2GSFA

The human epha3 receptor tyrosine kinase and juxtamembrane region
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
310
structure length
281
Chain Sequence
TYVDPHVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 3
publication title Structure Of The Human Epha3 Receptor Tyrosine Kinase and Juxtamembrane Region
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 281
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gsfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gsfA01
4C2WA 3PXRA 4YTHA 4M67A 4V0GB 2GCDA 4BGGA 4D5HA 2A0CX 1KE8A 3A4OX 2IW9A 4FTAA 5AAFA 4CFMA 2WMUA 1RDQE 2XEZA 3O51A 4J95A 3UQFA 3UBDA 3UTOA 3S3IA 4FKUA 3R21A 4LOQA 3SX9A 4DH8A 5CASA 3ZSIA 4FICA 4I41A 2CN5A 2C4GA 3AGLA 3DB6A 1Q41A 3OUNB 3QCQA 4BF2A 3ZDUA 2YWVA 5CEKA 2V22A 1ZLTA 4YPDA 2R3KA 4BR3A 3WE8A 2W1ZA 4DFLA 3FL4A 2JIUA 3FXXA 2C3LA 2VX1A 2XNMA 4QPAA 3COIA 2NNWB 4L3JA 5E9EA 2YM3A 1VJYA 4AE6A 2VAGA 4DINA 1YXUA 5BVEA 3AG9A 4CFWA 3UNKA 2VTQA 2UZUE 3HP2A 4O1PA 2QHMA 1CDKA 3LFSA 5DG5A 2O5KA 5IQIA 3EFKA 1Y8YA 2PZ5A 3LM0A 3I60A 3IW6A 5CI7A 5HE3A 4E4NA 5EKOA 4E73A 5L2WA 3DOGA 2QONA 3UP2A 1WBTA 3T3UA 3EFLA 4HOKA 5GJFA 1GZOA 5F94A 4YJSA 4UMTA 4AX8A 5E8VA 4O21A 3TZ8A 5BNJA 3IW5A 3UE4A 4O7WA 4KKHA 3U8WA 3FI2A 3Q9WA 4LV8A 2CKEA 4YO4A 2XYUA 2ZV9A 3QC9A 3LLAA 4DFYA 1Y8GA 3PY0A 4K2RA 4D28A 3C1XA 4IZ5A 4TTHB 5DRDA 2GTNA 5ANOA 4NL0A 3UOHA 2R3JA 5DLSA 3VRYA 4EL9A 1WBOA 4H1JA 4PDPA 4O0VA 4CV8A 4FZAB 3NDMA 4JQEA 4OTQA 5EOLA 1YOMA 3RVGA 4QQCA 5H3QA 5EQYA 4A4OA 3TTJA 3IQ7A 4HCVA 3RP9A 4G17A 4AFEA 4EQMA 4OAVB 1F0QA 3VS0A 5KMLA 2BMCA 5LVPA 3QBNA 4ALWA 3HRCA 4TW9A 3I7CA 4FG9A 5AMNA 2X7GA 2YIRA 5M4FA 4WG4A 3DK6A 4E5AX 3LCTA 4KBAA 2RFSA 1WVXA 1PMUA 3DXNA 3R63A 1H28A 4EOMA 4J96A 1OPKA 4AGUA 2W5HA 3BWJA 4K18A 1Q8UA 3I79A 4XX9A 4IEBA 4D58A 1H1QA 2IO6A 3ZOSA 4BL1A 1KUTA 5ANDA 3F2AA 4KSQA 3F7WA 3M11A 4BZOA 3AT4A 5F9EA 3DXPA 3NRMA 2HXLA 3R9NA 4I6QA 1LEWA 3E64A 5EM5A 4K6ZA 2X6DA 3KRXA 3VS5A 5AA8A 5FM2A 2BIYA 5JQ5A 4C4JA 4UY9A 4C37A 2X39A 3BU6A 1QPEA 4ZSJA 4C57A 3SVVA 1YKRA 3V5TA 4E4MA 4YSMA 2BKKA 1ZXEA 4I94A 3EIDA 2YCRA 2VTSA 4WBBB 4EBVA 4M14A 4M13A 4IFGA 4JT3A 4Z9LA 1YOJA 3ALNA 5AADA 4Y95A 3R8LA 3FKNA 4HJOA 3KMMA 4AZWA 5FLFA 3DNDA 4DGGA 4UZDA 4IAAA 1Q8ZA 5H8BA 2UW4A 4EH4A 3UJGA 3CE3A 5IA0A 3CJGA 4XRJA 4I23A 3IDBA 3UPXA 2CGWA 3DJ7A 4I22A 5DWRA 3NUPA 3Q5IA 3CP9A 3D5XA 1T46A 3C50A 3OY3A 2W1GA 3PSBA 5AM6A 3NW6A 1Q97A 3PVWA 4BWKA 3EQHA 3PG1A 1MRVA 3NUUA 3IGGA 3RPVA 5M51A 3MFSA 4JR7A 2CN8A 4FTJA 3GOKA 3I81A 2UW0A 4PL3A 4L3PA 4W9XA 5HVJA 4D1XA 2W4KA 3ROCA 2OIDA 4DH3A 4FGRA 3NCGA 2BZHB 1GZKA 1F3MC 4RBLA 1Q8TA 2FYSA 5HEZA 5HLNA 4QTCA 5FEDA 4OBOA 3FWQA 1F5QA 4G3EA 4NH1A 3H9OA 4WSQA 2CKQA 4F0IA 2UZOA 3DZQA 3LJ1A 5AV0A 1UKIA 3QALE 3R02A 4MD9E 5HE1A 3P9JA 4W4YA 3AT2A 3E7OA 3KMUA 3D7TB 3MW1A 3TUDA 2WU6A 4YBKA 3UO5A 2QO9A 3NNVA 1ZZ2A 4YZDA 3QHRA 2B9HA 5J79A 2XNGA 3AD5A 3F3ZA 4G6LA 3VO3A 3R2YA 4PNKA 2XZSA 2FSLX 5GIPE 1PF8A 4EH7A 5FDPA 3QCXA 4I4FA 4HYIA 4FKGA 4CZUA 1OZ1A 2PE0A 3C4CA 4M68A 4OTDA 1R0PA 2ETMA 1OM1A 3EQRA 3UIUA 3CC6A 2WMTA 5AIKA 1YXSA 2ZJWA 2CCHA 3QA0A 4EOSA 3R7YA 1PJKA 2WO6A 1UNHA 3U9NA 5AR7A 3CLYA 4EYMA 1LEZA 3VJOA 2UW6A 3UOJA 2A4LA 3OWLA 1NT2A 3HNGA 3MB6A 5AR2A 5K0KA 5M09A 1V0PA 2WMBA 3L9PA 2ACXA 4ZAUA 3DKCA 4BKJA 5GINE 5JFXA 4MX9A 3UC4A 2QG5A 4JAIA 3T9TA 4RMZA 3MY1A 3PLSA 4EYJA 3KF4A 3WILA 3S4QA 1Y6BA 5HBJA 1EH4A 5CYIA 3ORPA 3IKAA 4MXCA 2C0TA 3QTSA 3VHEA 2BHHA 5L3AA 4X0MA 3FI8A 4CG8A 2YN8A 4BI0A 4CYIA 2YFXA 3MN3A 2ETRA 4X3FB 3W33A 4FEXA 2B1PA 2VUWA 5CLPA 4FIGA 4C4IA 4E1ZA 5IQHA 2WQOA 3LXKA 2QLUA 4U80A 3REPA 4FI1A 4MBIA 1NY3A 2R0UA 4KBCA 4NCTA 3ZC5A 5M08A 3IDCA 4IX6A 5EKNA 4YBJA 2X7FA 3C7QA 1VR2A 4J99A 4L44A 3TZ9A 5J5SA 1H08A 5EYKA 4V01A 3ET7A 4IAYA 3RCDA 5BPYA 3V8TA 4A9RA 4NZWB 2JGZA 1B38A 3U4WA 4ASDA 2IW8A 4QMQA 4AU8A 3DBDA 1P4FA 4GFMA 2ZOQA 2UW3A 4C4GA 5IISA 3C0HA 1R78A 4USFA 2CKOA 4IVCA 5BVKA 5F4NA 2OJGA 4FL2A 4E6AA 2OGVA 3F61A 1DI9A 4O86A 4BCQA 5HCXA 2XKDA 4IVBA 4KBKA 4C61A 1XBAA 3NIZA 2ITVA 4F64A 4FTRA 4ZXTA 3R1NA 3HMOA 3WOWA 4ASZA 2XNNA 4WUNA 2WHBA 3MIAA 3MFRA 4QMWA 3UO6A 3W8QA 4O7LA 5D7AA 2C47A 4JR3A 2AC5A 1XH7A 2Z7SA 3KMWA 4HYHA 4FVQA 3VWAA 4J8MA 3I0QA 3FXWA 4QP4A 2RFEA 3L8VA 3R22A 4GCJA 4ZEGA 4AZTA 4KKGA 3NNUA 3TIZA 3TN8A 2IZRA 1FOTA 3TNQB 2VV9A 4EQCA 3GCUA 4NW6A 3RAWA 3TNPC 2GSFA 3VULA 5HLWA 5HKMA 5KUPA 3O17A 1MQBA 4QYFA 5B2MA 4YC6A 3P23A 3QLFA 2P4IA 2RF9A 2H8HA 2X9FA 3IOKA 4FEVA 3R0TA 4D5KA 4EJNA 5FP6A 1JPAA 3QZIA 5JT2A 5I9YA 5IQFA 5CVHA 3HMPA 4C2VA 1P2AA 4QP9A 3RALA 3NZ0A 2GU8A 4TL0A 3ZEPA 2Y4IB 4ZSGA 5CAPA 3PJ2A 3IG7A 4KRCA 4D0WA 4MXAA 3RK5A 3ZBXA 4HVDA 2XH5A 5EFQA 2BRBA 1S9IA 2FB8A 4FV8A 4Z55A 4O27B 3F88A 3JPVA 3HV6A 3CEKA 2E9UA 4BDHA 4BBMA 4E7WA 3W1FA 2AUHA 4RIYA 3ZRLA 4ZMFA 4CGAA 4S30A 2PMOX 3ZYAA 3HAVA 2OO8X 2UZTA 3HLLA 3TACA 4BDGA 3N4TA 5E8UA 5EDRA 4TNDA 2VN9A 1H1PA 5A9UA 2E2BA 5AR5A 5KNJA 1JKTA 1OECA 2ITPA 3KXHA 4ZJVA 3EQBA 3OVVA 3D5VA 4R3PA 3RM6A 4GKIA 5IG1A 5CEOA 3G9NA 4IQ6A 5GHVA 4MD7E 3VW8A 2B52A 3ORMA 3ZUTA 5TO8A 1VZOA 4L52A 4WHZA 4B7TA 1BX6A 3DTWA 