2GSFA

The human epha3 receptor tyrosine kinase and juxtamembrane region
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
310
structure length
281
Chain Sequence
TYVDPHVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
publication title Structure Of The Human Epha3 Receptor Tyrosine Kinase and Juxtamembrane Region
rcsb
source organism Homo sapiens
total genus 91
structure length 281
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gsfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gsfA01
1RE8A 3DOGA 5I9YA 4F63A 3I0OA 2WZJA 3A99A 3PXQA 4QMMA 4FGRA 1PY5A 5AX3A 3TKUA 2JKOA 4EOKA 3Q4TA 3QU0A 3AGMA 3OBJA 5M4UA 4ZZNA 5E8YA 3LLAA 1ZAOA 3EL8A 3JUHA 4L3PA 4NWMA 3EJ1A 3C13A 4H58A 4XG7A 3MI9A 2LAVA 3QZIA 4IE9A 5AUXA 4HGLA 1UVRA 4F0IA 1OKWA 4AOJA 3LXPA 2C6OA 4EK3A 4C4GA 3DXPA 4GW8A 3A60A 3BGQA 1WAKA 4EC8A 3HAMA 3P9JA 4EZ5A 4ZJIA 3VWAA 2WIHA 1UU8A 4OTPA 4JAIA 3COKA 3HP5A 2WMUA 3S95A 4H3PA 4KSPA 3BQCA 5HU3A 1BL6A 5IA5A 3OCBA 3LE6A 3GOPA 4R6VA 4YZNA 2B9IA 5BUEA 4NCTA 4ZY5A 2CJMA 1NXKA 5HO7A 2YLEA 3GFWA 4DGOA 3MY0A 2C6TA 3TZ7A 4HYSA 4EL9A 3SLSA 3LW0A 5A4QA 3RJCA 2V62A 4IB5A 4JR3A 2BDFA 5I3RA 3ZRLA 3QGYA 2OH4A 5IISA 1GIHA 4O7YA 5KHXA 4PP7A 3BLQA 5AIRA 3SG8A 3P79A 5EYDA 1CM8A 3Q52A 4DC2A 4MD9E 3FMKA 5LARA 4FT0A 4F99A 2P3GX 1OL7A 3WI6A 4F64A 1FMOE 3QCYA 5HCYA 3QQHA 1ZY5A 2Z7RA 3VBWA 2WQEA 3THBA 2WU7A 4GFOA 3E8EA 3PPJA 2YDKA 1FINA 1YDRE 2GNIA 2G15A 2UZDA 2WQBA 3NRMA 3OROA 3QA0A 4OTGA 4A07A 1S9JA 3HAVA 2VX0A 3ZU7A 3GUBA 2VO0A 4MKCA 4XP3A 2Y8OA 1OKZA 2EB3A 1ZYSA 3E92A 3BLRA 3ODYX 3QRTA 2JKMA 4IX4A 5CU6A 4BCHA 4U3YA 4KBAA 4E6DA 3ZLXA 5HX8A 3H3CA 4RPVA 3CBLA 3Q60A 3LFAA 4AW5A 2XBAA 1UWJA 4X3FB 1AGWA 3I6WA 3BHUA 4J99A 3G90X 2GPHA 2WOTA 4JQEA 1U4DA 3DNEA 3G9NA 3VS6A 5B2KA 4C58A 2XCKA 4GCJA 4XG2A 4X3JA 3PFQA 4AWIA 1Q8UA 2BRHA 4N57A 4XG4A 1OB3A 4TT7A 2ZV7A 1PW2A 3L9NA 4FNYA 4I94A 5CSHA 5E8WA 4YC3A 3UG2A 3UQFA 2YAAA 1LUFA 3CXWA 3IGGA 4BDEA 1M2QA 4X3FC 4KIQA 3A7JA 3WIKA 3WF7A 4EH5A 4NM3A 3WZDA 1R78A 4G5PA 4IVAA 3DFAA 5M4CA 3N4TA 3KFAA 3MTFA 5FTQA 3W2OA 4AACA 1JAMA 2G1TA 3VS1A 4BI1A 4BBMA 1BLXA 5IDNA 3PZEA 5J7BA 5CU3A 5ANIA 3VJNA 4QO9A 4UMUA 3CTHA 2BRGA 2F7XE 5D9HA 3VS4A 4IEBA 1I44A 2B7AA 3COIA 1RJBA 4W4YA 2XNEA 2UVXA 4YO6A 1GIJA 5FXRA 3D5UA 1YI6A 2GNJA 4QMQA 2QU5A 2H9VA 3TDVA 2VWXA 2HW6A 3EFWA 4HNFA 2JFLA 2UUEA 4BTKA 2J51A 2OJJA 4CSVA 4X2FA 3PXKA 3EZRA 3REPA 1ZY4A 3FSFA 2BMCA 2ETKA 5BX0A 2JDSA 3FMDA 4KD1A 1FVRA 3KK9A 2R3RA 4X7QA 2WU6A 1WBNA 2B0QA 4GYGA 2YHVA 2VU3A 4IX3A 1YWRA 4EI4A 4D4SA 4IVBA 4TYHA 4GRBA 2XK8A 5FM3A 5IA2A 3CC6A 5ANDA 3EFLA 5HD7A 3QTRA 4BDCA 5L8JA 3O96A 3FUPA 3QAME 4DITA 1JKLA 3R8MA 2J2IB 4RG0A 5HBJA 3FDNA 3W2SA 4D28A 4ASDA 2A1AB 4N4SA 5I3OA 4U81A 2BR1A 2ITTA 3GB2A 4I23A 3WYXA 5BPYA 1Q8TA 3C1XA 5ETFA 4WSYA 3GVUA 3ZTXA 4C4IA 3CY2A 3BZ3A 4PQNA 4YLLA 3QTZA 3C4EA 3OUKA 3D5XA 5CANA 2CGXA 2E9VA 3D7TB 4EQUA 1H27A 5KUPA 3T9IA 1H28A 5KZ0A 1X8BA 5FDXA 2CKEA 3NSZA 3E3BX 4IHPA 4DN5A 4K6ZA 5J9YA 5FWKK 4DE4A 2W9ZB 4CCBA 3F5XA 3BPRA 5A54A 4C4JA 4L3JA 3F2RA 2X39A 4BIEA 4D4YA 5CALA 4USEA 2NRUA 4TYEA 3F2AA 4GYIA 4MEDA 5DBXA 3RGFA 4D4RA 4E5AX 5DYJA 3NYNA 5CYIA 4ANBA 3V01A 4LGDA 4RBLA 1PXPA 3TACA 2PMNX 1FGIA 4BDKA 3EQBA 4BY9E 4LMUA 1B39A 4EJ7A 2PVHA 1W98A 3U4UA 2I0EA 4BDDA 4QQTA 1FBNA 3DB8A 4RFZA 4AUAA 3QC9A 4PPCA 2OWBA 2JITA 2IO6A 4HYUA 4M0YA 3VO3A 4DTAA 4TY1A 3ZH8A 4HZRA 4TWNA 3O71A 3KXNA 3NYVA 4KS8A 3VBQA 4CZTA 5L8LA 3OY1A 3ZXTA 1MQ4A 2WB8A 3GP0A 5L3AA 3SQQA 2I7QA 2J90A 2QOIA 5B2LA 2ZDUA 2XA4A 2P2HA 3GC9A 4KNBA 2IVVA 4EBWA 1U54A 2HZIA 3QLFA 4HYHA 4ZSEA 2YM4A 2PSQA 4IW0A 3QZGA 3V5WA 4CVAA 5LMBA 3ZC5A 3I5ZA 1NW1A 2J4ZA 3F5GA 3F6XA 5HBHA 4U79A 2CGUA 4QTCA 1KWPA 1PXKA 3RKBA 3FEGA 3KU2A 4QQCA 3EYHA 3RZBA 3UJGA 4TNBA 4YUQA 4IAAA 3NVKI 3OTUA 4FT5A 3OT8A 5IG1A 2YEXA 2WFYA 4WUNA 4O0SA 3SA0A 2YM6A 3FE3A 2J7TA 4RIXA 3QTQA 1H1QA 4FT3A 2ITOA 4J96A 4F4PA 3VUMA 3W16A 3Q5ZA 4D2VA 3FZ1A 3HZTA 3W8LA 1GZ8A 2HOGA 2IJMA 3PPZA 4GFMA 5FLFA 2JBOA 3NUAA 3R71A 3AC4A 3Q9YA 4EH7A 5DHJA 5B2MA 3R8UA 2OIDA 5KX8A 4UEUA 4NIFA 2O5KA 3CQWA 5GJGA 4Z3VA 2OXXA 4EOJA 5TF9A 4G3FA 4EK5A 2IWIA 2BCJA 3A4OX 3GT8A 1ZMVA 4DTKA 4ANOA 4AX8A 2UZVA 3NNWA 4F1MA 3KF7A 3PSDA 1WVYA 4HGTA 1QPEA 1Y6AA 2C1BA 3RK7A 4X2KA 4M97A 1PKGA 4LOOA 4ZTLA 5IUHA 5K9IA 4R7BA 4U44A 5HLPA 3KXXA 5KMLA 1Z9XA 5AP5A 3BE2A 3DNDA 4I5MA 2I0VA 4NKAA 3DQWA 5KE0A 4EH4A 4K77A 4QP1A 3VBYA 5BQ0A 1FQ1B 4JG6A 4EOLA 3L8PA 3FMHA 5A3XA 1TKIA 4RWJA 5B0XA 3RNYA 4BCPA 5AP3A 1J7UA 5BVKA 4H36A 3FKLA 3PZHA 2YIWA 4ZOGA 5CENA 2IW9A 5K0XA 5DLSA 2GHMA 3LAUA 5LVLA 4IM0A 5J87A 3MFUA 4BBFA 4R3PA 5HOAA 2Z7SA 3UQCA 3DKFA 3O8PA 4BDFA 4E5BA 3MA3A 2I1MA 2WMBA 3NIZA 2OFVA 3D15A 3LM0A 2WQMA 2QQ7A 3CQUA 3L8XA 3TNPC 2CNQA 2XS0A 4RMZA 3UZRA 4NZWB 5GIPE 3QUEA 2IZSA 2JFMA 2PVJA 5AV3A 4YP8A 2VTTA 2X6EA 3BKBA 4E6CA 4O82A 4DFNA 4G3CA 3DGKA 1SM2A 4II5A 3ZUVA 4I6HA 2R3LA 3SXSA 2VWVA 2YCSA 2XNGA 4CT2A 2VGPA 5HVKA 4FL2A 1Q97A 2BDJA 3W1FA 2XM9A 3DQXA 1WBPA 2C5VA 4GFGA 3OXZA 4YBJA 3ZXZA 3ZSHA 4YBKA 1QPDA 4ZP5A 4FIJA 4RJ4A 4LQMA 5FTOA 2QOBA 4LUEA 5T6KA 3T3UA 1KE9A 3IDBA 