3W8QA

Structure of the human mitogen-activated protein kinase kinase 1 (mek1)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
344
structure length
318
Chain Sequence
b'ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in "DFG-Asp Out" conformation
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 318
sequence length 344
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w8qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w8qA01
2P2IA 1PXKA 1MRUA 4I3ZA 5H3QA 3CY2A 4ALWA 2X9EA 2UV2A 3KN6A 4FUYA 5DT3A 1P5EA 2R3KA 4YGAA 1Q8TA 4H1JA 4B6LA 5AP7A 4UY9A 2XRUA 3D5UA 3ORKA 2PMOX 2YM3A 4L3PA 4F9AA 1JSUA 4QP9A 4BTFA 4QTDA 4D4YA 4U6RA 5IQDA 3OROA 5L3AA 4DHFA 2O63A 1J7LA 4AW0A 3Q6WA 2Z7LA 4H39A 4O0XA 5AFVA 2XNGA 4GK4A 5ICPA 3RI1A 3VS6A 4R1YA 1T45A 2R9SA 3OXIA 3BU3A 5I5ZA 5D1JA 4QMYA 3FMJA 1YOLA 5K0KA 4HGLA 4EH3A 5F94A 4O83A 5FRIA 4BI2A 5JEBA 4O86A 2UW9A 4ORKA 3BQCA 4F1TA 1YVJA 4ZAUA 3II5A 4EHZA 4RWIA 2C6DA 4KWPA 2ITWA 3GU5A 1KE8A 4QPSA 2QR8A 4WT6A 4L44A 1OB3A 3MYGA 5HGIA 4AXAA 3VS3A 4C36A 1Q99A 1OKWA 2YACA 3RCJA 4IVCA 1W84A 3F66A 4GYIA 5CLPA 4DFUA 2R5TA 2JIUA 2X7OA 4FVPA 4HOKA 1TQPA 4K1BA 4BKZA 3MPMA 2C1AA 2OXXA 4V01A 4W9WA 5CI7A 5HIBA 2AYPA 4BWXA 1IASA 4ZY6A 2BDWA 2H34A 2PE2A 3RPVA 3A7FA 4NK9A 5IA4A 2GTMA 5J95A 3MFTA 3R9OA 4IDVA 3DAEA 4HCTA 2GNLA 4QYFA 4TXCA 4YBJA 2BALA 3KREA 4FV2A 3E87A 4CLJA 3BV2A 3GEQA 3MH3A 4WUNA 1DI8A 1WVYA 3A8XA 4FKVA 2P55A 4W8EA 4IIRA 5EDQA 1H0WA 3T9TA 4PL3A 4JVGA 5AR4A 5HE2A 2R3FA 2ZAZA 3DBCA 1YW2A 2OJ9A 2BAJA 1XBCA 4H1MA 1TQMA 4ZTHA 3ZEWA 2W05A 2YIQA 3LW0A 3NNXA 2Y4IC 4JG7A 3Q52A 4RIYB 4CQEA 4C3RA 3UTOA 2Z7SA 2OH4A 1JLUE 5HE0A 4XJ0A 3SLSA 4FSUA 5HG9A 3NR9A 2JC6A 5AEPA 1V0PA 3FWQA 3O7LB 4FVRA 4J53A 1APME 3TXOA 