3W8QA

Structure of the human mitogen-activated protein kinase kinase 1 (mek1)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
344
structure length
318
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in "DFG-Asp Out" conformation
rcsb
source organism Homo sapiens
total genus 94
structure length 318
sequence length 344
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w8qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w8qA01
4CKRA 1XH4A 2NRYA 3MFTA 1XWSA 4C59A 1K2PA 4F9AA 4FKUA 4FTKA 1V0PA 4KIQA 4JOAA 2C6EA 4BF2A 2CPKE 3ZUTA 5M07A 3KN5A 5KO1A 4FT0A 1WBTA 3PXKA 4BB4A 2Z7SA 4Z16A 1OIYA 3DJ6A 3FLQA 4IB3A 3PVUA 4GVJA 4D0XA 3VS3A 4IAZA 4GG7A 4AP7A 5HE0A 3OMVA 4BI2A 2JKOA 2PZPA 5DRBA 4CMUA 4ZTMA 4O0RA 4NWMA 4IDTA 2C6IA 2G9XA 3GC8A 3Q4TA 3ZONA 3C4FA 4F1TA 2RFNA 4H3QA 2QU6A 3BCEA 3FQEA 1GNGA 5LVOA 3P08A 2IN6A 3FLNC 4CV8A 1OL2A 5CASA 4DT8A 4O96A 2PVJA 3E8EA 3I1AA 3I5ZA 5TO8A 1WVXA 5GNKA 4F7LA 3NYOA 3EL8A 4RVKA 4BDDA 3BLQA 1SM2A 5AP6A 2J0MB 2O8YA 5GZ8A 2J7TA 3KRLA 3T9TA 2UZTA 3SOAA 2IWIA 4AW1A 1QPDA 3QRTA 2W7XA 3VQHA 4EH5A 5JFWA 3BHVA 3R9NA 3ZZWA 3IG7A 4KIKA 5AP7A 4AX8A 3TWJA 2VTOA 2ZV8A 4GSBA 4J98A 3VAPA 2X2KA 3D5VA 2OI4X 4FTTA 1WBVA 3R02A 4FZDB 4G6OA 4HCVA 2QNJA 2YM7A 3SAYA 4LI5A 3KXZA 1OIQA 3HMOA 4GW8A 4H39A 5KMOA 1NA7A 2ERKA 4YC3A 3UIXA 4DINA 5IPJA 4CT2A 3KREA 2IVTA 3A8XA 4G6NA 4G3GA 4UMQA 3UNJA 4UV0A 4Q2AA 3KF4A 3HNGA 5EI2A 4BWKA 3CJFA 3EKKA 1UNLA 4UWBA 3E5AA 5E91A 2OH0E 3AD5A 1JBPE 1QPCA 4DFLA 3AC4A 4FKOA 3BGQA 5AUXA 4GFOA 1OBGA 3COIA 2Q83A 3DNEA 1TQIA 3EJ1A 1J1CA 4XP0A 4A4LA 1B6CB 4IX4A 4JBQA 1Z5MA 3PRIA 2OLCA 2BZJA 4KRDA 4H1MA 5T6KA 3VULA 4QP2A 5CTPA 2PZRA 3NEWA 2IW8A 1ZMVA 4CFWA 3TV4A 1E1VA 5FQDC 3ZZEA 4EC8A 5J9LA 4ZMEA 2QG5A 4FEWA 3SGCA 2XEYA 5K5XA 1UA2A 4HGSA 4DFXE 3QWJA 3IDPA 5FRIA 3FJQE 3U6HA 5E1SA 2XP2A 3QQLA 4EH7A 3BE2A 1ZWSA 4FNXA 3G9LX 4FV9A 4U79A 5EM5A 3U4WA 5JRSA 1JAMA 2GNHA 4LUDA 4C3FA 3DT1A 3UOHA 4F1MA 3FZOA 3DAKA 4DTBA 2F7ZE 2YIWA 2CGUA 2ZDTA 3RMFA 4BKJA 1OBDA 2HZ0A 1YHWA 2XH5A 4EONA 2OKRA 4L3LA 3SW4A 3W8QA 3GB2A 3MTFA 5FXQA 5J7BA 2X2LA 4FIGA 3MA3A 2DUVA 2ZAZA 3LKMA 2VTIA 3Q96A 4YBKA 3LOKA 4QMTA 2CNUA 4BKYA 4YHJA 4IMYA 4GS6A 1UVRA 2X9FA 5EOBA 4CCBA 3S1HA 2CNQA 3FZSA 5JZJA 4FT3A 4MF1A 1KOAA 4RLKA 3G6GA 4RWKA 4MAOA 3ULIA 2PVMA 3WF6A 2VO0A 4XG7A 2YAKA 2WOTA 3WF7A 2B4SB 3DK6A 2OXXA 5HO7A 2EVAA 2PVFA 4AW2A 3IKAA 4DEAA 4XMOA 4I41A 1XJDA 4J95A 5F95A 4GT4A 3OWJA 4FODA 2B0QA 3PVBA 5DNRA 4F0FA 3DBCA 5C03A 4KSQA 4CZYB 5HE3A 1OL5A 4ERWA 4XP3A 5IA1A 4OAUC 3UMXA 2XEZA 2YJSA 1YOJA 3PLSA 4O7SA 2UW7A 3IW4A 3EQGA 2WMAA 2ONLA 4IFGA 4HGEA 4E8AA 1YWRA 2YZLA 4RMZA 2BIKB 3FZTA 3R8LA 1ZYJA 5LVMA 3ELJA 5EM6A 4QMQA 3WF8A 4M12A 5EW9A 5AV4A 5HU9A 5JQ8A 4QMSA 1IAJA 4AFJA 1SVEA 3UO4A 3VO3A 3VWAA 4LOPA 4GUBA 2C3KA 3SD0A 5HLNA 4IVCA 2VO3A 4GK2A 4F63A 5J1WA 4BR3A 3B8QA 3LXLA 5CNOA 4I6HA 4D4RA 3I7CA 3E7VA 2BFYA 4I92A 3FI2A 1EH4A 3ZLWA 1VYZA 3LFAA 4BTFA 3QAME 1PXIA 3AC5A 3QXOA 4FIJA 1Q8YA 4G9CA 5B7VA 3WZKA 2F9GA 2BROA 3W8LA 3UYSA 3EN4A 5IQGA 4TYHB 4ZOGA 4O0UA 2Y6OA 1MUOA 3PXZA 1OIUA 2YFXA 2BAJA 2B7AA 3V51A 4UMUA 2CKPA 5EDRA 5C26A 2BHEA 4CZUA 3POOA 4IBMA 1FVVA 4BIDA 2C1AA 2V22A 3FMMA 4OR5A 1HOWA 4O1OA 2Y0AA 2W1HA 4D2RA 4USEA 1M7NA 4HJOA 1P5EA 4XG3A 3CTJA 5DR9A 4KNBA 2XIKA 5CQWA 3LFEA 4FL3A 1NY3A 3Q2JA 5IEXA 4A4OA 3FI4A 4M66A 4YJSA 1PXPA 4BHZA 3OFMA 4K8AA 4ACMA 4EOLA 3VUTA 4MD9E 2VTNA 2YAAA 3DDQA 4HYSA 4IEBA 4OLIA 2GHLA 4FK6A 3QGWA 2I0HA 4JR3A 4HVSA 5EFQA 3VUGA 4AA4A 3GI3A 3KL8A 1IASA 2RFDA 3E3PA 3LHJA 4PUZA 4R3CA 4BRXA 4DLIA 3LLAA 1IA8A 3HUBA 2YCRA 3F5PA 4XS2A 3ZLXA 4JAJA 3A8WA 2XKCA 4AWIA 3P4KA 2XS0A 2E2BA 2YWPA 3KMUA 2HXQA 4YZMA 2DS1A 2HYYA 3L1SA 5BVNA 3D14A 5A3XA 3AT2A 3KCKA 4RX8A 5HTBA 2QOQA 1FVRA 3IS5A 1FPUA 4XV9A 5IMXA 4RQVA 4IFCA 4E73A 3FPMA 5HIBA 5EQYA 4JG7A 3S2PA 2UZLA 3GXLA 2RSVA 3HYHA 4GYGA 3NIEA 1UKHA 4YZ9A 2QODA 4WOVA 4G3DA 4IM3A 3ZDIA 1ZAOA 2AC5A 4BBMA 3PXQA 4TRLA 4U8ZA 4TYEA 4Q9SA 1CSNA 4NH1A 4OTQA 3M42A 4EC9A 4TWOA 1OGUA 4BN1A 3CE3A 4FTOA 4FG9A 3HV3A 4OTPA 1Q8WA 4TYHA 4D2VA 5LWMA 2CGVA 4QQJA 4TWCA 3SXRA 1FINA 4WT6A 3V8SA 2B1PA 2BCJA 2VRXA 3FZRA 3PZEA 5DR2A 3ZXZA 3FDNA 3W10A 4L46A 5DN3A 3EHAA 5JGDA 4RVMA 3OXTA 3DB6A 2GQGA 4PTGA 4BZDA 5AP5A 3BQCA 3D5XA 3TTIA 1ZZLA 2PE0A 4BCJA 3F88A 2PHKA 5IEVA 1H1RA 4FR4A 1ZY4A 3SXFA 2WFYA 4PMSA 1Q8UA 2C3JA 4AN3A 2PZYA 3BX5A 3RNIA 2R4BA 3QHWA 4AZTA 4B9DA 5KUPA 2IZSA 3PA3A 4KSPA 2CDZA 3K3IA 4RJ8A 3Q9ZA 4S2ZA 5ANEA 5IA4A 3R22A 4NM3A 3F5UA 5J9ZA 2GHGA 4C58A 1GZNA 2AC3A 4YUQA 3FMNA 4OT5A 4FX3A 4Y5HA 2V55A 3OCGA 3UG2A 3KF7A 4M67A 4QMOA 1WBPA 3R7OA 4P5QA 4AW0A 4MTAA 4BHNA 3DTCA 3F9NA 3CC6A 3GU7A 2C6OA 4UB7A 1URWA 4EUUA 2QR8A 2NPQA 2R3IA 4EJNA 3JVSA 3REPA 3CEKA 3E64A 4EHVA 4FGBA 4K11A 1P4OA 3WZUA 5IQDA 5D7AA 2BALA 5CSHA 5EDPA 4I0SA 5K9IA 2NNWB 3I6WA 1YXUA 4X3FB 4TT7A 3F2RA 5FTQA 4FV3A 2E9OA 4QPSA 2NRUA 4WO5A 2E9NA 1OKYA 4I24A 2RG5A 5LCJA 3RKBA 4K77A 3UOLA 4BDGA 2JIVA 3CQWA 4C2WA 4E7WA 1PRYA 3F61A 3W2QA 1R0PA 3DTWA 3W32A 5GHVA 3PP0A 3RK9A 5L8LA 3R1QA 5EQPA 2RG6A 3QWKA 3NYVA 3WF5A 