP A;  3DB6 A;  2YCR A;  2QD9 A;  5FP5 A;  2EXE A;  2PVL A;  3CIK A;  2YM8 A;  4XS2 A;  1PW2 A;  5JH6 A;  3A4O X;  3DDP A;  3M42 A;  4RWL A;  5A54 A;  3ZTX A;  1OPL A;  3CR0 A;  2CKE A;  4YHT A;  3SHE A;  3CD3 A;  1XKK A;  4XG3 A;  3L8V A;  4YUQ A;  5E7R A;  3RZF A;  4CVA A;  1UKH A;  3R8U A;  4GII A;  2XJ1 A;  4F65 A;  2W4J A;  1M2Q A;  2QUR A;  2HY0 A;  5DR2 A;  3HZT A;  3QZF A;  3GQI A;  3RBW A;  5CEI A;  1JSV A;  2XNP A;  1YHS A;  5GJF A;  4C2W A;  4RGJ A;  1WMK A;  4F7J A;  3OY3 A;  5IUH A;  3AC4 A;  4QP2 A;  2VWU A;  3UG2 A;  4CFN A;  4EOP A;  4UWC A;  4TNB A;  4EH6 A;  4I5P A;  2OH4 A;  4FTI A;  4AA4 A;  1W84 A;  2ZOQ A;  3CTH A;  4D2W A;  4IHP A;  3EQC A;  2C0I A;  2XNM A;  1MRY A;  3E62 A;  5J87 A;  3TKH A;  1JKL A;  2JDS A;  3QD2 B;  1XO2 B;  4W4X A;  4RVL A;  1YWN A;  3CPC A;  1P5E A;  3OCT A;  2HWO A;  4LG4 A;  5DMZ A;  3DK3 A;  1SNX A;  5EW9 A;  1Q61 A;  3DJ6 A;  4CEG A;  2PL0 A;  4WT6 A;  2HCK A;  5ACK A;  4H58 A;  4I22 A;  5H2U A;  1W98 A;  3UNZ A;  3POZ A;  3QKM A;  3HMP A;  2WU6 A;  3GU4 A;  3MTF A;  4AN3 A;  3ZRK A;  4FV6 A;  3TKU A;  2ZV9 A;  1V0O A;  1R39 A;  1ZLT A;  4MD8 E;  4CFX A;  3DBF A;  2WZJ A;  4AT4 A;  3UVP A;  2C6M A;  4YJO A;  3VUI A;  4A9R A;  1NVS A;  3QL8 A;  2GNJ A;  5HG8 A;  3NCZ A;  5KO1 A;  2ZM1 A;  4BZN A;  2C6L A;  4LUD A;  4R1V A;  2EB3 A;  5DOS A;  3AD6 A;  3QKK A;  3AMY A;  3P79 A;  3POO A;  1FVT A;  3NCG A;  3FWQ A;  4HVD A;  5F1Z A;  2QR7 A;  4H39 A;  1R1W A;  4ZY4 A;  4TWP A;  2B9H A;  4BRX A;  3IG7 A;  2R0I A;  4OBQ A;  3V5T A;  2WTV A;  4EK4 A;  1G5S A;  2GDO A;  2JLD A;  3W2C A;  3CKX A;  1J1C A;  4RLK A;  4CNH A;  2HXL A;  5LOH A;  3U6J A;  3I79 A;  3LJ2 A;  4Q5E A;  4ZSA A;  2R64 A;  2YCQ A;  1WVY A;  1KWP A;  5IU2 A;  2GFS A;  4IX5 A;  2JAM A;  3QA0 A;  3UQG A;  4V01 A;  3MDY A;  4PP7 A;  4D4V A;  5JT2 A;  4Y73 A;  5I9Y A;  5CX9 A;  3UQF A;  2IJM A;  3CKW A;  2YEX A;  3DBE A;  3MW1 A;  5E1S A;  5HNG A;  3ZYA A;  3HV7 A;  4KD1 A;  3VUH A;  4TXC A;  3EJ1 A;  4F7L A;  3DAK A;  3PSB A;  5HOA A;  1H08 A;  4USE A;  1QMZ A;  3LFN A;  3GU8 A;  3EQF A;  2ITY A;  3NAY A;  4L43 A;  2CGX A;  3W55 A;  5AM6 A;  1S9J A;  1H4L A;  3FPM A;  4TT7 A;  3QTU A;  4YZB A;  2W7X A;  3QLF A;  3F88 A;  4MVF A;  4YJU A;  4RX7 A;  1Q8W A;  5CLP A;  4CRS A;  2Z60 A;  1TZD A;  4BID A;  5A4E A;  2EU9 A;  2DQ7 X;  4I0R A;  5HKM A;  3QX2 A;  2ONL C;  3RMF A;  1F5Q A;  2X39 A;  3KXZ A;  3CGO A;  3MIA A;  3TTI A;  4KAO A;  4YZM A;  5CSP A;  3EL7 A;  3TV6 A;  2ZB1 A;  3EMG A;  4U41 A;  5BUJ A;  2ESM A;  4QMO A;  4C58 A;  4JDK A;  4YJS A;  5A6N A;  3DK6 A;  1AQ1 A;  4K33 A;  2ITU A;  5CQU A;  1S9I A;  3D7T B;  4B0G A;  2ZDU A;  2W99 B;  3B2T A;  4HZR A;  3QUE A;  3RNI A;  4TYI A;  4K77 A;  4E5W A;  2GS6 A;  3Q4C A;  5TT7 A;  2PZR A;  4L7S A;  2OK1 A;  3F3W A;  4WIH A;  2JDT A;  4NU1 A;  1OIT A;  4HYH A;  1UNH A;  5KMO A;  2QLQ A;  2X9F A;  2X7O A;  4IFG A;  1K3A A;  4C35 A;  3S1H A;  3QTZ A;  4YNE A;  3D15 A;  3I0Q A;  1ZMU A;  4PTG A;  1Q8U A;  2VTO A;  3K3I A;  4D55 A;  4E3C A;  3DNE A;  2WGJ A;  4DH7 A;  3OXI A;  3VS5 A;  3OC1 A;  3PXK A;  4WUA A;  3DZO A;  4FG7 A;  4O0U A;  4FL2 A;  3FAA A;  4GU6 A;  4L3J A;  5AR2 A;  2YDJ A;  4FG8 A;  2O65 A;  4CLI A;  4IAI A;  3ZSH A;  4CMO A;  3IOP A;  1JOW B;  3TNQ B;  2FSO X;  3EFL A;  5F4N A;  2P33 A;  5CEK A;  2OH0 E;  3O8P A;  5FRI A;  5JFW A;  1YOL A;  4ZTL A;  1NXK A;  3H0Z A;  1J91 A;  2JGZ A;  1RQQ A;  2C3I B;  1KE8 A;  2B4S B;  4BBM A;  5AUT A;  2R3K A;  3BWF A;  3T3V A;  