2C6EA 3MY0A 2WD1A 3HMIA 3TNPC 4EC8A 4PDYA 2B55A 4OTPA 2J0LA 5I4NA 2BDFA 3V5JA 4FKUA 4BHZA 3FXXA 3MTLA 1IG1A 3RAWA 4BZDA 2EU9A 3DJ7A 4M68A 2VWXA 5FDXA 3ZDUA 2XUUA 2HCKA 4DGGA 3OEFX 4U97A 2YDIA 3Q4TA 3ZRMA 4FSTA 4IWDA 4IVDA 1QMZA 3LXLA 3OUNB 4AOJA 2JKMA 3P4KA 1KWPA 4IFGA 4F0IA 4O7NA 3EOCA 1KOBA 4KA3A 1SM2A 2B9FA 3SRVA 5M51A 3PE1A 3F3WA 3OY3A 3RPOA 3MA3A 3VHEA 4M69B 2R3LA 4DLJA 4BGHA 5FEQA 3ROCA 4RZVA 5HO7A 3TUDA 3VN9A 2WTJA 2CGVA 3CD8A 2OXYA 5E90A 2YN8A 2CNVA 4AZEA 3U55A 2RIOA 1OIUA 3BYOA 4M0ZA 4F9CA 4MF0A 1PHKA 2W9FB 3ZSIA 5IH6A 3UC4A 2BTSA 3KKVA 3QALE 3Q9WA 4EOOA 4V0GA 3KRWA 1L3RE 5IISA 5KO1A 2ITYA 4KIQA 1PMUA 3EFLA 3HUBA 3QFVA 5K0XA 2ONLA 2W1DA 1BMKA 3LIJA 4D55A 2Z8CA 2C5OA 2JDOA 3ZHPC 2UZTA 3NUXA 3KRRA 3ITZA 4A9RA 4DEEA 3RCDA 5EYKA 4NJ3A 5IA3A 4IFCA 4PF4A 2WU6A 1QPDA 2VO7A 3PVWA 3PUPA 4CYJA 2GS2A 2XVDA 3D94A 4UYNA 1R39A 2V5QA 5JGBA 2ITXA 3C51A 1B38A 3IS5A 4HVIA 2GU8A 4J95A 5IZFA 1OITA 2HZIA 2XNNA 4W8DA 3FZRA 2Y4PA 4BIBA 2ZV2A 4E7WA 4YO6A 2ONLC 3UO4A 2WQBA 3GCUA 3TTIA 2QU5A 1WVWA 5CY3A 3VVHA 4U41A 3I5NA 3Q9ZA 5KMIA 2PZRA 1JPAA 3QYWA 4GJ2A 4PQNA 2ITPA 2OJGA 4IH8A 4ANLA 2VWBA 4GUEA 5JKGA 3BHTA 3WZDA 5C9CA 1R0PA 2IZUA 3BU6A 3R7EA 4EC9A 5K4IA 3E64A 4LL0A 5AV1A 3K5UA 5E7RA 4D9TA 3SXRA 4D2RA 4L00A 4BN1A 2ETKA 4LOOA 3ZYAA 5CVFA 3VHKA 3BLHA 3KL8A 3B8RA 5JRQA 5KMMA 1G3NA 3BHUA 4BI0A 3JY0A 3NEWA 3PPZA 4DC2A 5AA9A 4RIXA 2J0MB 5EW3A 4K8AA 2VTRA 4TNDA 2ITUA 2UZEA 4USFA 3DV3A 3F5XA 4S33A 5EK7A 3WZKA 5HCXA 3I7BA 4ZSGA 4KBAA 5B2MA 4EK6A 5A4LA 1R0EA 4OTHA 2YM7A 2YDJA 4FV3A 2ZJWA 2CGWA 3VUGA 4UZDA 5FXQA 5ITAA 2PU8A 1ZYCA 2ERZE 2X81A 4J52A 4I1ZA 2P0CA 4X2NA 3U4UA 4C59A 4RC3A 3R7UA 3L9PA 4NM7A 2FSLX 2XB7A 4DEDA 5HTBA 1ZMVA 3EQPA 1J1BA 4WHZA 3DDPA 2W4OA 5DYJA 