3VJOA 5BUEA 3ZH8A 4WRGA 4CNHA 3I0QA 5BMMA 4WHZA 5DH3A 2OH4A 5HNGA 4ZK5A 1JSVA 3L8VA 3R9HA 4W4XA 5HHWA 5A6NA 4TL0A 4W4YA 5EM7A 2HK5A 3PVWA 4RWLA 1IA9A 1M2RA 2R9SA 1ZYDA 1QPEA 4LL0A 5E90A 3GFWA 2XA4A 1DAWA 4DTAA 3DQXA 4QYYA 1XBAA 5CVFA 2I0VA 4RIWA 4U40A 3R8VA 3G5DA 3QYWA 1JKKA 1BX6A 4GL9A 4U41A 3R2YA 4FV1A 4ZTHA 1H1PA 5FGKA 2GDOA 4TWPA 5ITAA 2W1GA 4NYEA 3UO5A 1G3NA 4WUNA 5LOHA 4AOTA 5F1ZA 4O82A 3BLRA 1H25A 2WTIA 1KV2A 5E8XA 4DH8A 5D41A 4M13A 4DT9A 3EN9A 5GIOE 1WBNA 1ZYSA 5EYDA 1A06A 3DXNA 4ALWA 2RF9A 4FTLA 4XH6A 4JG8A 5A54A 3AMAA 3NYNA 4CMTA 5E8TA 5K4JA 4MWHA 4AZSA 5KBQA 3R8UA 4AE6A 4D9TA 1ZOEA 4BCQA 3FKOA 2BRMA 2ITQA 3DBFA 4YJVA 4BTKA 4E20A 4I5CA 3QU0A 1U54A 4ACGA 3GNIB 2HXLA 4S34A 2IZRA 3G9NA 3UTOA 2PL0A 3UQGA 2O64A 5K4IA 3RPSA 3BV2A 2C5YA 2BZKB 2QO9A 4R5SA 2JLDA 4BIBA 1PMNA 1MQBA 4EORA 4FEQA 3BWFA 3P9JA 4R3RA 4AXAA 2PZ5A 3UZRA 5CI7A 2J90A 3COKA 4BFMA 1J91A 1SNXA 4JQEA 4XX9A 4IC7A 4MHAA 4QTAA 3UPZA 5IISA 2GS7A 3QUPA 4V0GA 2W4OA 3NLBA 2FUMA 2CMWA 4OTHA 4A7CA 4C35A 2QOCA 5DWRA 4DEBA 4QP8A 3F3TA 3MDYA 4XEYA 1AD5A 2X39A 4MWIA 5EKOA 3UMWA 5E8ZA 2J0IA 3Q52A 4NM7A 3ZBXA 3MH3A 4MYGA 3PA5A 3TXOA 3LCKA 4Z7GA 5E7RA 1JOWB 3R28A 5CS6A 4XG4A 1YWVA 1NVSA 4IJ9A 5AEPA 2OZOA 4O83A 2JC6A 2GHMA 2EXEA 1BKXA 5D1JA 2YACA 3W2CA 4Y5QA 3ATTA 1YKRA 5CNNA 3VHKA 2XMYA 4P4CA 4YU2A 2PWLA 1JKTA 5CSPA 5JMSA 2YHVA 4D1ZA 3DLZA 2OJFE 1SYKA 3LFNA 4I3ZA 3C0HA 3DGKA 2P3GX 4JVGA 5L8JA 2KTYA 5DFPA 4LUEA 3QTQA 3LLTA 4IAYA 5HLWA 4X3JA 5CI6A 3G15A 1O6KA 4X7QA 2UVYA 4QP7A 5AX9A 5A14A 1KWPA 4FEVA 4XJ0A 5FBOA 2WQMA 4IB0A 3A4OX 3CGOA 3VHEA 4EK3A 4U3YA 3QX4A 3RWPA 1RJBA 4CG8A 3TV7A 2REIA 3ERKA 2VTHA 3U55A 3AG9A 2J5FA 3BV3A 4QP6A 2BVAA 4X2KA 4ZMFA 1OPLA 4F09A 3W2PA 3E93A 5B2LA 3CTHA 4X0MA 3W55A 5CAVA 2X4FA 4LFIA 2XKDA 5KCVA 4R78A 3D5WA 3WILA 3CCNA 4BGHA 3RBWA 3UQCA 5LMAA 5DPVA 1U46A 5J9YA 5CVGA 5E92A 2C69A 4DEDA 4DF3A 4ZSGA 5FDXA 5AV3A 3VQUA 1FGIA 1FMOE 3C4XA 5AV0A 3S4QA 3VS5A 3DAEA 2CCIA 2W1FA 5CZHA 2HY81 2VGPA 3K5VA 3ACJA 4IM2A 3OWLA 4YP8A 2GMXA 2W1ZA 4XP2A 2CHLA 1ZLTA 5HE2A 3PJ3A 3D7TB 1BMKA 3ZSGA 1OKWA 4I5MA 5DI1A 3IONA 5DLSA 4U80A 3SKCA 2Q0NA 3Q2MA 3QRUA 4EQUA 2XNGA 4FOBA 2FSTX 3BU5A 5DT0A 3VRYA 2QVSE 4BGGA 2CLXA 4OT6A 3TCPA 4ARKA 4F6SA 5E8YA 3QLGA 4FUXA 4ZTSA 3OBJA 5FDPA 3TZ9A 4B8MA 1Q8ZA 2J0KA 3FLZA 3PP1A 4F7JA 4ZSJA 4UMRA 3V5TA 4GFGA 4HVDA 4G3CA 3PXYA 4PL5A 4U5JA 3RK5A 4LOOA 4FKRA 3V5LA 4O86A 3DLSA 4N70A 3S3IA 3ITZA 2PVLA 4WSYA 3AT3A 2QOIA 2BAKA 2ERZE 3EOCA 4EOPA 4D2PA 5AX3A 5EYKA 2F2UA 2C30A 2I1MA 3OVVA 4RIXB 4YPDA 4FVPA 1GIHA 3SRVA 1PXJA 1MP8A 4EH9A 2PMIA 5EW8A 4Z55A 3RAHA 1OM1A 2GNLA 2UW6A 3BZ3A 3NUPA 4LMNA 2WTKC 5JZNA 3TJDA 3O96A 4HNIA 2WOUA 1K3AA 4BCFA 3MJ1A 2XJ1A 4LL5A 1M7QA 4F6WA 5BNJA 3ZU7A 4YBJA 2B52A 2VTRA 4G16A 2WMQA 3R7IA 4FZFB 3CR0A 3DKCA 4H36A 4DN5A 4RPVA 4FV8A 3O8PA 2PUPA 3AGMA 4R8QA 3LMHA 4K2RA 1YXSA 3UVRA 4TPTA 4H58A 1YI4A 4NFMA 5A46A 3MH2A 3D4QA 2OJJA 1Q41A 2F57A 2PVYA 4C33A 1H00A 4YO6A 5FD2A 3UVQA 4WBOA 5J79A 3ORKA 4FSUA 2BAQA 3ZUVA 2JAVA 4M84A 3FMKA 3OEZA 2CGWA 4J1RA 5L2IA 4C34A 5HO6A 2CSNA 4YJQA 3H10A 4L01A 2G01A 3IW8A 4IC8A 4RVTA 5F4NA 3IPHA 4O7RA 1JVPP 3BU6A 5CXHA 4E4NA 3DFCB 4IZ5A 3W33A 3UIUA 5C8KA 3ORNA 4I4FA 3TG1A 4MXAA 3O7LB 2QHMA 3AOXA 3QA0A 4YJNA 3UP2A 4KIOA 2J9MA 4I6QA 3NUAA 4GUEA 3WIKA 3ZRLA 3SC1A 4WA9A 2QLUA 2PK9A 3ZHPC 3ZRKA 5LVPA 5AR2A 4UWYA 4NJDA 3GT8A 3AGLA 5BUIA 5CEMA 3MYGA 4FTUA 4KAOA 1JSUA 3DQWA 4L52A 3KA0A 2PE1A 3B2TA 1F3MC 4QMPA 3U6IA 4P90A 4DCAA 4YNEA 1UWHA 1TQPA 1Z57A 4NZWB 3R7VA 4OBPA 2J4ZA 4IWDA 4KB8A 4L6QA 2P33A 4IJPA 3ZFXA 4BI0A 4DG2E 1H01A 4E6DA 5DEYA 2WKMA 3M11A 4Q5EA 5CLPA 4O2ZA 1CKIA 2JIIA 2OFVA 2X8DA 1XH9A 3E63A 3GOKA 5BVWA 3FSFA 5KE0A 4XRJA 3TT0A 2CKEA 5BX0A 1FBNA 3PY3A 2WMRA 3PFQA 5L2WA 1QCFA 4IAFA 4EUTA 3OUKA 4FI1A 3NUSA 4USFA 1VEBA 4F99A 4KUJA 5KBRA 2R3MA 3PE2A 2UVXA 3CLYA 5CXZA 3IGGA 3MY0A 3Q9YA 4FKPA 2GPHA 1JQHA 1WFCA 2WEIA 5L2SA 4L43A 4KKHA 5K0XA 3P5KA 3HECA 3SOCA 4DLJA 3UNZA 2JDTA 1PXMA 4KIPA 4L67A 4MXYA 4AA5A 1VR2A 2XB7A 2IVUA 4AA0A 3JPVA 3ALNA 3QGYA 4BDIA 3QD0A 2ZMCA 4ID7A 2QI8A 3K2LA 3PIYA 4DBXA 3POZA 1IG1A 2DYLA 4YLKA 3T8OA 4U7ZA 3FMEA 4FE2A 3A99A 5CU6A 4HPTE 4I5PA 5HOAA 4ZJJA 2VTMA 2PTKA 4AGCA 4FT9A 3TUBA 1QPJA 2HZIA 2YM4A 3QZIA 1Q3DA 3DFAA 4G9RA 2WMBA 5KHWA 1UU3A 5LMBA 4FNYA 3FEGA 5AAEA 4TW9A 4O7ZA 2W5BA 2WMSA 4QO9A 3OTVA 4B0GA 4F70A 4RX5A 3HAMA 3BYSA 1YI3A 4AGWA 1LR4A 4ASDA 3F3VA 5HD4A 2W4KA 3PG3A 5E8UA 1FVTA 5AUWA 4EJ7A 2ITVA 4DGNA 1ZYCA 4I5HA 1H1WA 3NW6A 1PMEA 3HA8A 3VF8A 2OBJA 2YLFA 3R04A 2XVDA 4FEUA 5JRQA 4IVAA 4EKLA 4K33A 2GNJA 2W9ZB 3VVHA 4J8MA 4C4HA 5CEOA 5C8NA 2Z7LA 5IQEA 5HO8A 2ZJWA 4L53A 4GU6A 4UBAA 5AV1A 4X6QC 2JGZA 3FI3A 3NCZA 3RZFA 4FTRA 4AG8A 2X7OA 4AZWA 4NKAA 4RJ3A 2XZSA 3KFAA 3FMLA 1TQMA 1SVHA 3NVMB 4C3PA 1YXXA 1MRUA 5HIEA 4F7NA 1L8TA 2R3PA 4TKSA 3F5GA 4D2WA 1TKIA 1Q24A 3KRWA 3V8TA 5ANJA 3JUHA 3U8WA 5BQ0A 1H07A 2XBJA 2ZMDA 3GU5A 3QKMA 3CBLA 3UC3A 4ZLOA 2HCKA 5BVEA 4AE9A 3KCFA 3UIBA 3FL4A 2HY0A 3UGCA 3MA6A 1Y8GA 5FTOA 2Y4PA 5AIRA 1GJOA 1V1KA 2OO8X 3Q4UA 3F2NA 2C6LA 3AMYA 1OL6A 