2Y9QA 2CHLA 3A7IA 3NLBA 3OOGA 3P08A 5JRSA 3PJ1A 1XKKA 3VUGA 2W1ZA 3I7BA 3W33A 4X2JA 4A06A 1E9HA 4J98A 5H9BA 3C0HA 4ALWA 4Q2AA 1OUYA 3LXNA 3TNWA 1H4LA 2XIRA 3HUCA 1SVHA 2QKWB 4JBPA 4JNWA 3R9HA 3K3IA 1H00A 2XZSA 3D9VA 4O0VA 1R0PA 5AR8A 4DFXE 4DYMA 3G15A 2EXEA 5IU2A 4RX5A 5J1VA 5DNRA 2FSOX 1XH7A 3MVJA 3OZ6A 4A9TA 4D0WA 2VWWA 5CVFA 2CPKE 1OECA 2E9OA 3AC5A 2XKCA 4EWHA 2HYYA 5HCXA 2JKQA 2VTSA 3M42A 3O7LB 3UO6A 4C3PA 5DN3A 3KMMA 4MXXA 1ZWSA 4RVTA 4D5KA 3UPXA 5IDPA 4D2TA 5C4LA 4L7FA 5C01A 2QOQA 4AE6A 3EQDA 2QOFA 4C0TA 1XWSA 3C4ZA 3H30A 5EW8A 4C35A 1PXIA 3LMHA 3OC1A 5HO6A 1O6YA 2YJRA 4Z55A 3RM6A 2F9GA 3BI6A 4OT6A 3HA8A 3FLSA 1SYKA 2C3LA 4L6QA 2RFEA 4O7LA 4GVJA 1UKIA 3DJ6A 4JQ7A 3ORZA 2XF0A 5K3YA 4PRJA 2BIKB 2R3HA 3Q04A 3V5QA 2UW3A 4DEBA 2ERKA 5GIOE 4FV4A 4LOPA 4BFMA 4YTHA 4Y72A 2G2HA 4V04A 3U6JA 3R28A 2ZM3A 2VUWA 2F49A 3NNVA 4L9IA 4QP7A 3TG1A 4FIGA 5CASA 2FH9A 2I40A 4ZMEA 3SHEA 4S34A 5IZFA 5GJFA 1JSUA 1UWHA 4FUXA 3WE4A 3ZMMA 1Q5KA 1YRPA 2R3PA 3O51A 4CFFA 2YCRA 4DH8A 3QHWA 5ANGA 2UZWE 4UBAA 1GNGA 4ENXA 4HVIA 4GKIA 3PDTA 4EOIA 3D2KA 4EHVA 1FGKA 3M1SA 2HXQA 4ACDA 5CEOA 4FR4A 2W96B 3EQRA 4GL9A 3F9NA 3R0TA 5AJQA 1P4FA 3R04A 4IWPA 4WG4A 4GUBA 2EXCX 3CGFA 1LR4A 4DFUA 3LXLA 5ITAA 2W1DA 2R9SA 5HGIA 3EQHA 4YGAA 4C3FA 4F9WA 5LVOA 4EBVA 3UBDA 4NJDA 4BYIA 3NNXA 2R5TA 4YZBA 5DA3A 1YI4A 4IX6A 4EQCA 3H10A 4IVDA 3MV5A 3DKGA 4JDHA 1BI7A 3K5UA 3E8DA 4U7ZA 3NAYA 3QQLA 3E63A 3RAHA 1F5QA 2PMOX 3FXZA 2GQRA 2XK4A 4GMYA 4UV0A 4E93A 4DEHA 4GG7A 4QYFA 3NYXA 1DAWA 4HPTE 3VC4A 5J8IA 3RPVA 4FIHA 2YDJA 3KQ7A 4FTKA 4CEGA 4IX5A 4RJ6A 4F70A 3FYKX 4NH1A 5F4NA 4F7LA 5CEPA 1K2PA 4FYNA 4BRXA 1IAHA 1IG1A 5DEWA 5E8SA 4LL5A 3DV3A 5J9LA 1G8AA 2J6MA 5CF4A 3P5KA 4RIXB 4D58A 3KXHA 5F1ZA 2UZEA 1ZYCA 2P55A 2OIQA 4XJ0A 5HE0A 3PXZA 3SW7A 4IQ6A 4B8MA 3C4CA 3KN5A 4M84A 4TXCA 2PULA 1ZZLA 5C03A 4E4XA 2B9JA 4HNIA 4W4XA 5EI8A 3I4BA 1XHAA 1HCKA 1T45A 2XNOA 3ANQA 3MVHA 3GNIB 4KKHA 3DAKA 2R4BA 3ZBFA 1NVRA 5LVMA 3U6IA 1A48A 2WXVA 4MYGA 4FZ7A 2F4JA 4YC8A 5CEIA 1XQZA 5ETAA 4P7EA 3MESA 2Y7JA 1H1SA 4CLIA 2W06A 4CMTA 5HNIX 3ORLA 1IA9A 4ACGA 4DGGA 2A0CX 2RIOA 3LFEA 4P90A 2Z7LA 5CU0A 5CSVA 2PE1A 3QRUA 4G6OA 3LCDA 4AT3A 3IDPA 3IGOA 4JG8A 5JFSA 2DQ7X 4FSNA 3UDBA 5LMKA 3VQHA 1VR2A 2BIYA 3C50A 3MFTA 4ZTSA 5HNGA 5C26A 2Y4IB 3TJDA 5IQIA 3EN5A 4BCFA 2JBPA 1SNXA 3W10A 3EN4A 4GVAA 4XLIA 2VTHA 4FTOA 1LPUA 1VJYA 3RAKA 4RIYA 5CSWA 4O1PA 2VWBA 4MCVA 3NW7A 3MFSA 4G9CA 4JS8A 3JR1A 3HUBA 4IMYA 5JFXA 2G01A 5JGBA 1K3AA 3LCSA 3D2IA 3HEGA 2Y4IC 3ZHPC 1WVWA 4AT4A 1LEZA 1UNGA 2ZDTA 4BCOA 2WTCA 5EM5A 5GZ8A 2KTYA 3EL7A 4RA4A 4J95A 4HVSA 3E7OA 1KV2A 5JKGA 3POOA 2IZUA 1WBOA 5HVYA 5M08A 4BCQA 5AAEA 2RG6A 4WRSA 3OWJA 3QGWA 1G5SA 4NFNA 4DFYA 2BZIB 4FTUA 4A4LA 4FTLA 2UW9A 3DZQA 1JKKA 1J1BA 4OAUC 3LJ0A 1YI3A 3S00A 4E1ZA 2UZNA 3G51A 4IAKA 4ZJJA 3ZSIA 4F7NA 5LVNA 3GCVA 2W9FB 5FTGA 3SXFA 4NM0A 4O22A 2ITPA 4EUTA 5DR6A 5M57A 4DH1A 4XP2A 4BWXA 2ZB0A 3FQSA 2JDVA 2QURA 2W17A 5FEEA 2RKUA 2QCSA 3DTWA 4BZNA 2F2CB 3AC2A 3GQIA 3JYAA 4G16A 4AW1A 5HTCA 4EOPA 5L8KA 3PWDA 4OTHA 2BAKA 4FKWA 3N4VA 4FL3A 4EOOA 2JAMA 4TW9A 4QYYA 2DUVA 4WSQA 1CMKE 1HCLA 3VNTA 5AEPA 4O7RA 4DEAA 4YLKA 1Y8GA 5D10A 5LWMA 3Q4UA 1YDTE 3RNIA 4E5WA 1A06A 5JMSA 4M12A 4I0SA 3HRBA 2DS1A 2VX3A 3DS6A 3JS2A 2R3QA 4HCUA 4XV1A 3AMAA 4C4EA 1OPKA 4XMOA 3SOCA 2OK1A 3VF9A 4IXPA 4FG8A 3VS3A 4E73A 1L3RE 3KCKA 1BKXA 5JGAA 3JY9A 3ZFMA 4PTEA 2W5AA 2UZTA 4KSQA 2HXLA 3KKVA 2QG5A 2SRCA 4AW0A 3RPYA 2V7AA 4XRJA 2JIVA 5IF1A 3FLZA 4NSTA 4W9WA 3OBGA 2WMTA 3D5WA 4M14A 2YN8A 3DAJA 2QD9A 3A4PA 4HJOA 3PWYA 3OY3A 3V8WA 2FSLX 2YAKA 3C4XA 4RFMA 3UQGA 1OL1A 3PJCA 5DI1A 1YXTA 4QMXA 2AUHA 3DK7A 3LFCA 2W1GA 3FV8A 4TL0A 4MNFA 5EHLA 4Q9ZA 3FMEA 2UW4A 4A4OA 3BHVA 4W4WA 4I4EA 3FXXA 5AUZA 4OTIA 1J7LA 5LOHA 4M7IA 5F95A 4RC2A 4ID7A 2FVDA 3EKKA 4GU9A 4Q5EA 4C57A 2PUPA 3F88A 4AXAA 3GU6A 1I09A 3BGZA 5T3QA 4F9BA 1YOJA 2GTMA 4RVKA 1OIRA 4IFGA 5DRBA 3UC3A 5AV4A 4CG9A 2FYSA 2UZBA 4FVQA 4LL0A 2WTDA 4FV7A 2CGVA 1UKHA 5GHVA 4CFWA 2J0KA 4F9YA 4BI0A 4BTFA 3OS3A 2AC5A 1UA2A 4RVLA 3SW4A 2V7OA 3EZVA 3GCSA 3NUUA 1UU9A 1CKPA 4K9YA 4ZZMA 1W83A 3F66A 4HGEA 4TNDA 2BAJA 2JKKA 3PXFA 4RGJA 3MB6A 5HTIA 3PUPA 4BCKA 4M13A 3OVVA 3WZEA 4ZZOA 3H0ZA 4TWPA 4AOTA 2X7GA 4FVRA 4WKQA 4CKIA 2C1AA 5EYMA 4DEDA 3NNUA 4PF4A 3VUHA 2Z02A 5IQGA 1ZMUA 4J97A 2OZOA 3I7CA 4DBNA 3F3ZA 2EU9A 1FVVA 1Z5MA 4RJ8A 5CEMA 4GIHA 4JDKA 4OR5A 4UMTA 5GZ9A 4FX3A 4NM5A 3ORPA 4IIRA 4QMWA 3LLTA 5BVWA 3R9RA 2ZB1A 3R6XA 4Y8DA 1OI9A 4YJPA 3E3PA 3FHRA 4E4LA 3ZO2A 4WNKA 5IQEA 2YZAA 2OH0E 2WIPA 3PP1A 3UP2A 2GQSA 5H3QA 3BHHA 4GT4A 3BBTB 4I93A 4Y95A 4ZK5A 4ONAA 1BX6A 4O2PA 2B9HA 4IANA 3SX9A 3UNZA 3PYYA 4QOXA 4YJRA 3F61A 5CSXA 3RHXA 5C4KA 4ZTQA 4QP8A 5IQFA 4GK3A 3ERKA 3FY0A 3WZJA 2B1PA 4RT7A 3P7BA 3UZPA 3S3IA 4X6QC 4DLIA 1ZOHA 3CIKA 4DAWA 2JDTA 2C3IB 4MXZA 1YOMA 5FEDA 5KO1A 4G6NA 4WA9A 5M55A 3C5IA 4OAVB 5FBOA 3A8XA 4G34A 2FSTX 2OJIA 3PLSA 4GUEA 5FG8A 3UIUA 2PUIA 4QMTA 4I5CA 5AV2A 3SKCA 3EN7A 1PJKA 4AZFA 1W82A 3E88A 4K18A 4KIOA 3KA0A 5CXHA 1KE8A 3SDJA 3W2PA 5A4TA 1ZYJA 4CFMA 3TDWA 5BVNA 3E62A 4FVPA 