4DFNA 5E8ZA 2C0IA 2WZJA 2R3RA 4IX3A 4QNYA 5ACKA 5CTPA 4XYFA 3IOPA 3FQEA 2HXQA 3KRWA 3UNZA 5HTIA 1WBPA 3Q4CA 3QQFA 5DN3A 1W7HA 5CALA 2EVAA 3W18A 2EU9A 4QP6A 4YP8A 2XKCA 2Z7QA 4GVJA 2C3IB 5DHJA 3DAKA 1IA9A 5FUTA 3KGAA 4FV0A 3RCJA 1W98A 2J51A 5M06A 5CU3A 4TYIA 3UYTA 1W84A 1RQQA 2IVSA 4U42A 1ZYSA 5D11A 4XOYA 4F9WA 3QA8A 2GS2A 2QOQA 2ZV2A 3CS9A 4MNEB 2C6EA 3LFFA 4XV9A 4O7NA 3PVBA 3V5WA 3PXYA 2NRUA 3JUHA 5BX0A 4BCIA 3R83A 4AZSA 2JEDA 3G9LX 3A8WA 3I7BA 3O50A 3OW3A 4HCUA 5CQWA 4F09A 3BZ3A 3LXPA 3GU6A 2QOFA 2GNJA 3UPZA 1ZYCA 1JWHA 2H34A 3EN5A 3QHWA 4RIXB 4RJ3A 4EZ5A 5BQ0A 5AV3A 5JN2A 3NW7A 5D12A 4IH8A 3R7IA 4C02A 3I5ZA 3PY1A 4WRGA 3NIEA 4YJQA 3HUCA 5EW8A 4QD6A 3EQIA 2P2IA 1MP8A 2QURA 2HWOA 3OROA 4GFGA 2VTIA 5C01A 3EYHA 5IA4A 2PZRA 1PW2A 2PU8A 3NPCA 4UXLA 2V7OA 4L43A 4NCTC 2XBJA 4BYIA 2OICA 4RJ6A 2YIWA 2BRMA 4IDVA 2WQNA 3PWYA 2YJSA 4O0XA 3ZBFA 2GNLA 4JDIA 4FC0A 4FSWA 4C36A 3OCGA 3FLQA 4LMNA 4UYAA 4C3PA 1O6LA 4UB7A 3BHHA 3ORLA 3RKBA 5A4QA 1E1VA 2PSQA 3OBJA 3LCDA 2J2IB 3SD0A 4UBAA 2XJ1A 4FK3A 4EHZA 4AA5A 5HG9A 3VUTA 4C58A 3LCSA 2GMXA 1OL2A 1KOAA 3OFMA 1KE6A 2ITYA 4IB1A 4LL0A 2Q0NA 2WEVA 4XV3A 5AP7A 1FVTA 4E4XA 2WMSA 4YU2A 5CF5A 3BV3A 4U40A 3VRZA 2C69A 3KRLA 1OUYA 2A27A 4NSTA 3ODZX 5EK7A 5AA9A 3ALOA 3JR1A 2ESMA 4FF8A 2WB8A 3VQUA 3JS2A 3LMGA 2BDWA 3W2QA 1ZY5A 3C0GA 2VO0A 3O7LB 3FAAA 3ORNA 3RJCA 4C33A 2PYWA 3GI3A 3O96A 3E7VA 5EYCA 4ALUA 5A4CA 3H0ZA 1XQZA 3WI6A 4OGRA 4LGGA 3RNYA 2EXEA 2J50A 3KK8A 3V5QA 1WBVA 1ZMVA 1O6KA 4BB4A 1XWSA 1YW2A 2A1AB 3PZHA 4RLLA 5KCVA 5CENA 4U3YA 3QQUA 4FZDB 4YUQA 1FVRA 3COKA 4WNMA 3RPOA 5J9ZA 1MRYA 3Q53A 4F1TA 3VNTA 4ASXA 2VWUA 3Q3BA 2H9VA 3S0OA 3CR0A 5HNGA 4QPSA 3FLYA 3SRVA 4DGLC 4HVHA 5GZ8A 2W4JA 3GU7A 3HL7A 2W06A 4O22A 5FTOA 2W1CA 5IUIA 4IM3A 4D2TA 2Y4PA 2CCIA 2F57A 2JD5A 3JVRA 2Q83A 2G2HA 2OXDA 3EZRA 3PIZA 5IEVA 4K9YA 2Y8OA 3FZRA 2JKQA 3I4BA 4TWOA 3E8DA 3NNWA 4CFFA 3GCSA 3TZ7A 3HAMA 3AC2A 1NVSA 2UZWE 2SRCA 3OXZA 4DG2E 4ANSA 4GK4A 2B0QA 4BDKA 3I1AA 1LR4A 3LFDA 4CRLA 5CS6A 3P7AA 3G6HA 2QO7A 4I1ZA 3N51A 2PL0A 2ZMCA 4IB3A 4QMSA 4AOTA 5CEPA 3ORIA 3ORZA 4Z7HA 3MH3A 5K4JA 1J3HA 4JX3A 4EUUA 2VX0A 3R28A 3O0GA 4S32A 4IAFA 5LMBA 4QP7A 4EI4A 2HCKA 3ATSA 4XCUA 4OTGA 4MF0A 3TNWA 1PRYA 4MQ1A 4ORKA 1ZY4A 1AD5A 5HX8A 2KTYA 4RVMA 2FSMX 3FHIA 3RAKA 3RINA 4NU1A 3VJNA 5AUUA 2C6DA 3SXSA 5K9IA 1H27A 1ZOHA 2BZIB 3MS9A 4YNEA 4NM0A 3CY2A 5LVNA 3MPTA 4S31A 4FEWA 1WBSA 2IZSA 5LCKA 3SOAA 2BPMA 2PTKA 2W1DA 3FMDA 5DPVA 3U6IA 4KUJA 3AGMA 2WTWA 2ZB1A 4BCJA 4MWIA 4U7ZA 2XIKA 2X2LA 3RZBA 3SHEA 5LARA 4WG5A 5FWKK 3ZU7A 4E4LA 3WBLA 3KY2A 3MVLA 1H1WA 2EB2A 3FZSA 5CY3A 4ZK5A 1P14A 4TYHA 1GY3A 3DY7A 3KCKA 4FKWA 4IB5A 4BYJA 1UU7A 2OH0E 3FZTA 3PJ3A 4RC2A 3QD4A 4D9TA 5ANJA 1OB3A 1PY5A 3PJ8A 3OT8A 2H96A 3QTQA 4AW5A 4IACA 4ZZNA 1U5QA 4B8MA 2CDZA 4JIKA 2QVSE 4L01A 4QNAA 4BDFA 4HNIA 3MFUA 4CCUA 2CJMA 3T9IA 5J1WA 3E63A 3NS9A 3RK9A 2QOCA 2FH9A 4JBQA 2E9VA 4HPTE 4PMSA 2W99B 3MI9A 2CLXA 4GW8A 3TNIA 1ND4A 1XH4A 3M2WA 5IA3A 1FINA 1IA8A 1ZOEA 5HHWA 2YAKA 5IUHA 5LVMA 3FI4A 4C38A 2HW7A 3ULIA 3F3VA 2BAQA 4IX4A 2ONLC 3UIBA 3OCSA 2PPQA 5AUXA 4F9AA 4RWKA 5FQDC 5T3QA 1RE8A 2PMIA 4FKVA 4JI9A 3DKFA 3R7EA 1I09A 4ZTLA 3LQ8A 3VS1A 5FGKA 3VC4A 5IA2A 4R5YA 3U51A 3K2LA 3QCYA 4BHZA 4C4HA 4FKRA 2C6LA 5HLPA 4YZBA 5AFVA 2UZEA 2RSVA 2OSCA 2G01A 5CNOA 4XG4A 2ITOA 4A9UA 2VTPA 2FO0A 3CD3A 4JVGA 5HG8A 2XNEA 2J0IA 2Z2WA 4FZ7A 4CYJA 1XH5A 2G2FA 3AMAA 4FA2A 4N57A 2CGUA 2O65A 4CLIA 4CQGA 4X3FC 2W1HA 3WIKA 3OEFX 2ITZA 4Y8DA 4J8NA 4DBNA 2PE2A 4RLKA 4PWNA 1BI8A 5J1VA 3ODYX 5AUWA 1QPDA 1ZAOA 2HOGA 3CPCA 3O8TA 1IAHA 3R1QA 4LOOA 1PMVA 5KKRC 2PK9A 3BHTA 4S2ZA 1E1XA 3LCKA 4PX6A 4ZLYA 2XMYA 4MXOA 1H26A 4AS0A 3BBWA 3R30A 4A9YA 3VHKA 4JX7A 3KREA 4OLIA 3R1YA 4BGHA 5JFSA 3G15A 3F7ZA 3M42A 2FUMA 4O2ZA 1M17A 4X2JA 3A60A 2X4ZA 2QC6A 4I92A 4D4RA 2PULA 4ZY6A 2JIIA 1UNLA 2Y6OA 3CTHA 3ACKA 4O82A 1IR3A 5DR6A 4R8QA 4RVLA 5CF8A 3VF8A 4DFXE 4AZEA 4R1YA 4GS6A 5K5NA 4M0YA 2BFYA 3FKLA 3MY0A 3PJ1A 4ACMA 2ZV7A 3P4KA 3PXZA 4XS2A 5EHYA 2YDJA 4KIOA 5JZNA 2VNYA 1OKVA 2O0UA 2YEXA 1H24A 2QKWB 4GT5A 4UWYA 5H8GA 3ZSGA 3GP0A 2GQRA 2WMVA 3D7ZA 5AP5A 1U54A 3VVHA 3EKNA 3OBGA 3EWHA 4FIFA 4YZNA 1W0XC 3VS7A 4O96A 2WTDA 2W5BA 4C3RA 4GMYA 2PMLX 2RIOA 4MK0A 2WMXA 3FZPA 3HV4A 3OWKA 4DT9A 5IQGA 2YACA 5A14A 5C8KA 2YABA 4I6HA 5KMJA 5E1SA 2I40A 2XKEA 4HVSA 1NXKA 4P5ZA 2HIWA 4RA5A 2HY81 3TEIA 4MAOA 2XA4A 4XG9A 4QYHA 3ZXZA 4K8AA 5B7VA 4E93A 5EM6A 3UQCA 3JXWA 5ETCA 2QNJA 5LVOA 3EHAA 2Y4IC 3RAIA 4F6WA 5HTBA 3BEGA 1ZARA 4KA3A 4JAJA 4D4YA 3LMIA 5DOSA 2PY3A 5KBQA 3PG3A 3NX8A 3RI1A 4D55A 2OG8A 5JGAA 4E6QA 3FEGA 4AQCA 3BU5A 2ITNA 2X8DA 2VO6A 3FMLA 1UNGA 1VYWA 4D1SA 4WT6A 3TKUA 4AW2A 4YHJA 3U55A 1I44A 4EZ7A 2R3PA 5IDNA 4CT2A 3UODA 4JJRA 5BUIA 2UZLA 3H30A 4L6QA 4ZS4A 4KIKA 3ZS5A 3OEZA 4FV1A 3UQGA 1YI3A 1PXKA 3GC0A 4HW7A 4F0GA 1AGWA 2VTNA 2IZTA 4EOIA 3FLNC 2WXVA 3TNHA 4Q5HA 4O7ZA 2VGPA 1FMOE 4JG7A 4TYJA 3DNEA 1NVQA 4EK3A 5KMOA 4YC8A 4FTLA 4BBEA 1K9AA 5D9HA 3RWQA 2WELA 3QFVA 4RQKA 4RX9A 4C3FA 4AT3A 4F6SA 5JKGA 1WBNA 4LG4A 4U9AA 4QTEA 3MTFA 3SV0A 5IQAA 3W16A 3TDVA 