4B8L A;  1PXO A;  3DDQ A;  2J4Z A;  4XOY A;  3OOM A;  2BDF A;  3FKN A;  4BCO A;  1W2F A;  3C0G A;  4D9U A;  2WAJ A;  4O91 A;  3KXG A;  3W10 A;  4F08 A;  5JRQ A;  3HA6 A;  4W9X A;  4DEI A;  3UQC A;  3A99 A;  4J53 A;  4IWQ A;  4U43 A;  3A7G A;  5IH5 A;  1W2C A;  5L2S A;  4C62 A;  3QC4 A;  2RFS A;  2WIH A;  3SOA A;  2WMX A;  3OZ6 A;  3PY0 A;  3TAC A;  4L52 A;  2DUV A;  2PZI A;  2WMU A;  3EYG A;  3LXN A;  3EQD A;  3EZR A;  1W0X C;  3BIZ A;  4LGD A;  3D7T A;  5HCX A;  4FTQ A;  2AC3 A;  5BVW A;  3Q53 A;  4WOV A;  4EKL A;  2R3P A;  1LUF A;  4BCK A;  1JSU A;  3QQF A;  4XHK B;  2WTK B;  3B2W A;  4I41 A;  4PV0 A;  1ZZ2 A;  4BTM A;  4E6Q A;  3FMJ A;  4EHZ A;  4CKR A;  2RSV A;  3F9N A;  2C5X A;  5A4C A;  3TUB A;  1PMU A;  4U5J A;  2WIP A;  4K1B A;  4Y83 A;  4YLK A;  4FIG A;  1A9U A;  3C4E A;  4FTO A;  4MD7 E;  2UW9 A;  4RA4 A;  3TZM A;  4DIT A;  5I9X A;  2QLU A;  4ENY A;  5M4I A;  3Q5I A;  4RPV A;  4Z7H A;  4BBE A;  3EQP A;  1VJY A;  4J1R A;  3S4Q A;  5CWZ A;  3D9V A;  3MA3 A;  3TTJ A;  4BTK A;  3NZ0 A;  2OFU A;  3M2W A;  3PA5 A;  5KCV A;  1LP4 A;  4CMT A;  5JQ5 A;  3ORM A;  5KHX A;  5FGK A;  3LCO A;  4G3G A;  2R3M A;  5JZN A;  2OI4 X;  3GEN A;  4I23 A;  4IAD A;  1JBP E;  4YZ9 A;  4BI2 A;  2UZT A;  3F61 A;  1HCK A;  4U7Z A;  4XBU A;  5HCY A;  4I6H A;  2FA2 A;  5CNN A;  3EZV A;  4R1Y A;  4D1X A;  4BZO A;  4ZSE A;  4EOQ A;  4U3Y A;  4FIJ A;  4ZTN A;  5AX9 A;  4BDB A;  4C36 A;  4KIO A;  4EWH A;  4FTR A;  1B38 A;  2X7F A;  4XX9 A;  4L6Q A;  3ZLW A;  4MXZ A;  5J9L A;  4AXA A;  2RG6 A;  3F6X A;  3PXZ A;  4ANM A;  5J7H A;  1JNK A;  3ZEW A;  5F94 A;  1LR4 A;  3KF4 A;  4GIH A;  1H1R A;  1WFC A;  3SW7 A;  3QZH A;  4PMM A;  1KSW A;  2W9F B;  3B8Q A;  3C0H A;  5CSH A;  3VS2 A;  3MH1 A;  3R9O A;  1JQH A;  1LPU A;  1H00 A;  2C6E A;  4M68 A;  4AP7 A;  2EVA A;  3HUB A;  3OW4 A;  4ERW A;  2UW7 A;  4A7C A;  2HEN A;  2RFN A;  4AN2 A;  5B0X A;  3E8E A;  3MVH A;  4UWB A;  3C4X A;  4EOL A;  2VTM A;  1BI8 A;  3RK7 A;  4LOO A;  1JAM A;  4JJR A;  4D4S A;  5K3Y A;  2VTI A;  4MBJ A;  3CD8 A;  5HTC A;  3QYW A;  4E4M A;  2XF0 A;  2H6D A;  5I9Z A;  5CAV A;  4F1M A;  3MPM A;  4NWM A;  1PXM A;  2Z8C A;  1ERK A;  4EJN A;  3JY0 A;  4PF4 A;  4F6U A;  4KBK A;  5I9U A;  1Q24 A;  4IC7 A;  3VRY A;  5LQF A;  5JEB A;  1YOJ A;  4FT9 A;  3FZR A;  2CGW A;  3O96 A;  4EK5 A;  5I9W A;  3E87 A;  3R1Y A;  2X0O A;  4AZS A;  5FDX A;  4E8A A;  4YSM A;  5TOZ A;  4FV5 A;  4WG3 A;  3O0G A;  4PTE A;  4AW0 A;  5HLP A;  2XNO A;  1O6K A;  2QOL A;  3P08 A;  3EN7 A;  4IVB A;  2J5F A;  5LVN A;  5IH4 A;  3RAK A;  2PVJ A;  4RX5 A;  5I4N A;  3FLY A;  4IVD A;  5DBX A;  2FVD A;  2IZS A;  4MWI A;  3VO3 A;  2VTL A;  4AZF A;  4F63 A;  3Q9Y A;  3GC8 A;  2GHL A;  2OZO A;  3KU2 A;  2B9F A;  4TRL A;  4BGQ A;  3AGL A;  2IN6 A;  3DJ5 A;  3LQ8 A;  4FRF A;  4I6F A;  1UA2 A;  1A06 A;  4ZTQ A;  3R83 A;  4MF1 A;  3NNV A;  5K4J A;  3UO5 A;  4FX3 A;  4NJD A;  2J6M A;  4CTB A;  3WE8 A;  4R3C A;  1WCC A;  2Q0N A;  4EZ5 A;  3HNG A;  3R9H A;  2QO7 A;  4C33 A;  3V5J A;  2P2H A;  2PVF A;  3QQU A;  1KV1 A;  4C4J A;  3C4Z A;  2YIT A;  4LL0 A;  4FTN A;  3LFQ A;  3ZSI A;  3OT3 A;  4XG9 A;  5DEY A;  2E9V A;  1ZY5 A;  4BCI A;  4RJ5 A;  4DH1 A;  5JKG A;  1ZY4 A;  3GP0 A;  2BAL A;  3ZUV A;  2WOT A;  4AE9 A;  3LQ5 A;  4ANN A;  4CT1 A;  4O6L A;  2R9S A;  2VWZ A;  5E90 A;  2JIT A;  3HRB A;  3ZO3 A;  2BFX A;  3SW4 A;  3PJ8 A;  5JFS A;  4E6D A;  1V0B A;  3GGF A;  4X2N A;  4C4H A;  4J71 A;  3CS9 A;  1OKV A;  4BHZ A;  3QRI A;  4LOQ A;  4MK0 A;  2GTN