1U59A 2ETRA 4E93A 2GQRA 3F2AA 4QYGA 2RKUA 5B0XA 3CKXA 2W99B 2W1DA 3ORIA 3TNPC 5H3QA 4MXZA 2WNTA 4O0XA 1JNKA 3ZM4A 4F7SA 3COHA 3O17A 1WBSA 1OPKA 3EN7A 3QQKA 2PY3A 3HMPA 3AT4A 3TI1A 4DFNA 4K6ZA 4MX9A 4E5AX 3VJNA 4JT3A 3W18A 4YLLA 2ITNA 2XNOA 4Z9LA 3TKHA 4ERKA 2XM9A 3PRFA 4JIKA 4QP4A 2P55A 5HQ0A 3G33A 4BL1A 2QLQA 5AMNA 2LAVA 4AS0A 3OOGA 2WTCA 3RTPA 4ACHA 2KULA 3MVLA 2BDWA 3MTLA 2G2IA 5CAOA 4OGRA 2GFSA 4EWHA 5J7HA 3PY1A 4CCUA 4MNEB 4U45A 3LJ2A 4L7FA 3V5JA 4BBEA 3OCSA 2C5OA 3BBTB 4IWOA 5HX8A 4MD8E 2ITUA 2ZV2A 1HCKA 4GIHA 3UZTA 5JGAA 3VUIA 5KMLA 1T45A 2WXVA 3H30A 3RPOA 3L9NA 3FY2A 4JNWA 4X2JA 3ZSIA 3HV4A 3QYZA 4RLLA 3RCDA 3EQFA 5IDNA 3QLFA 5CEPA 5CF6A 3HMIA 1W8CA 3DNDA 4EH3A 3R9RA 3A61A 3BKBA 2VTAA 4M8TA 3LJ1A 3EB0A 3EFWA 3I7BA 4UMPA 3D15A 3PVGA 2I7QA 2UW9A 5IDPA 1E9HA 4RJ7A 4C4IA 3ID6C 2IO6A 4NL0A 1Q99A 4MVFA 3TN8A 4QYHA 4RC4A 1Q5KA 2ITTA 3Q6WA 1SVGA 3F3WA 1OUYA 5L2TA 1ZARA 2QKRA 3FI8A 4EWQA 3TKIA 5H8GA 4D4YA 2XIYA 4ZIMA 3UO6A 5KHXA 3PLAE 5AUUA 3BLHA 1ZOGA 1ZMUA 4BICA 3K5UA 3BE9A 4USDA 4KBKA 4C38A 3VS2A 5HORA 2XIRA 4YC6A 2PYWA 5FUTA 4H1JA 4IVBA 3EWHA 3FL5A 2X7GA 3MVHA 4FTNA 4XV1A 2JBPA 2F2CB 4JDHA 4U44A 3P1AA 4QYFA 3P23A 4Z3VA 1V0BA 4LYNA 3NUUA 5HVYA 3DPKA 4YZNA 1XH5A 2P0CA 4W4WA 3LFFA 2Z02A 1H08A 4ZLZA 3RWQA 2JDVA 5LMKA 1H28A 2GTNA 5LVNA 1OECA 5C9CA 3Q9WA 5HG8A 3PG1A 3PJCA 3LXNA 3QCSA 3F5XA 4FIEA 4DFZE 2VWXA 4C8BA 3KMWA 4MK0A 5CALA 3E8CA 3DCVA 3HZTA 2PZIA 5HG5A 4ASEA 4TY1A 3BELA 3QHRA 4NCTC 3D2IA 3U4UA 4DGOA 4IH8A 4H05A 4YHFA 2VWVA 4C02A 3KXMA 3NR9A 5HICA 2W9FB 4FICA 4JL9A 4RA4A 4EHGA 3TZMA 4D0WA 5AP4A 5L4QA 3TZ8A 5IUGA 3KULB 4FV6A 2HWPA 4O6EA 1AQ1A 1JPAA 3C9WA 3QA8A 3U9NA 3CY2A 3EQDA 4G3EA 3ULZA 4AZEA 5CEKA 3KVXA 4CYIA 4ZZNA 5EHYA 3EMGA 3ZO3A 3DBEA 4AOIA 4F64A 4BDAA 5I9XA 3GQLA 3OC1A 3EQHA 4L9IA 2R3OA 5IH6A 3P86A 2QOOA 1UWJA 3QTXA 3Q4CA 2P2IA 4RWJA 5I9WA 4UYNA 2QOBA 2UZWE 3Q3BA 2R3JA 1MRVA 4C4GA 4GT5A 3HV7A 3PY0A 4PX6A 2VWZA 2BHHA 3GOPA 5CF8A 1Y91A 1ATPE 3TV6A 4DGGA 3E88A 2OXYA 3ZEPA 4GRBA 5HBJA 4HZRA 2QOHA 2YISA 2R0UA 5A4LA 5FXSA 3N9XA 4JBVA 3GU8A 1VYWA 2GNIA 3TNIA 4FV4A 2WU7A 1OL7A 5KMIA 5LVLA 3NUXA 4O6LA 1OPJA 2VTTA 3R1NA 5ANKA 3O51A 2FGIA 4YURA 3PE1A 2LGCA 3CY3A 5E9EA 4RQKA 3ZC5A 4QMVA 4G34A 2ESMA 2OJ9A 2VO6A 4FT7A 4PPCA 4S30A 1Y57A 5HIDA 1J3HA 3EQPA 3LJ0A 5HVJA 3FMDA 1S9IA 4GG5A 5DOSA 3VC4A 2VNWA 3AD6A 5D7VA 4BDFA 5CYIA 1W0XC 1Q62A 2V62A 1ZOHA 4IX6A 4JDJA 4F0GA 1WBOA 4F6UA 5M56A 5HLPA 4G31A 1PXNA 4C36A 5JH6A 2OZAB 5HU3A 4NTTA 4PPAA 3QQJA 1OUKA 2YM3A 3QZHA 2BRHA 3MBLA 2BRGA 4AGDA 4QT1A 4AGUA 4GVAA 3FQSA 5IQHA 3LXPA 3M2WA 2O65A 4U9AA 3UODA 4DBNA 5ACBC 1XH6A 3C13A 4RT7A 3R8ZA 3RAIA 1XH7A 2OK1A 4DH3A 2B54A 4CRSA 1I09A 3NW5A 4CFXA 2HW6A 4FKLA 3W2OA 5I9VA 5HG9A 5IUIA 4R7HA 2J51A 2OWBA 3TNHA 5CU4A 3OHTA 2JEDA 4M0ZA 4E3CA 1J7IA 4JJRA 4ZY5A 2GNFA 2FO0A 2QO7A 2W17A 3DA6A 3KC3A 3BHHA 3IDCA 3MS9A 3Q32A 4O0SA 5AR7A 3FUPA 4D2TA 3GCVA 4EH2A 3FYJX 4ZZMA 1HCLA 4N6ZA 4EH6A 2E9PA 2XRWA 4X2NA 3ZOSA 1KV1A 2UW0A 3BQRA 4A9RA 1YRPA 2YCSA 4O0YA 2E9UA 5DRDA 3UJGA 5IQIA 3OS3A 2R3HA 4CKJA 2VTQA 1B38A 5JFSA 4N4SA 3FPQA 4FT5A 2WD1A 3VF9A 2XYUA 1RDQE 4IVDA 2C0OA 3R0TA 3QTWA 4WUAA 3FMJA 3QTUA 4J97A 3SX9A 3T3VA 4D9UA 2GSFA 2FSOX 3V5WA 2ZYBA 3EQCA 4I94A 3BI6A 4FOCA 2WMUA 2JFMA 3RNYA 4R7BA 1ZYLA 3TACA 4YPSA 3CIKA 5C27A 4UALA 3F3UA 3EKNA 4RFYA 3D5UA 4AZFA 4BDHA 1MRYA 1T46A 4FF8A 3NMUF 2XK6A 2C47A 3NS9A 2PVRA 2R2PA 2BRBA 3C5UA 4Q9ZA 4M0YA 5I5ZA 4I20A 4PV0A 5DT3A 5M4CA 3ZYAA 3DK3A 2YDIA 4HCTA 4JQ8A 5AM6A 3OT3A 1G5SA 4WRSA 5IH5A 3FYKX 4D5KA 4PP9A 5JGBA 3UNKA 2IJMA 2J0LA 3NX8A 4FSNA 3MPMA 1BL7A 1M17A 3EQIA 2WO6A 3HX4A 5DR6A 3PPKA 2X4ZA 2R3FA 4FKIA 4Z7HA 3L9PA 3IK3A 2BDFA 4YTHA 1RW8A 3E62A 4IX3A 5LWNA 2OJIA 1PMVA 2UZUE 2OGVA 4JBOA 4RZWA 4FNWA 4CMOA 3GU6A 4G17A 3VNTA 4CTCA 3R83A 1W7HA 4FVRA 4UWCA 4JRNA 3AD4A 3HV6A 2XCHA 3O7LD 4DITA 4WKQA 2ZVAA 3LCDA 2YN8A 1YHVA 1YDRE 4QP9A 3NIZA 2YM8A 1WVYA 1OI9A 3RAKA 2J2IB 2DQ7X 3MPAA 1YOMA 4L45A 5JEBA 4ZXTA 4HVGA 1CKPA 3M1SA 2VD5A 2OJGA 4QNAA 4TTHB 4AFEA 4BTMA 3HMMA 5M08A 3SLSA 3UP7A 4BI1A 5ETIA 3QX2A 1O6YA 4IWQA 3ODYX 5T68A 2UZEA 4RG0A 3HRBA 2R3KA 2ONLC 2W1CA 3O71A 4GYIA 2QONA 4FTMA 4YJOA 3WE8A 3JR1A 4W4VA 3PXRA 4XHKB 2ETMA 4FTCA 4O91A 4BCPA 3DU8A 4MH7A 1FGKA 2F49A 4NIFB 3C5IA 5F94A 3KN6A 4EBVA 5HESA 4X6RA 4EOSA 3U6JA 1Z9XA 3UIMA 2UV2A 3A7FA 5BPYA 2H34A 5IEYA 3UYTA 1PXKA 1DI8A 4MBLA 4LV5A 5BMSA 3NZ0A 4PMPA 3GQIA 4BDEA 4YGAA 5H2UA 3ZBFA 3ZXTA 5AUTA 2HENA 4G5JA 4X3FA 4MQ1A 3GGFA 3UZPA 2PUIA 3BGPA 2Y6MA 2FB8A 3LVPA 2XNMA 2Z60A 3G2FA 1S9JA 3NAYA 3R00A 3SV0A 3P79A 3A7JA 4ITHA 4WG3A 4IQ6A 4AOJA 5DG5A 1WAKA 4QQCA 5I9ZA 4NW5A 3MPTA 4I93A 5HI2A 3SW7A 3BIZA 1NVRA 2BZIB 4F9YA 1YXTA 4FIIA 2G15A 5EK7A 4EOIA 3JY9A 4JX3A 3VBXA 5EQEA 4RIOA 4F08A 2QR7A 2PMOX 2IG7A 1GAGA 2J50A 5AA9A 2WQNA 4EK6A 3FQHA 2QURA 2GQSA 2Y7JA 4S31A 3W1FA 2XUUA 5EM8A 5AR4A 4APCA 3C51A 4FZ6A 3WF9A 2WIPA 2YM6A 5JFVA 3VUHA 3HKOA 3D2KA 4HYUA 5FTGA 3R9DA 4ZTLA 3ZMMA 5CU2A 5B2MA 5C4LA 4RJ6A 3FLSA 4P7EA 3ORMA 4EHZA 1STCE 3VBVA 1OZ1A 2H9VA 4ANSA 4DAWA 5L8KA 3BGZA 2Y8OA 