2X2KA 1Q8WA 2FA2A 3G6GA 2BKKA 2C6KA 1KOAA 4XV3A 1JBPE 4FTJA 2OICA 3NUPA 5ETIA 4YJSA 4R7IA 1S9IA 5IMXA 2QODA 4FBXA 5HLWA 4OTDA 4MBJA 4XX9A 2ESMA 2B54A 3VS5A 4ZAUA 3FI8A 3R63A 4GKHA 3LJ2A 2WTKB 4I22A 4QYEA 3LPBA 5FQDC 4BDHA 4JBQA 4BBEA 1PXLA 1Y8YA 3EQIA 3KCFA 1BL7A 4WO5A 5AP7A 4PY1A 4Z16A 4FV0A 3R30A 3C4FA 4YPSA 2JEDA 4MNEB 1WBSA 3Q9WA 4ZIMA 3ZSGA 1G3NA 4KIKB 1H24A 1YDSE 4FI1A 1UU7A 3DA6A 2KULA 3A7HA 2VO7A 3MY5A 4IACA 4PV0A 5DT4A 5AR7A 4C37A 3O7LD 3EQCA 3C9WA 3UODA 4QP3A 4QQ5A 5GINE 2ZVAA 4YTCA 5JZNA 4QP9A 1OM1A 2GHLA 3O23A 1CKJA 3FLWA 5AP0A 3QWJA 4BGQA 2OXYA 3P0MA 5M07A 2HZ4A 2W1FA 2QHMA 3EN6A 3O8TA 3ZCLA 4NJ3A 4FK3A 3A2CA 2BPMA 3QXOA 4OTFA 4R7HA 4DG3E 3EYGA 4CD0A 4RQKA 4KB8A 2OFUA 3HV6A 3TV7A 4FZ6A 4DHFA 5BVFA 3AC1A 3V6RA 5A6OA 5J5TA 1FPUA 2QHNA 2UW5A 2F7EE 3K54A 4BICA 3ITZA 5TKDA 3O2MA 2OJGA 4EHEA 4BGHA 4BZDA 3FMJA 5EHOA 5EOLA 4FYOA 3UYTA 2C6LA 4I21A 3SV0A 3KRJA 2P0CA 1P14A 1ZARA 3HMIA 3L9MA 4O7WA 3PJ2A 4S33A 4FSZA 5TE0A 5KNJA 5LCJA 5DWRA 2YM8A 3UOHA 4YZMA 2XVDA 3HRCA 3TV6A 2XNBA 1K9AA 1REKA 2ITNA 3NUSA 3O17A 4DH7A 4FSMA 3PVWA 4HOKA 4BZOA 2QKRA 3QYWA 5DT3A 2C0TA 3ZUUA 4C61A 2BZKB 4UMQA 3IKAA 2ONLC 5AP6A 4DGNA 3Q5IA 2OJFE 5M4IA 3QD3A 3DJ5A 1HOWA 1OPJA 2ITXA 3DK3A 4FTCA 2QOOA 5AP1A 4RZWA 2BDWA 3HYHA 4A9YA 3ELJA 4QTEA 3MIAA 2CSNA 3HV5A 4R3RA 4OTWA 2OSCA 2PUNA 1PMUA 2HENA 4FTIA 4LV5A 2XIXA 4CTBA 3PVUA 4Y46A 3IS5A 4QMZA 4WNMA 4EYJA 3GFEA 2PYWA 3CTQA 4RC3A 5EI6A 2C5YA 3BYMA 3LFBA 3E8NA 4O1OA 3WE8A 4NEUA 4IDVA 2XIZA 3UIXA 4D2SA 4R8QA 3MY1A 4JI9A 4BB4A 5A4LA 4FL1A 4ZY6A 4CLJA 3BIZA 4U8ZA 2QOLA 4DF3A 5FXSA 4CZYB 3BE9A 3CPCA 2QLQA 4MXAA 5ANEA 5HD4A 4DA5A 2R7IA 1JVPP 3TWJA 4FV2A 3ZLYA 4BKYA 4FC0A 5HG5A 2ITYA 3R02A 4O7ZA 4RX9A 4WD5A 3EQFA 1GIIA 1O9UA 3PA3A 4G17A 3QWKA 1QPCA 3HDMA 4FA2A 4KIPA 4QRCA 1QCFA 4ALVA 3FL5A 5AR2A 2G2FA 4FKOA 3DK6A 1G8SA 3NUXA 3ZZWA 4E4NA 4JIAA 3FHIA 3VJOA 4R77A 2UZLA 5DEYA 2C6MA 1M52A 4QPAA 1Q24A 4DG0E 4ASEA 4NU1A 4FG9A 3LHJA 3OXIA 3BELA 4FODA 3EIDA 4ZEGA 4F9CA 3ZFYA 5AA9A 4FOBA 3UIBA 4EEVA 2BROA 4XRLA 2EB2A 4BDBA 4RLKA 1A9UA 4ANMA 3LZBA 4GU6A 2CMWA 4A9SA 3FLNC 2EUFB 3NCZA 3IQ7A 4MTAA 3DU8A 5CI6A 2BKZA 3M11A 5EW3A 4D2WA 2WD1A 3VUIA 3R9NA 2Y4PA 2YITA 3O0GA 3QFVA 5JT2A 2CKOA 2ZM4A 3QTIA 3FJQE 3RWPA 4FKSA 3FL4A 4N6ZA 3ZONA 4CFVA 3GU4A 4U43A 2NP8A 4UX9A 3LOKA 3QL8A 3SXRA 5AX9A 3MDYA 5H8GA 4QPSA 4MHAA 4BF2A 4WG5A 5DR9A 4BVUA 3MW1A 4RFYA 4U97A 3P4KA 3IPHA 4JAJA 5DPVA 4O7NA 1OL5A 3PIYA 3UIMA 2W1EA 5J5SA 4GK2A 4M69A 4FEXA 1YW2A 3HGKA 3ORTA 2X2LA 3FPMA 4NCTC 1U59A 4TYIA 4Z7GA 2GMXA 3R7IA 5E9EA 3JXWA 2ERZE 2IN6A 4YJNA 2XK3A 1ZOGA 3HA6A 4BIBA 4CQEA 5M53A 4UYNA 2AC3A 3U4WA 3QQUA 1PYEA 4H39A 1VZOA 5HIBA 2XIYA 3II5A 3KRXA 1V0OA 4BKZA 3TL8A 3ZOSA 2VWUA 2R3JA 2ZAZA 3IW8A 5J7HA 3M2WA 4KS7A 1H1WA 3G0FA 4FSTA 3WARA 1ZXEA 1JSVA 4FKJA 3FZRA 2WOUA 2C5NA 4WHZA 1V0BA 4JQ8A 2VTMA 4AZWA 4LGGA 4EC9A 3QLGA 5ETCA 1OIYA 5I5ZA 3Q4ZA 4U6RA 5AWMA 5CY3A 2C0OA 3UZTA 4IZ7A 4EH2A 3FKOA 3GXLA 3P23A 4MAOA 3C0GA 2X1NA 3Q53A 5D11A 3PA5A 4GV1A 1YXXA 5CAVA 4TTHB 4JX3A 5ICPA 4YC6A 5K5XA 2Z2WA 1CDKA 4N70A 4AQCA 2XKFA 3BX5A 3RCJA 4K2RA 3R21A 4BCJA 5IQHA 3FZPA 3OWLA 3OCSA 2XNMA 4PL4A 4UWBA 3QC4A 4AS0A 4BCNA 4B9DA 4U42A 1H1PA 4AF3A 3UVRA 2NPQA 5KKRB 1Q3WA 4J71A 4W9XA 2VTNA 3BU3A 3V3VA 3E7VA 5E8VA 4AGUA 3QQKA 5AUVA 3GEQA 4EHZA 5IH4A 3UNKA 2RL5A 2W0JA 3HMNA 2ITUA 2O63A 5E8ZA 2GTNA 5HU9A 1KOBA 4FTNA 3FMLA 5HG9A 5HG8A 4B99A 4DEIA 4DCEA 2XK7A 3P1AA 3DTCA 1J91A 4D55A 3LIJA 4QP2A 5CS6A 4QMVA 4K11A 3C4WA 1GZNA 4OLIA 4V0GA 4O7VA 3O50A 4BR3A 4FIIA 3HV4A 4RQVA 4FKVA 2PZ5A 1DS5A 4S32A 2YCFA 5TT7A 5EM7A 5A4EA 2WEIA 1KV1A 3KK8A 4IJ9A 5TO8A 2ITVA 3ANRA 4EH9A 4FIEA 5IPJA 4AW2A 3B2WA 2VTQA 3TN8A 4ZLZA 3TUCA 5L6PA 5DG5A 2AYPA 3VHKA 1BI8A 2BUJA 5EKOA 4ZTNA 3VRYA 5J95A 4O84A 4TYHB 2A2AA 4RWLA 3ZLWA 4O38A 4QD6A 4FT9A 5HHWA 2IZTA 4QNYA 4RX7A 3ORIA 3R7YA 4R5YA 2F57A 4CFNA 1P4OA 2FGIA 4F7JA 5AR4A 3NZ0A 1OGUA 3AC8A 3NW6A 2VTOA 1XH9A 3QA8A 5EH0A 2UZUE 4RIWA 3PVGA 3AD4A 2Q0BA 4IAFA 3TTJA 2OJ9A 4G31A 1J7IA 3OCTA 5CX9A 5TOZA 5I0BA 3LQ3A 1L8TA 2XK6A 2X2MA 4BGGA 5FUTA 2REIA 2RFSA 4RJ3A 3NIEA 4R3CA 1MUOA 2C6DA 2WPAA 2YERA 3AXWA 4L46A 4O96A 3RMFA 5AIKA 2ETMA 4XG3A 3I5NA 3EHAA 3UMXA 4L01A 5L2QA 2IW8A 3BEGA 3E87A 3ORKA 4E3CA 4EK8A 4PTCA 4NTTA 3MSSA 4G2FA 3BYUA 5JGDA 5DR2A 2VZ6A 3WF5A 3SG9A 2X9EA 1EH4A 3L9LA 3ETAA 4TZRA 3RAIA 3ROCA 4LYNA 5E91A 3ZC6A 3CD8A 2BRMA 5IQCA 3WF6A 4BDJA 3LFSA 4F6UA 4FEQA 3ORNA 1SVEA 4M66A 4UN0C 4YSMA 3UOKA 1U46A 2J5EA 4F0GA 1ZMWA 3RPSA 2WTIA 5FD2A 4AE9A 3LXKA 4WBOA 2XNNA 3AD6A 2WKMA 1YHSA 3DDQA 4TWOA 4UWYA 4MH7A 5KMMA 2W4OA 2WELA 2X7FA 3MBLA 4FSYA 4E7WA 4CKJA 5JQ8A 3OXTA 4AFJA 2GFCA 3AT4A 1PXNA 4X21A 3F69A 3T8OA 4E20A 2P33A 4Y85A 4A9RA 2OF4A 1ND4A 4TPTA 4MXCA 3NR9A 2V55A 4AN9A 3OTVA 5IQBA 4NFMA 3DBDA 4FV1A 5GJDA 3V8TA 5A14A 5HESA 4LV8A 4U9AA 4ANLA 3RP9A 3U9NA 2I6LA 2WO6A 4MXOA 5CNOA 1U54B 1TQIA 4G5JA 4ACCA 4CCUA 4FNWA 3PJ8A 4L42A 2HELA 3RBWA 3UOLA 2XNPA 3FI3A 3TIZA 1SMHA 1JKSA 3MVMA 3ZZEA 1ZOEA 3EQPA 3CKWA 4F1TA 3BU6A 4YZCA 4CFXA 1WVXA 3NCGA 2R3GA 5IQAA 4IJPA 4YJOA 3ZLSA 3ZUTA 