A;  4YC6 A;  1PF8 A;  4YTC A;  4FVP A;  3RPY A;  3QRK A;  4CFW A;  2R3J A;  4I24 A;  4G34 A;  2PHK A;  2WEI A;  1B39 A;  1JST A;  1OUY A;  1REK A;  4DFL A;  1UU3 A;  4FV7 A;  3TNW A;  3DKG A;  3WZJ A;  1W2D A;  4QTE A;  3S00 A;  3FQS A;  5FTQ A;  4UEU A;  3HMM A;  4EL9 A;  3MN3 A;  2V5Q A;  3LCK A;  3LZB A;  3BBW A;  1CKI A;  2XK8 A;  5IA2 A;  4ASX A;  3G2F A;  4GT4 A;  4CMU A;  2VGO A;  1CKP A;  1YWR A;  2OO8 X;  2P0C A;  5AV0 A;  3RM7 A;  1YXX A;  3TNH A;  2WU7 A;  3V8T A;  3LXL A;  4QP9 A;  4BIE A;  4EH3 A;  5EDP A;  4HGS A;  4ZK5 A;  2EXM A;  5C8M A;  1FVR A;  4I20 A;  4RQV A;  5CVH A;  5C8N A;  3PPK A;  3MVL A;  3LM0 A;  5J5S A;  3TZ7 A;  3K3J A;  2F57 A;  3A61 A;  4I4E A;  2W4K A;  2XVD A;  2VWX A;  2IO6 A;  3MH0 A;  3AMB A;  3R9N A;  3Q32 A;  1PXK A;  4FKI A;  3ZON A;  2ERZ E;  1K2P A;  3A8X A;  3LCS A;  3WZD A;  2G1T A;  4O4F A;  4YMJ A;  2FH9 A;  3NW5 A;  1PMV A;  3V01 A;  4L00 A;  4TTH B;  4GVJ A;  3JPV A;  3G9N A;  3UO6 A;  4YJR A;  3UE4 A;  4BCN A;  5BMM A;  5J79 A;  1WVW A;  3A7F A;  5FEQ A;  4YZD A;  3W16 A;  3PTG A;  5KUP A;  3D5U A;  4HGT A;  2XIK A;  4NK9 A;  4NUS A;  5DR6 A;  3ZOS A;  5FBN C;  4NT4 A;  4O0V A;  4BGG A;  1FQ1 B;  3F5P A;  5J95 A;  4GUE A;  1ZYS A;  4QMM A;  4RFZ A;  3EFK A;  3MFT A;  4OTG A;  4HVI A;  2YLE A;  2JDR A;  2GNI A;  2OIC A;  3HDM A;  3C4F A;  4EK3 A;  3Q9W A;  3IW4 A;  3EWH A;  5CVF A;  5GJD A;  3GC9 A;  5DPV A;  3U8W A;  3V5Q A;  4EBV A;  5E8U A;  3COM A;  4FUY A;  2W05 A;  4FSR A;  5CEN A;  4E4X A;  3P1A A;  4ITJ A;  3FZS A;  3GFE A;  4QPA A;  3NGA A;  3JUH A;  4AW2 A;  4EUT A;  3ZFM A;  2HAK A;  3KF7 A;  4FTT A;  1OKW A;  4DBN A;  5DT4 A;  2QOI A;  3ULI A;  4DEB A;  2QR8 A;  3OT8 A;  1UU9 A;  4LGH A;  1CMK E;  2FUM A;  5KZ0 A;  2DWB A;  2QKW B;  4A9U A;  4E73 A;  4F9B A;  4MQ1 A;  4I1Z A;  2R3Q A;  4JDI A;  3ODY X;  1OIY A;  1FGI A;  3PA3 A;  5K4I A;  4FOB A;  3BYO A;  2E9P A;  3NUP A;  3OS3 A;  4S33 A;  3KRW A;  3OEF X;  5HHW A;  4O0X A;  3WE4 A;  4YUR A;  5JGB A;  3RAH A;  1SM2 A;  3PJ3 A;  5AUZ A;  4DFN A;  2PSQ A;  3A62 A;  3L8X A;  2B7A A;  2UZL A;  3PXR A;  4O96 A;  2OU7 A;  4BDE A;  1FMO E;  4N0S A;  5AUW A;  3VBW A;  3TNI A;  4M7I A;  3DY7 A;  3QUP A;  3DA6 A;  3ION A;  2FSL X;  4MNF A;  4WD5 A;  2YDK A;  3HRF A;  4X3F C;  5E8Z A;  2ZMC A;  4IMY A;  1GNG A;  3BYS A;  2ZDT A;  4BTF A;  5HO8 A;  3RWQ A;  4ENX A;  5HTI A;  4ANB A;  2C3K A;  4V0G B;  1QCF A;  2C69 A;  4EZ7 A;  3L1S A;  4RT7 A;  3SX9 A;  3UTO A;  4Z3V A;  3KUL B;  2C6K A;  3BHY A;  3G51 A;  2PZP A;  3QD3 A;  5GZA A;  3P23 A;  5CU2 A;  4GRB A;  2ITP A;  2GSF A;  4G1W A;  4TWC A;  5C9C A;  2ZM4 A;  4E6C A;  4BCF A;  3ZRM A;  4OAV B;  2VO6 A;  3WF7 A;  3JVR A;  3PLS A;  4TWO A;  3MGY A;  3Q4Z A;  2VWV A;  3VQH A;  5CF5 A;  4D2R A;  5HLN A;  3NYV A;  5TE0 A;  1SVH A;  3QC9 A;  4C4G A;  1XWS A;  2OF2 A;  3KB7 A;  3DS6 A;  3UIX A;  3D14 A;  4IVA A;  3VHK A;  1H1S A;  3PWD A;  4ZP5 A;  2UZN A;  2XIZ A;  4CZT A;  4DFZ E;  4MH7 A;  5C03 A;  2JFM A;  2Y0A A;  4M0Z A;  4R7H A;  3PG1 A;  5EFQ A;  3DAE A;  5HD4 A;  2GNF A;  2ITO A;  1X8B A;  4I3Z A;  4AF3 A;  1JKT A;  2XS0 A;  4HGE A;  5AR7 A;  2A27 A;  4QP7 A;  5C27 A;  5FXQ A;  2XNN A;  4Q2A A;  4PQN A;  2BRG A;  3ORZ A;  4LFI A;  5EI6 A;  4C0T A;  3NUY A;  3O8U A;  5I3O A;  3OWP A;  4FKG A;  5HES A;  4HVG A;  4TWN A;  1CSN A;  5IDP A;  4NW6 A;  3R1N A;  4XG2 A;  3PJC A;  1I09 A;  3PA4 A;  4ANQ A;  3R9D A;  4EOK A;  1W7H A;  3R7E A;  1R0E A;  5EM6 A;  3I7C A;  1SVE A;  4U44 A;  