3VBVA 4E5BA 4ZOGA 3G90X 3QGYA 4XG3A 3WZEA 5KX8A 5C9CA 1H4LA 5J9LA 4GU6A 1UU9A 4JDKA 4DA5A 4GK3A 2J5FA 3Q60A 5AUYA 3L8XA 3TV7A 4U3ZA 3OY1A 5DE2A 5ANEA 3W55A 4EH8A 3C13A 4FSQA 3UNJA 5HE2A 3QUDA 2F9GA 5CZHA 3G0EA 3EL8A 3BEAA 3CTJA 5IKWA 4O1OA 1H1RA 2DWBA 3IS5A 3U6JA 3R7GA 4I0SA 5TOZA 5ANIA 3SC1A 1GIJA 5L2IA 4FK6A 3R01A 1REKA 3MH2A 1FGIA 2XM8A 3DGKA 4RFYA 3V6RA 4WNOA 3NNXA 2C6IA 3MPAA 5C4KA 3WE4A 1YWNA 2PVHA 2UV2A 4R1VA 3BGZA 4FV7A 3HEGA 4ANNA 3RBWA 4CKRA 4KRDA 4CZTA 3Q6WA 1BMKA 3F9NA 4RJ8A 5IMEA 5CT0A 3KN6A 1REJA 2GTMA 3CJFA 4YJVA 3Q4ZA 4GL9A 5DI1A 4ZTMA 2GS7A 2PZYA 2PUUA 4RIYB 2J0MB 1OIQA 2XIYA 4L67A 5LMKC 4BRXA 3SAYA 4ZSAA 1WFCA 3CBLA 4OT5A 5CU0A 5IH5A 4D2PA 2OXXA 3NUNA 4PTGA 4CQEA 4YJUA 1G8SA 3NYXA 4WRSA 5JGDA 4GSBA 3V01A 5IMXA 2R9SA 4U41A 3O2MA 3IO7A 2QOHA 4DCEA 2BAJA 3EZVA 3E93A 4ZLZA 4XP0A 3R8PA 3PY3A 3V8WA 2BIKB 4OTPA 1QPJA 1Q5KA 4FKLA 3HRBA 3FKOA 3CQWA 3N9XA 2Y7JA 2OZOA 3GCPA 1PHKA 2XIRA 4KS7A 4TZRA 3E8NA 5L8LA 3FMEA 4CTBA 2R7BA 4DLJA 4F65A 3SG9A 2DS1A 2JDRA 4K11A 5D10A 5LCJA 2ITWA 3DBEA 1X8BA 2PUNA 1GZNA 4EWQA 3V04A 5M56A 2Z8CA 5GJGA 2C5VA 1M2RA 4OTRA 3HV3A 4O0WA 4TPTA 4X7QA 4YJOA 3PVGA 4ANBA 3TJCA 5CSWA 5HD7A 5FDXA 2P3GX 3KCFA 3E3BX 5FD2A 3ELJA 4GYIA 3THBA 4BHNA 3MVHA 4FL1A 4PTEA 3POOA 3QRTA 5EM8A 5CF4A 2WPAA 4GFOA 3FQSA 3NUYA 3B2TA 3R8MA 4G3DA 3E92A 4IXPA 3VS3A 1SNXA 3D15A 4XLVA 4OW8A 3LAUA 4CNHA 3UG1A 2X8IA 2BROA 5E8TA 1J1BA 4GRBA 4AW1A 4XV1A 3WF8A 4HYSA 4CG9A 4V05A 4LRMA 3G0FA 4DBXA 3GQIA 3KRRA 4NFMA 3FC1X 5CU2A 3MY5A 3MB7A 5AAGA 3D94A 1PXJA 4QMNA 5CAVA 4FNXA 3UVRA 4Q9ZA 4J1RA 2C1AA 4OUCA 4F99A 2AYPA 1Y6AA 5LQFA 2PVMA 3BGPA 3HDNA 4FZFB 5M57A 4K1BA 2JIVA 1OKYA 1YXVA 3G33A 3GT8A 4NM3A 3R7VA 2W5AA 4IBMA 3ZLWA 4G34A 4H3PA 4D4SA 2Y6MA 2QCSA 4NEUA 4RWJA 3RPSA 4RQVA 5J7HA 4GVAA 2GNHA 3QKKA 4FV9A 4NM7A 2PHKA 4ITJA 4LYNA 3MVMA 3QUEA 1SVHA 1OVEA 4L00A 3GGFA 2OJJA 1YDRE 3CQUA 4XHKB 5TF9A 3VUIA 4R77A 5E8XA 4B6LA 3D5UA 3QXPA 4XP3A 3BV2A 2ZB0A 3W8LA 4WD5A 3K54A 4R78A 2XUUA 3HUBA 4PV0A 1UU8A 1J7LA 2IVTA 3HV5A 1JSTA 4FBXA 2ITUA 5J95A 3ZLSA 3DQXA 3ZONA 2WTJA 4FNWA 3UZTA 1Q4LA 4FV5A 4G6OA 4OT6A 5EDPA 4ONAA 4RG0A 4RJ5A 1Q24A 1R1WA 4W4VA 5HD4A 4ZMEA 4IC7A 4BTMA 1YQJA 4FNZA 5IQCA 4PMMA 3DKOA 2J0KA 4FV3A 3H3CA 4ASEA 3K5VA 2RGPA 4YLLA 3HRFA 3V8SA 3MH1A 1JNKA 5KKRB 2NP8A 4RPVA 4IE9A 1GIHA 5KMNA 5C26A 1T45A 3GB2A 5K5XA 3VS4A 2BZKB 4G16A 1IG1A 3EQDA 2UZBA 3G2FA 3VBXA 3FSFA 2QOOA 3Q96A 5EM7A 2VRXA 2UVYA 3BE9A 4M66A 5CVGA 2F7ZE 4Y5HA 3TUCA 4JL9A 5FXRA 5BMMA 2WIPA 3QTUA 4J53A 4YMJA 5ETIA 4FOBA 3F3WA 5AX9A 4DC2A 1URWA 5L2TA 3NYVA 2PE1A 4ZSEA 1OL7A 2GHMA 3QF9A 4IAZA 4RC4A 5A3XA 3HVCA 3SRVB 2REIA 1OPLA 2OKRA 3BIZA 1TKIA 2V5QA 4FEQA 4EK4A 4F08A 5K0XA 2WOUA 4GV1A 1YWVA 4E20A 4EOQA 4AE9A 3BHUA 4CFUA 1IEPA 4FTQA 4APPA 4DHFA 4X2FA 3R71A 1MQ4A 3ZH8A 4ENXA 3K3JA 3AC4A 3ZTXA 4D2VA 4UXQA 3HP5A 4CMUA 4FV4A 4I4EA 3AD6A 4WNKA 4DFUA 4F9YA 4I6FA 5DGZA 3VN9A 1STCE 4TWPA 4R5SA 3EMGA 4FTUA 4M69A 1AQ1A 4HPUE 4M15A 4YGAA 3OW4A 4QP1A 1Z57A 2JKMA 1WCCA 3H9FA 1TQPA 3IW4A 5EQPA 4RVTA 4BIBA 1TVOA 2DYLA 1XBCA 3HV7A 4XBUA 3DFAA 2YJRA 3BGQA 2OF2A 1BI7A 2BFXA 4FTKA 4OTHA 3GU4A 5EYDA 4YTCA 5FG8A 5BMSA 3A7IA 5L2SA 3S2PA 2C6KA 3EQCA 4AUAA 2G1TA 3TM0A 4JS8A 5CNNA 3QU0A 3R6XA 3G5DA 4BCKA 2J90A 3OHTA 4DLIA 1H8FA 3DLSA 5HESA 3UOKA 4BWPA 2YERA 3LFQA 2ITQA 3GCVA 5CXZA 5CAQA 3DU8A 4NFNA 2F4JA 1UV5A 2WMQA 2BRGA 2R64A 3OXIA 4QTBA 5DMZA 4BKYA 5DBXA 3QD3A 4WG3A 1IAJA 2EUFB 5EI6A 4A06A 4Z16A 1SMHA 5GZAA 3MJ2A 2WU7A 1UU3A 4PY1A 4G5PA 5IA1A 5J9YA 4C59A 2OJIA 4NM5A 3NAYA 4NWMA 3R9DA 5A4TA 2Z7RA 4TYHB 4O0TA 4QT1A 3FMMA 4ANOA 3Q9ZA 3TG1A 3D0EA 5HG7A 4YJRA 1OITA 1KV2A 4J71A 3P7BA 4DEGA 2XK7A 4JQ7A 4C62A 3CGOA 2OIBA 2HY0A 3UZPA 3UDBA 2CHLA 4OTFA 5JH6A 2WQMA 3MFTA 4AA0A 1GNGA 3F5GA 5AP6A 5D1JA 2OU7A 4FSZA 4CMOA 3PPZA 4BCFA 3LFNA 4R3RA 4YZCA 4AACA 3FZOA 1Q8WA 3KXZA 5AX3A 4ERKA 3LXLA 5AP0A 4BIEA 3P78A 4I5HA 4O7TA 2Z7LA 5T68A 4QMPA 3IPHA 4GG5A 3ZO2A 3ZZEA 4FKOA 4C34A 1SVEA 4FL3A 4QTDA 4WNPA 1XH9A 3WZKA 2W9ZB 3CCNA 3AC5A 4L53A 4QQTA 4LGHA 1DI8A 2Q0BA 4HNFA 3B2WA 4XUFA 2CMWA 2YDKA 3ULZA 3QQGA 4QMOA 2GNFA 4F0FA 4PMPA 4LV5A 3LZBA 5J8IA 1OBGA 2QD9A 3BWFA 4PDOA 3R00A 1YI6A 3R2BA 4B0GA 4U43A 1Z5MA 1YXTA 1W82A 2ZM3A 3BKBA 1CMKE 4OR5A 4PPAA 4WSYA 4U8ZA 5LVLA 3EL7A 4M12A 4FIHA 4ACGA 4DG3E 3AQVA 4KIPA 4M7IA 4XNEA 2BILB 2V55A 4Q2AA 3KL8A 4L9IA 3OOMA 3Q9XA 3D7TA 5I9XA 4E8AA 5BVOA 5C1QB 5CEIA 1L3RE 2X2KA 3ATTA 2J4ZA 2WTCA 3Q32A 1U59A 3E8EA 5FP5A 5TT7A 4IWOA 4XMOA 4X21A 2X81A 3PSDA 5CSHA 3PE2A 4C0TA 3DJ6A 2GDOA 3FYKX 2YDIA 2WGJA 3A62A 3CKXA 2WMWA 4XG2A 4ANQA 5ITAA 5C4LA 4GIHA 4HVIA 2JBPA 3LFEA 3OCTA 4BZNA 4O91A 4F1OA 4CFXA 5TE0A 3UYSA 4RIWA 4AWIA 3TL8A 2V62A 5ANGA 3R9RA 3RPRA 3Q2MA 4F6UA 5AR3A 2YM5A 2WD1A 1BUHA 3BHYA 3ROYA 3UOLA 3OMVA 4XJ0A 4M0ZA 4O0SA 3W2OA 2VX3A 4R3CA 3EJ1A 2XF0A 4P7EA 4XV2A 5F95A 4TY1A 3UC3A 4P90A 5AEPA 2EWAA 2YWPA 1XH8A 3C4EA 1YHVA 3E5AA 4YO6A 1G3NA 3LXNA 3FXZA 1NA7A 3DPKA 2IWIA 5KMKA 1XBBA 2G9XA 1U54B 5HNBA 3R04A 3TKIA 3CY3A 1P5EA 4IB0A 3WF5A 5M4IA 5GZ9A 3BQCA 3MESA 5DEYA 4XG6A 3CXWA 5IDPA 5M4CA 2VTTA 