1PHKA 4QMZA 5L6PA 4NIFA 1IRKA 2XK7A 4I1ZA 1YDTE 3ZSHA 4L8MA 2RFEA 4QMYA 4FGRA 4HYHA 4LGHA 3TNQB 4A07A 3IQ7A 3QRIA 3L9MA 3PIZA 3PWYA 1RQQA 2X8EA 3GC7A 3QRJA 3QTSA 5T3QA 4J71A 4QYEA 3ODZX 2WGJA 3H4JA 1LEZA 2ITPA 3LE6A 4O0TA 5TKDA 4AQCA 4DFYA 4EKKA 3LPBA 5FG8A 2R3LA 2VWIA 3NGAA 4XBRA 5DBXA 4I6FA 3C4ZA 1XBBA 4E5WA 4AAAA 5DE2A 2CLQA 3MSSA 4TYJA 4LV8A 3S00A 4BY9E 3A2CA 1M14A 4CFVA 2XNPA 2X6EA 3ZLSA 2C6KA 2OIDA 3DK7A 4YTCA 3C4EA 4GJ3A 3WIGA 3N4TA 4ZSLA 4I23A 5I9YA 4ZY6A 1H26A 5A4CA 3JY0A 2JBOA 3GVUA 3CGFA 4RX9A 3JXWA 4KA3A 1URCA 4A06A 3FV8A 4EQCA 4RC3A 4EBWA 4QMMA 2HZNA 4RGJA 3OY3A 5D9HA 5KKRC 1O6LA 5EOLA 5FWKK 3V8WA 5ANGA 1DAYA 4IW0A 4RJ5A 4YLJA 4MF0A 4ASZA 4EQMA 3HRFA 1XBCA 5KNJA 3VS1A 2WIHA 2BZHB 4WNOA 3FE3A 3F6XA 1IAHA 1BUHA 3R2BA 4S33A 1FMKA 3ZTXA 2OIBA 3R7GA 2YDKA 2JITA 5C4KA 4FKVA 4MXOA 4YSJA 4IIRA 5CU0A 3TDVA 4EK8A 2VV9A 3C50A 2B9JA 3R63A 3FHRA 4PF4A 1Q3WA 3DZQA 3LFDA 4QD6A 3S0OA 2PPQA 4S32A 2XYNA 4FIFA 2WU6A 2YEXA 5AP1A 1I44A 3PDTA 2ACXA 4M3QA 4O7NA 3I60A 1P4FA 4KINA 4DGLC 3R73A 2XK4A 5CSWA 4NKSA 4IB5A 3H9RA 3ANRA 4UZHA 3PXFA 2Z8CA 4CEGA 1BI7A 3LCTA 2VN9A 3OW4A 5EYCA 3QC9A 5C01A 3EH9A 2OF2A 4HCUA 3LQ8A 2YJRA 3LFSA 4DGMA 1F0QA 3MIYA 3OF0A 5D11A 3HV5A 2BDJA 3WI6A 3FC2A 4EOMA 3FWQA 5EW3A 2JD5A 4CQGA 2VTLA 4YZCA 5G1XA 5JSMA 2GCDA 2XKEA 2GNGA 3EIDA 2ETKA 3DXPA 1R3CA 3U54A 3GU4A 3I5NA 3O8TA 2AUHA 3BYMA 4ALUA 4LG4A 5DHJA 4PY1A 3QQUA 5CF4A 5EI8A 5AUVA 1XKKA 3HGKA 3D7TA 2FA2A 5IG1A 5BYLA 1ERKA 2RGPA 2CN8A 4XV2A 2O0UA 4JDIA 5M44A 2XM8A 2PUUA 3NNWA 3HEGA 2A2AA 2YCFA 2EB2A 2C0IA 2Y4IC 4XUFA 4D1SA 5IF1A 2BKKA 1GOLA 2J0JA 2OG8A 4DH7A 4QP3A 3JYAA 1UNGA 3QL8A 4ACDA 1OKZA 2R3QA 3FZ1A 3MB6A 3CPBA 4RIYB 5D12A 2OFUA 3E8DA 2CCHA 4HZSA 4MXCA 4Y73A 4DYMA 5C1QB 3VUMA 1W98A 2JKMA 2YCQA 2YIYA 2VX1A 3IW7A 2V0DA 2W06A 3PIXA 3ATSA 4OTWA 2B9HA 3N4VA 3C1XA 3QKKA 5ACKA 1ND4A 4Y85A 1JLUE 4M15A 1DM2A 2JAMA 2ZDUA 4MBIA 2PVHA 2XNEA 3MFUA 4RIXA 5ANIA 3ZDUA 3IECA 4HOKA 2A1AB 2YDJA 3JVRA 4LMUA 3ALOA 3KKVA 3OROA 3FAAA 3G6HA 1LEWA 4FKTA 1W83A 1YDSE 4GK3A 4YJUA 3QUEA 3SG9A 3KRRA 5DA3A 4C2VA 5CQUA 2ITYA 1FOTA 4RZVA 5ETFA 4BDKA 1H8FA 3PSDA 1SMHA 1XO2B 4TYIA 3R9OA 3FXXA 4J99A 4DEEA 4O7VA 2JIUA 3GUBA 1G8AA 2VTJA 3DV3A 3ZO1A 2YABA 4P5ZA 2W05A 4QMWA 3R7YA 4ITJA 4BVUA 4ZEGA 1SZMA 3THBA 5JN2A 5KMKA 1ZMWA 3N4UA 2CKOA 1KE8A 1PKDA 3EYGA 3R7UA 2WMWA 4FK3A 4EZ3A 4F0IA 3P0MA 4AT4A 3QTIA 3HMNA 4FL2A 5A9UA 1Y6AA 2UZDA 3TIZA 2JDOA 3R21A 3NW7A 3K54A 5HTCA 4NFNA 4KKGA 2DWBA 1WVWA 2V7OA 3A62A 3E7OA 3H0YA 4M68A 3MY1A 4HVHA 3GC9A 3OG7A 3RPRA 4JIAA 3AC2A 2RFSA 3DXQA 3AMBA 2IVSA 3HRCA 3HUCA 1AGWA 5CVHA 5FP6A 5CAPA 4OAVB 4ZSEA 4K1BA 1H1QA 3ZS5A 3QTRA 5IQAA 4YZDA 3PSCA 4F9WA 5A4EA 1KE7A 2UW5A 3NYXA 4PTCA 4UEUA 3FC1X 4N6YA 4GJ2A 5A4TA 2F7XE 3NWWA 4E26A 3MI9A 3FMHA 5F9EA 3RHKA 4CZTA 2W96B 2VAGA 2J6MA 2H96A 3ENMA 3NUYA 3HVCA 2Z7QA 4G2FA 4BCKA 4O7YA 2O2UA 4GKIA 2A4LA 3G0FA 3H0ZA 3LQ5A 3IW6A 4JBPA 4JDKA 4IZAA 1GIJA 1P14A 4RFZA 4AT5A 3G0EA 5IQCA 2EWAA 5CENA 1W82A 4PWNA 4EZ5A 3OD6X 4AZVA 4GMYA 4F1OA 3TEIA 5AA8A 3E87A 4IANA 2HELA 3UC4A 3EFLA 2X6DA 4C3RA 4HVIA 4BCHA 3OZ6A 2O63A 4R77A 3VS0A 4BZNA 4DEHA 3I0OA 3QZFA 3R01A 1OB3A 1BL6A 3F69A 4QNYA 2B55A 1DI9A 4AT3A 1JWHA 5L6OA 3JS2A 1OL1A 4BDBA 4XLVA 1REJA 2C68A 4RJ4A 3Q5IA 1APME 4IHPA 4O22A 4KBCA 5ANOA 3QBNA 4HGTA 2F4JA 4M14A 2PE2A 4J96A 4JAIA 4Y8DA 2IVVA 2PMNX 1PXLA 5CT0A 2RL5A 5JT2A 5IU2A 2X7FA 5M51A 4HGLA 5AADA 3QTZA 1OMWA 5JQ5A 2YIRA 4JQ7A 3OCBA 3PJ8A 4CYJA 4DFUA 4FV7A 3I6UA 1B39A 3DB8A 3DJ7A 4KS8A 5FXRA 3O0GA 5M09A 3HP2A 4J53A 5B2KA 1DS5A 5HNBA 4CVAA 4ACCA 5I3OA 1Q61A 4CTBA 3LAUA 3AXWA 3P7AA 3CKWA 4M69B 5EHOA 3MGYA 4BYIA 4R1VA 4D5HA 2I6LA 2IW6A 4BWXA 5LXMA 2HZ4A 3HDMA 5IKWA 4GK4A 4CD0A 3DBDA 1KE6A 3RVGA 3GCQA 4UN0C 2BKZA 4DH1A 3H9OA 4WG5A 2WQEA 3ANQA 1QL6A 2PULA 1O9UA 4FKJA 4W9WA 4WBBB 5EH0A 4R1YA 3KRXA 2OIQA 2X81A 4B6LA 4PDYA 3DAJA 3RPVA 4XG2A 3CXWA 3NNUA 3UE4A 5IMEA 2GS2A 4IZYA 1R0EA 2GFCA 4EH8A 5IA2A 1PKGA 1PY5A 2GS6A 4I0TA 3QZGA 4BCOA 2ZM3A 5KMJA 5M4FA 2ZM4A 4QRCA 5TE0A 4FG7A 3UQFA 2Z2WA 4OW8A 3K3JA 3MFSA 4L3PA 3PTGA 4LRJA 5KZIA 2BIYA 4DEIA 4IACA 4IAIA 4CFUA 2FSMX 1ZRZA 2VU3A 4KABA 4FUYA 3IGOA 3G51A 5GJFA 5EI6A 3VUDA 3AQVA 3CJGA 3RM7A 2JKQA 4G6LA 4MBJA 3COMA 1MQ4A 1PYXA 3FBVA 4OTIA 4PL3A 5F20A 5KMNA 3WBLA 3MB7A 2NP8A 3R8MA 2PVKA 4D1XA 4U3ZA 4DTKA 1IEPA 2PVNA 3GP0A 2J5EA 2YM5A 3MIAA 5M4UA 3HP5A 4UMTA 4U42A 3OEFX 4F9CA 2XIZA 3AC1A 2YIQA 5M53A 4ANOA 4BCIA 3SXSA 2G1TA 1H27A 4WG4A 4EI4A 1V0OA 5CEQA 1GIIA 4OTDA 4RFMA 4ANQA 3IOKA 4YO4A 4YTFA 3Q5ZA 4FTIA 2CN5A 5M55A 4FBXA 3P7BA 4XYFA 5KX8A 1R1WA 2XBAA 4M69A 3T3UA 3MWUA 4QMNA 2C5NA 3L8XA 5FEEA 3KY2A 4O7WA 3PWDA 4FV5A 4AU8A 3L8PA 3SG8A 2Q0BA 3ZM9A 2WTWA 2ZV7A 4FV2A 4XCUA 1PXOA 3GEQA 3KXHA 4R3PA 5D10A 4FSTA 3E8NA 4HYIA 4EL9A 1NW1A 3MFRA 3ET7A 3Q53A 1UKIA 4I4EA 2BRNA 4QTCA 4CXAA 3V01A 5DMZA 4RVLA 4YR8A 4APPA 3GCSA 3MVMA 4LRMA 5E8VA 2C0TA 1M2QA 3D7ZA 2VNYA 5AR8A 3LCSA 2OU7A 4HPUE 4CSVA 4U6RA 3I79A 4CT1A 2IZTA 3H3CA 2ZM1A 4QPMA 3MV5A 4R5YA 4BBFA 2VWWA 5HX6A 3V6RA 2ITOA 2JDRA 2ZB0A 4MNEA 2R7IA 4WSQA 