3AD6A 4YJTA 5E8UA 2VX3A 5BUEA 3W10A 4ZZNA 4C4HA 2WMRA 1W98A 1M2QA 1LEZA 2XYNA 3BE9A 1RJBA 5ETCA 4S2ZA 2Z60A 3F3ZA 4HVSA 4R77A 2CKQA 3EL7A 4JBPA 4U9AA 3S1HA 4IZ5A 1CKJA 3K5VA 3PWDA 1S9IA 4PTEA 3GQLA 2F7XE 3VJNA 3B8QA 3OZ6A 4QP3A 3RK7A 4JL9A 3VW6A 1ZZLA 4YHJA 4EZ5A 4LRKA 3MFUA 2EVAA 4G3CA 4K11A 3ORMA 3GI3A 5EI6A 1OMWA 2CDZA 4J98A 4E4MA 2JAMA 4FA2A 3ID6C 3P78A 4E8AA 3LFFA 3LCDA 5CF6A 3GFWA 5DG5A 2JKQA 4HCVA 5L6WL 5LWMA 4FTQA 4I6FA 5C03A 3V8SA 4FG8A 3IDBA 4KKHA 2XNMA 3EQBA 5CAPA 2W1FA 4J97A 1K9AA 4R1VA 2VWWA 3GOKA 4JX7A 4DBNA 1WVXA 4XBUA 3DNDA 5AR2A 2OFUA 4FSYA 4QP2A 3TZMA 4WSQA 4ASXA 2GQRA 3IW8A 3P08A 1SNXA 2XK7A 3GU8A 4KUJA 3QXOA 3OEZA 2QI8A 4IC7A 4YHFA 2BZJA 4LOQA 5IKWA 3ZRKA 3LCOA 4BBFA 5KHXA 4AT4A 3IOPA 3ZMMA 2QODA 3HA6A 5LVOA 3D4QA 3EFKA 4PRJA 3BCEA 2XKCA 3TWJA 4F4PA 3C5UA 2CKPA 3AXWA 3UYTA 3HAVA 3MB6A 1GY3A 1MQ4A 3UVQA 4YNOA 4BWKA 4RLLA 3VF9A 2J5EA 3DAJA 4FZFB 3R28A 3KY2A 5J5TA 3R8UA 4IZAA 4FIGA 4FSMA 4QQJA 4FUXA 4RJ7A 2FB8A 4A9SA 4YBKA 5IDPA 4UV0A 5E8WA 2YISA 1BL7A 4HYHA 2PVMA 3LMIA 5J1VA 3QTUA 2QO7A 4FMQA 4YMJA 1XBBA 4J96A 3RALA 4HGEA 4BDBA 4CTCA 2BCJA 5CU0A 3R73A 5L2WA 4G3GA 4RG0A 2PVFA 1OPJA 3R00A 4EKKA 2UZUE 2WHBA 4QPAA 1BUHA 3PP0A 3HKOA 5ANGA 4DFLA 5B2LA 1YKRA 1UKHA 3N9XA 2W1CA 1M7NA 4XRJA 4DFNA 2BKKA 1YHWA 2GS6A 2X2MA 3FC2A 3NSZA 3D2IA 5HHWA 1GIHA 2HWOA 4RZWA 3BKBA 5ANEA 3U9CA 4LM5A 1U54B 2KTYA 2Y4IB 3O8UA 4IE9A 4XV9A 3QGWA 5HVYA 3W16A 4ACMA 4UWCA 4F7LA 3PWYA 5EKNA 3N4VA 2W1GA 5JFWA 3FMLA 2PK9A 3PYYA 4KB8A 3GCQA 3KF4A 1PXPA 2CMWA 5C8MA 3RJCA 4FT0A 2DS1A 2BPMA 3IECA 4YP8A 2YIRA 1H07A 3G90X 3IO7A 3ZO2A 3QHRA 4MTAA 4NTSA 5T3QA 2F9GA 4L6QA 4EUTA 2Y9QA 3FEGA 3U6JA 2PTKA 3C4XA 3DLSA 4AE6A 3DK6A 4H58A 4YLLA 5CU3A 3CR0A 4IZYA 1KV2A 