2O64A 2FSMX 2NNWB 4YHJA 4O0YA 4KINA 1BMKA 4JRNA 4B7TA 1OKYA 1H07A 1PMEA 3FI2A 3FLYA 4J8MA 4OTQA 3HV3A 3R83A 3AGLA 1REJA 2HZ0A 3CGOA 1OUKA 4WNPA 4DEGA 4XH6A 3PG3A 4FG7A 4L8MA 2YWPA 1YKRA 3SOAA 4ASXA 3G33A 4DG2E 1FVTA 2XJ2A 2V22A 2HZNA 5AP4A 4O81A 2HW7A 3MWUA 3AD5A 3P7AA 5EG3A 4EKKA 4I5HA 5AP2A 3PG1A 4APCA 4DINA 4GG5A 2X4FA 3FAAA 3A7FA 4NIFB 3EFKA 4IWDA 4D9UA 4ACHA 3CKXA 5L2SA 2QI8A 4F9AA 3K3JA 5CF6A 5FBNC 3KF4A 2C3JA 5D41A 2E9NA 2ZM1A 3QX4A 3RVGA 5KBRA 3MJ1A 4J52A 3W2RA 1M2PA 3KGAA 4L67A 4FTRA 3Q2MA 4FSRA 1GJOA 3KC3A 3V6SA 5HKMA 2JIUA 4M69B 4X3FA 3T3VA 2RGPA 1OBGA 2P4IA 3U6HA 4D1ZA 3EFJA 3RPOA 5K4IA 2PUUA 3FC2A 5K4JA 1WFCA 4FOCA 3QTSA 5EDQA 4EZ7A 1AD5A 2YLFA 4MX9A 3UTOA 2YM7A 1H26A 3HDNA 4KBKA 4RX8A 3TNQB 2PMIA 4PWNA 3WILA 3KMUA 2YCQA 4KKEA 4FE2A 3OWPA 5E8UA 4GH2A 3LFFA 5DE2A 4I41A 4IC8A 4IZ5A 3DKCA 3ODZX 3F3VA 3TUDA 3RZFA 3AG9A 1OIUA 4M3QA 3TV4A 5CF8A 2W1CA 3R9DA 3UO4A 4CV8A 2PZPA 4MQ2A 3OEFX 4I20A 1ZYLA 2R3IA 3NUYA 1H01A 5KMNA 3PY0A 2CNVA 4HPUE 4R1VA 2BAQA 4FTAA 2XM8A 3QQGA 1XJDA 5CEKA 4ZTRA 3HNGA 1XH4A 2IVTA 3QF9A 4RJ5A 4EOSA 5A9UA 5JQ5A 2W99B 3K5VA 2EVAA 3QTWA 2YZLA 1YOLA 3KXZA 5ANJA 3OMVA 5HEZA 4W4VA 2RF9A 2RFDA 3E8CA 4S2ZA 2Q0NA 5H8EA 4A4XA 4EZ3A 4IB3A 2VAGA 3PIXA 3DCVA 2BFXA 3R1SA 4CQGA 1IAJA 2QNJA 1SVGA 3JY0A 3C0IA 2PZYA 2ITZA 4NKSA 4P5QA 4BDGA 3DXQA 4DT8A 5H8BA 3I6UA 1UV5A 4IADA 5AM7A 4L52A 3FZTA 4QT1A 2XH5A 3Q32A 3R7UA 4OGRA 2BZJA 3DBQA 5CZHA 4LM5A 4QQJA 3MJ2A 5LMAA 3RHKA 3CCNA 3RM7A 5KZIA 5C8MA 3UE4A 5ANOA 4B0GA 5CF5A 2BHHA 5J1WA 4FF8A 4NT4A 2GQGA 3ATTA 4FEUA 2PVFA 3N4UA 3MYGA 3VF8A 3BQRA 3FY2A 5HLNA 2X8DA 4BL1A 5EI2A 3CS9A 1OPLA 3VBVA 2JLDA 3GCPA 4D5HA 5AR5A 3PSCA 3Q9XA 4ZSJA 1OL2A 2PHKA 3FQHA 3U9CA 4ACMA 2YM5A 1ERKA 2VNYA 2H8HA 2PL0A 2FB8A 3KEXA 5EM6A 3H0YA 5T68A 4CFUA 4DH5A 2R3OA 5AV1A 1Y91A 4M68A 5DRDA 2JGZA 4D1SA 3OFMA 1Q4LA 4O2ZA 2VRXA 3ALOA 3NGAA 3JVSA 4P2KA 4RLLA 1E1XA 4HW7A 2CKQA 1H8FA 2PE0A 4ITIA 3RAWA 2BZHB 4XV2A 5BUJA 4I24A 4F6WA 1KE6A 5KHWA 2OIBA 2CLQA 4BWPA 3VBXA 2EXMA 4FTQA 4QMLA 4CYIA 2BRNA 2QOKA 1BUHA 2V0DA 3Q6WA 3QRJA 2QU6A 2R3KA 3KRRA 3HVCA 5M56A 2PU8A 4JXFA 1URWA 3VVHA 3WYYA 2IPXA 5BVEA 3A8WA 3HV7A 3FBVA 4ZSGA 3ZFXA 4ITHA 5HIEA 2QLUA 2X7OA 4IDTA 4XHKB 1VEBA 4BDIA 1NA7A 2WMSA 4FV9A 1XBCA 4FGBA 2QOCA 4FKPA 2H96A 3VAPA 3LKMA 4LRKA 2NRYA 4PL3A 4CXAA 3ID6C 2G2IA 3NYOA 2VV9A 4PDSA 5M4FA 2C3KA 2JIIA 3BEAA 5FM2A 4AFEA 1OITA 1RQQA 1F3MC 3KY2A 2QO2A 5F94A 4CGAA 3HX4A 2XRWA 3CTJA 4O86A 3PTGA 5ACKA 2PVKA 4B8LA 3ALNA 3HP2A 5IKWA 4K1BA 4ZLOA 3UGCA 3CQEA 3P7CA 3LCOA 4J7BA 4USDA 2YM3A 3H9OA 5DT0A 3FMNA 4MQ1A 3VUKA 1B6CB 2I0YA 5DVRA 4JX7A 4YJTA 4MF1A 4FEWA 4ANSA 4YNEA 4FICA 5HZNA 4KBCA 2CCIA 3VW6A 3UYSA 2C6IA 3BRBA 3R1YA 4FKLA 3V5LA 4LMNA 3KREA 4JT3A 3NX8A 3N9XA 2DYLA 1W0XC 2OBJA 2UW6A 4FKQA 4YPDA 4BYJA 4PX6A 2ZOQA 5DMZA 5JSMA 4MWHA 4O0TA 3LFQA 3PRIA 3ENMA 4BIDA 4Y73A 4ZLYA 2WHBA 3NDMA 4PMTA 4ZXTA 5C8KA 5AFVA 3S4QA 4FSUA 5E90A 2ETRA 5BNJA 5A6NA 4LRMA 4YMJA 3RK9A 5GZAA 1XBBA 2W5HA 4I6FA 4YU2A 5D7AA 1NY3A 3VW8A 4YLJA 3U55A 3V8SA 1TQPA 1PMNA 3D4QA 3FLQA 4KABA 3FZOA 3ULIA 2XJ1A 3LFNA 4PDOA 2PVLA 3HMOA 3HECA 3F3UA 3Q4CA 1RDQE 3V51A 5AR3A 5IA3A 3R8PA 3AMBA 1CTPE 4APPA 4EHGA 5KCVA 1PRYA 4DCAA 1V1KA 4K33A 3DDPA 3NWWA 4RIOA 4U0IA 4D1XA 1NVQA 4FV6A 2RSVA 3AT2A 3JVRA 3IK3A 4X2NA 4L45A 4O21A 2YFXA 2EWAA 4YTFA 5AUTA 3DLZA 3MH1A 4BCGA 4F65A 4CNHA 1XH8A 3I1AA 3BV2A 4G3GA 2GS7A 3MPTA 2GU8A 3VUTA 3W8QA 2H34A 2VD5A 3FQEA 1OZ1A 3ZEWA 1PKDA 4IBMA 4TWCA 2Y6OA 3PPKA 1OVEA 3LM5A 4AN3A 4UMPA 4C59A 3UO5A 5F9EA 1DI8A 3R1NA 3QRKA 5EQPA 4C34A 1MRVA 3D94A 5HX6A 4ZS4A 4FNZA 1ZZ2A 3GI3A 5B7VA 4U45A 2J0JA 5CQUA 2Z8CA 4KA3A 4IZAA 4YJQA 5F20A 3ZBXA 4CMUA 3NMUF 2XCHA 3V5TA 3UP7A 4BTMA 3QD4A 4YSJA 1JWHA 2B53A 4U5JA 3A62A 3RPRA 4AZSA 4PMSA 5IEVA 3H4JA 4KKGA 4RIYB 3RK5A 3PSBA 4PUZA 3ZM4A 4PL5A 1V0PA 1J1CA 1ATPE 2J9MA 2OZAA 3MGYA 4FKUA 1H1RA 4XBUA 4D2PA 5EHYA 4YR8A 5IH6A 3PA4A 4C62A 5LMKC 2PK9A 2WTKC 3ZS5A 2PTKA 4UMRA 4LGHA 3WBLA 5BVOA 2J0LA 4QYHA 1VYWA 2W7XA 2WMWA 3QCQA 1B38A 4QMUA 3RCDA 5JH6A 3FYJX 4U41A 4Y83A 4Q9SA 1U5QA 3F5UA 5DFPA 4YO4A 5KMKA 2JAVA 5DGZA 4FEVA 2NO3A 2XIKA 1U5RA 2GS6A 4I92A 4WG3A 2WMQA 3DPKA 1IA8A 2B9FA 5IEXA 2O3PA 3BWJA 3QZFA 5BMMA 3B2TA 2VTLA 4CV9A 4FT7A 4GJ3A 3Q6UA 4PDYA 4C2WA 1IR3A 3CSVA 4N0SA 4IAZA 3S2PA 2JDOA 4BTJA 4ZSAA 3LCKA 4F7SA 3LQ8A 3PJ3A 5EQYA 3R01A 3AT3A 4DFLA 5ANKA 1YQJA 3GU7A 3QXPA 3VS7A 3L8VA 1OL6A 1OKVA 5G1XA 4EONA 2CN5A 2BTRA 5EDRA 3F7ZA 1QMZA 2JD5A 4RSSA 3ZO3A 4G9RA 4FUYA 3MB7A 1Q41A 2X8EA 4V01A 5D1JA 4DT9A 4UALA 4D9TA 3MH2A 2QO7A 4UZDA 1MQBA 2PWLA 3D14A 1WMKA 2XEZA 4X6RA 3U8WA 2WQNA 3TZMA 3ROYA 3R1QA 3V5JA 1GZOA 4H05A 3HRFA 1P2AA 4O7SA 4NYEA 4XUFA 1TVOA 1FOTA 2QC6A 3VULA 1CSNA 3PY1A 4JBOA 4IWOA 3WF8A 1IEPA 4WT6A 1PMVA 3ET7A 3QQFA 3OW4A 2HCKA 4NM7A 4OBPA 1JNKA 4ARKA 5EKNA 4NL0A 3S0OA 3VHEA 2VWYA 5CAUA 4OBOA 5C9CA 3TTIA 4GSBA 2PVMA 4QMYA 4F09A 4L00A 5CVGA 5CU4A 5ACBC 1H25A 4JRVA 1T46A 4MD7E 3UG1A 4D0XA 2VO6A 3VIDA 3E5AA 3GOKA 2UV2A 3VS0A 4C3RA 2WGJA 2HWPA 5IUIA 5JFWA 3SVVA 3GC7A 4C33A 4TKSA 5A46A 4RJ7A 4L68A 3MA6A 