4QTA A;  3R8M A;  5JFV A;  2JKM A;  2X0Q A;  3PUP A;  3HV3 A;  3CE3 A;  4CFM A;  1BL7 A;  3AXW A;  4FKQ A;  4HYS A;  5IH6 A;  4U3Z A;  1STC E;  2ACX A;  3ET7 A;  5CTP A;  3NEW A;  1OZ1 A;  3T9I A;  5L8J A;  3KRL A;  4ZSG A;  5E8W A;  2XCK A;  4YSJ A;  2VWI A;  4IB3 A;  2Z7Q A;  3U51 A;  2KTY A;  1GIH A;  4PMT A;  5BVO A;  3DB8 A;  3T8O A;  1VYZ A;  3IDC A;  5M4F A;  2VWB A;  4YC8 A;  3KUL A;  2RL5 A;  5G6V A;  3WBL A;  3ZEP A;  3O71 A;  2OXD A;  4IAF A;  4QRC A;  3R7Y A;  4YJT A;  4Q9S A;  4WNP A;  3ZM4 A;  3UO4 A;  3EN5 A;  3D4Q A;  2PVM A;  3E7O A;  3DCV A;  3REP A;  2GPH A;  3RGF A;  4A07 A;  4FKS A;  3VS0 A;  4HNI A;  4QMZ A;  4C2V A;  3FSF A;  4TYE A;  5BVE A;  4IBM A;  3UOK A;  5IUI A;  5LMK A;  2NP8 A;  3MBL A;  3UOJ A;  4W4Y A;  4R3P A;  4YC3 A;  4ZEG A;  2YLF A;  4YPD A;  3T9T A;  2VD5 A;  1MP8 A;  3DJ7 A;  3LFE A;  1UKI A;  4MTA A;  2AC5 A;  3VNT A;  2YFX A;  3R6X A;  3DBC A;  1J1B A;  5LCK A;  4BI0 A;  4KNB A;  5EM5 A;  4LMN A;  3FYK X;  3ZZW A;  2IWI A;  2QU5 A;  4F09 A;  4FYN A;  4NEU A;  2QC6 A;  2YJR A;  3DZQ A;  2R3G A;  4RC2 A;  2R3I A;  4XUF A;  3AC5 A;  2ETK A;  3IS5 A;  2W9Z B;  5AP1 A;  2WQN A;  4PPC A;  2GCD A;  3DGK A;  4ITI A;  4QMY A;  4F0G A;  5M44 A;  5G1X A;  4JI9 A;  4IZ5 A;  5IIS A;  2R7B A;  2BIK B;  4L7F A;  2BDW A;  2ZV2 A;  4XLV A;  4X7Q A;  4K9Y A;  5DVR A;  2Z7S A;  3G0F A;  2AYP A;  4KKE A;  4QYE A;  4NZW B;  1QPJ A;  1SNU A;  1E9H A;  3O17 A;  4KB8 A;  3LFC A;  4UN0 C;  4ZSJ A;  2VZ6 A;  3NYN A;  3ZBF A;  2QOD A;  3L8S A;  3VUG A;  3KK9 A;  4D4R A;  3QHR A;  2OGV A;  4DFY A;  2UV2 A;  2C5O A;  4ZTR A;  3PE2 A;  1JKK A;  2JDV A;  2VTS A;  3RPS A;  2CN8 A;  2GNL A;  4FKR A;  5FG8 A;  4EQM A;  1BLX A;  5KNJ A;  5L6P A;  3ZO1 A;  4ACM A;  3U6H A;  3HMI A;  4KA3 A;  4C7T A;  1O9U A;  2Y4I C;  4TYH B;  4XNE A;  2WTD A;  4D9T A;  3FY2 A;  5T6K A;  2X8D A;  4E5B A;  1REJ A;  4I5H A;  3BHU A;  2C6T A;  3IKA A;  3FV8 A;  4DEH A;  3NIZ A;  2I40 A;  4C61 A;  3IW6 A;  2HW6 A;  2QU6 A;  2GNG A;  2XK7 A;  3MH3 A;  4BKZ A;  1SMH A;  3MB6 A;  3DQW A;  5BVN A;  4QMT A;  4J96 A;  2UZE A;  4FSW A;  4O0W A;  1V0P A;  5HI2 A;  4DC2 A;  2CHL A;  4BDG A;  3HUC A;  2XKE A;  2W5A A;  3Q60 A;  3PXQ A;  5HLW A;  4FI1 A;  3R8V A;  4HGL A;  3VBX A;  4JNW A;  2UVZ A;  3IQ7 A;  2RFD A;  3I81 A;  2JD5 A;  2VNW A;  2E2B A;  3KRR A;  1ZAR A;  5HO7 A;  4G6L A;  3BCE A;  3LLT A;  3LFA A;  1UVR A;  4JS8 A;  4NM3 A;  4RC4 A;  4PL4 A;  4C02 A;  3U9N A;  5AX3 A;  3L9P A;  4J99 A;  3TG1 A;  5DWR A;  4XH6 A;  2IW6 A;  4ZAU A;  1VR2 A;  2CCI A;  2J50 A;  4UX9 A;  2C5Y A;  3KMM A;  2P4I A;  1SYK A;  2VN9 A;  4P4C A;  3FZT A;  5EYK A;  5AV1 A;  3NNW A;  2OID A;  5E1E A;  5AIR A;  3CY2 A;  4YHF A;  5D10 A;  3LE6 A;  4HYU A;  5CYI A;  5IPJ A;  3WIK A;  3ZH8 A;  4AE6 A;  4PWN A;  5CU6 A;  3D83 A;  4JBO A;  5ANG A;  4O1O A;  2XJ0 A;  3FMH A;  4JG6 A;  5L2T A;  4RVT A;  5HVY A;  4L44 A;  2X1N A;  2XKD A;  2F7X E;  4JBQ A;  3PIX A;  5AM7 A;  4M84 A;  4O0T A;  1R78 A;  5B2L A;  2Z7L A;  4TYH A;  3NYO A;  3HV5 A;  5CQW A;  3VJN A;  4WRG A;  4J8M A;  1U5R A;  3LFS A;  3TI1 A;  4FV9 A;  4FTU A;  1ZXE A;  2ITV A;  3QQJ A;  2LAV A;  3FML A;  4EOS A;  3C50 A;  3NR9 A;  2BTS A;  3FMK A;  3NW6 A;  2X2M A;  1IR3 A;  2B9J A;  4FTL A;  2JDO A;  4IIR A;  4L45 A;  2WHB A;  2JBO A;  1Q8T A;  4FT5 A;  3LJ1 A;  1DS5 A;  2H34 A;  2QCS A;  2C6I A;  2WEL A;  4F6W A;  3BU3 A;  3QTI A;  4NTT A;  5AR4 A;  4QOX A;  1UU8 A;  4USD A;  4IAK A;  4J52 A;  3ZZE A;  5ANO A;  2IVV