2Z02A 1CKPA 1FPUA 1JOWB 2J0JA 4DTAA 1GIIA 1Q3DA 2W1EA 4FKIA 4Y72A 5M07A 3QWJA 4FVRA 5FBNC 4EKLA 5EG3A 3SXFA 4BN1A 4AZFA 4XG7A 2JITA 4O0RA 2PVFA 3ZO4A 2XCKA 1XHAA 2B55A 2DUVA 2JDVA 2OH4A 3VIDA 4BDCA 4BTKA 4YSJA 3QUPA 2B53A 3FC2A 1PXIA 4WIHA 1SYKA 2CKPA 4EC8A 5BUEA 2W7XA 5H9BA 4EHVA 5I9WA 3CTQA 2O2UA 3V5JA 4XLIA 1UKHA 2YITA 4ZLOA 3ZM9A 1A9UA 4RA4A 3R1SA 5IEYA 4FNYA 4RX7A 4ZTSA 1IRKA 3EYGA 3ZXTA 5I3RA 4NKAA 4RGJA 3RNIA 1SVGA 4RC3A 1ZWSA 2RKUA 3VUHA 3PE1A 4G3FA 5AP2A 2KULA 2F49A 1R3CA 3KULA 3PTGA 4E6CA 5FTGA 3WARA 4HCTA 3ZM4A 4YURA 2VTHA 4BGQA 3ZCLA 3R9OA 3D5WA 2X2MA 4JRNA 2F2UA 3VAPA 4RIOA 3WZUA 4ERWA 4UWBA 1L8TA 4BTJA 3EH9A 3N4VA 3E87A 3HYHA 4IM2A 4BVUA 4L46A 2GPHA 1KSWA 3QZHA 4C4EA 4ANLA 3FV8A 3KN5A 3NWWA 3I6WA 3LJ0A 3MA3A 2IZUA 4P5QA 4KIKB 3QXOA 4EK5A 1YI4A 4EH2A 2BRNA 4W9WA 4IFCA 4QMVA 2AC3A 3QQKA 3UO4A 3PUPA 3Q4TA 5HIEA 4Y83A 3DS6A 1QCFA 1OKWA 4NK9A 3ENHA 4FIEA 1H00A 2OWBA 3UIXA 4ANMA 4E26A 2C3JA 4N6ZA 3ZLXA 4PDSA 3GENA 2C5NA 4FX3A 2OK1A 3A7HA 4FVPA 4UV0A 1VEBA 5HE0A 2J7TA 5ANKA 4DH7A 3ID6C 5M53A 1M2PA 1ZZLA 4W8EA 4V04A 4G1WA 4D1ZA 3RTPA 3NVMB 4DFZE 1W83A 1KWPA 4L7FA 3T8OA 4USDA 4YTFA 4J98A 4DGNA 4GJ3A 4I0RA 2Y0AA 4B8LA 2EXMA 3OXTA 2B9FA 4RX8A 4K33A 5AUTA 3NSZA 1HOWA 3QX4A 4NT4A 1Q62A 3W10A 3P7CA 4GG7A 3HDMA 4DH5A 2FSTX 5HNIX 3FY0A 3BYMA 4GT4A 3PLAE 1BL7A 2BZJA 3QTXA 4S33A 3BYVA 4QO9A 5CX9A 3DAEA 3PP1A 2R0IA 3R8UA 3UIMA 4EH3A 5AUVA 2YIXA 4XG8A 1MUOA 5E4HA 5FBOA 1GJOA 1FMKA 3R8ZA 1P4OA 4Y85A 3QQHA 4MCVA 5T6KA 3C9WA 4CD0A 1GOLA 2XK8A 3QX2A 4FKSA 3Q52A 4RFMA 1Z9XA 3GXLA 4FYOA 1WZYA 4LRKA 1K2PA 1PYXA 4BBFA 4YC3A 2OF4A 2ETKA 3MWUA 2ZMDA 4LUDA 5M55A 3RPYA 1NVRA 4PDYA 2OJFE 4WO5A 2CNVA 3A7GA 1JSUA 4G3CA 4EJ7A 5CVFA 5F1ZA 4ZJJA 1OKZA 3NUSA 2VO3A 2XVDA 3QD0A 3HGKA 4L68A 4XBRA 2XCHA 3HZTA 4RVKA 3U54A 5AWMA 4FTOA 2GNGA 2VD5A 4Y46A 3OTUA 4FTMA 4AZVA 1FVVA 4A9SA 4E6DA 3LFAA 3KKVA 4II5A 2YLFA 2HZIA 1BLXA 2OW3A 3MDYA 5D7VA 4MYGA 1BL6A 3OCBA 2YM7A 2VTLA 3VBQA 2YIYA 2QKRA 3DDPA 4NJ3A 3QRKA 5B0XA 5KZ0A 5HU3A 2OJ9A 4FT7A 5E8SA 2UVXA 2EXCX 3DA6A 4F63A 5ACBC 3PP0A 3CPBA 4GK2A 4L8MA 4AGWA 4DTBA 2RFNA 2OIQA 4EUTA 3DZOA 3TCPA 3GOPA 1R0EA 3A7JA 2YM6A 2PZPA 5HVYA 2F7XE 3LKMA 5CWZA 2I0YA 4FSYA 3SKCA 4TWCA 4RJ7A 3F5XA 4EOJA 3D2KA 4QMTA 4BDJA 5HTCA 1M14A 3V51A 4ITIA 5I5ZA 5EQEA 3B8RA 1O9UA 5HICA 4KNBA 3PFQA 4TRLA 3ITZA 3EN6A 1CM8A 3QKLA 3GQLA 4FKTA 4XEYA 4EWHA 1Q3WA 3COMA 5IF1A 3FPQA 3PSCA 3QLGA 5LXMA 2XK6A 1PXLA 4FIIA 3CSVA 4PP7A 3U6HA 4FYNA 2WTIA 1YHSA 2VNWA 3F6XA 3WYYA 3ZFMA 1YDTE 3ZRKA 4WOVA 3TUBA 1V1KA 1J1CA 4LUEA 2V0DA 2R2PA 1KE5A 1WBWA 4IX5A 2X8EA 1J7IA 3BI6A 4YLKA 4CXAA 2OLCA 4D0XA 3MJ1A 1OIYA 5CZIA 5L4QA 4FT3A 3OP5A 4L7SA 3VQHA 1UWHA 4PQNA 4KD1A 5HIDA 1IASA 3LLTA 3PJCA 1QMZA 2C1BA 3OOGA 4H3BA 3NW5A 2LAVA 4KS8A 4A4XA 3QTRA 3FLWA 5L6OA 5CU6A 3WF7A 5HO7A 3NUAA 3KB7A 4PTCA 1G5SA 2WQEA 4RWIA 2OI4X 3HKOA 1PKDA 4J52A 2W17A 3PPKA 2I0EA 5CAOA 4LOPA 3D9VA 5HZNA 3OWPA 4M3QA 4ENYA 2VWWA 4IANA 5GIOE 5AJQA 4O83A 2BCJA 3PA5A 2A2AA 2BUJA 4A07A 1JBPE 2VTAA 2GS6A 5LWMA 2ITTA 4DGOA 4O7SA 3BLHA 4AW0A 2YLEA 3QRJA 1PXOA 5DYJA 4MQ2A 5AV2A 3I5NA 2W1IA 2E9OA 3VUGA 1LP4A 3ETAA 3LFCA 5FEQA 4X6QC 4ALVA 5KZIA 4WKQA 2ZDTA 1OL6A 3LM5A 3PA3A 1GZ8A 4MXXA 4WBOA 3WZDA 3QWKA 1DM2A 4U45A 4D4VA 1Q8YA 3EFJA 4F7NA 5DT3A 4TKSA 5AUZA 5A4EA 5HBHA 3KXXA 3FDNA 3DV3A 4DYMA 4FTTA 5C8MA 5HI2A 2JKKA 3BE2A 5F20A 5HG5A 4FGBA 4QP2A 2C5OA 2VTMA 3GC9A 3QAME 5E90A 3C5IA 5HX6A 3FMNA 3FYJX 3SG8A 1SM2A 3F5PA 2YHVA 4IVDA 5E8WA 5K4IA 4X6RA 2QOBA 3WIGA 4JLCA 1V0BA 1W8CA 2PVRA 3E8CA 2WMAA 3JY0A 3P1AA 3TIYA 4I24A 4BC6A 5CEMA 2C3KA 3P79A 4UMQA 4QYYA 4AA4A 5BVDA 2UZDA 3AC1A 3PPJA 4RZVA 5I9VA 3F5UA 3NLBA 4EORA 4EH6A 3SGCA 4RWLA 5AM7A 4O0YA 2CGXA 4FV6A 3F3TA 4JXFA 1QL6A 4FKPA 3O71A 3KEXA 4GKHA 4BCPA 3KU2A 3R8VA 4DG0E 4JNWA 2BTSA 3IECA 1H0WA 4TYEA 4YHFA 3ZZWA 4ACDA 2YCFA 2QOIA 3FLZA 3HMMA 2CPKE 3A2CA 3P86A 4CFVA 3F2NA 3NYOA 3FMKA 4M69B 1JKKA 4LMUA 5DEWA 3BYSA 3PA4A 4DAWA 5C8NA 2QR8A 3ZC6A 3PDTA 3L9MA 4N0SA 4WA9A 4ZJIA 1OIRA 3R7OA 5AR4A 5EHOA 3R7UA 2C68A 1B39A 3QZGA 4AF3A 3DB8A 1PYEA 3W2RA 5A4LA 2XB7A 5E91A 2UW8A 4QQ5A 5HGIA 1CTPE 2YCQA 4CKIA 1OL5A 4YNOA 2O64A 4CSVA 4H3QA 4BDBA 4IC8A 1HCLA 5KHXA 2R3IA 3N4UA 1MRUA 2UVZA 3P5KA 1RJBA 1URCA 3UP7A 1DAWA 3FL5A 4ACCA 5DA3A 3AXWA 4ITHA 5DT0A 1XKKA 4KIQA 2NRYA 2B4SB 2YISA 3GC8A 4F7JA 4FMQA 4BCOA 4F1MA 3NR9A 1J7UA 2PVLA 3NGAA 2VWXA 1ERKA 3V6SA 4JBOA 5D41A 3IK3A 4NIFA 4FT9A 4QMUA 1A06A 1H01A 1R39A 4YJNA 3C4FA 5FM3A 5JSMA 3PXKA 4M8TA 4C35A 4RJ4A 3BBTB 4CCBA 5JRQA 5KMIA 4O81A 4BFMA 4I5CA 4BDEA 3KVWA 5A54A 4GT3A 3LVPA 4KKEA 2PZIA 4Z7GA 2VWIA 3MBLA 3VBYA 3G6GA 4MEDA 3KXMA 1XR1A 4F70A 2X7OA 3GU8A 3PXQA 4AT5A 5CSPA 4FSRA 1Q61A 4CRSA 3PYYA 2J5EA 2JFMA 2OFVA 4CTCA 4EHGA 4FV2A 5M4UA 3W2PA 4O7VA 5J87A 4J97A 5CU4A 1A48A 3Q5ZA 4BDAA 4U79A 3V5PA 3BCEA 3LMHA 3LW0A 2UUEA 2IJMA 3C51A 4QP3A 2HELA 4EK8A 5G6VA 4BZDA 4D2SA 5LOHA 3MV5A 4KSPA 2R3FA 2NPQA 1YRPA 4GUEA 5EW9A 2JAVA 2VWZA 4PUZA 2R4BA 4GU9A 2XM9A 1Y91A 4EC9A 5AV4A 5KO1A 3VS2A 4GJ2A 2G2IA 3WF6A 3A99A 5I4NA 5IA5A 5HO6A 1JVPP 3FQHA 4RSSA 