4QPMA 1KE7A 5CEQA 1RW8A 4FTMA 4UXLA 4QYGA 2C4GA 2X9FA 1PF8A 2WAJA 3G6HA 3R2BA 4FKIA 4GK4A 4QMNA 4BHNA 3I81A 3F5PA 5CWZA 2C30A 3ENHA 3KN6A 1H0WA 4O83A 3PXYA 3OWKA 4OUCA 3SC1A 1YVJA 1ZLTA 2VTAA 5EFQA 4QP4A 3QKMA 3QTXA 4IB1A 5GNKA 2QOHA 3R8ZA 4XG9A 4CT1A 1JQHA 2R3FA 2E2BA 2PVYA 2UW8A 4AA5A 2J0IA 3R9OA 4YJVA 1Q62A 3GU5A 2ZV9A 4O0XA 4S30A 5HE1A 4ORKA 3LVPA 4J8NA 5LWNA 1M7NA 5FRIA 1MP8A 5AM6A 2A19B 2UVYA 2ZMCA 3POZA 4MF0A 4PP9A 4I5PA 5DIAA 3PY3A 4KAOA 4M67A 5EOBA 4A7CA 3EQGA 4RWKA 2BILB 1KE5A 4IWQA 3Q96A 1WCCA 2IW6A 4M0ZA 5E7RA 3VUDA 3BWFA 2HWOA 3NPCA 4JDIA 4RVMA 4FTTA 4EH3A 2XEYA 3JPVA 2C69A 4PPBA 5IUGA 1AQ1A 3RI1A 3WIGA 2QR7A 4H1JA 2YACA 4FSWA 1O6LA 2G9XA 5FXQA 2VNWA 3CLYA 3D5VA 4P4CA 3FMMA 4XOZA 4YHFA 3DB6A 4BCMA 3QCXA 4AG8A 4EKLA 1KUTA 2B52A 3ORXA 4JBVA 4BHZA 2UVZA 1TQMA 3QZHA 4O27B 3GCQA 4XCUA 3DJ7A 4YNOA 5JK3A 4YTIA 1Q99A 5CU2A 3VRZA 2O8YA 4J53A 2YIXA 2ZV8A 4MWIA 4ERKA 4ZMFA 3KULA 2XRUA 3DBFA 4H1MA 2PE2A 4TRLA 4GEOA 5AAFA 4F0FA 4HCVA 2UW7A 2WMRA 3W32A 2J50A 2WMXA 4DTBA 2PPQA 3I0QA 1JPAA 5CAOA 4G1WA 1M7QA 2GNFA 3CR0A 3OUNB 1H0VA 3IDCA 4XG8A 5EDPA 3TI1A 1YWVA 4OT5A 2PMLX 1IASA 3TCPA 4GT3A 5C1QB 5JEBA 3Q9ZA 2X4ZA 3MH3A 3QUPA 3DLSA 4BC6A 3LMIA 4LI5A 2ZMDA 2WEVA 3SAYA 2R64A 1QPJA 4WNOA 3ZDUA 5LVPA 2W05A 2XUUA 5HG7A 2ACXA 3U87A 4X0MA 4AAAA 2HIWA 3U51A 3SRVA 4B4LA 1KSWA 3PXRA 4AGCA 1UNHA 1NVSA 2YWVA 3Q2JA 5BUIA 2YJSA 4O6LA 3IO7A 4WOVA 4Q5HA 4DGMA 3QTUA 3PLAE 4CRSA 5HE3A 5E8XA 5FP6A 5H2UA 3MN3A 4AZEA 2OLCA 3MTLA 4J1RA 3BBWA 3BHTA 2YABA 3QD2B 3QHRA 2W4KA 4MVFA 1GY3A 3EKNA 3UPZA 5L4QA 1OIQA 3EMGA 4JL9A 3TIYA 3WZKA 3AC3A 2ITWA 3LFDA 4L53A 4AGDA 2E9UA 5DH3A 4G6LA 5AADA 2GHGA 4FV3A 4DFBA 3DAEA 2X6DA 3R73A 3I60A 2QR8A 3OD6X 1Q3DA 2VTPA 3UVPA 3NVMB 2C6EA 2FUMA 4MBLA 4JDJA 2B55A 1PXJA 3DT1A 4OW8A 5AUWA 1XBAA 4C38A 5HORA 4FZAB 4NUSA 2XJ0A 2OI4X 3KL8A 2XK9A 3UVQA 3BCEA 5IA4A 5JN2A 2OZAB 3OW3A 5KKRC 4PMMA 4BKJA 5HIDA 3CJFA 3GU8A 3UC4A 5I9ZA 5J9ZA 3QKKA 4YZDA 5CT7A 4F08A 1IRKA 1ZRZA 3F3WA 2IVSA 4AP7A 4I1ZA 4NW5A 2R2PA 3OEZA 4M15A 4AT5A 4E4MA 5AAGA 5I4NA 5E4HA 1PYXA 1YHVA 3FSKA 3R22A 3MVLA 4I0TA 2I0HA 5L6WL 2GCDA 5EW9A 3FWQA 2OF2A 1PHKA 4UXQA 3KVXA 1GOLA 4H3QA 4Y5QA 2HY0A 5BYLA 4FZFB 4OTRA 1E1VA 2YIRA 3HL7A 4KRCA 4XYFA 3VQUA 4CZUA 4EJNA 5IH5A 4I0RA 2WTWA 4O6EA 3MH0A 3ZO1A 4EWQA 3QYZA 2XBJA 3LCTA 3B8RA 1QL6A 3BGPA 2WMAA 4HZSA 4U80A 3RALA 5L6OA 3R7GA 4HVHA 4GS6A 3OP5A 2R7BA 2VGOA 4WUAA 5CVHA 4E8AA 4IVCA 3C7QA 3G5DA 5CT0A 4CYJA 3R7OA 2LGCA 3BHYA 3F82A 3QBNA 5IA0A 1Y6BA 3R00A 3RTPA 4ZY4A 1J3HA 5K5NA 4KRDA 2WTJA 3TKIA 3KMWA 4FMQA 2CNUA 5HO8A 2GSFA 3RINA 4ANQA 5CLPA 5K0KA 4AGWA 4I4FA 5KBQA 1YWNA 2IZRA 3COHA 4FV8A 4ANNA 3CP9A 4AZVA 2BALA 3HMPA 4L7SA 5JRQA 3TZ9A 2R0IA 3LQ5A 5DOSA 3H9RA 3GCUA 3COMA 1URCA 1XO2B 2BTSA 3C51A 5FP5A 2UW0A 1W84A 2PZIA 4EOQA 3ATSA 2X8IA 5D7VA 3T9TA 2XMYA 5E1SA 5IA1A 3PIZA 5G6VA 4XEYA 2YIYA 3ZO4A 5KMJA 5HE2A 3K2LA 3FI4A 3QD0A 4BCIA 5CSPA 4L3LA 3QCSA 4I6QA 5IMEA 4XS2A 2GS2A 3MPMA 4FKTA 1MRUA 1UU3A 2YIQA 3TZ8A 4CG8A 3GENA 3SGCA 3IONA 3WOWA 2YDIA 5A4CA 2V5QA 3VS2A 4E6QA 3AMYA 1OMWA 4WBBB 1SNUA 2CN8A 4FSQA 3G2FA 2F7ZE 3G9LX 3ULZA 3QUDA 2OGVA 5FGKA 4YJUA 4JLCA 4IAYA 5I9VA 3R7EA 4AA0A 4LUDA 2ZV2A 3F2NA 1JLUE 4EUUA 5LJJA 2OG8A 4AU8A 3NS9A 4XNEA 2Y6MA 3DXNA 3QALE 2XP2A 4ENYA 4FK6A 4XV9A 3GGFA 3HKOA 5HICA 5BYYA 3D7ZA 1XH5A 4K8AA 4R5SA 5LQFA 3ZRKA 4CMOA 4PPAA 4W8EA 2CCHA 4P5ZA 2W4JA 3GC8A 3I79A 4FZDB 4GT5A 4M8TA 3C5UA 4JG7A 4JR7A 4ALUA 3D0EA 2C0IA 4IZYA 3ZM9A 3IW5A 3TKHA 2VN9A 2BRBA 3BU5A 1W7HA 5L2IA 4QMSA 2VO3A 3U54A 4LRJA 3LJ1A 1YXVA 5BMSA 2XKEA 2XB7A 5CAQA 3CEKA 3H9FA 3CPBA 5KMOA 5AMNA 3ACJA 3F7WA 4I6BA 4LOQA 4BN1A 5D12A 2Q83A 2VWIA 4G3EA 5CQWA 4QMOA 3WF9A 4U3ZA 3TEIA 3ZRMA 3R8VA 5HI2A 1XR1A 3TUBA 1Z57A 2Y0AA 3BYSA 3BYOA 2A4LA 3DBEA 1LP4A 5HQ0A 4UYAA 2WQOA 3V04A 4BWKA 4KWPA 1F0QA 2CDZA 2J5FA 2PZRA 3CE3A 3AQVA 4IC7A 3D83A 1R0EA 3WZUA 1BYGA 2R3NA 5TR6A 3IOPA 4QTAA 5HCZA 5C8NA 5M44A 4I3ZA 5HNBA 2QG7A 3GQLA 2X81A 3S1HA 4W8DA 2O0UA 4ASZA 3QX2A 1YHWA 4QNAA 4EK6A 5M09A 2PY3A 4IM3A 3NAXA 2CLXA 4YURA 3HLLA 3F3TA 4O91A 2YA9A 3PE1A 5CTPA 4TN6A 4BI2A 3NEWA 3UNJA 3QKLA 5I9WA 3PE2A 3EB0A 4AZTA 5M06A 4EH6A 3A61A 2GNHA 3TXOA 2W5BA 3BV3A 4HGSA 2OO8X 4ZJVA 2VTJA 1WZYA 4GIIA 2WNTA 3Q3BA 4NW6A 4RA5A 4IB0A 5L2TA 3IW6A 5LXMA 4BDAA 4ZS0A 3DZOA 3AOXA 2QONA 5JZJA 1PXMA 4EH8A 3KULB 3DKOA 2BHEA 4MK0A 3KB7A 2W1IA 3IW7A 1APME 2B4SB 1PXOA 3MPAA 4FNXA 4IM2A 2PVRA 4K0YA 4R1YA 5FEQA 2QVSE 1WBVA 2CKPA 4ITJA 4EK4A 4LFIA 2Z60A 4TYJA 4AN2A 4JIKA 2H6DA 4HVDA 4QTBA 3NUNA 4PMPA 1YXUA 3ORMA 2HY81 3GBZA 4HVGA 5HVJA 4IAIA 4O7TA 3BYVA 2RG5A 2R0UA 5C27A 4S31A 1STCE 4IH8A 2HAKA 4A9UA 4DEEA 2VTRA 5AA8A 1DAYA 3L9PA 3G0EA 1WBWA 3LMGA 3OCGA 4O0RA 4C02A 3TT0A 1YXSA 4L44A 2O2UA 4UWCA 1M2RA 1DI9A 3OHTA 5IEYA 4NK9A 2GFSA 3BLHA 4D2RA 4B6LA 4MBIA 3KXGA 5I9UA 4MNEA 3SRVB 4V05A 2VWZA 3ZDIA 4IFCA 4C7TA 5CZIA 2CGWA 4KIKA 5EQEA 3DFCB 2X0GA 1UNLA 4LG4A 5EYCA 4JOAA 3ZEPA 2C5OA 1R3CA 2BVAA 1Y57A 4FKGA 4Z9LA 4D4VA 2GNLA 4EORA 4C2VA 2BFYA 3TJCA 2QO9A 3QRIA 4GJ2A 4DH3A 4YZ9A 1GZKA 5EM8A 1CKIA 4UY9A 3W2QA 4L43A 