A;  3NPC A;  5D9H A;  5BNJ A;  5L2I A;  3SQQ A;  3A4P A;  4ERK A;  2WMB A;  2YIQ A;  4ALW A;  2XNE A;  2LGC A;  3KL8 A;  3R22 A;  3U4W A;  2C68 A;  4J97 A;  5EW8 A;  5KHW A;  2H9V A;  3QQG A;  4FTC A;  3LMG A;  3W2R A;  2XM8 A;  2Y6O A;  4LI5 A;  1LEW A;  3FKO A;  1OVE A;  3D94 A;  4O0R A;  3ROC A;  1ATP E;  3O7L D;  4GT3 A;  3DXN A;  3R28 A;  4GFO A;  1WAK A;  2E9O A;  2VGP A;  4EOR A;  3OWJ A;  4DG3 E;  3QU0 A;  3F3Z A;  4EC9 A;  4RZV A;  4CXA A;  3Q2M A;  4FV0 A;  5HE0 A;  5CAU A;  3ZUU A;  2PVN A;  3ROY A;  2ZAZ A;  4BHN A;  3F3T A;  1MRU A;  3QX4 A;  3VS7 A;  4NKS A;  3SDJ A;  3TIY A;  1W82 A;  5DNR A;  4HCU A;  1P14 A;  3BU6 A;  2R7I A;  1E1V A;  3AC3 A;  1KE9 A;  3FJQ E;  3NLB A;  3PP1 A;  5FQD C;  1PYX A;  3DFA A;  5JQ8 A;  3BU5 A;  3C5U A;  5HIE A;  2YN8 A;  3QBN A;  5AR5 A;  2QG5 A;  5HO6 A;  4YTF A;  4ACH A;  2W1D A;  2ZYB A;  4BCP A;  3IW8 A;  4X3F A;  4FII A;  1Y91 A;  1AGW A;  2PVY A;  1DAW A;  1XH4 A;  3IW5 A;  3E5A A;  4B99 A;  1Q62 A;  3GCQ A;  3KRJ A;  3PZH A;  4E93 A;  4K11 A;  2W17 A;  3ZMM A;  4GJ2 A;  3O2M A;  3P9J A;  2AQX A;  1XBB A;  2YJS A;  4DH5 A;  2C30 A;  4PY1 A;  4P5Q A;  2JIU A;  4E4L A;  3PZE A;  1WBS A;  3PVB A;  3KVW A;  3PRI A;  1BI7 A;  3MA6 A;  3KVX A;  1XBC A;  4QTC A;  4C57 A;  5H9B A;  2QOB A;  4QML A;  4ZY5 A;  3H9F A;  3EYH A;  3SC1 A;  2C6D A;  5HG7 A;  4BCQ A;  2QOC A;  2WFY A;  3CBL A;  3HRC A;  3LFD A;  5L8K A;  2GQG A;  4R5S A;  4L46 A;  4BWP A;  2OZA A;  2F49 A;  4C3P A;  4OTR A;  3HP2 A;  3OP5 A;  5EHY A;  2XK4 A;  3BE9 A;  2IZR A;  5HNB A;  3QRU A;  4U45 A;  2C1B A;  2PY3 A;  4BDF A;  2ZJW A;  3OUN B;  2XNB A;  3Q4T A;  3FLS A;  2SRC A;  4NTS A;  3BRB A;  2OJF E;  3ACK A;  4WNM A;  2GTM A;  4ZJJ A;  3W1F A;  4TL0 A;  5DLS A;  4FKT A;  3CLY A;  4I6Q A;  4UZD A;  4BDC A;  2OJ9 A;  2PWL A;  5KMJ A;  4AW5 A;  5CU0 A;  4YLL A;  3MPT A;  3U4U A;  4GU9 A;  3Q52 A;  4FSU A;  3TZ9 A;  3BQR A;  3LHJ A;  4HW7 A;  4L01 A;  3L9L A;  4OR5 A;  3COI A;  4WSY A;  5B2K A;  4DGL C;  4O2Z A;  2OKR A;  1PJK A;  4QP6 A;  4X2K A;  4XLI A;  1CM8 A;  1T46 A;  4BF2 A;  5HBH A;  2W5B A;  1YRP A;  1OL1 A;  4TZR A;  4GW8 A;  3BV3 A;  4K0Y A;  5TKD A;  2CDZ A;  3EOC A;  5KKR B;  1BMK A;  4D2V A;  1V1K A;  4O4E A;  4AS0 A;  5C1Q B;  3BGZ A;  5KBQ A;  2HYY A;  3NDM A;  4M12 A;  3MSS A;  2B55 A;  1PHK A;  2RFE A;  2CPK E;  5HD7 A;  4UBA A;  1PME A;  1R3C A;  2G9X A;  5KMN A;  4M97 A;  5KMI A;  3QA8 A;  4NH1 A;  1OL6 A;  3F5G A;  3G90 X;  2XYU A;  3QCS A;  4ZOG A;  4BCG A;  2YDI A;  4K6Z A;  3LCD A;  3OF0 A;  4FNX A;  5E92 A;  4AT3 A;  1MQB A;  3NW7 A;  1CTP E;  4ONA A;  4EHV A;  3SAY A;  3H3C A;  3UPX A;  3DPK A;  2DS1 A;  1Q99 A;  4DGM A;  4JG8 A;  4X2F A;  5E91 A;  2PUU A;  4BYI A;  2YCS A;  3TKI A;  4KKH A;  4NIF A;  1KOA A;  5CSW A;  2GU8 A;  5M53 A;  3S95 A;  4CZY B;  3Q4U A;  3EN4 A;  3FLZ A;  5AEP A;  2W1G A;  3D0E A;  4D2T A;  4RX9 A;  4DH8 A;  5D41 A;  5ITA A;  2OXX A;  2HIW A;  3QTR A;  4O38 A;  4D2S A;  3F66 A;  5AV4 A;  2R3H A;  3G33 A;  5C01 A;  4M13 A;  3QTW A;  5EOL A;  3QZI A;  5AND A;  5KML A;  3UOH A;  2J2I B;  4O0S A;  4DGG A;  4DEE A;  4EZ3 A;  5H8B A;  4LRK A;  3HA8 A;  3VHE A;  4JDJ A;  1OEC A;  1TKI A;  3FMD A;  1TQI A;  2W06 A;  4W8D A;  5IG1 A;  2PK9 A;  5T68 A;  4AU8 A;  4BDH A;  1TVO A;  5HG5 A;  1SVG A;  3OW3 A;  3FXX A;  4U9A A;  3QCQ A;  4NCT A;  2XEZ A;  3FLN C;  4RA5 A;  2O63 A;  3MY0 A;  2J51 A;  3WF8 A;  2ZB0 A;  4FEQ A;  1BKX A;  1ZMW A;  3HVC A;  5T3Q A;  5DE2 A;  3LOK A;  3VJO A;  