5HBEA 5DR9A 5B2LA 2OFUA 3S1HA 4KINA 4UN0C 2C0OA 2W9FB 4I5MA 2X0GA 3FJQE 3BLRA 3MPMA 4E5WA 2OZAA 5DR2A 3MA6A 4Y73A 3EKKA 3LFBA 3GUBA 3TJDA 5DH3A 4XP2A 3UVQA 2O3PA 3KF7A 5AP1A 3FSKA 3ENMA 4YTIA 5HCYA 3RHKA 3W32A 2XKFA 2FVDA 3SA0A 1Q99A 2GQGA 2PVKA 3KQ7A 3OD6X 5EOBA 4W8DA 4UMUA 3QYWA 3KFAA 4MBLA 1M7NA 4BWXA 5H2UA 2J6MA 2JDSA 4FOCA 3JY9A 3VUKA 3L9LA 3IDPA 1KE7A 4MTAA 5G1XA 4FUXA 2W05A 2J9MA 1WVWA 2WAJA 2WNTA 4HGTA 3K3IA 3A4PA 4LRJA 3DLZA 4I20A 2IN6A 4RFZA 1PXNA 3JYAA 2OXYA 3VUDA 3KVXA 2R5TA 4RT7A 3ORXA 3O8PA 5M44A 5EW3A 4FSNA 4FZ6A 3OC1A 1APME 3OUKA 4LI5A 4LL5A 4CLJA 3I0OA 3LIJA 3E62A 4LM5A 1J91A 4EZ3A 4NW5A 3VBTA 4NUSA 4ZTNA 4TWNA 2JBOA 4CZYB 4DGMA 1JQHA 1NW1A 4FTNA 4QMXA 3BHVA 3PWDA 4RIWB 3NUXA 4G9RA 4DFBA 2JC6A 3F69A 3QTZA 3V5LA 2GFSA 3PIYA 3HMNA 4V0GA 3W2CA 3MSSA 1WMKA 3QZFA 5C03A 3RM7A 5JZJA 2R3MA 3SOCA 5EH0A 2XRUA 3TI1A 4CMTA 5BVFA 4U81A 3TWJA 2V7AA 2I1MA 3DAJA 4XRLA 4HYUA 1UVRA 4O6EA 4A9TA 2R7IA 5I0BA 1U46A 2JLDA 3C4XA 2UW7A 2QQ7A 3ZRMA 3A7FA 4DEEA 4J7BA 5CAUA 1PXMA 3EFWA 3A8XA 3F66A 2UW9A 3BYOA 3H4JA 3MVJA 4O2PA 3FBVA 3Q9YA 3QGWA 4PPBA 5AP3A 3EQGA 4UMPA 3KA0A 5CANA 3TDWA 4DCAA 1LUFA 2XNBA 3OT3A 2C6OA 5FRIA 2WTKB 3VBWA 1PMNA 2QI8A 3DBFA 3P0MA 4YJTA 3LQ5A 5BYYA 5LJJA 3C5UA 4EQUA 3HMIA 3TV6A 5HORA 4WUAA 3BQRA 4X2KA 3QKMA 2I0HA 5DNRA 5JRSA 5LMAA 3SLSA 5ICPA 4JRVA 2B9JA 4FSUA 5KHWA 3C4WA 4N4SA 1YDSE 4IAIA 2CNQA 5B2KA 1OUKA 3NAXA 4G5JA 4O84A 5HCZA 2C5YA 5EYMA 4AN3A 1JKSA 2ITXA 5HVKA 2CGVA 2VWYA 4QMLA 4ZTHA 5FXSA 2GFCA 4XOZA 3CGFA 3H10A 5IPJA 5JMSA 4MH7A 3POZA 2IVUA 2RFDA 4IVAA 4ZIMA 5ETFA 4Q9SA 5IU2A 4EOPA 3NCZA 3MIYA 4UZHA 3RK7A 2I7QA 2O63A 1DS5A 4X2GA 4ACHA 3R9HA 4H1MA 4KABA 3FMHA 3MTLA 3P08A 3WF9A 5TKDA 3KULB 1UA2A 3QQLA 4K77A 4N70A 3VW6A 3PXFA 2XYNA 2JKOA 4EONA 3BPRA 1M52A 4CVAA 3DTCA 4D2RA 1FQ1B 1ZMUA 2IW6A 4JBVA 4D2WA 5J5TA 5CEQA 4R7HA 5EI2A 3U4UA 2P33A 2RG6A 2YM8A 2HZNA 2HENA 2XIXA 2XK9A 2VZ6A 3TT0A 2I0VA 3GCQA 4FE2A 4M84A 4IJPA 3EQFA 3FLSA 3O23A 3W2SA 2B54A 2XK3A 2QO2A 4K0YA 3RAHA 1OL1A 1FGKA 3SDJA 5A6NA 4ZTRA 4BKZA 4FSTA 3GC7A 4DH1A 1ZRZA 2OBJA 2YZAA 1H25A 4GH2A 4PF4A 3AD4A 3OTVA 1BKXA 2QOLA 3ACJA 2VTRA 3BX5A 4O7RA 4IHPA 1V0OA 4HVGA 4L45A 4I6BA 3DBQA 3ZSHA 4AOIA 2VWVA 2BKZA 3CIKA 3LE6A 1PKGA 3BLQA 1OBDA 2H6DA 2ZM1A 4RX5A 1DAYA 4APCA 4DITA 4AT4A 1S9JA 5I9UA 2X6EA 3TV4A 3JVSA 4ZTQA 3II5A 3EQPA 4PP9A 4YJPA 1KV1A 3CKWA 2X4FA 4FUYA 3ZUUA 2YCSA 2CSNA 4FR4A 1OI9A 5EDQA 2DQ7X 4JDHA 3KC3A 3AC3A 2QODA 2WEIA 4ZS0A 4R6VA 4CFNA 4YPSA 4JDJA 4DEDA 5IEXA 1M7QA 2RG5A 1B6CB 4AGCA 3ANQA 4R7BA 4GEOA 4W4WA 4X3JA 3UMWA 3QTIA 5I9ZA 3UMXA 4DE4A 2FSOX 2P55A 3F2RA 1TQMA 5CSXA 4HGSA 4CT1A 5HIBA 3BYUA 2XNPA 3AMBA 4BCHA 5JFWA 5DT4A 5HOAA 4U97A 3PVUA 4OAUC 5DIAA 5C27A 2GHGA 2XK4A 4IAKA 2R3LA 2BALA 3HX4A 2UZNA 3BU3A 4HZSA 3WZJA 2QG7A 2XNOA 4O7YA 2BVAA 2QR7A 2WTVA 4MWHA 1OMWA 5IH6A 2ZYBA 3LPBA 4PMTA 4NYEA 4I5PA 2JDOA 3MGYA 4IZ7A 5IQBA 2C6MA 4F4PA 4ZP5A 4H58A 2W96B 3NEWA 4AGDA 2VWBA 4JG8A 4B4LA 4PRJA 5JFVA 1CSNA 4OTIA 5DVRA 3MYGA 3ERKA 3U87A 4CV9A 3L9NA 3TXOA 3Q04A 3H9RA 2UW5A 2JDTA 1H1SA 2WQBA 2XRWA 3S95A 1G8AA 2ZM4A 3RHXA 2PVJA 2R3NA 4GIIA 4FT0A 3T3VA 2YIQA 3GVUA 4UYNA 3L8PA 4HGEA 4EHEA 1ZYLA 3L8SA 3AC8A 2W0JA 5HQ0A 2P2HA 4FG7A 2ZAZA 4R7IA 3VUMA 2GNIA 4AP7A 3BELA 1XO2B 4QOXA 4GUBA 4GYGA 1SZMA 3I6UA 4TNBA 2NO3A 2YAAA 2VTJA 4JBPA 5E1EA 4PL5A 4EKKA 2BR1A 4ZZOA 2E9NA 3KK9A 4YHTA 3QQJA 2PMNX 4A4LA 2ONLA 2EB3A 1CKJA 5BVNA 3DT1A 5BUJA 3HECA 4ID7A 4H36A 4OTWA 3GBZA 2UZVA 2QU6A 2W4OA 4BDDA 5A46A 4UX9A 1WVYA 3ZO3A 5KBRA 3F3UA 4G3GA 5IQDA 4FSMA 4EBWA 4F7SA 1PMEA 2WOTA 4FKQA 1JKLA 3C4ZA 4FEUA 2ERZE 4QYEA 4PL4A 5JQ8A 4W4XA 1XH6A 4NJDA 1O6YA 3GFEA 3LOKA 2WFYA 3OG7A 3QTWA 4IDTA 2BRHA 3Q2JA 5JGBA 4IMYA 4EOLA 1FBNA 1OIUA 1JSVA 3DDQA 4X3FA 4YZMA 4KWPA 2F2CB 3RWPA 2R3HA 3GU5A 3NVKI 4H05A 3UVPA 4C4FA 3UGCA 3SQQA 1PXPA 5L8KA 3O7LD 4JG6A 4C8BA 3DFCB 2BDJA 2F7EE 1JLUE 3KXGA 4U6RA 5CQUA 3GNIB 3KRJA 4MNFA 1GAGA 3FUPA 4FKJA 2R3OA 4JQ8A 5ETAA 3ZUVA 3OF0A 5CT7A 5DRBA 1U5RA 4MVFA 1OGUA 5EI8A 5L6PA 5BVWA 4MKCA 3IONA 5I3OA 2PUIA 2HYYA 4BCMA 4D9UA 4MD8E 5IUGA 4BCGA 3LCOA 2RL5A 4I21A 3LQ3A 4YLJA 4QMZA 5J7BA 4QYGA 4TN6A 4IWDA 2YZLA 4QRCA 3QRIA 3QD2B 1YXXA 3FE3A 4JOAA 2R3GA 4G2FA 3F82A 1M2QA 3EB0A 2BDFA 2VGOA 3ZO1A 4BI1A 4F9BA 3EN4A 5H8EA 2JFLA 4LGDA 4DEIA 1H0VA 5FXQA 3WYXA 3ZMMA 3CQEA 3PRIA 2O8YA 3DQWA 4C7TA 5KMMA 5FTQA 4UWCA 4DF3A 2B9IA 4NTTA 2Z60A 5GJDA 3RZFA 3SXRA 3ZEWA 2CNUA 3BRBA 4N6YA 2FGIA 5HO8A 4NKSA 4QQJA 1K3AA 4EOKA 1YHWA 3FY2A 3KXNA 4G6NA 4A7CA 3IW7A 4BDIA 3EN9A 3K5UA 2HW6A 3DCVA 4ARKA 3U9CA 4B9DA 1U4DA 4MXYA 4ZZMA 5DFPA 1YOLA 3RMFA 4TXCA 4AAAA 3VS6A 4DEBA 2XJ2A 2BTRA 3NYNA 3HA6A 4IZAA 4RRVA 5IH4A 4DT8A 2GHLA 2XP2A 2HAKA 3CD8A 3EOCA 1WAKA 4U44A 5BYZA 3D2IA 2QOKA 3ZFYA 4DN5A 3AMYA 3G51A 4U0IA 3GEQA 3DJ5A 3QL8A 3NMUF 2LGCA 4UMRA 5LWNA 4FTCA 2XJ0A 4HZRA 5L8JA 5BYLA 4ZY5A 1KOBA 1E9HA 2ERKA 4O0UA 4IZYA 4NTSA 3PZEA 2YA9A 2BAKA 2X9EA 3PRFA 3IGOA 5AAEA 4MBJA 3VF9A 4Q5EA 2C5XA 3B8QA 4Y5QA 4AFJA 1UWJA 4F9CA 4L3LA 4QMYA 5E8YA 3L1SA 1XJDA 2IG7A 2Y9QA 3D83A 4O38A 5CXHA 5CF6A 3EN7A 3LHJA 1OPJA 