3B8QA 2OU7A 2J0MB 1O6KA 3OF0A 2VTIA 1LEWA 2RFNA 1JSTA 1SZMA 2XYUA 2ZYBA 3EH9A 4WRGA 5E8TA 5EYKA 3L8SA 2Z7QA 3GC0A 3QQJA 4JVGA 3OT3A 1Q8ZA 3FPQA 4QP6A 3DY7A 4FIFA 1GAGA 3KXMA 5AUYA 3FC1X 4XBRA 4CTCA 2VX1A 3PP0A 2UZOA 3EN9A 5EK7A 4F1OA 2YISA 5CXZA 2JC6A 2O65A 2XKDA 3KRWA 1VYZA 5BVDA 4V0GB 3MS9A 3VN9A 4E26A 2OKRA 2W1HA 2A27A 4QTDA 3R8LA 3EOCA 2ONLA 1M14A 4HYIA 5CAPA 2GNGA 4R78A 4Z7HA 4XG6A 4FV5A 2ITQA 1W8CA 1R39A 1H08A 1ZYDA 3N51A 3CD3A 1M17A 3W2CA 4C4FA 4DFZE 3UOJA 4H3BA 2FO0A 3IG7A 4ZSLA 3TNHA 2GDOA 3D7TA 3R7VA 4WIHA 3V5PA 4ZTMA 2E9PA 2OXDA 4JJRA 3IW4A 4E6AA 4XP0A 3HMMA 5E92A 4DLJA 3O8UA 1Q8YA 2PVNA 4O0WA 4C4HA 3FKNA 4U40A 2C5XA 5BYZA 4C36A 4CKRA 3R2YA 4KUJA 3OOMA 4G3DA 1MRYA 1JKTA 3PVBA 4PNKA 1JOWB 3DBCA 2WTVA 4EQMA 5IQDA 4AOIA 4CRLA 4O0UA 1XH6A 3FXWA 2HK5A 3P78A 4RIWB 4TYGA 2IVUA 4HCTA 3CJGA 3CY3A 2DWBA 2R3MA 4RC4A 4DGLC 4EOMA 5AUUA 3SD0A 3VBTA 2C68A 1FMKA 3FZSA 4PTGA 2F2UA 4RRVA 5E1EA 4QMPA 2JDRA 4XLVA 5CI7A 4MD8E 3TNIA 2WMVA 1R1WA 2C47A 3A7GA 4XOYA 4C8BA 4OBQA 3P86A 3IECA 5CNNA 3UMWA 3L1SA 3IOKA 2P2IA 4YHTA 1P5EA 3E64A 2OW3A 3NW5A 3E93A 3MIYA 4PNIA 3EWHA 3OG7A 4FKRA 4ERWA 3KRLA 5AV0A 4RWIA 5KMIA 4UZHA 4EYMA 5JFVA 3MFRA 4Y5HA 4X2GA 4ZTHA 1OBDA 5L2WA 1WBTA 4USFA 3ZYAA 5HTBA 5FDPA 3W18A 4NTSA 4F6SA 2ZJWA 2XYNA 4MXYA 3KVWA 3W55A 1DM2A 3RWQA 4DBXA 3PRFA 5I9XA 1NT2A 2IG7A 4PDPA 4N6YA 4AA4A 5HBEA 5LCKA 4UB7A 5M51A 1Q61A 3ACKA 4RZVA 3TM0A 5J79A
chains in the Genus database with same CATH superfamily
1RE8A 3DOGA 5I9YA 4F63A 3I0OA 2WZJA 3A99A 3PXQA 4QMMA 4FGRA 1PY5A 5AX3A 3TKUA 2JKOA 4EOKA 4LDTA 3Q4TA 3QU0A 3AGMA 3OBJA 5M4UA 4ZZNA 5E8YA 3LLAA 1ZAOA 3EL8A 3JUHA 4L3PA 4NWMA 3EJ1A 3C13A 4H58A 4XG7A 3MI9A 2LAVA 3QZIA 4IE9A 5AUXA 4HGLA 1UVRA 4F0IA 3AKJA 1OKWA 4AOJA 3LXPA 2C6OA 4EK3A 4C4GA 3DXPA 4GW8A 3A60A 3BGQA 1WAKA 4EC8A 3HAMA 3P9JA 4EZ5A 4ZJIA 3VWAA 2WIHA 1UU8A 4OTPA 4JAIA 3COKA 3HP5A 2WMUA 3S95A 4H3PA 4KSPA 3BQCA 5HU3A 1BL6A 5IA5A 2NYAA 3OCBA 3LE6A 3GOPA 4R6VA 4YZNA 2B9IA 5BUEA 4NCTA 4ZY5A 2CJMA 1NXKA 5HO7A 2YLEA 3GFWA 4DGOA 3MY0A 2C6TA 3TZ7A 4HYSA 4EL9A 3SLSA 3LW0A 5A4QA 3RJCA 2V62A 4IB5A 4JR3A 2BDFA 5I3RA 3ZRLA 3QGYA 2OH4A 5IISA 1GIHA 4O7YA 5KHXA 4PP7A 3BLQA 5AIRA 3SG8A 3P79A 5EYDA 1CM8A 3Q52A 4DC2A 4MD9E 3FMKA 5LARA 4FT0A 4F99A 2P3GX 1OL7A 3WI6A 4F64A 1FMOE 3QCYA 5HCYA 3QQHA 1ZY5A 2Z7RA 3VBWA 2WQEA 3THBA 2WU7A 4GFOA 3E8EA 3PPJA 2YDKA 1FINA 1YDRE 2GNIA 2G15A 2UZDA 2WQBA 3NRMA 3OROA 3QA0A 4OTGA 4A07A 1S9JA 3HAVA 2VX0A 3ZU7A 3GUBA 2VO0A 4MKCA 4XP3A 2Y8OA 1OKZA 2EB3A 1ZYSA 3E92A 3BLRA 3ODYX 3QRTA 2JKMA 4IX4A 5CU6A 4BCHA 4U3YA 4KBAA 4E6DA 3ZLXA 5HX8A 3H3CA 4RPVA 3CBLA 3Q60A 3LFAA 4AW5A 2XBAA 1UWJA 4X3FB 1AGWA 3I6WA 3BHUA 4J99A 3G90X 2GPHA 2WOTA 4JQEA 1U4DA 3DNEA 3G9NA 3VS6A 5B2KA 4C58A 2XCKA 4GCJA 4XG2A 4X3JA 3PFQA 4AWIA 1Q8UA 2BRHA 4N57A 4XG4A 1OB3A 4TT7A 2ZV7A 1PW2A 3L9NA 4FNYA 4I94A 5CSHA 5E8WA 4YC3A 3UG2A 3UQFA 2YAAA 1LUFA 3CXWA 3IGGA 4BDEA 1M2QA 4X3FC 4KIQA 2XANA 3A7JA 3WIKA 3WF7A 4EH5A 4NM3A 3WZDA 1R78A 4G5PA 4IVAA 3DFAA 5M4CA 3N4TA 3KFAA 3MTFA 5FTQA 3W2OA 4AACA 1JAMA 2G1TA 3VS1A 4FJVA 4FRFA 4BI1A 4BBMA 1BLXA 5IDNA 3PZEA 5J7BA 5CU3A 5ANIA 3VJNA 4QO9A 4UMUA 3CTHA 1G8KA 2BRGA 2F7XE 5D9HA 3VS4A 4IEBA 1I44A 2B7AA 3COIA 1RJBA 4W4YA 2XNEA 2UVXA 4YO6A 1GIJA 5FXRA 3D5UA 1YI6A 2GNJA 4QMQA 2QU5A 2H9VA 3TDVA 2VWXA 2HW6A 3EFWA 4HNFA 2JFLA 2UUEA 4BTKA 2J51A 2OJJA 4CSVA 4X2FA 3PXKA 3EZRA 3BL7A 3REPA 1ZY4A 3FSFA 2BMCA 2ETKA 5BX0A 2JDSA 3FMDA 4KD1A 1FVRA 3KK9A 2R3RA 4X7QA 2WU6A 1WBNA 2B0QA 4GYGA 2YHVA 2VU3A 4IX3A 1YWRA 4EI4A 4D4SA 4IVBA 4TYHA 4GRBA 2XK8A 5FM3A 5IA2A 3CC6A 5ANDA 3EFLA 5HD7A 3QTRA 4BDCA 5L8JA 3O96A 3FUPA 3QAME 4DITA 1JKLA 3R8MA 4QDVA 2J2IB 4RG0A 5HBJA 3FDNA 3W2SA 4D28A 4ASDA 2A1AB 4N4SA 5I3OA 4U81A 2BR1A 2ITTA 3GB2A 4I23A 3WYXA 5BPYA 1Q8TA 3C1XA 5ETFA 4WSYA 3GVUA 3ZTXA 4C4IA 3CY2A 3BZ3A 4PQNA 4YLLA 3QTZA 3C4EA 3OUKA 3D5XA 5CANA 2CGXA 2E9VA 3D7TB 4EQUA 1H27A 5KUPA 3T9IA 1H28A 5KZ0A 1X8BA 5FDXA 2CKEA 3NSZA 3W0RA 3E3BX 4IHPA 4DN5A 4K6ZA 5J9YA 5FWKK 4DE4A 2W9ZB 4CCBA 3F5XA 3BPRA 5A54A 4C4JA 4L3JA 3F2RA 2X39A 4BIEA 4D4YA 5CALA 4USEA 2NRUA 1TZDA 3F2AA 4GYIA 4MEDA 4TYEA 5DBXA 3RGFA 4D4RA 4E5AX 3NYNA 5CYIA 4ANBA 3V01A 4O4BB 4LGDA 4RBLA 1PXPA 3TACA 2PMNX 1FGIA 4BDKA 3EQBA 1XMMA 4BY9E 4LMUA 1B39A 4EJ7A 2PVHA 1W98A 3U4UA 2I0EA 4BDDA 4QQTA 1FBNA 3DB8A 4RFZA 4AUAA 3QC9A 4PPCA 2OWBA 2JITA 2IO6A 4HYUA 4M0YA 3VO3A 4DTAA 4TY1A 3ZH8A 4HZRA 4TWNA 3O71A 3KXNA 3NYVA 4KS8A 3VBQA 4CZTA 5L8LA 3OY1A 3ZXTA 1MQ4A 2WB8A 3GP0A 5L3AA 3SQQA 2I7QA 2J90A 2QOIA 5B2LA 2ZDUA 2XA4A 2P2HA 3GC9A 4KNBA 2IVVA 4EBWA 1U54A 2HZIA 3QLFA 4HYHA 4ZSEA 2YM4A 2PSQA 4IW0A 3QZGA 3V5WA 4CVAA 5LMBA 3ZC5A 3I5ZA 1NW1A 2J4ZA 3F5GA 3F6XA 5HBHA 4U79A 2CGUA 4QTCA 1KWPA 1PXKA 3RKBA 3FEGA 3KU2A 4QQCA 3EYHA 3RZBA 3UJGA 4TNBA 4YUQA 4IAAA 3NVKI 3OTUA 4FT5A 3OT8A 5IG1A 2YEXA 2WFYA 4WUNA 4O0SA 3SA0A 2YM6A 3FE3A 2J7TA 4RIXA 3QTQA 1H1QA 4FT3A 2ITOA 4J96A 4F4PA 3VUMA 3W16A 3Q5ZA 4D2VA 3FZ1A 3HZTA 3W8LA 1GZ8A 2HOGA 2IJMA 3PPZA 4GFMA 5FLFA 2JBOA 3NUAA 3R71A 3AC4A 3Q9YA 4EH7A 5DHJA 5B2MA 3R8UA 2OIDA 5KX8A 4UEUA 