5JGD A;  2R0U A;  1K9A A;  3M1S A;  4M67 A;  4RWI A;  4EWQ A;  3KCK A;  3PPJ A;  2BCJ A;  2I0Y A;  5ANJ A;  2WQO A;  2XBA A;  4C4I A;  1WBW A;  1APM E;  1Y6A A;  3OXZ A;  2J0I A;  5HIB A;  1ZOH A;  2ITZ A;  1JWH A;  4JOA A;  4JXF A;  4APP A;  4KSQ A;  5CZI A;  4IX3 A;  3RM6 A;  4UYA A;  1XR1 A;  4B6L A;  5CEQ A;  2FSM X;  4JX7 A;  5L2Q A;  1CDK A;  3C4C A;  5L6W L;  2WMR A;  4FV2 A;  3R8P A;  3SRV A;  3BV2 A;  1PYE A;  3BYM A;  2ERK A;  4XV1 A;  4BDJ A;  4BTJ A;  1H24 A;  3FI3 A;  3C0I A;  2PML X;  3OBG A;  4YO6 A;  5TR6 A;  4FOD A;  1JLU E;  3FUP A;  2WTC A;  4IB0 A;  4XRJ A;  4O22 A;  3E3P A;  4MXA A;  4GG7 A;  2WQE A;  4JAJ A;  4L3L A;  3BE2 A;  5EYM A;  3VUD A;  3NUS A;  2BIY A;  2C5N A;  2XA4 A;  4FKV A;  3GC7 A;  3QTQ A;  3UMX A;  4ZLZ A;  4GV1 A;  4QMP A;  2FST X;  3R7G A;  3FL5 A;  3MY5 A;  3F82 A;  1ZYJ A;  3A60 A;  4FIH A;  5E8Y A;  5HIC A;  3FE3 A;  3I6W A;  3K5U A;  4XG6 A;  4G31 A;  4RIY A;  2OF4 A;  2UW4 A;  3QGY A;  5LXM A;  3RCJ A;  3ZXT A;  4FVR A;  2HZI A;  3KXH A;  3FQH A;  3TL8 A;  1Q8Y A;  3BYV A;  3EKN A;  2HZN A;  1G3N A;  4H3Q A;  5AR8 A;  4MXC A;  4D5K A;  5IME A;  4UXQ A;  1OL5 A;  4ACC A;  1H0W A;  3UP7 A;  4CD0 A;  4MKC A;  5HEZ A;  4EYM A;  4U42 A;  3UNK A;  2O5K A;  5IA1 A;  3LXP A;  4DED A;  3TUC A;  3VBQ A;  5BYZ A;  4N6Z A;  4IAZ A;  1E1X A;  4N4S A;  5AP3 A;  3AGM A;  2UZO A;  4E4N A;  3F3V A;  3P0M A;  5BUE A;  4AGD A;  2BDJ A;  3K5V A;  4FKJ A;  3A8W A;  2W0J A;  3FHI A;  2J0J A;  3P5K A;  2JKQ A;  5EG3 A;  1H26 A;  4KS7 A;  3TT0 A;  3O8T A;  4I93 A;  3RWP A;  3VRZ A;  4FSM A;  4FL3 A;  2UZD A;  4O4B B;  3UZT A;  4KIN A;  3HX4 A;  3FSK A;  2R3F A;  3MY1 A;  4FV4 A;  4IAC A;  4KBC A;  3ERK A;  4OUC A;  3KGA A;  5CF8 A;  3Q96 A;  4FZ6 A;  4YO4 A;  4M14 A;  1Q41 A;  3D5W A;  4UMP A;  4AFJ A;  3KN6 A;  3G5D A;  4IFC A;  4JBP A;  3QAM E;  3UC3 A;  2J0K A;  4FNZ A;  2OXY A;  4K8A A;  2VX0 A;  4GMY A;  4TYJ A;  3RIN A;  3Q9X A;  5HVK A;  3ODZ X;  4FKP A;  4GL9 A;  3RKB A;  3DBQ A;  4GUB A;  3I4B A;  2QI8 A;  4GK3 A;  5EK7 A;  4RIO A;  5K0X A;  2XJ2 A;  5IKW A;  4AAA A;  3DQX A;  4JL9 A;  5KZI A;  4EH5 A;  3IW7 A;  3ORI A;  4OTQ A;  4AA0 A;  1UV5 A;  3R00 A;  4EH2 A;  1ZYD A;  4CFF A;  3VW8 A;  3FI2 A;  3FDN A;  4KS8 A;  4NKA A;  4DH3 A;  4ZJV A;  4ID7 A;  3GVU A;  1U46 A;  2BHE A;  2VTQ A;  3CPB A;  4XV3 A;  3ULZ A;  4IEB A;  4MED A;  3V6S A;  1IEP A;  2CCH A;  4IZY A;  1GOL A;  2B1P A;  4HOK A;  3DLS A;  3R2B A;  2QOQ A;  4RFY A;  5CS6 A;  2VTH A;  3RPO A;  4AAC A;  5EDR A;  3NUX A;  5L4Q A;  3FME A;  4LM5 A;  1DAY A;  3WIL A;  4LOP A;  4QTD A;  2Y8O A;  3H4J A;  5DG5 A;  1Q3W A;  3R73 A;  2BVA A;  3D5V A;  4HVH A;  5I0B A;  2I0E A;  3PXF A;  1M7Q A;  4FVQ A;  5E8S A;  4ALU A;  4QMX A;  3ENM A;  2YIR A;  2R4B A;  4G2F A;  2YM6 A;  1O6L A;  4QYY A;  2V7A A;  2ONL A;  2JIV A;  3PE1 A;  3LPB A;  4FT7 A;  5CXZ A;  3LFB A;  3P78 A;  4JT3 A;  5FED A;  2NPQ A;  3AMA A;  4FK3 A;  3BGQ A;  3R8Z A;  2XZS A;  2IW9 A;  3UG1 A;  2VNY A;  2ZVA A;  4UMR A;  5DFP A;  5IA5 A;  1HCL A;  4RFM A;  4O4C A;  2C3L A;  4QNA A;  2XIX A;  3ORT A;  4ZJI A;  2W1C A;  4L67 A;  1P4O A;  3BQC A;  3QQL A;  1PXP A;  3VS3 A;  3ZSG A;  5DEW A;  2YM3 A;  3QUD A;  5TF9 A;  3ZLX A;  2CJM A;  3C51 A;  5HE2 A;  1GZN A;  5AAD A;  2JFL A;  4XYF A;  3HEG A;  5HX6 A;  5HID A;  1ZYC A;  4XP2 A;  5F20 A;  4GH2 A;  3SLS A;  3RHX A;  3ZFX A;  2Z2W A;  2B53 A;  4FZF B;  4N70 A;  4LRM A;  3BBT B;  3CTQ A;  3NNX A;  4DG2 E;  3VS6 A;  3UDB A;  2UW6 A;  3ANR