2HZ4A 3O8UA 2WIHA 4AXAA 2PVYA 2QHNA 4YZ9A 1YVJA 4IWQA 4NIFB 3QYZA 4QPMA 4G31A 1ZYJA 1VYZA 2X1NA 4QMMA 4S34A 5GNKA 2WMRA 2XS0A 5E92A 4EK6A 4PNIA 2XBAA 3PIXA 3DXQA 5CI6A 1LPUA 4IJ9A 1ZYDA 2WKMA 1H07A 3QC4A 2R3QA 4XH6A 2A19B 2PWLA 3DK7A 3MH0A 2CLQA 3ORTA 4FT5A 1CKIA 4IWPA 3A61A 3ZHPC 4CKJA 2PVNA 2VO7A 2B7AA 3E88A 1ZMWA 2C30A 1JAMA 3FI3A 5FEEA 3TZMA 5HU9A 2I6LA 4U5JA 4AN9A 2VU3A 4I93A 3FMJA 2FA2A 4H39A 4M97A 5TR6A 4HGLA 5AV1A 3UG2A 1ZOGA 2HWPA 4I3ZA 4L42A 4EOOA 3RGFA 4EH5A 4Z3VA 5A6OA 3H0YA 3M1SA 2ZVAA 4FODA 3E3PA 4MNEA 4QP8A 5CSVA 5L6WL 4TT7A 4EH9A 4KAOA 3SW4A 4FG8A 4KB8A 4E3CA 4MF1A 4BICA 4RZWA 3D4QA 1TQIA 2BHEA 5L2QA 3ZDIA 3ZLYA 3OZ6A 4B99A 2C6TA 3QRUA 2QU5A 5E7RA 5KE0A 3ZFXA 3AOXA 4RIXA 4TYGA 2ZV8A 4IIRA 4I0TA 3SW7A 4F7LA 5IZFA 3V3VA 4UEUA 4LQMA 3OS3A 3TKHA 2GQSA 5IQEA 2WTKC 3R73A 4YR8A 4BI2A 2W1FA 4DEHA 1Y57A 2IVVA 2OZAB 3S00A 2JAMA 3AT3A 5AIRA 2XIZA 2IPXA 3LJ2A 2VTOA 3D14A 2ZDUA 4EEVA 3ORKA 3HA8A 2HZ0A 5EHLA 3QCSA 5LMKA 1RW8A 4AG8A 4AN2A 4P4CA 4IW0A 4CEGA 4OBQA 4AOJA 2E9PA 3IW8A 3GFWA 5AR8A 4BCNA 3C0IA 4USEA 4P2KA 1YWRA 1QPCA 4X2NA 4MXZA 4BTFA 4IM0A 3COHA 1ATPE 4DTKA 4OBPA 4BIDA 2G15A 2HK5A 3ANRA 3Q6UA 2QLQA 2XEYA 4BY9E 1SNUA 5K3YA 3FHRA 1BYGA 1KE9A 4MHAA 3DKGA 4ZY4A 1HCKA 5JEBA 3TTIA 2P0CA 4UALA 4FTIA 4DEAA 4LFIA 4JIAA 5AP4A 4ZSLA 3DBCA 2YM4A 4IADA 3FPMA 4G9CA 4PPCA 3FZ1A 4FIJA 4O6LA 2J0LA 3Q4UA 3DK3A 5JK3A 2PUPA 3UZRA 3OWJA 4QTAA
chains in the Genus database with same CATH superfamily
4C2WA 3PXRA 4YTHA 4M67A 4V0GB 2GCDA 4BGGA 4D5HA 2A0CX 1KE8A 3A4OX 2IW9A 4FTAA 5AAFA 4CFMA 2WMUA 1RDQE 2XEZA 3O51A 4J95A 3UQFA 3UBDA 3UTOA 3S3IA 4FKUA 3R21A 4LOQA 3SX9A 4DH8A 5CASA 3ZSIA 4FICA 4I41A 2CN5A 2C4GA 3AGLA 3DB6A 1Q41A 2IF8A 3OUNB 3QCQA 3ZDUA 4BF2A 2YWVA 3KIOC 5CEKA 2V22A 1ZLTA 4YPDA 2R3KA 4BR3A 3WE8A 2W1ZA 4DFLA 3FL4A 2JIUA 3FXXA 2C3LA 2VX1A 2XNMA 4QPAA 3COIA 2NNWB 4L3JA 5E9EA 2YM3A 1VJYA 4AE6A 2VAGA 4DINA 1YXUA 5BVEA 3AG9A 4CFWA 3UNKA 2VTQA 2UZUE 3HP2A 4O1PA 2QHMA 1CDKA 3LFSA 5DG5A 2O5KA 5IQIA 3EFKA 1Y8YA 2PZ5A 3LM0A 3I60A 3IW6A 5CI7A 5HE3A 4E4NA 5EKOA 4E73A 5L2WA 3DOGA 2QONA 3UP2A 1WBTA 3T3UA 3EFLA 4HOKA 5GJFA 1GZOA 5F94A 4YJSA 4UMTA 4AX8A 5E8VA 4O21A 3TZ8A 5BNJA 3IW5A 3UE4A 4O7WA 4KKHA 3U8WA 3FI2A 3Q9WA 4LV8A 2CKEA 4YO4A 2XYUA 2ZV9A 3QC9A 3LLAA 4DFYA 1Y8GA 3PY0A 4K2RA 4D28A 3C1XA 4IZ5A 4TTHB 5DRDA 2GTNA 5ANOA 4NL0A 3UOHA 2R3JA 5DLSA 3VRYA 4EL9A 1WBOA 4H1JA 2XANA 4PDPA 4O0VA 4CV8A 4FZAB 3NDMA 4JQEA 4OTQA 5EOLA 1YOMA 4AAYA 3RVGA 4QQCA 5H3QA 5EQYA 4A4OA 3TTJA 3IQ7A 4HCVA 3RP9A 4G17A 4AFEA 4EQMA 4OAVB 1F0QA 3VS0A 5KMLA 2BMCA 5LVPA 3QBNA 4ALWA 3HRCA 4TW9A 3I7CA 4FG9A 5AMNA 2XAOA 2X7GA 2YIRA 5M4FA 4WG4A 3DK6A 4E5AX 3LCTA 4KBAA 2RFSA 1WVXA 1PMUA 3DXNA 3R63A 1H28A 4EOMA 4J96A 1OPKA 4AGUA 2W5HA 3BWJA 4K18A 1Q8UA 3I79A 4XX9A 4IEBA 4D58A 1H1QA 2IO6A 3ZOSA 4BL1A 1KUTA 5ANDA 3F2AA 4KSQA 3F7WA 3M11A 4BZOA 3AT4A 5F9EA 3DXPA 3NRMA 2HXLA 3R9NA 4I6QA 1LEWA 3E64A 5EM5A 4K6ZA 2X6DA 3KRXA 3VS5A 5AA8A 5FM2A 2BIYA 5JQ5A 4C4JA 4UY9A 4C37A 2X39A 3BU6A 1QPEA 4ZSJA 4C57A 3SVVA 1YKRA 3V5TA 4E4MA 4YSMA 2BKKA 1ZXEA 4I94A 3EIDA 2YCRA 2VTSA 4WBBB 4EBVA 4M14A 4M13A 4IFGA 4JT3A 4Z9LA 1YOJA 3ALNA 5AADA 4Y95A 3R8LA 3FKNA 4HJOA 3KMMA 4AZWA 5FLFA 3DNDA 4DGGA 4UZDA 4IAAA 1Q8ZA 5H8BA 2UW4A 4EH4A 3UJGA 3CE3A 5IA0A 3CJGA 4XRJA 4I23A 3IDBA 3UPXA 2CGWA 3DJ7A 4I22A 5DWRA 3NUPA 3Q5IA 3CP9A 3D5XA 1T46A 3C50A 3OY3A 2W1GA 3PSBA 5AM6A 3O5AA 3NW6A 1Q97A 3PVWA 4BWKA 3EQHA 3PG1A 1MRVA 3NUUA 3IGGA 3RPVA 4DHZA 5M51A 3MFSA 4JR7A 2CN8A 4FTJA 3GOKA 3I81A 2UW0A 4PL3A 4L3PA 4W9XA 5HVJA 4D1XA 2W4KA 3ROCA 2OIDA 4DH3A 4FGRA 3NCGA 2BZHB 1GZKA 1F3MC 4RBLA 1Q8TA 2FYSA 5HEZA 5HLNA 4BJJA 4QTCA 3AKLA 5FEDA 4OBOA 3FWQA 1F5QA 4G3EA 4NH1A 3H9OA 4WSQA 2CKQA 4F0IA 2UZOA 3DZQA 3LJ1A 5AV0A 1UKIA 3QALE 3R02A 4MD9E 5HE1A 3P9JA 4W4YA 3AT2A 3E7OA 3KMUA 3D7TB 3MW1A 3TUDA 2WU6A 4YBKA 3UO5A 2QO9A 3NNVA 1ZZ2A 4YZDA 3QHRA 2B9HA 5J79A 2XNGA 3AD5A 3F3ZA 4G6LA 3VO3A 3R2YA 4PNKA 2XZSA 2FSLX 5GIPE 1PF8A 4EH7A 5FDPA 3QCXA 4I4FA 4HYIA 4FKGA 4CZUA 1OZ1A 2PE0A 3C4CA 4M68A 4OTDA 1R0PA 2ETMA 1OM1A 3EQRA 3UIUA 3CC6A 2WMTA 5AIKA 1YXSA 2ZJWA 2CCHA 3QA0A 4EOSA 3R7YA 1PJKA 2WO6A 1UNHA 3U9NA 5AR7A 3CLYA 4EYMA 1LEZA 3VJOA 2UW6A 3UOJA 2A4LA 3OWLA 1NT2A 3HNGA 3MB6A 5AR2A 5K0KA 5M09A 1V0PA 2WMBA 3L9PA 2ACXA 4ZAUA 3DKCA 4BKJA 5GINE 5JFXA 4MX9A 3UC4A 2QG5A 4JAIA 3T9TA 4RMZA 3MY1A 3PLSA 4EYJA 3KF4A 3WILA 3S4QA 1Y6BA 5HBJA 1EH4A 5CYIA 3ORPA 3IKAA 4MXCA 2C0TA 3QTSA 3VHEA 2BHHA 5L3AA 4X0MA 3FI8A 4CG8A 2YN8A 4BI0A 4CYIA 2YFXA 3MN3A 2ETRA 4FRFA 4X3FB 3W33A 4FEXA 2B1PA 2VUWA 5CLPA 4FIGA 4C4IA 4E1ZA 5IQHA 2WQOA 3LXKA 2QLUA 4U80A 3REPA 4FI1A 4MBIA 1NY3A 2R0UA 4KBCA 4NCTA 3ZC5A 5M08A 3IDCA 4IX6A 5EKNA 4YBJA 2X7FA 3C7QA 1VR2A 4J99A 4L44A 3TZ9A 5J5SA 1H08A 5EYKA 4V01A 3ET7A 4IAYA 4O4EA 3RCDA 5BPYA 3V8TA 4A9RA 4NZWB 2JGZA 1B38A 3U4WA 4ASDA 2IW8A 4QMQA 4AU8A 3DBDA 1P4FA 4GFMA 2ZOQA 2UW3A 4C4GA 5IISA 3C0HA 1R78A 4USFA 2CKOA 4IVCA 5BVKA 5F4NA 2OJGA 4FL2A 4E6AA 2OGVA 3F61A 1DI9A 4O86A 4BCQA 5HCXA 2XKDA 4IVBA 4KBKA 4C61A 1XBAA 3NIZA 2ITVA 4F64A 4FTRA 1G8JA 