4NIFA 2O5KA 3CQWA 5GJGA 4Z3VA 2OXXA 4EOJA 5TF9A 4G3FA 4EK5A 2IWIA 2BCJA 3A4OX 3GT8A 4QDEA 1ZMVA 4DTKA 4ANOA 4AX8A 2UZVA 3NNWA 4F1MA 3KF7A 3PSDA 1WVYA 4HGTA 1QPEA 1Y6AA 2C1BA 3RK7A 4X2KA 4M97A 1PKGA 4LOOA 4ZTLA 5IUHA 5K9IA 4R7BA 4U44A 5HLPA 3KXXA 5KMLA 1Z9XA 5AP5A 3BE2A 3DNDA 4I5MA 2I0VA 4NKAA 3DQWA 5KE0A 4EH4A 4K77A 4QP1A 3VBYA 5BQ0A 1FQ1B 4JG6A 4EOLA 3L8PA 3FMHA 5A3XA 1TKIA 4RWJA 5B0XA 3RNYA 4BCPA 5AP3A 1J7UA 5BVKA 4H36A 3FKLA 3PZHA 2YIWA 4ZOGA 5CENA 2IW9A 5K0XA 5DLSA 3TMOA 2GHMA 3LAUA 5LVLA 4IM0A 5J87A 3MFUA 4BBFA 4R3PA 5HOAA 2Z7SA 3UQCA 3DKFA 3O8PA 4BDFA 4E5BA 3MA3A 2I1MA 2WMBA 3NIZA 2OFVA 3D15A 3LM0A 2WQMA 2QQ7A 3CQUA 3L8XA 3TNPC 2CNQA 2XS0A 4RMZA 3UZRA 4NZWB 5GIPE 3QUEA 2IZSA 2JFMA 2PVJA 5AV3A 4YP8A 2VTTA 2X6EA 3BKBA 4E6CA 4O82A 4DFNA 4G3CA 3DGKA 1SM2A 4II5A 3ZUVA 4I6HA 2R3LA 3SXSA 2VWVA 2YCSA 2XNGA 4CT2A 2VGPA 5HVKA 4FL2A 1Q97A 2BDJA 3W1FA 2XM9A 3DQXA 1WBPA 2C5VA 4GFGA 3OXZA 4YBJA 3ZXZA 3ZSHA 4YBKA 1QPDA 4ZP5A 4FIJA 4RJ4A 4LQMA 5FTOA 2QOBA 4LUEA 5T6KA 3T3UA 3UDSA 1KE9A 3IDBA 2Y9QA 2CHLA 3A7IA 3NLBA 3OOGA 3P08A 5JRSA 3PJ1A 1XKKA 3VUGA 2W1ZA 3I7BA 3W33A 4X2JA 4A06A 4O4DA 1E9HA 4J98A 5H9BA 4DHIB 3C0HA 4ALWA 4Q2AA 1OUYA 3LXNA 3TNWA 1H4LA 2XIRA 3HUCA 1SVHA 2QKWB 4JBPA 3UDZA 4JNWA 3R9HA 3K3IA 1H00A 2XZSA 3D9VA 4O0VA 4DHZA 1R0PA 5AR8A 4DFXE 4DYMA 3G15A 2EXEA 5IU2A 4RX5A 5J1VA 5DNRA 2FSOX 1XH7A 3MVJA 3OZ6A 4A9TA 4D0WA 2VWWA 5CVFA 2CPKE 1OECA 2E9OA 3AC5A 2XKCA 4EWHA 2HYYA 5HCXA 2JKQA 2VTSA 3M42A 3O7LB 3UO6A 4C3PA 5DN3A 3KMMA 4MXXA 1ZWSA 4RVTA 4D5KA 3UPXA 5IDPA 4D2TA 3W0QA 5C4LA 4L7FA 5C01A 2QOQA 4AE6A 3EQDA 2QOFA 4C0TA 1XWSA 3C4ZA 3H30A 5EW8A 4C35A 1PXIA 3LMHA 3OC1A 5HO6A 1O6YA 2YJRA 4Z55A 3RM6A 2F9GA 3BI6A 4OT6A 3HA8A 3FLSA 1SYKA 2C3LA 4L6QA 2RFEA 4O7LA 4GVJA 1UKIA 3DJ6A 4JQ7A 3ORZA 2XF0A 5K3YA 4PRJA 2BIKB 2R3HA 3Q04A 3V5QA 2UW3A 4DEBA 2ERKA 5GIOE 4FV4A 4LOPA 4BFMA 4YTHA 4Y72A 2G2HA 4V04A 3U6JA 3R28A 2ZM3A 2VUWA 2F49A 3NNVA 4L9IA 4QP7A 3TG1A 1ST4A 4I6LA 4FIGA 5CASA 2FH9A 2I40A 4ZMEA 3SHEA 4S34A 5IZFA 5GJFA 1JSUA 1UWHA 4FUXA 3WE4A 3ZMMA 1TFFA 1Q5KA 1W2CA 1YRPA 2R3PA 3O51A 4CFFA 2YCRA 4DH8A 3QHWA 5ANGA 2UZWE 4UBAA 1GNGA 4ENXA 4HVIA 4GKIA 3PDTA 4EOIA 3D2KA 4EHVA 1FGKA 3M1SA 2HXQA 4ACDA 5CEOA 4FR4A 2W96B 3EQRA 4GL9A 3F9NA 3R0TA 5AJQA 1P4FA 3R04A 4IWPA 4WG4A 4GUBA 2EXCX 3CGFA 1LR4A 3NFGB 4DFUA 2A98A 3LXLA 5ITAA 2W1DA 2R9SA 5HGIA 3EQHA 4YGAA 4C3FA 4F9WA 5LVOA 4EBVA 3UBDA 4NJDA 4BYIA 3NNXA 2R5TA 4YZBA 5DA3A 1YI4A 4IX6A 4EQCA 3H10A 4IVDA 3MV5A 3DKGA 4JDHA 1BI7A 3K5UA 3E8DA 4U7ZA 3NAYA 3QQLA 3E63A 3RAHA 1F5QA 2PMOX 3FXZA 2GQRA 2XK4A 4BJJB 4GMYA 4UV0A 4E93A 4DEHA 4GG7A 4QYFA 3NYXA 1DAWA 4HPTE 3VC4A 5J8IA 3RPVA 4FIHA 2YDJA 3KQ7A 4FTKA 4CEGA 4IX5A 4RJ6A 4F70A 3FYKX 4NH1A 5F4NA 4F7LA 5CEPA 1K2PA 4FYNA 4BRXA 1IAHA 1IG1A 5DEWA 5E8SA 4LL5A 3DV3A 5J9LA 1G8AA 2J6MA 5CF4A 3P5KA 4RIXB 4D58A 3KXHA 5F1ZA 2UZEA 1ZYCA 2P55A 2OIQA 4XJ0A 5HE0A 3PXZA 3SW7A 4IQ6A 4B8MA 3C4CA 3KN5A 4M84A 4TXCA 2PULA 1ZZLA 5C03A 4E4XA 2B9JA 4HNIA 4W4XA 5EI8A 3I4BA 1XHAA 1HCKA 1T45A 2XNOA 3ANQA 3MVHA 3GNIB 4KKHA 3DAKA 2R4BA 3ZBFA 1NVRA 5LVMA 3U6IA 1A48A 3P5JC 2WXVA 4MYGA 4FZ7A 2F4JA 4YC8A 5CEIA 1XQZA 5ETAA 4P7EA 2ZFYA 3MESA 2Y7JA 1H1SA 4CLIA 2W06A 4CMTA 5HNIX 3ORLA 1IA9A 4ACGA 4DGGA 2A0CX 2RIOA 3LFEA 4P90A 2Z7LA 5CU0A 5CSVA 2PE1A 3QRUA 4G6OA 3LCDA 4AT3A 3IDPA 2IEWA 3IGOA 4JG8A 5JFSA 2DQ7X 4FSNA 3UDBA 5LMKA 3VQHA 1VR2A 2BIYA 3C50A 3MFTA 4ZTSA 5HNGA 5C26A 2Y4IB 3TJDA 5IQIA 3EN5A 4BCFA 2JBPA 1SNXA 3W10A 3EN4A 4GVAA 4XLIA 2VTHA 4FTOA 1LPUA 1VJYA 3RAKA 4RIYA 5CSWA 4O1PA 2VWBA 4MCVA 3NW7A 3MFSA 4G9CA 4JS8A 3JR1A 3HUBA 4IMYA 5JFXA 2G01A 5JGBA 1K3AA 3LCSA 3D2IA 3HEGA 2Y4IC 3ZHPC 1WVWA 4AT4A 1LEZA 1UNGA 2ZDTA 4BCOA 2WTCA 5EM5A 5GZ8A 2KTYA 3EL7A 4RA4A 4J95A 4HVSA 3E7OA 1KV2A 5JKGA 3POOA 2IZUA 1WBOA 5HVYA 5M08A 4BCQA 5AAEA 2RG6A 4WRSA 3OWJA 3QGWA 1G5SA 4NFNA 4DFYA 2BZIB 4FTUA 4A4LA 4FTLA 2UW9A 3DZQA 1JKKA 1J1BA 4OAUC 3LJ0A 1YI3A 3NFFB 3S00A 4E1ZA 2UZNA 3G51A 4IAKA 4ZJJA 3ZSIA 4F7NA 5LVNA 3GCVA 2W9FB 5FTGA 3SXFA 4NM0A 4O22A 2ITPA 4EUTA 5DR6A 5M57A 4DH1A 4XP2A 4BWXA 4O4CA 2ZB0A 3FQSA 2JDVA 2QURA 2W17A 5FEEA 2RKUA 2QCSA 3DTWA 4BZNA 2F2CB 3AC2A 3GQIA 3JYAA 4G16A 4AW1A 5HTCA 4EOPA 5L8KA 3PWDA 4OTHA 2BAKA 4FKWA 3N4VA 4FL3A 4EOOA 2JAMA 4TW9A 4QYYA 2DUVA 4WSQA 1CMKE 1HCLA 3VNTA 5AEPA 4O7RA 4DEAA 4YLKA 1Y8GA 5D10A 5LWMA 3Q4UA 1YDTE 3RNIA 4E5WA 1A06A 5JMSA 4M12A 4I0SA 3HRBA 2DS1A 2VX3A 3DS6A 3JS2A 2R3QA 4HCUA 4XV1A 3AMAA 4C4EA 1OPKA 4XMOA 3SOCA 2OK1A 3VF9A 4IXPA 4FG8A 3VS3A 4E73A 1L3RE 3KCKA 1BKXA 5JGAA 3JY9A 3ZFMA 4PTEA 2W5AA 2UZTA 4KSQA 2HXLA 3KKVA 2QG5A 2SRCA 4AW0A 3RPYA 2V7AA 4XRJA 2JIVA 5IF1A 3FLZA 4NSTA 4W9WA 3OBGA 2WMTA 3D5WA 4M14A 2YN8A 3DAJA 2QD9A 3A4PA 4HJOA 3PWYA 3OY3A 3V8WA 2FSLX 2YAKA 3C4XA 4RFMA 3UQGA 1OL1A 3PJCA 5DI1A 1YXTA 4QMXA 2AUHA 3DK7A 3LFCA 2W1GA 3FV8A 4TL0A 4MNFA 5EHLA 4Q9ZA 3FMEA 2UW4A 4A4OA 3BHVA 4W4WA 4I4EA 3FXXA 5AUZA 4OTIA 1J7LA 5LOHA 4M7IA 5F95A 4RC2A 4ID7A 2FVDA 3EKKA 4GU9A 4Q5EA 4C57A 2PUPA 3F88A 4AXAA 3GU6A 1I09A 3BGZA 5T3QA 4F9BA 1YOJA 2GTMA 4RVKA 1OIRA 4IFGA 5DRBA 3UC3A 