3KFAA 3VQUA 4HPTE 4Q5HA 4XV1A 3V51A 2GHMA 3C4EA 2QLQA 3G6GA 4QP8A 3EH9A 4IB5A 4MXOA 5HCYA 3TV6A 3CQUA 4MX9A 2A2AA 5BX0A 2OIDA 4OBPA 1W8CA 2GMXA 3RPRA 2X2KA 3SX9A 4E6QA 2YCRA 4XG6A 5A4CA 4RJ4A 4KKEA 4IAIA 4D1XA 2XBAA 4BWPA 2GQGA 1F0QA 3DQWA 4ID7A 5EOLA 1F3MC 3NPCA 3NWWA 4UEUA 4EYMA 3K3IA 4KIPA 4RC4A 4QMVA 2GFSA 2WTKC 3LFCA 3OOMA 3MY5A 5EDPA 5C27A 3VS5A 4HNFA 3ZO1A 4CG8A 3CPCA 4ZLOA 5HKMA 4QNAA 4IVAA 4EZ7A 3SRVB 2GNHA 4C4FA 2JIVA 2XRWA 3KMUA 3LFEA 3PSCA 1UVRA 4C35A 4A4OA 3TZ7A 3I4BA 2W96B 3EN4A 5H2UA 4PNKA 1WZYA 4XOZA 2R7IA 3OVVA 4QMOA 4QMLA 5CU6A 4R5SA 3KK9A 3HV5A 4HGSA 4JJRA 4C8BA 5IQHA 5DPVA 3Q9YA 2PZPA 1BYGA 2GSFA 4FT3A 4H36A 4XX9A 5J79A 3WZEA 4TYGA 2OZAA 3P86A 3WF5A 3R8MA 4ZLYA 4E4XA 4R5YA 3F3VA 1GZNA 2ZYBA 4V0GB 4C62A 4DEIA 3KU2A 1ZOGA 4M0YA 5AV4A 4FV9A 5HU3A 5J7BA 1SVHA 4QMXA 4F1MA 4UX9A 2ZOQA 5BPYA 3JPVA 1H1QA 2YIXA 1XWSA 1PY5A 3DB8A 4GVJA 5LOHA 2BHHA 2R0UA 2BTRA 4MNEA 4RX5A 5IEVA 2B7AA 3OC1A 3FQHA 5C01A 3WF8A 2YA9A 2V7OA 3PSDA 3RGFA 3ZUUA 4G16A 1YXSA 4NH1A 2E9NA 2VTTA 5HBEA 1Q41A 2W5BA 1M17A 4GSBA 3VBYA 4EHEA 4F99A 1U5QA 2IZRA 2EXCX 2QLUA 4B8LA 4Z3VA 1Q8ZA 5A54A 1XH6A 3ZCLA 4G31A 4O91A 2WMWA 4Z16A 3FL4A 3WILA 2UZNA 2R3MA 3FI8A 2ACXA 4KBKA 1Q97A 1L8TA 1NY3A 4BGGA 3KXHA 1M2PA 1YDRE 2NPQA 2XKEA 5CQUA 4HW7A 5C4KA 2YZAA 3R7YA 2BUJA 3IDPA 3TACA 4WKQA 3QWKA 1KE5A 4D2PA 1TVOA 4HCUA 4P2KA 5AUZA 4ZJVA 2C1BA 3A7JA 2R2PA 2XK9A 4IM3A 4KBCA 5E8SA 3FLSA 5C1QB 3EQRA 3OWKA 4FSZA 4IB0A 2WIHA 2FGIA 1HOWA 3Q53A 5IF1A 3QHWA 3KA0A 2BILB 2X8DA 3M42A 5GNKA 3COHA 3QTQA 4PV0A 5HNGA 5LQFA 4IADA 4QMZA 2XKDA 2W7XA 4G6LA 4M14A 4K2RA 1CKPA 2FSTX 5LXMA 5ETFA 1SNUA 4IM2A 4K9YA 1FGIA 1URCA 2GNFA 3L9MA 4ACHA 5CVGA 1PXNA 4IWQA 4L42A 4YZMA 2C6LA 4FC0A 4YPSA 1YI3A 1WFCA 