4ZXTA 3R1NA 3HMOA 3WOWA 4ASZA 2XNNA 4WUNA 2WHBA 3MIAA 3MFRA 4QMWA 3UO6A 3W8QA 4O7LA 5D7AA 2C47A 4JR3A 2AC5A 1XH7A 2IEWA 2Z7SA 3KMWA 4FVQA 4HYHA 3VWAA 4J8MA 3I0QA 3FXWA 4QP4A 2RFEA 3L8VA 3R22A 4GCJA 4ZEGA 4AZTA 4KKGA 3NNUA 3TIZA 4DDGA 3TN8A 2IZRA 1FOTA 3TNQB 2VV9A 4EQCA 3GCUA 4NW6A 3RAWA 3TNPC 2GSFA 3VULA 5HLWA 5HKMA 5KUPA 3O17A 1MQBA 4QYFA 5B2MA 4YC6A 3P23A 3QLFA 2P4IA 2RF9A 2H8HA 2X9FA 3IOKA 4FEVA 3R0TA 3BLAA 4D5KA 4EJNA 5FP6A 1JPAA 3QZIA 5JT2A 5I9YA 5IQFA 5CVHA 3HMPA 4C2VA 1P2AA 4QP9A 3RALA 3NZ0A 2GU8A 4TL0A 3ZEPA 2Y4IB 4ZSGA 5CAPA 3PJ2A 3IG7A 4KRCA 4D0WA 4MXAA 3RK5A 3ZBXA 4HVDA 2XH5A 5EFQA 2BRBA 1S9IA 2FB8A 4FV8A 4Z55A 4O27B 3F88A 3JPVA 3HV6A 3CEKA 2E9UA 4BDHA 4BBMA 4E7WA 3AKKA 3W1FA 2AUHA 4RIYA 3ZRLA 4ZMFA 4CGAA 4S30A 2PMOX 3ZYAA 3HAVA 2OO8X 2UZTA 3HLLA 3TACA 4BDGA 3N4TA 5E8UA 5EDRA 4TNDA 2VN9A 1H1PA 5A9UA 2E2BA 5AR5A 5KNJA 1JKTA 1OECA 2ITPA 3KXHA 4ZJVA 3EQBA 3OVVA 3D5VA 4R3PA 3RM6A 4GKIA 5IG1A 5CEOA 3G9NA 4IQ6A 5GHVA 3TMOA 4MD7E 3VW8A 2B52A 3ORMA 3ZUTA 5TO8A 1VZOA 4L52A 4WHZA 4B7TA 1BX6A 3DTWA 4O4FA 5E8ZA 4DFNA 3UDSA 2C0IA 2WZJA 2R3RA 4IX3A 4QNYA 5ACKA 5CTPA 4XYFA 3IOPA 3FQEA 2HXQA 3KRWA 3UNZA 5HTIA 1WBPA 3Q4CA 3QQFA 5DN3A 1W7HA 5CALA 2EVAA 2X0QA 3W18A 2EU9A 4QP6A 4YP8A 2XKCA 2Z7QA 4GVJA 2C3IB 5DHJA 3DAKA 1IA9A 5FUTA 3KGAA 4FV0A 3RCJA 1W98A 2J51A 5M06A 5CU3A 4TYIA 3UYTA 1W84A 1RQQA 2IVSA 4U42A 1ZYSA 5D11A 4XOYA 4F9WA 3QA8A 2GS2A 2QOQA 2ZV2A 3CS9A 4MNEB 2C6EA 3LFFA 4XV9A 4O7NA 3PVBA 3V5WA 3PXYA 2NRUA 3JUHA 5BX0A 4BCIA 3R83A 4AZSA 2JEDA 3G9LX 3A8WA 3I7BA 3O50A 3OW3A 4HCUA 5CQWA 4F09A 3BZ3A 3LXPA 3GU6A 2QOFA 2GNJA 3UPZA 1ZYCA 1JWHA 2H34A 3EN5A 3QHWA 4RIXB 4RJ3A 4EZ5A 5BQ0A 5AV3A 5JN2A 3NW7A 5D12A 4IH8A 3R7IA 4C02A 3I5ZA 3PY1A 4WRGA 3NIEA 4YJQA 3HUCA 5EW8A 4QD6A 3EQIA 2P2IA 1MP8A 2QURA 2HWOA 3OROA 4GFGA 2VTIA 5C01A 3EYHA 5IA4A 2PZRA 1PW2A 2PU8A 3NPCA 4UXLA 2V7OA 4L43A 4NCTC 2XBJA 4BYIA 2OICA 4RJ6A 2YIWA 2BRMA 4IDVA 2WQNA 3PWYA 2YJSA 4O0XA 3ZBFA 2GNLA 4JDIA 4FC0A 4FSWA 4C36A 3OCGA 3FLQA 4LMNA 4UYAA 4C3PA 1O6LA 4UB7A 3BHHA 3ORLA 3RKBA 5A4QA 1E1VA 2PSQA 3OBJA 3LCDA 2J2IB 3SD0A 4UBAA 2XJ1A 4FK3A 4EHZA 4AA5A 5HG9A 3VUTA 4C58A 3LCSA 2GMXA 1OL2A 1KOAA 3OFMA 1KE6A 2ITYA 4IB1A 4LL0A 2Q0NA 2WEVA 4XV3A 5AP7A 1FVTA 4E4XA 2WMSA 4YU2A 5CF5A 3BV3A 4U40A 3VRZA 2C69A 3KRLA 1OUYA 2A27A 4NSTA 3ODZX 5EK7A 5AA9A 3ALOA 3JR1A 2ESMA 4FF8A 2WB8A 3VQUA 3JS2A 3LMGA 2BDWA 3W2QA 1ZY5A 3C0GA 4AXDA 2VO0A 3O7LB 3FAAA 3ORNA 3RJCA 4C33A 2PYWA 3GI3A 3O96A 3E7VA 5EYCA 4ALUA 5A4CA 3H0ZA 1XQZA 3WI6A 4OGRA 4LGGA 3RNYA 2EXEA 2J50A 3KK8A 4O4BB 1WBVA 1ZMVA 1O6KA 3V5QA 1XWSA 1YW2A 4BB4A 2A1AB 3PZHA 4RLLA 5KCVA 5CENA 4U3YA 3QQUA 4FZDB 3NFGB 4YUQA 1FVRA 3COKA 4WNMA 3RPOA 5J9ZA 1MRYA 3Q53A 4F1TA 3VNTA 4ASXA 2VWUA 3Q3BA 2H9VA 3S0OA 1TFFA 3CR0A 5HNGA 4QPSA 3FLYA 3SRVA 4DGLC 4HVHA 5GZ8A 2W4JA 3GU7A 3HL7A 2W06A 4O22A 5FTOA 2W1CA 1XMLA 5IUIA 4IM3A 4D2TA 2Y4PA 2CCIA 2F57A 2JD5A 3JVRA 2Q83A 2G2HA 2OXDA 3EZRA 3PIZA 5IEVA 4K9YA 2Y8OA 3FZRA 2JKQA 3I4BA 4TWOA 3E8DA 3NNWA 4CFFA 3GCSA 3TZ7A 3HAMA 3AC2A 1NVSA 2UZWE 2SRCA 3OXZA 4DG2E 4ANSA 4GK4A 2B0QA 4BDKA 3I1AA 1LR4A 3LFDA 4CRLA 5CS6A 3P7AA 3G6HA 2QO7A 4I1ZA 3N51A 2PL0A 2ZMCA 4IB3A 4QMSA 4AOTA 5CEPA 3ORIA 3ORZA 4Z7HA 3MH3A 5K4JA 1J3HA 4JX3A 3W0RA 4EUUA 2VX0A 3R28A 3O0GA 4S32A 4IAFA 5LMBA 4QP7A 4EI4A 2HCKA 3ATSA 4XCUA 4OTGA 4MF0A 3TNWA 1PRYA 4MQ1A 4ORKA 1ZY4A 1AD5A 5HX8A 2KTYA 4RVMA 2FSMX 3FHIA 3RAKA 3RINA 4NU1A 3VJNA 5AUUA 2C6DA 3SXSA 5K9IA 1H27A 1ZOHA 2BZIB 3MS9A 4YNEA 4NM0A 3CY2A 5LVNA 3MPTA 4S31A 4FEWA 1WBSA 2IZSA 5LCKA 3SOAA 2BPMA 2PTKA 2W1DA 3FMDA 5DPVA 3U6IA 4KUJA 3AGMA 2WTWA 2ZB1A 4BCJA 4MWIA 4U7ZA 2XIKA 2X2LA 3RZBA 3SHEA 5LARA 4WG5A 5FWKK 3ZU7A 4E4LA 3WBLA 3KY2A 3MVLA 1H1WA 2EB2A 3FZSA 5CY3A 4ZK5A 1P14A 4TYHA 1GY3A 3DY7A 3KCKA 4FKWA 4IB5A 4BYJA 1UU7A 2OH0E 3FZTA 3PJ3A 4RC2A 3QD4A 4D9TA 5ANJA 1OB3A 1PY5A 3PJ8A 3OT8A 3BL9A 2H96A 3QTQA 4AW5A 4IACA 4ZZNA 1U5QA 4B8MA 2CDZA 4JIKA 2QVSE 4L01A 4QNAA 4BDFA 4HNIA 3MFUA 4CCUA 2CJMA 3T9IA 5J1WA 3E63A 3NS9A 3RK9A 2QOCA 2FH9A 4JBQA 2E9VA 4HPTE 4PMSA 2W99B 3MI9A 2CLXA 4GW8A 3TNIA 1ND4A 1XH4A 3M2WA 5IA3A 1FINA 1IA8A 1ZOEA 5HHWA 2YAKA 5IUHA 5LVMA 3FI4A 4C38A 2HW7A 3ULIA 3F3VA 2BAQA 4IX4A 2ONLC 3UIBA 3OCSA 2PPQA 5AUXA 4F9AA 4RWKA 5FQDC 5T3QA 2XARA 1RE8A 2PMIA 4FKVA 4JI9A 3W0QA 3DKFA 3R7EA 1I09A 4ZTLA 3LQ8A 3VS1A 5FGKA 3VC4A 5IA2A 4R5YA 3U51A 3K2LA 3QCYA 4BHZA 4C4HA 4FKRA 2C6LA 5HLPA 4YZBA 5AFVA 2UZEA 2RSVA 2OSCA 2G01A 5CNOA 4XG4A 2ITOA 4A9UA 2VTPA 2FO0A 3CD3A 4JVGA 5HG8A 2XNEA 2J0IA 2Z2WA 4FZ7A 4CYJA 1XH5A 2G2FA 3AMAA 4FA2A 4N57A 2CGUA 2O65A 4CLIA 4CQGA 4X3FC 2W1HA 3W0NA 3WIKA 4QEBA 3OEFX 2ITZA 4Y8DA 4J8NA 4DBNA 2PE2A 4RLKA 4PWNA 1BI8A 4BJJB 3ML1A 5J1VA 3ODYX 5AUWA 1QPDA 1ZAOA 2HOGA 3CPCA 3O8TA 1IAHA 1W2DA 3R1QA 4LOOA 1PMVA 5KKRC 2PK9A 3BHTA 4S2ZA 1E1XA 3LCKA 4PX6A 4ZLYA 2XMYA 4MXOA 1H26A 3PFYA 4AS0A 3BBWA 3R30A 4A9YA 3VHKA 4JX7A 3KREA 4OLIA 3R1YA 4BGHA 5JFSA 3G15A 3F7ZA 3M42A 2FUMA 4O2ZA 1M17A 4X2JA 3A60A 2X4ZA 2QC6A 4I92A 4D4RA 2PULA 4ZY6A 2JIIA 1UNLA 2Y6OA 3CTHA 3ACKA 4O82A 1IR3A 5DR6A 4R8QA 4RVLA 