5AV4A 4CG9A 2FYSA 2UZBA 4FVQA 4LL0A 2WTDA 4FV7A 2CGVA 1UKHA 5GHVA 4CFWA 2J0KA 4F9YA 4BI0A 4BTFA 3OS3A 2AC5A 1UA2A 4RVLA 3SW4A 2V7OA 3EZVA 3GCSA 3NUUA 1UU9A 1CKPA 4K9YA 4ZZMA 1W83A 3F66A 4HGEA 4TNDA 2BAJA 2JKKA 3PXFA 4RGJA 3MB6A 5HTIA 3PUPA 4BCKA 4M13A 3OVVA 3WZEA 4ZZOA 3H0ZA 4TWPA 4AOTA 2X7GA 4FVRA 4WKQA 4CKIA 2C1AA 5EYMA 4DEDA 1XMLA 3NNUA 4PF4A 3VUHA 2Z02A 5IQGA 1ZMUA 4J97A 2OZOA 3I7CA 4DBNA 3F3ZA 2EU9A 1FVVA 1Z5MA 4RJ8A 5CEMA 4GIHA 4JDKA 4OR5A 4UMTA 5GZ9A 4FX3A 4NM5A 3ORPA 4IIRA 2XAOA 4QMWA 3LLTA 5BVWA 3R9RA 2ZB1A 3R6XA 4Y8DA 1OI9A 4YJPA 3E3PA 3FHRA 4E4LA 3ZO2A 2X0QA 4WNKA 2YZAA 5IQEA 2OH0E 2WIPA 3PP1A 3UP2A 2GQSA 5H3QA 3BHHA 4GT4A 3BBTB 4I93A 4Y95A 4ZK5A 4ONAA 1BX6A 4O2PA 2B9HA 4IANA 3SX9A 3UNZA 3PYYA 4QOXA 4YJRA 3F61A 5CSXA 3RHXA 5C4KA 4ZTQA 4QP8A 5IQFA 4GK3A 4O4FA 3ERKA 3FY0A 3WZJA 2B1PA 4RT7A 3P7BA 3UZPA 3S3IA 4X6QC 4DLIA 1ZOHA 3CIKA 4DAWA 2JDTA 2C3IB 4MXZA 1YOMA 5FEDA 5KO1A 4G6NA 4WA9A 5M55A 3C5IA 4OAVB 5FBOA 3A8XA 4G34A 2FSTX 2OJIA 3PLSA 4GUEA 5FG8A 3UIUA 2PUIA 4QMTA 4I5CA 5AV2A 3SKCA 3EN7A 1PJKA 4AZFA 1W82A 3E88A 4K18A 4KIOA 3KA0A 5CXHA 1KE8A 3SDJA 3W2PA 5A4TA 1ZYJA 4CFMA 3TDWA 5BVNA 3E62A 4FVPA 2X2KA 1Q8WA 2FA2A 3G6GA 2BKKA 2C6KA 1KOAA 4XV3A 1JBPE 4FTJA 2OICA 3NUPA 5ETIA 4YJSA 4R7IA 1S9IA 5IMXA 2QODA 4FBXA 5HLWA 4OTDA 4MBJA 4XX9A 2ESMA 2B54A 3VS5A 4ZAUA 3FI8A 3R63A 4GKHA 3LJ2A 2WTKB 4I22A 4QYEA 3LPBA 5FQDC 4BDHA 4JBQA 4BBEA 1PXLA 1Y8YA 3EQIA 3KCFA 1BL7A 4WO5A 5AP7A 4PY1A 4Z16A 4FV0A 3R30A 3W0OA 3C4FA 4YPSA 2JEDA 4MNEB 1WBSA 3Q9WA 4ZIMA 3ZSGA 1G3NA 4KIKB 1H24A 1YDSE 4FI1A 1UU7A 3DA6A 2KULA 3A7HA 2VO7A 3MY5A 4DDIA 4IACA 4PV0A 5DT4A 5AR7A 4C37A 3O7LD 3EQCA 3C9WA 3UODA 4QP3A 4QQ5A 5GINE 2ZVAA 4YTCA 5JZNA 4QP9A 1OM1A 2GHLA 3O23A 1CKJA 3FLWA 5AP0A 3QWJA 4BGQA 2OXYA 3P0MA 5M07A 2HZ4A 2W1FA 2QHMA 3EN6A 3O8TA 3ZCLA 4NJ3A 4FK3A 3A2CA 2BPMA 3QXOA 4OTFA 4R7HA 4DG3E 3EYGA 4CD0A 4RQKA 4KB8A 2OFUA 3HV6A 3TV7A 4FZ6A 4DHFA 5BVFA 3AC1A 3V6RA 5A6OA 5J5TA 1FPUA 2QHNA 2UW5A 2F7EE 3K54A 2AEGA 4BICA 3ITZA 5TKDA 3O2MA 2OJGA 4EHEA 4BGHA 4BZDA 3FMJA 5EHOA 5EOLA 4FYOA 3UYTA 2C6LA 4I21A 3SV0A 3KRJA 2P0CA 1P14A 1ZARA 3HMIA 3L9MA 4O7WA 3PJ2A 4S33A 4FSZA 5TE0A 5KNJA 5LCJA 5DWRA 2YM8A 3UOHA 4YZMA 2XVDA 3HRCA 3TV6A 2XNBA 1K9AA 1REKA 2ITNA 3NUSA 3O17A 4DH7A 4FSMA 3PVWA 4HOKA 4BZOA 2QKRA 3QYWA 5DT3A 2C0TA 3ZUUA 4C61A 2BZKB 4UMQA 3IKAA 2ONLC 5AP6A 4DGNA 3Q5IA 2OJFE 5M4IA 3QD3A 3DJ5A 1HOWA 1OPJA 2ITXA 3DK3A 4FTCA 2QOOA 5AP1A 4RZWA 2BDWA 3HYHA 4A9YA 2XALA 3ELJA 4QTEA 3MIAA 2CSNA 3HV5A 4R3RA 4OTWA 2OSCA 2PUNA 1PMUA 2HENA 4FTIA 4LV5A 2XIXA 4CTBA 3PVUA 4Y46A 3IS5A 4QMZA 4WNMA 4EYJA 3GFEA 2PYWA 3CTQA 4RC3A 5EI6A 2C5YA 3BYMA 3LFBA 3E8NA 4O1OA 3WE8A 4NEUA 4IDVA 2XIZA 3UIXA 4D2SA 4DDGA 4R8QA 3MY1A 4JI9A 4BB4A 5A4LA 4FL1A 4ZY6A 4CLJA 3BIZA 4U8ZA 2QOLA 4DF3A 5FXSA 4CZYB 3BE9A 3CPCA 2QLQA 4MXAA 5ANEA 5HD4A 4DA5A 2R7IA 1JVPP 3TWJA 4FV2A 3ZLYA 4BKYA 4FC0A 5HG5A 2ITYA 3R02A 4O7ZA 4RX9A 4WD5A 3EQFA 1GIIA 1O9UA 3PA3A 4G17A 3QWKA 1QPCA 3HDMA 4FA2A 4KIPA 4QRCA 1QCFA 4ALVA 3FL5A 5AR2A 2G2FA 4FKOA 3DK6A 1G8SA 3NUXA 3ZZWA 4E4NA 4JIAA 3FHIA 3VJOA 4R77A 2UZLA 5DEYA 2C6MA 1M52A 4QPAA 1Q24A 4DG0E 4ASEA 4NU1A 4FG9A 3LHJA 3OXIA 3BELA 4FODA 3EIDA 4ZEGA 4F9CA 3ZFYA 5AA9A 4FOBA 3UIBA 4EEVA 2BROA 4XRLA 2EB2A 4BDBA 4RLKA 1A9UA 4ANMA 4AQKA 3LZBA 4GU6A 2CMWA 4A9SA 3FLNC 2EUFB 3NCZA 3IQ7A 4MTAA 3DU8A 5CI6A 2BKZA 3M11A 5EW3A 4D2WA 2WD1A 3VUIA 3R9NA 2Y4PA 2YITA 3O0GA 3QFVA 5JT2A 2CKOA 2ZM4A 3QTIA 3FJQE 3RWPA 4FKSA 3FL4A 4N6ZA 3ZONA 4CFVA 3GU4A 4U43A 2NP8A 4UX9A 3LOKA 3QL8A 3SXRA 5AX9A 3MDYA 5H8GA 4QPSA 4MHAA 4BF2A 4WG5A 5DR9A 4BVUA 3MW1A 4RFYA 4U97A 3P4KA 3IPHA 4JAJA 5DPVA 4O7NA 1OL5A 3PIYA 3UIMA 2W1EA 5J5SA 4GK2A 4M69A 4FEXA 1YW2A 3HGKA 3ORTA 2X2LA 3FPMA 4NCTC 1U59A 4TYIA 4Z7GA 2GMXA 3R7IA 5E9EA 3JXWA 2ERZE 2IN6A 4YJNA 2XK3A 1ZOGA 3HA6A 4BIBA 4CQEA 5M53A 4UYNA 2AC3A 3U4WA 3QQUA 1PYEA 4H39A 1VZOA 5HIBA 2XIYA 3II5A 3KRXA 1V0OA 4BKZA 3TL8A 3ZOSA 2VWUA 2R3JA 2ZAZA 3IW8A 5J7HA 3M2WA 4KS7A 1H1WA 3G0FA 4FSTA 3WARA 1ZXEA 1JSVA 4FKJA 3FZRA 2WOUA 2C5NA 4WHZA 1V0BA 4JQ8A 2VTMA 4AZWA 4LGGA 4EC9A 3QLGA 5ETCA 1OIYA 5I5ZA 3Q4ZA 4U6RA 5AWMA 5CY3A 2C0OA 3UZTA 4IZ7A 4EH2A 3FKOA 3GXLA 3AKKA 3P23A 4MAOA 3C0GA 2X1NA 3Q53A 5D11A 3PA5A 4GV1A 1YXXA 5CAVA 4TTHB 4JX3A 5ICPA 4YC6A 5K5XA 2Z2WA 1CDKA 4N70A 4AQCA 2XKFA 3BX5A 3RCJA 4K2RA 3R21A 4BCJA 5IQHA 3FZPA 3OWLA 3OCSA 2XNMA 4PL4A 4UWBA 3QC4A 4AS0A 4BCNA 4B9DA 4U42A 1H1PA 4AF3A 3UVRA 2NPQA 5KKRB 1Q3WA 4J71A 4W9XA 2VTNA 3BU3A 3V3VA 3E7VA 5E8VA 4AGUA 3QQKA 5AUVA 3GEQA 4EHZA 5IH4A 3UNKA 2RL5A 2W0JA 3HMNA 2ITUA 2O63A 5E8ZA 2GTNA 5HU9A 1KOBA 4FTNA 3FMLA 5HG9A 5HG8A 4B99A 4DEIA 4DCEA 2XK7A 3P1AA 3DTCA 1J91A 4D55A 3LIJA 4QP2A 5CS6A 4QMVA 4K11A 3C4WA 1GZNA 4OLIA 4V0GA 4O7VA 3O50A 4BR3A 4FIIA 3HV4A 4RQVA 4FKVA 2PZ5A 1DS5A 4S32A 2YCFA 5TT7A 5EM7A 5A4EA 2WEIA 1KV1A 3KK8A 4IJ9A 5TO8A 2ITVA 3ANRA 4EH9A 4FIEA 5IPJA 4AW2A 3B2WA 2VTQA 3KIOC 3TN8A 4ZLZA 3TUCA 5L6PA 5DG5A 2AYPA 3VHKA 1BI8A 2BUJA 5EKOA 4ZTNA 3VRYA 5J95A 4O84A 4TYHB 2A2AA 4RWLA 3ZLWA 4O38A 4QD6A 4FT9A 5HHWA 2IZTA 4QNYA 4RX7A