2W1ZA 2WKMA 2Y0AA 3O17A 4RX9A 4XG8A 3BQRA 1JOWB 1AD5A 1V0OA 3T8OA 1CDKA 2WQMA 3QCQA 3QRIA 1SYKA 5JZNA 1GJOA 2C69A 1ZY5A 3P23A 4ZTQA 5TOZA 4U0IA 1GZOA 4XCUA 1ZARA 2ZM1A 4L43A 2ZDUA 1PXJA 3FMHA 4TYIA 4O82A 2R0IA 3RNIA 4YUQA 5KCVA 3LFBA 3DS6A 2C3KA 3QTWA 5AM7A 5HE3A 3OCTA 4DG2E 4EUUA 5CT7A 5IQGA 4GMYA 4IQ6A 2YFXA 4J71A 3EHAA 4D4RA 4R3RA 1H1SA 1YI6A 2HENA 4EJNA 4FKPA 1GZKA 1QPEA 4RA4A 3A4PA 3E92A 2YAAA 2W1EA 5EI8A 5ANDA 3RAKA 3NYXA 3C4CA 3ORTA 4Z55A 2F2UA 4MXCA 1IA8A 1FINA 4ZY4A 2GHGA 4AFEA 2C5YA 2EB2A 3EL8A 3OOGA 4MVFA 5DT4A 3HAMA 3A62A 1LEWA 3UYSA 1M7QA 4RRVA 4X2GA 4QYYA 4UMPA 4C0TA 4QMTA 3C5IA 3RMFA 2HZ4A 2RL5A 3AD4A 5AR5A 5BVWA 4HPUE 2JFLA 4ZTLA 4OTRA 4LFIA 4RIWB 4K6ZA 4EEVA 4CKJA 5K9IA 3P9JA 5HU9A 1O6YA 1OPKA 2RFDA 4E6AA 2OIQA 2R3NA 5F1ZA 2QONA 2QQ7A 3CJFA 3UVPA 4BCJA 1RDQE 1V0BA 2ZMCA 2Z02A 3BYUA 3PJ3A 4FSWA 5IG1A 2XK3A 4FK6A 4MNFA 1FQ1B 2X8EA 3LHJA 3MSSA 3AMAA 3CEKA 3QUDA 5AP1A 2VWZA 3RHKA 3SDJA 5FGKA 3VS0A 3W55A 4EH7A 4A9YA 5C26A 1FVVA 4KIOA 2UW8A 3LKMA 1NA7A 2UW5A 1YHSA 4FIFA 1JKTA 2X6EA 1QPJA 3PXQA 3CXWA 3F61A 4OLIA 3ZZEA 4H3PA 2FSOX 4BCQA 2Z7QA 4MYGA 3LOKA 3EFWA 5CENA 1I44A 5F9EA 4O0RA 1J3HA 3AC4A 4QQCA 5DR6A 3MS9A 4I0RA 1OUKA 5GINE 4I93A 3Q2MA 2PZIA 5HLNA 1P4OA 4NW5A 4IZ7A 4UMRA 4U7ZA 2BFXA 4Z7GA 2OFVA 5I9UA 4V04A 2VTNA 4P5ZA 3F7ZA 2QOOA 2QNJA 3DXNA 3KXNA 4I6BA 3OD6X 5DGZA 3UZPA 4QQTA 4X6QC 3PXYA 3V5QA 4TPTA 2PULA 3QX2A 5BYLA 3HEGA 5KUPA 2X1NA 3KEXA 5DVRA 3ZFXA 5AIKA 4FR4A 4BZNA 3WF6A 2C3JA 2J0JA 1H27A 3RK9A 1Q5KA 3E88A 4AZTA 3FKLA 4F0FA 4O6EA 5CT0A 1JAMA 4DGLC 1H00A 4RWKA 5BVNA 4CRLA 5KMNA 3FY0A 4FTMA 4BDHA 3FMMA 2B1PA 3OTUA 4FKLA 4Q9SA 2W4JA 5DOSA 3EKKA 4F6SA 4QTCA 5CF4A 3UBDA 5E92A 4JI9A 4FK3A 4I24A 4I6QA 4ZY5A 5GZAA 4KAOA 3GB2A 