A;  4I5M A;  4D1S A;  2REI A;  3VS1 A;  2BRN A;  3VN9 A;  3LIJ A;  1KV2 A;  4AUA A;  2BRB A;  1OI9 A;  2QQ7 A;  3BHH A;  3ALN A;  2X0G A;  3VID A;  4GFM A;  3FC2 A;  4GFG A;  1M2P A;  3EB0 A;  2XK6 A;  3GI3 A;  3PVU A;  4RJ3 A;  3V5P A;  4C3F A;  4GG5 A;  3UJG A;  3EN9 A;  4Y8D A;  3BX5 A;  3GU7 A;  4GK2 A;  4FTM A;  5M56 A;  1URW A;  3GU6 A;  5A14 A;  4F4P A;  3BI6 A;  3A7I A;  4GYG A;  4YBJ A;  4XG4 A;  2PTK A;  4FSN A;  2FB8 A;  1OM1 A;  3UIM A;  2I0V A;  2XKF A;  4CQE A;  4IM0 A;  4JIA A;  3PG3 A;  4FIF A;  4N6Y A;  5I9V A;  3L9M A;  4AZV A;  3R2Y A;  4NFN A;  5KBR A;  2GS7 A;  5HG9 A;  5EHO A;  4F99 A;  3KMU A;  3KCF A;  3ACJ A;  2JAV A;  4NFM A;  4E1Z A;  3R0T A;  2IF8 A;  3MFS A;  4CSV A;  4ACD A;  3GQL A;  5IEY A;  4U80 A;  2WTJ A;  4OBO A;  2C0T A;  1KE6 A;  3BGP A;  5AP0 A;  2XUU A;  4YJN A;  4EUU A;  3VUL A;  4CT2 A;  1OIQ A;  1F3M C;  3TJC A;  3UYT A;  2V55 A;  4AFE A;  3OCS A;  4OW8 A;  3A2C A;  5M4U A;  1M17 A;  5IEV A;  3FXZ A;  1WVX A;  2G2F A;  2QO9 A;  2X9E A;  5EYC A;  4M69 B;  4QNY A;  1HOW A;  5GZ9 A;  4FT0 A;  4IE9 A;  4AZT A;  4MBL A;  3E88 A;  4PPA A;  4RX8 A;  5FM2 A;  2HY8 1;  4KSP A;  4AOI A;  3WF6 A;  4MQ2 A;  4FZA B;  5F9E A;  4MWH A;  4PTC A;  2VO7 A;  3PXY A;  2EWA A;  2O0U A;  5ETA A;  3QRJ A;  4PL3 A;  2XH5 A;  3JXW A;  2HWP A;  4FSQ A;  3QQH A;  5CAL A;  3D2I A;  5DR9 A;  1DI9 A;  2X2L A;  3TN8 A;  1KOB A;  2RF9 A;  4FMQ A;  3IEC A;  1UU7 A;  2W1E A;  4FF8 A;  2V22 A;  4E20 A;  5CY3 A;  2BZJ A;  4O21 A;  4RC3 A;  3MVM A;  2BIL B;  2I0H A;  3ANQ A;  2R3O A;  1JVP P;  4IQ6 A;  2W5H A;  3ZHP C;  1U5Q A;  2P55 A;  3DLZ A;  2PVR A;  3ALO A;  4QQ5 A;  3U87 A;  4IDT A;  3FMN A;  3HMN A;  2BFY A;  3GEQ A;  4KIP A;  4EK6 A;  2Y6M A;  3GNI B;  3DAJ A;  5K5X A;  4K2R A;  4MNE A;  1MRV A;  1PMN A;  3FPQ A;  5BPY A;  3ZO2 A;  2CLQ A;  3S2P A;  3NWW A;  3PIZ A;  1OUK A;  4IZA A;  3IOK A;  1YQJ A;  3QZG A;  3UNJ A;  3VUK A;  2WKM A;  4C59 A;  4E26 A;  3BLR A;  4GJ3 A;  4G3C A;  4CV8 A;  3B8R A;  3OWL A;  5E8X A;  3NUN A;  5HU3 A;  1YXU A;  3I60 A;  3GCP A;  4YNO A;  4F1T A;  4G3F A;  5B7V A;  4EHG A;  2F2C B;  4OTD A;  4FK6 A;  4D0W A;  1UWH A;  3AD5 A;  4OTI A;  3OOG A;  3ZDU A;  5JMS A;  3PFQ A;  3WZU A;  5AJQ A;  2E9N A;  2XNG A;  2NRU A;  5ANE A;  1ZMV A;  2VTN A;  4USF A;  4A9S A;  2R5T A;  1ZRZ A;  4BYJ A;  3ZXZ A;  4EQC A;  4GT5 A;  4Z7G A;  3QD0 A;  4ZZO A;  1B6C B;  5HNI X;  5LVO A;  1WBT A;  5CSX A;  4QQJ A;  3ELJ A;  4OAU C;  4M69 A;  2JC6 A;  5K0K A;  4D5H A;  5FXS A;  5HZN A;  4RIY B;  3GT8 A;  5ETF A;  4RIX A;  3RP9 A;  4U97 A;  2JKK A;  5ANK A;  3ZO4 A;  5M4C A;  2ETM A;  2YM4 A;  3R1Q A;  4EOJ A;  3MB7 A;  3OMV A;  5EI2 A;  4UYN A;  4DIN A;  3LVP A;  2OJG A;  2HW7 A;  2O3P A;  4F9W A;  2BZK B;  3M11 A;  4TPT A;  4AZE A;  2XK3 A;  4RWK A;  4L3P A;  4B8M A;  3DOG A;  4YR8 A;  3VS4 A;  2OIQ A;  3MPA A;  4UZH A;  5AP4 A;  3A7J A;  3G6H A;  1QPE A;  4FST A;  1Q4L A;  3CY3 A;  3MI9 A;  2NRY A;  2R3L A;  4HPU E;  1P2A A;  4ALV A;  2PZ5 A;  1IG1 A;  3N51 A;  4FV1 A;  4M15 A;  3KXM A;  4JDH A;  5HBJ A;  3GB2 A;  3R7O A;  4EH9 A;  1FIN A;  4L42 A;  2CGV A;  4DN5 A;  5E8T A;  4PX6 A;  2H96 A;  2VO3 A;  2E9U A;  3PPZ A;  1P4F A;  3EQH A;  3GFW A;  4E5A X;  3U6I A;  4FSZ A;  3EFJ A;  4GS6 A;  5LMA A;  2QOF A;  3H10 A;  4JBV A;  5I5Z A;  2Z7R A;  4FKL A;  4PMS A;  3E64 A;  2VU3 A;  2Y7J A;  4J7B A;  4Z55 A;  1M2R A;  1OIU A;  3EID A;  5EM8 A;  3U9C A;  1BL6 A;  1YDT E;  3OHT A;  1YDS E;  2WTK C;  2ETR A;  4QT1 A;  