5ICPA 3GCUA 2C6TA 2WAJA 3T9IA 4F65A 4EZ7A 4UYAA 4TNDA 2OF4A 3BHUA 3OUNB 4IZ7A 1BLXA 1H1SA 4IAAA 4PL4A 3ROYA 5GJGA 4E4MA 3VBQA 1PF8A 4C57A 1Q8TA 5DT4A 5GZ9A 3SVVA 3MN3A 2YZAA 1A48A 4EK5A 1GZKA 4FKGA 3OXZA 2UW4A 3KVWA 2G2HA 4XG6A 1WZYA 4FYNA 4DHFA 1LPUA 4AN9A 3WOWA 2QHNA 4FYOA 5DYJA 4GU9A 5AUYA 3B8RA 4C61A 3NPCA 2QKWB 4XRLA 3D83A 2CGXA 4RX7A 3WARA 2NO3A 4JXFA 2XKFA 2HAKA 4XBUA 1XH8A 4X2GA 3MW1A 3VW8A 4KBAA 4MKCA 3LW0A 5HZNA 3KU2A 4X2FA 3O23A 3DBQA 4W9XA 3EFKA 2HW7A 2VTPA 4BTJA 5KZ0A 3VS7A 1UNHA 2A19B 3CS9A 4NEUA 5A6OA 3MH0A 4EEVA 1WBWA 5M06A 3KK9A 3ZO2A 5KKRB 5AAGA 4O0WA 4Y95A 2BFXA 3WYYA 1YXVA 3IO7A 3CQEA 4YHTA 3MY5A 4TZRA 2XK9A 4G3FA 4A9TA 2EB3A 4MNFA 5J95A 5BYZA 5GZAA 3DKOA 4PP7A 4I6BA 5J5TA 4YJPA 3QC4A 1X8BA 3Q60A 3I4BA 1IR3A 1CM8A 2XIXA 2QD9A 3VS6A 2JFLA 3RK7A 4L7SA 4AN2A 4UX9A 3KXGA 2A27A 4IXPA 5I4NA 5AUZA 5FP5A 2VZ6A 5K5NA 3QD4A 3LM5A 4YMJA 2QC6A 4UZDA 1CTPE 1KE5A 5FBNC 4E5BA 3V5PA 3BHYA 1REKA 2VWYA 3R7EA 2UZOA 2WTKB 3QQFA 2HWOA 3KRJA 3Q4ZA 5CY3A 4ONAA 3ORXA 3KULA 4O2PA 1J7UA 2HIWA 3L8SA 4NM5A 3LFBA 5DEWA 5AR5A 5C8MA 4AACA 4O1PA 3CSVA 1WMKA 4FSRA 3A60A 5EDQA 2ZV9A 5HG7A 4QMLA 3GENA 4C62A 3CD3A 4E4LA 4EK4A 2XF0A 5TR6A 3AC8A 4U43A 3F82A 3LMGA 2BMCA 5E4HA 3GCPA 3MVJA 3F3ZA 4FTAA 3KEXA 4UY9A 3TTJA 1UU7A 2BTSA 4CLJA 2GTMA 5HCXA 5BVKA 3CP9A 3F7ZA 3C4CA 4I21A 2UZNA 3RJCA 4BYJA 2C3LA 1CKJA 3VBTA 4ANBA 3GFEA 3KXXA 3QKLA 4M97A 4ZJIA 4BKZA 1BI8A 4BIEA 4NM0A 3RP9A 4RIWB 3PJ1A 4H3BA 1YVJA 3DKGA 4A9UA 4BZOA 2W5HA 3PJ2A 4G1WA 5AFVA 4DA5A 2Y4IB 1QMZA 5I9UA 5K3YA 3G90X 2ITXA 3R1YA 4BGQA 4NK9A 4FEXA 1J1BA 2EUFB 2WMTA 3OW3A 5DGZA 3WE4A 3UOJA 4L3JA 3QALE 3RAWA 4JX7A 4QTDA 3AC3A 4DG0E 1YQJA 3OOMA 3TM0A 2O3PA 5FM2A 4U0IA 3S95A 3LZBA 3DKFA 4ZSAA 1KSWA 4C4JA 5HTIA 3QCYA 2R3NA 5GJDA 3QD3A 3QF9A 4L44A 5J87A 5AP0A 4JS8A 1GZ8A 4PNIA 5BVDA 2IPXA 2OZAA 4DG3E 2W5AA 3ENHA 2EXCX 3OTUA 2P4IA 4J7BA 3ZUUA 4EOOA 5HBEA 4ENYA 2UZVA 3ZC6A 1U54B 4WNPA 1RE8A 4FSYA 3OWKA 2VGOA 5ETCA 4D58A 2V5QA 3QCXA 1Y8YA 5IA5A 4FG8A 3OBGA 4W8EA 4L68A 2XCKA 5AV2A 3HLLA 2WPAA 5E8WA 3VRZA 5EKNA 3VUKA 3BRBA 5BVFA 4CFMA 4O21A 2UZBA 4D28A 3BBWA 4UXLA 1Y6BA 4ANNA 2BTRA 4E4XA 4QTEA 4R6VA 5BUJA 3N51A 2IZUA 4ANLA 2VWUA 5HBHA 4HW7A 1KOBA 2WZJA 5FEDA 2WEVA 2VO7A 2V7AA 2XNNA 3CTQA 5HEZA 3A7IA 3CQUA 4RRVA 2ZOQA 5LJJA 1YHSA 1M2PA 4ANMA 4PRJA 4V0GB 5G6VA 1XR1A 3F66A 2P2HA 2QU5A 2JKKA 3P78A 4TNBA 2FH9A 3UBDA 5IZFA 2CJMA 4YSMA 4QQ5A 4CV9A 3VIDA 4OTRA 2X0GA 2JDSA 2WB8A 3LM0A 5ANDA 3TZ7A 3FLYA 5IH4A 3TUDA 1OKVA 3FHIA 4EYMA 5M57A 4TN6A 3KQ7A 3PYYA 5HGIA 4GKHA 4EOJA 5H9BA 2W4JA 4ZY4A 5H8EA 2FSLX 4KD1A 2UW8A 3ZEWA 4K0YA 2UUEA 1WCCA 4II5A 5I3RA 1K9AA 2XJ2A 3MH1A 3OT8A 3Q6UA 4FKWA 3TKUA 2I40A 4D4VA 2QG7A 1YWNA 3QUDA 5HNIX 2C1BA 5L3AA 2WTVA 2WELA 3H9FA 4IAKA 3W2RA 5A4QA 3TDWA 4WNKA 1PMUA 4TYGA 4ORKA 3VW6A 5LMKC 4L42A 5CEIA 3W2SA 4E6QA 4CLIA 3BPRA 2I0EA 4J8NA 4ENXA 1CDKA 3PPZA 4F9BA 4LGDA 2X2MA 4FVQA 2ZB1A 3R1SA 4YC8A 1E1XA 5EYMA 3NVKI 3DY7A 3BYOA 4CRLA 1VZOA 2OSCA 4QPAA 4GIIA 4A9YA 4C7TA 3UVPA 2RIOA 4YZBA 1H0VA 2Y9QA 3U87A 1PJKA 5AM7A 3CD8A 4ZS4A 4IX5A 5AAFA 3EZVA 3HAVA 5CSXA 4V01A 3EL7A 4NTSA 5EG3A 5BYYA 3ZCLA 1U5RA 3IDBA 3MESA 3RZBA 2WQOA 4FKSA 1H4LA 4Y46A 3ROCA 2YIXA 1ZZ2A 4V04A 4FZ7A 3PUPA 4FSWA 4U97A 3QQHA 5J1VA 2W1EA 4LQMA 4K18A 3RPYA 5AJQA 5CWZA 3R30A 5J5SA 2H6DA 3IOPA 2G2FA 3LXKA 3ORLA 4IDVA 1PW2A 4EYJA 3SA0A 3B2WA 4V05A 3V6SA 1OVEA 5TF9A 4I0RA 1XQZA 4G5PA 3SQQA 4GV1A 4XOZA 4WIHA 4YJRA 3BEAA 5CAUA 2QO2A 5AP2A 3LQ3A 2C4GA 3RHXA 4N0SA 4ASXA 2W0JA 3A7GA 2OXDA 1M52A 4OBOA 4A9SA 4KWPA 5AIKA 1JKLA 5HE1A 3BU3A 1UV5A 3D0EA 3BYUA 2QCSA 4GCJA 2VX0A 3LMIA 2C6MA 4BCGA 4O7TA 3ZRMA 2XNBA 3A7HA 2I0YA 5LCKA 5I0BA 3D9VA 4MQ2A 1NXKA 1ZXEA 4FA2A 4GH2A 3FXWA 4CFFA 5IQBA 4FSQA 2XK8A 4TWNA 4D55A 4OBQA 3C0IA 4O38A 4YJTA 2O5KA 5HKMA 4ZTRA 4FL1A 3NUNA 4LM5A 5LARA 4NJ3A 1J7LA 2C3IB 4N57A 3EN5A 1H24A 2C5VA 2UW3A 3EN6A 3U9CA 4E1ZA 2SRCA 4ALVA 3TUCA 3WZEA 3LFQA 2WTDA 4PMTA 3VN9A 2F7EE 3VS4A 4IWPA 3GC0A 3SRVB 1W84A 4RBLA 1P2AA 4EOKA 3V5QA 3HL7A 4BC6A 1NVQA 5TOZA 2X8IA 3E3BX 3VBWA 2GU8A 4FIHA 4E6CA 2PMLX 2BUJA 2BPMA 2R7BA 4EH4A 4IE9A 4PPBA 4XOYA 5CU3A 2PU8A 3RALA 3ZO4A 4ITIA 4BDJA 1F5QA 2FYSA 2WMXA 4H3PA 5CF5A 4CG9A 4PDSA 2X9EA 3FKLA 3V04A 4A4XA 1A9UA 3RINA 4XLIA 2YERA 4QQTA 3V3VA 2A0CX 3U51A 3NRMA 2PUNA 1Q4LA 3OWPA 2R64A 4JLCA 4PQNA 5FM3A 5JKGA 1U5QA 4BWPA 4DE4A 4OTFA 4CQEA 1U4DA 2H8HA 3GBZA 3DJ5A 3ACKA 3FKNA 3ZFMA 2QOFA 5DVRA 3LFCA 4AW5A 5TT7A 2IW9A 5HVKA 4ZJVA 4CGAA 4NU1A 3UPXA 1H0WA 3PPJA 3EQRA 3C7QA 4P2KA 5FEQA 4MCVA 5H8BA 4EHEA 2OW3A 3C0GA 4M7IA 3EYHA 4RWIA 4X21A 1YW2A 2VWBA 4WNMA 3DOGA 2BR1A 3EQBA 4FSZA 5CX9A 4XV3A 1JKSA 3W16A 5KMMA 5AWMA 3HDNA 5HCZA 4PTEA 2ITWA 2FVDA 1VJYA 4BCMA 3DDPA 4KS7A 4AF3A 5LQFA 4KKEA 3FSKA 1UU8A 4TXCA 3WZDA 2YWVA 3RI1A 3KMMA 5ETAA 4BDCA 4C4FA 3ETAA 1XHAA 2W1IA 4FSMA 1PYEA 2Z7RA 2B9FA 4IB1A 3SHEA 4O7LA 3RCJA 4OTGA 4LRKA 2XRUA 4RC2A 3PSBA 4QP1A 1CMKE 2XJ0A 3CPCA 4D2SA 4FKQA 3UOKA 3QXPA 2VUWA 2CNVA 3BHTA 3QD2B 4R7IA 3FLWA 2B9IA 2QOLA 3UDBA 1R39A 1YOLA 5CANA 5IQFA 3II5A 3Q04A 3WZJA 4CFNA 