3NNVA 4U42A 4XBRA 3E8NA 4AT5A 4WSYA 5A4TA 5CEOA 4LV5A 1J7UA 4FEVA 2O2UA 2OK1A 3R1YA 4O0WA 3FPMA 3QQUA 2PVRA 4MD8E 3N51A 5IQAA 3R6XA 4K33A 2W1HA 3ZO4A 4GCJA 4RFMA 3VBXA 3F69A 3OWLA 2I0YA 4JT3A 3WYYA 5HTCA 1I09A 2H6DA 4IC8A 4FNWA 4N57A 1Y91A 4DCEA 3UO6A 2J4ZA 3FMDA 2WQEA 3DU8A 4C37A 4OTGA 3AG9A 3HRCA 3O96A 4RPVA 3VUTA 3SVVA 4QMPA 4BDDA 5G1XA 1EH4A 5D12A 1BI7A 1Y6AA 4XLIA 3BU5A 3PY3A 4IAFA 5EYDA 4G34A 4B9DA 4CKRA 5L6OA 2HW7A 1P2AA 4JR3A 3FLQA 1Q3WA 5A6NA 5DA3A 4FZ7A 5DR9A 3TEIA 3AOXA 2O8YA 1JQHA 2J7TA 4CZTA 3ULZA 3VO3A 4ENXA 2E9OA 3O51A 4S30A 3THBA 1OKZA 2CKEA 1OKYA 2PUUA 2UZDA 2X4FA 4CCBA 3DDQA 3TKUA 4BCKA 4D4VA 3MDYA 4E6DA 2VWUA 3SW7A 3I6UA 4FYOA 3G9NA 2UVXA 5B0XA 1BLXA 3TJDA 5BUJA 3U8WA 5EW9A 3BZ3A 2BHEA 3CQWA 4O21A 4AN2A 2B9JA 4ASZA 4D0XA 4BICA 4EQMA 3TUCA 5AUTA 4D2SA 3D2KA 3ULIA 3VBTA 3WBLA 4ACDA 3HMNA 5FD2A 3BWJA 3Q4CA 4I94A 3QTRA 4U40A 4FKTA 5IA1A 3ZBFA 3IW4A 5KKRB 4FOCA 5E91A 3SAYA 4OGRA 1CTPE 3I60A 5FBOA 1ZLTA 3R1NA 4QNYA 5CXHA 5LARA 3D0EA 3FMKA 4OT6A 4XG3A 3FXZA 2XK6A 3LMGA 4C33A 5LVMA 2OSCA 2C30A 4JS8A 4AA4A 1A48A 3GOPA 3BYMA 5BQ0A 4M66A 2B54A 3I0QA 3H30A 3GC9A 4E1ZA 3BRBA 3NCGA 2H9VA 3E8DA 3PY0A 4NFNA 3PPJA 5I3OA 4AZFA 3Q32A 3ZFMA 2IW9A 3KCFA 3LE6A 4E73A 5BNJA 3RHXA 4CLIA 2JITA 4BCMA 5EM6A 4XHKB 4GIHA 5FTGA 2GPHA 3QTZA 5EHYA 1K2PA 5IQCA 4IAAA 4Q5EA 3TN8A 4FE2A 2RFNA 4BC6A 5IH5A 2WOUA 4YLJA 1CKIA 3UMWA 4AP7A 3TT0A 2C3LA 4BCFA 2WB8A 4TYHA 4QP4A 4XG2A 3TKHA 4I5CA 1Q62A 4YC8A 2XCHA 1PXOA 3MIYA 4QP1A 4O7RA 1O9UA 3QLFA 2QC6A 2WGJA 4O7VA 5CEMA 2J51A 4GG7A 1YOMA 2OKRA 3HLLA 2QHNA 4LRJA 3QD2B 3P1AA 4QYEA 2VU3A 4CEGA 4CKIA 2XH5A 2WQNA 3KXXA 4FTTA 2CN8A 4AACA 3SA0A 3V6RA 4FIEA 5AMNA 5TO8A 2C4GA 5FM2A 5FTQA 4ITJA 2VO6A 4U3YA 4J1RA 5EI2A 3LLAA 