1TQP A;  3IPH A;  2GNH A;  4J8N A;  3KMW A;  3VQU A;  3DT1 A;  3GOK A;  4WRS A;  3F7Z A;  5DH3 A;  4CFV A;  4WUN A;  2VRX A;  5AV2 A;  4BKJ A;  3P4K A;  4FNW A;  2HK5 A;  3CC6 A;  4XRL A;  4MBI A;  3JVS A;  4KIK A;  3G0E A;  4BIB A;  3PWY A;  4RG0 A;  3UC4 A;  5IZF A;  1Q8Z A;  3R21 A;  2VTT A;  4FL1 A;  4W4V A;  4II5 A;  2BKZ A;  1URC A;  4I94 A;  4IJP A;  2A98 A;  5AP6 A;  4BBF A;  4F0I A;  2B9I A;  5FWK K;  3GU5 A;  3Q3B A;  3WIG A;  3TNP C;  3PY3 A;  3FKL A;  4A9Y A;  4QD6 A;  4KAB A;  3RCD A;  5DGZ A;  4QP3 A;  3OTU A;  1SZM A;  3COK A;  4KIQ A;  3SVV A;  3PYY A;  4IWO A;  4Q9Z A;  3UBD A;  5BMS A;  4M3Q A;  5AP2 A;  3O7L B;  4WG5 A;  1DI8 A;  2A1A B;  4NM0 A;  4IWD A;  4P7E A;  4LUE A;  2HZ4 A;  1UNG A;  3I5N A;  4DG0 E;  3DKC A;  2WNT A;  4EKK A;  1GZ8 A;  5IEX A;  5J1W A;  1WBV A;  3PSC A;  4H36 A;  5D7A A;  1RW8 A;  1H1Q A;  1WZY A;  5CAN A;  3VUT A;  4QMV A;  3VW6 A;  2W4O A;  3OG7 A;  4ZLO A;  3FYJ X;  4FZ7 A;  3LXK A;  1PXL A;  3FXW A;  4ZIM A;  3MFU A;  3W8Q A;  3MIY A;  3ZBX A;  3EQB A;  3IO7 A;  3SA0 A;  2W1H A;  3IGG A;  4QYF A;  4X3F B;  1XH8 A;  3I6U A;  4JR3 A;  3BLQ A;  4B4L A;  2XP2 A;  3V3V A;  3R7U A;  3RJC A;  3CP9 A;  4NJ3 A;  2CGU A;  2BAK A;  2JBP A;  4M66 A;  3VBY A;  2UZU E;  3UIU A;  2J9M A;  2ITQ A;  5DT0 A;  4IM3 A;  5BUI A;  5LJJ A;  2G15 A;  4EOI A;  1OPJ A;  2OSC A;  4XBR A;  4G3D A;  4ZSL A;  4EOO A;  3I1A A;  3LJ0 A;  3MVJ A;  4MYG A;  5KX8 A;  5HE3 A;  4PMP A;  2AUH A;  4C38 A;  3KQ7 A;  4G5J A;  2C3J A;  1R0P A;  4TY1 A;  3FBV A;  2QOO A;  4PPB A;  5AUV A;  3GC0 A;  2GMX A;  5L8L A;  3OBJ A;  5DT3 A;  2WMQ A;  4V05 A;  5HTB A;  3LW0 A;  3QXP A;  5AAE A;  1NY3 A;  4OTW A;  4ZS0 A;  4BGH A;  2OZA B;  4QO9 A;  4Y72 A;  2FYS A;  3AG9 A;  1FVV A;  3TXO A;  4DFX E;  3SOC A;  4FZD B;  5GZ8 A;  3V6R A;  1YXT A;  2YM7 A;  3FHR A;  2C4G A;  3Q6W A;  2ITT A;  5CU3 A;  4CCB A;  4NM7 A;  1VZO A;  3DKO A;  4O0Y A;  3QTX A;  3DND A;  4Y46 A;  4YJV A;  4CYI A;  2ITX A;  5A4Q A;  4FTJ A;  1RJB A;  5FDP A;  4RJ7 A;  4XV2 A;  3QLG A;  4EH8 A;  4W9W A;  3DTC A;  3R71 A;  4U0I A;  2BR1 A;  2WTW A;  2YAB A;  3CEK A;  2ZMD A;  4IM2 A;  2XMY A;  4S2Z A;  5L2W A;  3ZU7 A;  4FT3 A;  1OIR A;  2UZV A;  4O4D A;  4YJQ A;  3EL8 A;  3AD4 A;  4KWP A;  1GY3 A;  3DTW A;  3F5X A;  3SXR A;  4BCJ A;  4FKU A;  5ANI A;  4NW5 A;  4G6O A;  4W4W A;  2IW8 A;  2X6D A;  4MD9 E;  4JX3 A;  5AR3 A;  2VX3 A;  3AC1 A;  5ICP A;  2P3G X;  4F0F A;  4DEG A;  2C1A A;  3MTL A;  4HJO A;  3LAU A;  5C8K A;  4CLJ A;  4LV5 A;  2XCH A;  4CKJ A;  2R3N A;  5GHV A;  3G9L X;  3H9R A;  4IH8 A;  4OTP A;  3WF5 A;  1PXN A;  3HMO A;  4CZU A;  5JSM A;  4UV0 A;  2FGI A;  4G17 A;  3NNU A;  3C9W A;  1OGU A;  1QL6 A;  2W1Z A;  4GK4 A;  4U81 A;  5CVG A;  4CTC A;  4XP3 A;  2O64 A;  1GII A;  2FO0 A;  2V62 A;  3KXX A;  3NRM A;  3KXN A;  4QYH A;  3PP0 A;  2VUW A;  4QMU A;  3Q9Z A;  3HGK A;  4AGU A;  2G2I A;  4C4F A;  5HU9 A;  3W2O A;  4WSQ A;  3UYS A;  4BDK A;  3AC2 A;  3O51 A;  4BB4 A;  3WF9 A;  2XKC A;  3V8W A;  2RKU A;  4IWP A;  4NIF B;  4ASZ A;  4RRV A;  2CLX A;  4UXL A;  4RVM A;  5A4L A;  4XV9 A;  1H28 A;  3QGW A;  3RPR A;  3BLH A;  3P7A A;  1L3R E;  3Q04 A;  3P7B A;  3Q5Z A;  5BYY A;  4X6Q C;  3LM5 A;  3GCV A;  2VV9 A; 
#chains in the Genus database with same CATH homology
 4O4C A;  2A98 A;  4O4D A;  2X0O A;  4FRF A;  2X0P A;  1W2F A;  1W2C A;  2AQX A;  4O4B B;  4O4E A;  2IF8 A;  2IEW A;  2X0Q A;  4O4F A;  1W2D A;  1TZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...