5CF8A 3VF8A 4DFXE 4AZEA 4R1YA 4GS6A 5K5NA 4M0YA 2BFYA 3FKLA 3MY0A 3PJ1A 4ACMA 2ZV7A 3P4KA 3PXZA 4XS2A 5EHYA 2YDJA 4KIOA 5JZNA 2VNYA 1OKVA 2O0UA 2YEXA 1H24A 2QKWB 4GT5A 4UWYA 5H8GA 3ZSGA 3GP0A 2GQRA 2WMVA 3D7ZA 5AP5A 1U54A 3VVHA 3EKNA 3OBGA 3EWHA 4FIFA 4YZNA 1W0XC 3VS7A 4O96A 2WTDA 2W5BA 4C3RA 4GMYA 2PMLX 2RIOA 4MK0A 2WMXA 3FZPA 3HV4A 3OWKA 4DT9A 5IQGA 2YACA 5A14A 5C8KA 2YABA 4I6HA 5KMJA 5E1SA 2I40A 2XKEA 4HVSA 1NXKA 4P5ZA 2HIWA 4RA5A 2HY81 3TEIA 2NYAA 4MAOA 2XA4A 4XG9A 4QYHA 3ZXZA 4K8AA 5B7VA 4E93A 5EM6A 3UQCA 3JXWA 5ETCA 2QNJA 5LVOA 3EHAA 2Y4IC 3RAIA 4F6WA 5HTBA 3BEGA 1ZARA 4KA3A 4JAJA 4D4YA 3LMIA 5DOSA 2PY3A 5KBQA 3PG3A 3NX8A 3RI1A 4D55A 2OG8A 5JGAA 4E6QA 3FEGA 4AQCA 3BU5A 2ITNA 2X8DA 2VO6A 3FMLA 1UNGA 1VYWA 4D1SA 4WT6A 3TKUA 4AW2A 4YHJA 3U55A 1I44A 4EZ7A 2R3PA 5IDNA 4CT2A 3UODA 4JJRA 5BUIA 2UZLA 3H30A 4L6QA 4ZS4A 4KIKA 3ZS5A 3OEZA 4FV1A 3UQGA 1YI3A 1PXKA 3GC0A 4HW7A 4F0GA 1AGWA 2VTNA 4QDEA 2IZTA 4EOIA 3FLNC 2WXVA 3TNHA 2XALA 4Q5HA 4O7ZA 2VGPA 1FMOE 4JG7A 4TYJA 3DNEA 1NVQA 4EK3A 5KMOA 4YC8A 4FTLA 4BBEA 1K9AA 5D9HA 3RWQA 2WELA 3QFVA 3W0PA 4RQKA 4RX9A 4C3FA 4AT3A 4F6SA 5JKGA 1WBNA 4LG4A 4U9AA 4QTEA 3MTFA 3SV0A 5IQAA 3W16A 3TDVA 3VBVA 4E5BA 4ZOGA 3G90X 3QGYA 4XG3A 2A98A 3WZEA 5C9CA 5KX8A 1H4LA 5J9LA 4GU6A 1UU9A 4JDKA 4DA5A 4GK3A 2J5FA 3Q60A 5AUYA 3L8XA 3TV7A 4U3ZA 3OY1A 5DE2A 5ANEA 3W55A 4EH8A 3C13A 4FSQA 3UNJA 5HE2A 3QUDA 2F9GA 5CZHA 3G0EA 3EL8A 3BEAA 3CTJA 5IKWA 4O1OA 1H1RA 2DWBA 3IS5A 3U6JA 3R7GA 4I0SA 5TOZA 5ANIA 3SC1A 1GIJA 5L2IA 4FK6A 3R01A 1REKA 3MH2A 1FGIA 2XM8A 3DGKA 4RFYA 3V6RA 4WNOA 3NNXA 2C6IA 3MPAA 5C4KA 3WE4A 1YWNA 2PVHA 2UV2A 4R1VA 3BGZA 4FV7A 3HEGA 4ANNA 3RBWA 4CKRA 4KRDA 4CZTA 3Q6WA 1BMKA 3F9NA 4RJ8A 5IMEA 5CT0A 3KN6A 1REJA 2GTMA 3CJFA 4YJVA 3Q4ZA 4GL9A 5DI1A 4ZTMA 2GS7A 2PZYA 2PUUA 4RIYB 2J0MB 1OIQA 2XIYA 4L67A 5LMKC 4BRXA 3SAYA 4ZSAA 1WFCA 3CBLA 4OT5A 5CU0A 5IH5A 4D2PA 2OXXA 3NUNA 4PTGA 4CQEA 4YJUA 1G8SA 3NYXA 4WRSA 5JGDA 4GSBA 3V01A 5IMXA 2R9SA 4U41A 3O2MA 3IO7A 2QOHA 4DCEA 2BAJA 3EZVA 3E93A 4ZLZA 4XP0A 3R8PA 3PY3A 3V8WA 2BIKB 4OTPA 2X0OA 1QPJA 1Q5KA 4FKLA 3HRBA 3FKOA 3CQWA 3N9XA 2Y7JA 2OZOA 3GCPA 1PHKA 2XIRA 4KS7A 4TZRA 3E8NA 5L8LA 3FMEA 4CTBA 2R7BA 4DLJA 4F65A 3SG9A 3W0OA 2DS1A 2JDRA 4K11A 5D10A 5LCJA 2ITWA 3DBEA 1X8BA 2PUNA 1GZNA 4EWQA 3V04A 5M56A 2Z8CA 5GJGA 2C5VA 1M2RA 4OTRA 3HV3A 4O0WA 4TPTA 4X7QA 4YJOA 3PVGA 4ANBA 3TJCA 5CSWA 5HD7A 5FDXA 2P3GX 3KCFA 3E3BX 5FD2A 3ELJA 4GYIA 3THBA 4BHNA 3MVHA 4FL1A 4PTEA 3POOA 3QRTA 5EM8A 5CF4A 2WPAA 4GFOA 3FQSA 3NUYA 3B2TA 3R8MA 4G3DA 3E92A 4IXPA 3VS3A 1SNXA 3D15A 4XLVA 4OW8A 3LAUA 4CNHA 3UG1A 2X8IA 2BROA 5E8TA 1J1BA 4GRBA 4AW1A 4XV1A 3WF8A 4HYSA 4CG9A 4V05A 4LRMA 3G0FA 4DBXA 3GQIA 3KRRA 4NFMA 3FC1X 5CU2A 3MY5A 3MB7A 5AAGA 3D94A 1PXJA 4QMNA 5CAVA 4FNXA 3UVRA 4Q9ZA 4J1RA 2C1AA 4OUCA 4F99A 2AYPA 1Y6AA 5LQFA 2PVMA 3BGPA 3HDNA 4FZFB 5M57A 4K1BA 2JIVA 1OKYA 1YXVA 3G33A 3GT8A 4NM3A 3R7VA 2W5AA 4IBMA 3ZLWA 4G34A 4H3PA 4D4SA 2Y6MA 2QCSA 4NEUA 4RWJA 3RPSA 4RQVA 5J7HA 4GVAA 2GNHA 3QKKA 4FV9A 4NM7A 2PHKA 4ITJA 4LYNA 3MVMA 3QUEA 1SVHA 1OVEA 4L00A 3GGFA 2OJJA 1YDRE 3CQUA 4XHKB 5TF9A 3VUIA 4R77A 5E8XA 4B6LA 3D5UA 3QXPA 4XP3A 3BV2A 2ZB0A 3W8LA 4WD5A 3K54A 4R78A 2XUUA 3HUBA 4PV0A 1UU8A 1J7LA 2IVTA 3HV5A 1JSTA 4FBXA 2ITUA 5J95A 3ZLSA 3DQXA 3ZONA 2WTJA 4FNWA 3UZTA 1Q4LA 4FV5A 4G6OA 4OT6A 5EDPA 4ONAA 4RG0A 4RJ5A 1Q24A 1R1WA 4DDIA 4W4VA 5HD4A 4ZMEA 4IC7A 4BTMA 1YQJA 4FNZA 5IQCA 4PMMA 3DKOA 5BV3A 2J0KA 4FV3A 3H3CA 4ASEA 3K5VA 4O4CA 2RGPA 4YLLA 3HRFA 3V8SA 3MH1A 1JNKA 5KKRB 2NP8A 4MUQA 4RPVA 4IE9A 1GIHA 5KMNA 5C26A 1T45A 3GB2A 5K5XA 3VS4A 2BZKB 4G16A 1IG1A 3EQDA 2UZBA 3G2FA 3VBXA 3FSFA 2QOOA 3Q96A 5EM7A 2VRXA 2UVYA 3BE9A 4M66A 5CVGA 3VONA 2F7ZE 4Y5HA 3TUCA 4JL9A 5FXRA 5BMMA 2WIPA 3QTUA 4J53A 4YMJA 5ETIA 4FOBA 3F3WA 5AX9A 1XMMA 4DC2A 1URWA 5L2TA 3NYVA 2PE1A 4ZSEA 1OL7A 2GHMA 3QF9A 4IAZA 4RC4A 5A3XA 3HVCA 3SRVB 2REIA 1OPLA 2OKRA 3BIZA 1TKIA 2V5QA 4FEQA 4EK4A 4F08A 5K0XA 2WOUA 4GV1A 1YWVA 4E20A 4EOQA 4AE9A 3BHUA 4CFUA 1IEPA 4FTQA 4APPA 4DHFA 4X2FA 3R71A 1MQ4A 3ZH8A 4ENXA 3K3JA 3AC4A 3ZTXA 4D2VA 4UXQA 3HP5A 4CMUA 4FJVA 4FV4A 4I4EA 3AD6A 4WNKA 4DFUA 4F9YA 4AXCA 4I6FA 5DGZA 3VN9A 1STCE 4TWPA 4R5SA 3EMGA 4FTUA 4M69A 1AQ1A 4HPUE 4M15A 4YGAA 3OW4A 4QP1A 1Z57A 2JKMA 1WCCA 3H9FA 1TQPA 3IW4A 5EQPA 4RVTA 4BIBA 1TVOA 2DYLA 1XBCA 3HV7A 4XBUA 3DFAA 2YJRA 3BGQA 2OF2A 1BI7A 2BFXA 4FTKA 4OTHA 3GU4A 5EYDA 4YTCA 5FG8A 5BMSA 3A7IA 5L2SA 3S2PA 2C6KA 3EQCA 4AUAA 2G1TA 3TM0A 4JS8A 5CNNA 3QU0A 3R6XA 3G5DA 4BCKA 2J90A 3OHTA 4DLIA 1H8FA 3DLSA 5HESA 3UOKA 4BWPA 2YERA 3LFQA 2ITQA 3GCVA 5CXZA 5CAQA 3DU8A 4NFNA 2F4JA 1UV5A 2WMQA 2BRGA 2R64A 3OXIA 4QTBA 5DMZA 4BKYA 5DBXA 3QD3A 1ST0A 4WG3A 1IAJA 2EUFB 5EI6A 4A06A 4Z16A 1SMHA 5GZAA 3MJ2A 2WU7A 1UU3A 4PY1A 4G5PA 5IA1A 5J9YA 4C59A 2OJIA 4NM5A 3NAYA 4NWMA 3R9DA 5A4TA 2Z7RA 4TYHB 4O0TA 4QT1A 3FMMA 4ANOA 3Q9ZA 3TG1A 3D0EA 5HG7A 4YJRA 1OITA 1KV2A 4J71A 3P7BA 4DEGA 2XK7A 4JQ7A 4C62A 3CGOA 2OIBA 2HY0A 3UZPA 3UDBA 2CHLA 4OTFA 5JH6A 2WQMA 3MFTA 4AA0A 1GNGA 3F5GA 5AP6A 5D1JA 2OU7A 4FSZA 4CMOA