3R71A 1SNUA 2BILB 5CZIA 4DC2A 3FXZA 2HOGA 4NT4A 1Q97A 4XNEA 4MXXA 1BYGA 2X1NA 2WMVA 4O27B 3ORZA 2UVZA 5CAQA 3NSZA 3Q9XA 5E1EA 4JR7A 3ZFYA 3QRKA 3DS6A 3NAXA 4J52A 5HD7A 4E6AA 4QTBA 3R8PA 2WTJA 3VBYA 4OUCA 2WQBA 4LOQA 1GY3A 4U81A 4JG6A 4ZP5A 2C5XA 4GT3A 4DFBA 2AYPA 3ORTA 5EHLA 2QQ7A 5E8SA 4FTJA 2R3GA 4KRCA 4DEGA 4O81A 4ZTNA 4CKIA 3LIJA 4AUAA 4FTQA 1G8SA 4I22A 2XK3A 3IW5A 3OXIA 4EOQA 4DCEA 1KUTA 3ZLYA 2YITA 4PDOA 3I81A 3F7WA 3O50A 3EZRA 3WYXA 1JSTA 3R6XA 4RA5A 3QFVA 4MEDA 5HCYA 3UG1A 2B53A 4B8LA 3KK8A 3P7CA 4PDPA 4YNOA 3SDJA 1FQ1B 2QOKA 3PZHA 4FMQA 2YA9A 3BYVA 3HA6A 4FZAB 4Y83A 5DIAA 5L6WL 4QOXA 4B4LA 4C37A 2VTSA 1UU9A 1L3RE 3OY1A 4FV0A 4UXQA 2ITZA 3LCOA 1TVOA 3DZOA 4C0TA 4ZZOA 2YLEA 2R5TA 4ZS0A 2OICA 4YTIA 4O84A 4Y72A 4XG8A 4X3FC 4GFMA 1LUFA 1R78A 5FLFA 4ZAUA 5L2QA 1KE9A 5AR3A 4DH5A 3KB7A 5M4IA 4W8DA 5IUHA 4FC0A 5AP3A 1OIRA 4NW6A 4B99A 3KGAA 4PNKA 4ZTQA 2E9VA 5IA3A 2VX3A 3OP5A 2EU9A 3EFJA 5IA0A 2PSQA 3TL8A 4IADA 4NSTA 3TIYA 4C4EA 4O0VA 3PA4A 4XG9A 4D4SA 4ZLYA 4QMXA 2EXMA 3O8UA 4JRVA 4NCTA 2WHBA 3MJ2A 4JI9A 4WD5A 4HNFA 5CSVA 3NNXA 4F4PA 3NCGA 1ZY5A 3KXNA 5BVOA 4KIKB 4B7TA 2C6DA 3FZPA 3O2MA 2R3RA 4RSSA 4GEOA 4Q5HA 1GZOA 3OCTA 5JFXA 1NT2A 3C4WA 3NDMA 2CKQA 3BWJA 3E92A 5J8IA 4K9YA 3QCQA 4QMUA 3RGFA 3NNVA 3TNWA 5JK3A 3FY0A 2R0IA 3RM6A 5CT7A 4RIYA 3BEGA 5GIPE 4BCNA 3TJCA 4MD7E 3A4PA 3ORPA 3L9LA 3QQGA 4L00A 3D94A 1LP4A 4FNZA 4LGGA 4IM0A 4PMMA 1OITA 1YI6A 5GINE 4NUSA 5K0KA
chains in the Genus database with same CATH superfamily
4CKRA 1XH4A 2NRYA 3MFTA 1XWSA 4C59A 1K2PA 4F9AA 4FKUA 4FTKA 1V0PA 4KIQA 4JOAA 2C6EA 4BF2A 2CPKE 3ZUTA 5M07A 3KN5A 5KO1A 4FT0A 1WBTA 3PXKA 4BB4A 2Z7SA 4Z16A 1OIYA 3DJ6A 3FLQA 4IB3A 3PVUA 4GVJA 4D0XA 3VS3A 4IAZA 4GG7A 4AP7A 4FRFA 5HE0A 3OMVA 4BI2A 2JKOA 2PZPA 5DRBA 4CMUA 4ZTMA 4O0RA 4NWMA 4IDTA 2C6IA 2G9XA 3GC8A 3Q4TA 3ZONA 3C4FA 4F1TA 2RFNA 4H3QA 3UDSA 2QU6A 3BCEA 3FQEA 1GNGA 5LVOA 3P08A 2IN6A 3FLNC 4CV8A 1OL2A 5CASA 4DT8A 4O96A 2PVJA 3E8EA 3I1AA 3I5ZA 5TO8A 1WVXA 5GNKA 4F7LA 3NYOA 3EL8A 4RVKA 4BDDA 3BLQA 4LV7A 1SM2A 5AP6A 2J0MB 2O8YA 5GZ8A 2J7TA 3KRLA 3T9TA 2UZTA 3SOAA 2IWIA 4AW1A 1QPDA 3QRTA 2W7XA 3VQHA 4EH5A 5JFWA 3BHVA 3R9NA 3ZZWA 3IG7A 4KIKA 5AP7A 4AX8A 3TWJA 2VTOA 2ZV8A 4GSBA 4J98A 3VAPA 2IF8A 2X2KA 2OI4X 3D5VA 1WBVA 3R02A 4FTTA 4FZDB 4G6OA 4HCVA 2QNJA 2YM7A 3SAYA 4LI5A 3KXZA 1OIQA 3HMOA 4GW8A 4H39A 4DHIB 5KMOA 1NA7A 2ERKA 4YC3A 3UIXA 4DINA 5IPJA 4CT2A 3KREA 4MUQA 2IVTA 3A8XA 4G6NA 4G3GA 4UMQA 3UNJA 4UV0A 4Q2AA 3KF4A 3HNGA 5EI2A 4BWKA 3CJFA 3EKKA 1UNLA 4UWBA 3E5AA 5E91A 2OH0E 3AD5A 1JBPE 1QPCA 4DFLA 3AC4A 4FKOA 3BGQA 5AUXA 4GFOA 1OBGA 3COIA 2Q83A 3DNEA 1TQIA 3EJ1A 1J1CA 4XP0A 4A4LA 1B6CB 4IX4A 4JBQA 1Z5MA 3PRIA 2OLCA 2BZJA 4KRDA 4H1MA 5T6KA 3VULA 4QP2A 5CTPA 2PZRA 3NEWA 2IW8A 1ZMVA 4CFWA 3TV4A 1E1VA 5FQDC 3ZZEA 4EC8A 5J9LA 4ZMEA 2QG5A 4FEWA 3SGCA 2XEYA 5K5XA 1UA2A 4HGSA 4DFXE 3QWJA 3IDPA 5FRIA 3FJQE 3U6HA 5E1SA 2XP2A 3QQLA 4EH7A 3BE2A 1ZWSA 4FNXA 3G9LX 4FV9A 4U79A 5EM5A 3U4WA 5JRSA 1JAMA 2GNHA 4LUDA 4C3FA 3DT1A 3UOHA 4F1MA 3FZOA 3DAKA 4DTBA 2F7ZE 2YIWA 2CGUA 2ZDTA 3RMFA 4BKJA 1OBDA 2HZ0A 1YHWA 2XH5A 4EONA 2OKRA 4L3LA 3SW4A 3W8QA 3GB2A 3MTFA 5FXQA 5J7BA 2X2LA 4FIGA 3MA3A 2DUVA 2ZAZA 3LKMA 2VTIA 3Q96A 4YBKA 3LOKA 4QMTA 2CNUA 4BKYA 4YHJA 4IMYA 4GS6A 1UVRA 2X9FA 5EOBA 4CCBA 3S1HA 2CNQA 3FZSA 5JZJA 4FT3A 4MF1A 1KOAA 4RLKA 3G6GA 4RWKA 4MAOA 3ULIA 2PVMA 3WF6A 2VO0A 4XG7A 2YAKA 2WOTA 3WF7A 2B4SB 3DK6A 2OXXA 5HO7A 2EVAA 2PVFA 4AW2A 3IKAA 4DEAA 4XMOA 4I41A 1XJDA 4J95A 5F95A 4GT4A 3OWJA 4FODA 2B0QA 4AAYA 3PVBA 5DNRA 4F0FA 3DBCA 5C03A 4KSQA 4CZYB 5HE3A 1OL5A 4ERWA 4XP3A 5IA1A 4OAUC 3UMXA 2XEZA 2YJSA 1YOJA 3PLSA 4O7SA 2UW7A 3IW4A 3EQGA 2WMAA 2ONLA 4IFGA 4HGEA 4E8AA 1YWRA 2YZLA 4RMZA 2BIKB 3FZTA 3R8LA 1ZYJA 5LVMA 3ELJA 5EM6A 4QMQA 3WF8A 4M12A 5EW9A 5AV4A 5HU9A 5JQ8A 4QMSA 2XAMA 1IAJA 4AFJA 1SVEA 3UO4A 3VO3A 3VWAA 4LOPA 4GUBA 2C3KA 3SD0A 5HLNA 4IVCA 2VO3A 4GK2A 4F63A 5J1WA 4BR3A 3B8QA 3LXLA 5CNOA 4I6HA 4D4RA 3I7CA 3E7VA 2BFYA 4I92A 3FI2A 1EH4A 3ZLWA 1VYZA 3LFAA 4BTFA 3QAME 1PXIA 3AC5A 3QXOA 4FIJA 1Q8YA 4G9CA 4QEBA 5B7VA 3WZKA 2F9GA 2BROA 3W8LA 3UYSA 3EN4A 5IQGA 4TYHB 4ZOGA 4O0UA 2Y6OA 1MUOA 3PXZA 4QDEA 1OIUA 2YFXA 2BAJA 2B7AA 4O4BB 3V51A 4UMUA 2CKPA 5EDRA 5C26A 2BHEA 4CZUA 3POOA 4IBMA 1FVVA 4BIDA 2C1AA 2V22A 3FMMA 4OR5A 1HOWA 4O1OA 2Y0AA 2W1HA 4O4FA 4D2RA 4USEA 1M7NA 4HJOA 1P5EA 4XG3A 3CTJA 5DR9A 4KNBA 2XIKA 5CQWA 3LFEA 4FL3A 1NY3A 3Q2JA 5IEXA 4A4OA 3FI4A 4M66A 4YJSA 1PXPA 4BHZA 3OFMA 4K8AA 4ACMA 4EOLA 3VUTA 4MD9E 2VTNA 2YAAA 3DDQA 4HYSA 4IEBA 4OLIA 3W0NA 2GHLA 4FK6A 3QGWA 2I0HA 4JR3A 4HVSA 5EFQA 3VUGA 4AA4A 3GI3A 3KL8A 1IASA 2RFDA 3E3PA 3LHJA 4PUZA 4R3CA 4BRXA 4DLIA 3LLAA 1IA8A 3HUBA 2YCRA 3F5PA 4XS2A 3ZLXA 4JAJA 3A8WA 2XKCA 4AWIA 3P4KA 2XS0A 2E2BA 2YWPA 3KMUA 4AXCA 2HXQA 4YZMA 2DS1A 2HYYA 3L1SA 5BVNA 1XMLA 3D14A 5A3XA 3AT2A 3KCKA 4RX8A 5HTBA 2QOQA 1FVRA 3IS5A 1FPUA 4XV9A 5IMXA 4RQVA 4IFCA 4E73A 3FPMA 5HIBA 5EQYA 4JG7A 3S2PA 2UZLA 3GXLA 2RSVA 3HYHA 4GYGA 3NIEA 1UKHA 4YZ9A 2QODA 4WOVA 4G3DA 4IM3A 4QDVA 3ZDIA 1ZAOA 2AC5A 4BBMA 3PXQA 4TRLA 4U8ZA 4TYEA 4Q9SA 1CSNA 4NH1A 4OTQA 3M42A 4EC9A 4TWOA 1OGUA 4BN1A 3CE3A 4FTOA 4FG9A 3HV3A 4OTPA 1Q8WA 4TYHA 4D2VA 5LWMA 2CGVA 4QQJA 4TWCA 3SXRA 1FINA 4WT6A 3V8SA 2B1PA 2BCJA 2VRXA 3FZRA 3PZEA 5DR2A 3ZXZA 3FDNA 3W10A 4L46A 5DN3A 3EHAA 5JGDA 4RVMA 3OXTA 3DB6A 2GQGA 4PTGA 4BZDA 5AP5A 3BQCA 3D5XA 3TTIA 1ZZLA 2PE0A 4BCJA 3F88A 2PHKA 5IEVA 1H1RA 4FR4A 1ZY4A 3SXFA 2WFYA 4PMSA 1Q8UA 2C3JA 4AN3A 2PZYA 3BX5A 3RNIA 2R4BA 3QHWA 4AZTA 4B9DA 5KUPA 2IZSA 2X0QA 3PA3A 4KSPA 2CDZA 3K3IA 4RJ8A 3Q9ZA 4S2ZA 5ANEA 5IA4A 3R22A 4NM3A 3F5UA 5J9ZA 2GHGA 4C58A 1GZNA 2AC3A 4YUQA 3FMNA 4OT5A 4FX3A 4Y5HA 2V55A 3OCGA 3UG2A 3KF7A 4M67A 4QMOA 1WBPA 3R7OA 4P5QA 4AW0A 4MTAA 4BHNA 3DTCA 3F9NA 3CC6A 3GU7A 2C6OA 4UB7A 1URWA 4EUUA 2QR8A 2NPQA 2R3IA 4EJNA 3JVSA 3REPA 3CEKA 3E64A 4EHVA 4FGBA 4K11A 1P4OA 3WZUA 5IQDA 5D7AA 2BALA 5CSHA 5EDPA 4I0SA 5K9IA 2NNWB 3I6WA 1YXUA 4X3FB 4TT7A 3F2RA 5FTQA 4FV3A 2E9OA 4QPSA 2NRUA 4WO5A 2E9NA 1OKYA 4I24A 2RG5A 5LCJA 3RKBA 4K77A 3UOLA 4BDGA 2JIVA 3CQWA 4C2WA 4E7WA 1PRYA 3F61A 3W2QA 1R0PA 3DTWA 3W32A 5GHVA 3PP0A 3RK9A 5L8LA 3R1QA 5EQPA 2RG6A 3QWKA 3NYVA 3WF5A 3VJOA 5BUEA 3ZH8A 4WRGA 4CNHA 3I0QA 5BMMA 4WHZA 5DH3A 2OH4A 5HNGA 4ZK5A 1JSVA 3L8VA 3R9HA 4W4XA 5HHWA 5A6NA 4TL0A 4W4YA 5EM7A 2HK5A 3PVWA 4RWLA 1IA9A 1M2RA 2R9SA 1ZYDA 1QPEA 4LL0A 5E90A 3GFWA 2XA4A 1DAWA 4DTAA 3DQXA 4QYYA 1XBAA 5CVFA 2I0VA 4RIWA 4U40A 3R8VA 3G5DA 3QYWA 1JKKA 1BX6A 4GL9A 4U41A 3R2YA 4FV1A 4ZTHA 1H1PA 5FGKA 2GDOA 4TWPA 5ITAA 2W1GA 4NYEA 3UO5A 1G3NA 4WUNA 5LOHA 4AOTA 5F1ZA 4O82A 3BLRA 1H25A 2WTIA 1KV2A 5E8XA 4DH8A 5D41A 4M13A 4DT9A 3EN9A 5GIOE 1WBNA 1ZYSA 5EYDA 1A06A 3DXNA 4ALWA 2RF9A 4FTLA 4XH6A 4JG8A 5A54A 3AMAA 3NYNA 4CMTA 5E8TA 5K4JA 4MWHA 4AZSA 5KBQA 3R8UA 4AE6A 4D9TA 1ZOEA 4BCQA 3FKOA 2BRMA 2ITQA 3DBFA 4YJVA 4BTKA 2NYAA 4E20A 4I5CA 3QU0A 1U54A 4ACGA 3GNIB 2HXLA 4S34A 2IZRA 3G9NA 3UTOA 2PL0A 3UQGA 2O64A 5K4IA 4DHJA 3RPSA 3BV2A 2C5YA 2BZKB 2QO9A 4R5SA 2JLDA 4BIBA 1PMNA 1MQBA 4EORA 4FEQA 3BWFA 3P9JA 4R3RA 4AXAA 2PZ5A 3UZRA 5CI7A 2J90A 3COKA 4BFMA 1J91A 1SNXA 4JQEA 4XX9A 4IC7A 4MHAA 4QTAA 3UPZA 5IISA 2GS7A 3QUPA 4V0GA 2W4OA 3NLBA 2FUMA 2CMWA 4OTHA 4A7CA 4C35A 2QOCA 5DWRA 4DEBA 4QP8A 3F3TA 3MDYA 4XEYA 1AD5A 2X39A 4MWIA 5EKOA 3UMWA 5E8ZA 2J0IA 3Q52A 4NM7A 3ZBXA 3MH3A 4MYGA 3PA5A 3TXOA 3AKLA 3LCKA 4Z7GA 5E7RA 1JOWB 3R28A 5CS6A 4XG4A 1YWVA 1NVSA 4IJ9A 5AEPA 2OZOA 4O83A 2JC6A 2GHMA 2EXEA 1BKXA 5D1JA 2YACA 3W2CA 4Y5QA 3ATTA 1YKRA 5CNNA 3VHKA 2XMYA 4P4CA 4YU2A 2PWLA 1JKTA 5CSPA 5JMSA 2YHVA 4D1ZA 3DLZA 2OJFE 1SYKA 3LFNA 4I3ZA 3C0HA 3DGKA 2P3GX 4JVGA 5L8JA 2KTYA 5DFPA 4LUEA 3QTQA 3LLTA 4IAYA 5HLWA 4X3JA 5CI6A 3G15A 1O6KA 4X7QA 2UVYA 4QP7A 5AX9A 5A14A 1KWPA 4FEVA 4XJ0A 1W2CA 5FBOA 2WQMA 4IB0A 3A4OX 3CGOA 3VHEA 4EK3A 4U3YA 3QX4A 3RWPA 1RJBA 4CG8A 3TV7A 2REIA 3ERKA 2VTHA 3U55A 3AG9A 2J5FA 3BV3A 4QP6A 2BVAA 4X2KA 4ZMFA 1OPLA 4F09A 3W2PA 3E93A 5B2LA 3CTHA 4X0MA 3W55A 5CAVA 2X4FA 4LFIA 2XKDA 5KCVA 4R78A 3D5WA 3WILA 3CCNA 4BGHA 3RBWA 3UQCA 5LMAA 5DPVA 1U46A 5J9YA 5CVGA 5E92A 2C69A 4DEDA 4DF3A 4ZSGA 5FDXA 5AV3A 3VQUA 1FGIA 1FMOE 3C4XA 5AV0A 3S4QA 3VS5A 3DAEA 2CCIA 2W1FA 5CZHA 2HY81 2VGPA 3K5VA 3ACJA 4IM2A 3OWLA 4YP8A 2GMXA 2W1ZA 4XP2A 2CHLA 1ZLTA 5HE2A 3PJ3A 3D7TB 1BMKA 3ZSGA 1OKWA 4I5MA 5DI1A 3IONA 5DLSA 4U80A 3SKCA 2Q0NA 3Q2MA 3QRUA 4EQUA 2XNGA 4FOBA 2FSTX 3BU5A 5DT0A 3VRYA 2QVSE 4BGGA 2CLXA 4OT6A 3TCPA 4ARKA 4F6SA 5E8YA 3QLGA 4FUXA 4ZTSA 3OBJA 5FDPA 3TZ9A 4B8MA 1Q8ZA 2J0KA 3FLZA 3PP1A 4F7JA 4ZSJA 4UMRA 3V5TA 4GFGA 4HVDA 4G3CA 3PXYA 4PL5A 4U5JA 3RK5A 4LOOA 4FKRA 3V5LA 4O86A 3DLSA 4N70A 3S3IA 3ITZA 2PVLA 4WSYA 3AT3A 2QOIA 2BAKA 2ERZE 3EOCA 4EOPA 4D2PA 5AX3A 5EYKA 2F2UA 2C30A 2I1MA 3OVVA 4RIXB 4YPDA 4FVPA 1GIHA 3SRVA 1PXJA 1MP8A 4EH9A 2PMIA 5EW8A 4AXDA 4Z55A 3RAHA 1OM1A 2GNLA 2UW6A 3BZ3A 3NUPA 4LMNA 2WTKC 5JZNA 3TJDA 3O96A 4HNIA 2WOUA 1K3AA 4BCFA 3MJ1A 2XJ1A 4LL5A 1M7QA 4F6WA 5BNJA 3ZU7A 4YBJA 2B52A 2VTRA 4G16A 2WMQA 3R7IA 4FZFB 3CR0A 3DKCA 4H36A 4DN5A 4RPVA 4FV8A 3O8PA 2PUPA 3AGMA 4R8QA 3LMHA 2X0OA 4K2RA 1YXSA 3UVRA 4TPTA 4H58A 1YI4A 4NFMA 5A46A 3MH2A 3D4QA 2OJJA 1Q41A 2F57A 2PVYA 4C33A 1H00A 4YO6A 5FD2A 3UVQA 4WBOA 5J79A 3ORKA 4FSUA 2BAQA 3ZUVA 2JAVA 4M84A 2XANA 3FMKA 3OEZA 2CGWA 4J1RA 5L2IA 4C34A 5HO6A 2CSNA 4YJQA 2XALA 3H10A 4L01A 2G01A 3IW8A 4IC8A 4RVTA 5F4NA 3IPHA 4O7RA 1JVPP 3BU6A 5CXHA 4E4NA 3DFCB 4IZ5A 3W33A 3UIUA 5C8KA 3ORNA 4I4FA 3TG1A 4MXAA 3O7LB 2QHMA 3AOXA 3QA0A 4YJNA 3UP2A 4KIOA 2J9MA 4I6QA 3NUAA 4GUEA 3WIKA 3ZRLA 3SC1A 4WA9A 2QLUA 2PK9A 3ZHPC 3ZRKA 5LVPA 5AR2A 4UWYA 4NJDA 3GT8A 3AGLA 5BUIA 5CEMA 3MYGA 4FTUA 4KAOA 1JSUA 3DQWA 4L52A 3KA0A 2PE1A 3B2TA 1F3MC 4QMPA 3U6IA 4P90A 4DCAA 4YNEA 1UWHA 1TQPA 1Z57A 4NZWB 2IEWA 3R7VA 4OBPA 2J4ZA 4IWDA 4KB8A 4L6QA 2P33A 4IJPA 3ZFXA 4BI0A 4DG2E 1H01A 4E6DA 5DEYA 2WKMA 4FJVA 3M11A 4Q5EA 5CLPA 4O2ZA 1CKIA 2XARA 2JIIA 2OFVA 2X8DA 1XH9A 3E63A 3GOKA 5BVWA 3FSFA 5KE0A 4XRJA 3TT0A 2CKEA 5BX0A 1FBNA 3PY3A 2WMRA 3PFQA 5L2WA 1QCFA 4IAFA 4EUTA 3OUKA 4FI1A 3NUSA 4USFA 1VEBA 4F99A 4KUJA 5KBRA 2R3MA 3AKKA 3PE2A 2UVXA 3CLYA 5CXZA 3IGGA 3MY0A 3Q9YA 4FKPA 2GPHA 1JQHA 1WFCA 2WEIA 5L2SA 4L43A 4KKHA 5K0XA 3P5KA 3HECA 3SOCA 4DLJA 3UNZA 2JDTA 1PXMA 4KIPA 4L67A 4MXYA 4AA5A 1VR2A 2XB7A 2IVUA 4AA0A 3JPVA 3W0OA 3ALNA 3QGYA 4BDIA 3QD0A 2ZMCA 5BV3A 4ID7A 2QI8A 3K2LA 3PIYA 4DBXA 3POZA 1IG1A 2DYLA 4YLKA 3T8OA 4U7ZA 3FMEA 4FE2A 3A99A 5CU6A 4HPTE 4I5PA 5HOAA 4ZJJA 2VTMA 2PTKA 4AGCA 4FT9A 3TUBA 1QPJA 2HZIA 2YM4A 3QZIA 1Q3DA 3DFAA 4G9RA 2WMBA 1ST4A 5KHWA 1UU3A 5LMBA 3TYKA 4FNYA 3FEGA 5AAEA 4TW9A 4O7ZA 2W5BA 2WMSA 4QO9A 3OTVA 4B0GA 4F70A 4RX5A 3HAMA 3BYSA 1YI3A 4AGWA 1LR4A 4ASDA 3F3VA 5HD4A 2W4KA 3PG3A 5E8UA 1FVTA 5AUWA 4EJ7A 2ITVA 4DGNA 1ZYCA 4I5HA 1H1WA 3NW6A 1PMEA 3HA8A 3VF8A 2OBJA 2YLFA 3R04A 2XVDA 4FEUA 5JRQA 4IVAA 4EKLA 4K33A 2GNJA 2W9ZB 3VVHA 4J8MA 4C4HA 3W0QA 5CEOA 5C8NA 2Z7LA 5IQEA 5HO8A 2ZJWA 4L53A 4GU6A 4UBAA 5AV1A 4X6QC 2JGZA 3FI3A 3NCZA 3RZFA 4FTRA 4AG8A 2X7OA 4AZWA 4NKAA 4RJ3A 2XZSA 3KFAA 3FMLA 1TQMA 1SVHA 3NVMB 4C3PA 1YXXA 1MRUA 5HIEA 4F7NA 1L8TA 2R3PA 4TKSA 3F5GA 4D2WA 1TKIA 1Q24A 3KRWA 3V8TA 5ANJA 3JUHA 3U8WA 5BQ0A 1H07A 2XBJA 2ZMDA 3GU5A 3QKMA 3CBLA 3UC3A 4ZLOA 2HCKA 5BVEA 4AE9A 3KCFA 3UIBA 3FL4A 2HY0A 3UGCA 3MA6A 1Y8GA 5FTOA 2Y4PA 5AIRA 1GJOA 1V1KA 2OO8X 3PUFC 3Q4UA 3F2NA 2C6LA 3AMYA 3UDZA 1OL6A 1U59A 2ETRA 4E93A 2GQRA 3F2AA 4QYGA 2RKUA 5B0XA 3CKXA 2W99B 2W1DA 3ORIA 3TNPC 1W2FA 5H3QA 4MXZA 2WNTA 4O0XA 1JNKA 3ZM4A 4F7SA 3COHA 3O17A 1WBSA 1OPKA 3EN7A 3QQKA 2PY3A 3HMPA 3AT4A 3TI1A 4DFNA 4K6ZA 4MX9A 4E5AX 3VJNA 4JT3A 3W18A 4YLLA 2ITNA 2XNOA 4Z9LA 3TKHA 4ERKA 2XM9A 3PRFA 4JIKA 4QP4A 2P55A 5HQ0A 3G33A 4BL1A 2QLQA 5AMNA 2LAVA 4AS0A 3OOGA 2WTCA 3RTPA 4ACHA 2KULA 3MVLA 2BDWA 3MTLA 2G2IA 5CAOA 4OGRA 2GFSA 4EWHA 5J7HA 4DHZA 3PY1A 4CCUA 2X0PA 4MNEB 4U45A 3LJ2A 4L7FA 3V5JA 4BBEA 3OCSA 2C5OA 3BBTB 4IWOA 5HX8A 4MD8E 2ITUA 2ZV2A 1HCKA 4GIHA 3UZTA 5JGAA 3VUIA 5KMLA 1T45A 2WXVA 3H30A 3RPOA 3L9NA 3FY2A 4JNWA 4X2JA 3ZSIA 3HV4A 3QYZA 4RLLA 3RCDA 3EQFA 3W0MA 5IDNA 3QLFA 5CEPA 5CF6A 3HMIA 1W8CA 3DNDA 4EH3A 3R9RA 3A61A 3BKBA 2VTAA 4M8TA 3LJ1A 3EB0A 3EFWA 4BJJB 3I7BA 4UMPA 3D15A 3PVGA 2I7QA 4AQKA 2UW9A 5IDPA 1E9HA 4RJ7A 4C4IA 3ID6C 2IO6A 4NL0A 1Q99A 4MVFA 3TN8A 4QYHA 4RC4A 1Q5KA 2ITTA 3Q6WA 1SVGA 3F3WA 1OUYA 5L2TA 1ZARA 2QKRA 3FI8A 4EWQA 3TKIA 5H8GA 4D4YA 2XIYA 4ZIMA 3UO6A 5KHXA 3PLAE 5AUUA 3BLHA 1ZOGA 1ZMUA 4BICA 3K5UA 3BE9A 4USDA 4KBKA 4C38A 3VS2A 5HORA 2XIRA 4YC6A 2PYWA 5FUTA 4H1JA 4IVBA 3EWHA 3FL5A 2X7GA 3MVHA 4FTNA 4XV1A 2JBPA 2F2CB 4JDHA 4U44A 3P1AA 4QYFA 3P23A 4Z3VA 1V0BA 4LYNA 3NUUA 5HVYA 3DPKA 4YZNA 1XH5A 2P0CA 4W4WA 3LFFA 2Z02A 1H08A 4ZLZA 3RWQA 2JDVA 5LMKA 1H28A 2GTNA 5LVNA 1OECA 5C9CA 3Q9WA 5HG8A 3PG1A 3PJCA 3LXNA 3QCSA 3F5XA 4FIEA 4DFZE 2VWXA 4C8BA 3KMWA 4MK0A 5CALA 3E8CA 3DCVA 3HZTA 2PZIA 5HG5A 4ASEA 4TY1A 3BELA 3QHRA 4NCTC 3D2IA 3U4UA 4DGOA 4IH8A 4H05A 4YHFA 2VWVA 4C02A 3KXMA 3NR9A 5HICA 2W9FB 4FICA 4JL9A 4RA4A 4EHGA 3TZMA 4D0WA 5AP4A 5L4QA 3TZ8A 5IUGA 3KULB 4FV6A 2HWPA 4O6EA 1AQ1A 1JPAA 3C9WA 3QA8A 3U9NA 3CY2A 3EQDA 4G3EA 3ULZA 4AZEA 5CEKA 3KVXA 4CYIA 4ZZNA 5EHYA 3EMGA 3ZO3A 3DBEA 4AOIA 4F64A 4BDAA 5I9XA 3GQLA 3OC1A 3EQHA 4L9IA 2R3OA 5IH6A 3P86A 2QOOA 1UWJA 3QTXA 3Q4CA 2P2IA 4RWJA 5I9WA 4UYNA 2QOBA 2UZWE 3Q3BA 2R3JA 1MRVA 4C4GA 4GT5A 3HV7A 3PY0A 4PX6A 2VWZA 2BHHA 3GOPA 5CF8A 1Y91A 1ATPE 3TV6A 4DGGA 3E88A 2OXYA 3ZEPA 4GRBA 5HBJA 4HZRA 2QOHA 2YISA 2R0UA 5A4LA 5FXSA 3N9XA 4JBVA 3GU8A 1VYWA 2GNIA 3TNIA 4FV4A 2WU7A 1OL7A 5KMIA 5LVLA 3NUXA 4O6LA 1OPJA 2VTTA 3R1NA 5ANKA 3O51A 2FGIA 4YURA 3PE1A 2LGCA 3CY3A 5E9EA 4RQKA 3ZC5A 4QMVA 4G34A 2ESMA 2OJ9A 2VO6A 4FT7A 4PPCA 4S30A 1Y57A 5HIDA 1J3HA 3EQPA 3LJ0A 5HVJA 3FMDA 1S9IA 4GG5A 5DOSA 3VC4A 2VNWA 3AD6A 5D7VA 4BDFA 5CYIA 1W0XC 1Q62A 2V62A 1ZOHA 4IX6A 4JDJA 4F0GA 1WBOA 4F6UA 5M56A 5HLPA 4G31A 1PXNA 4C36A 5JH6A 2OZAB 5HU3A 4NTTA 4PPAA 3QQJA 1OUKA 2YM3A 3QZHA 2BRHA 3MBLA 2BRGA 4AGDA 4QT1A 4AGUA 4GVAA 3FQSA 5IQHA 3LXPA 3M2WA 2O65A 4U9AA 3UODA 4DBNA 5ACBC 1XH6A 3C13A 4RT7A 3R8ZA 3RAIA 1XH7A 2OK1A 4DH3A 2B54A 4CRSA 1I09A 3NW5A 4CFXA 2HW6A 4FKLA 3W2OA 5I9VA 5HG9A 5IUIA 4R7HA 2J51A 2OWBA 3TNHA 5CU4A 3OHTA 2JEDA 4M0ZA 4E3CA 1J7IA 4JJRA 4ZY5A 2GNFA 2FO0A 2QO7A 2W17A 3DA6A 3KC3A 3BHHA 3IDCA 3MS9A 3Q32A 4O0SA 5AR7A 3FUPA 3KIOC 4D2TA 3GCVA 4EH2A 3FYJX 4ZZMA 1HCLA 4N6ZA 4EH6A 2E9PA 2XRWA 4X2NA 3ZOSA 1KV1A 4O4DA 2UW0A 3BQRA 4A9RA 1YRPA 2YCSA 4O0YA 2E9UA 5DRDA 3UJGA 1TZDA 5IQIA 3OS3A 2R3HA 4CKJA 2VTQA 1B38A 5JFSA 4N4SA 3FPQA 4FT5A 2WD1A 3VF9A 2XYUA 1RDQE 4IVDA 2C0OA 3R0TA 3QTWA 4WUAA 3FMJA 3QTUA 4J97A 3SX9A 3T3VA 4D9UA 2GSFA 2FSOX 3V5WA 4JMQA 2ZYBA 3EQCA 4I94A 3BI6A 4FOCA 2WMUA 2JFMA 3RNYA 4R7BA 1ZYLA 3TACA 4YPSA 3CIKA 5C27A 4UALA 3F3UA 3EKNA 4RFYA 3D5UA 4AZFA 4BDHA 1MRYA 1T46A 4FF8A 3NMUF 2XK6A 2C47A 3NS9A 2PVRA 2R2PA 2BRBA 3C5UA 4Q9ZA 4M0YA 5I5ZA 4I20A 4PV0A 5DT3A 5M4CA 3ZYAA 3DK3A 2YDIA 4HCTA 4JQ8A 5AM6A 3OT3A 1G5SA 4WRSA 5IH5A 3FYKX 4D5KA 4PP9A 5JGBA 3UNKA 2IJMA 2J0LA 3NX8A 4FSNA 3MPMA 1BL7A 1M17A 3EQIA 2WO6A 3HX4A 5DR6A 3PPKA 2X4ZA 2R3FA 4FKIA 4Z7HA 3L9PA 3IK3A 2BDFA 4YTHA 1RW8A 3E62A 4IX3A 5LWNA 2OJIA