3FDNA 2UW7A 1NVQA 3KC3A 4FVQA 3QC9A 2XEYA 3MH1A 2BIKB 4JDHA 3KRJA 3KRXA 5KE0A 3M11A 5G6VA 3NYVA 3WF9A 3JS2A 4EHGA 2FH9A 3KULB 3BWFA 4AGCA 4DG3E 5HQ0A 2WAJA 1UU3A 1XBAA 3CKWA 3S95A 1GIIA 4MBLA 3W2PA 3OY1A 3D5XA 2GTNA 2XCKA 3RTPA 5I9ZA 1G5SA 3BLQA 3PIZA 3VBQA 5KHWA 3NYOA 5JN2A 3HV4A 2YLEA 4M3QA 3OHTA 4X2JA 3ZZWA 4X7QA 3ZH8A 4WUAA 3OS3A 5H8BA 3NVMB 2EUFB 3M1SA 5DNRA 4YTFA 4QTAA 5ETIA 1DI9A 4CD0A 4N4SA 3HV7A 2VNWA 4E5BA 4DEAA 3PJ1A 4KIKB 4QO9A 1OL1A 3VC4A 4G5JA 5DE2A 2OG8A 3QF9A 4I5PA 1KE9A 1J7IA 3H0YA 3HDMA 5L2SA 2V55A 1IAHA 2QG5A 4FG9A 2FUMA 4UYAA 4ALUA 3ZXTA 1W82A 5CEQA 3C0IA 5I0BA 5CX9A 3ZSGA 3JYAA 4I4FA 2J2IB 4ZMEA 1PMVA 3R22A 2UZOA 3EN6A 2QOKA 3FMEA 4JR7A 4IBMA 4YR8A 1VR2A 3QQFA 5J9YA 2VWVA 1JSTA 4BDGA 5GJDA 2QG7A 4FEWA 1KOAA 4YJQA 4N6YA 1XKKA 3G2FA 4F9BA 5CF5A 4FKJA 4E3CA 4AOTA 3VF8A 4NW6A 3COMA 4FV1A 2OJFE 2W1IA 4TYEA 2QKRA 5HG7A 3ZUVA 2RG5A 5CEKA 4GL9A 1YHVA 3T3UA 3WZUA 4EK5A 3LXNA 1JSVA 2YM8A 3FLZA 3QKKA 3TIYA 2G01A 1BI8A 3NUNA 1OIYA 5EDRA 3HNGA 4MD7E 2VTQA 2R3IA 2WMTA 4F09A 2HWPA 3ORXA 1XQZA 4FIIA 3ZBXA 2F4JA 3LCKA 4YNEA 3ZU7A 2PHKA 3AQVA 3CC6A 3DBFA 3HZTA 3S2PA 4F9YA 5IUIA 1ZRZA 3EQCA 4FV4A 5AP3A 3CD3A 2IVSA 3DZQA 2LGCA 3DKGA 2CPKE 1TQIA 1WBVA 3F2NA 3PVBA 3P79A 4GH2A 4WG5A 4FV5A 4Y5HA 3TI1A 5CF8A 1ZY4A 3TUBA 4BDKA 3UDBA 2YIWA 3DKFA 3HRFA 1KE7A 3R8LA 3HV6A 5CTPA 4EJ7A 2Y8OA 2VAGA 3BX5A 3MFSA 3PZEA 2IZSA 5AWMA 1Q4LA 4X3FA 3GP0A 3KVWA 3ET7A 3EQFA 3A4OX 4FEUA 1Q61A 4XUFA 5JH6A 4QQ5A 3LLTA 4D2VA 4DAWA 4C02A 3ELJA 4FF8A 4A07A 4WNOA 5BVFA 4BIEA 2CGXA 2JAVA 4MXXA 2PSQA 3FKNA 5IQBA 2CLQA 4CG9A 4JBVA 4KRDA 2OLCA 3UG1A 3OCSA 2IW8A 4X3FC 3F82A 4EHVA 1DAYA 2WTCA 4I5HA 5GIOE 4CSVA 4F63A 4KRCA 2V62A 4PL4A 3DT1A 3GCSA 3E3BX 1Z9XA 3D7TA 4XYFA 5LVLA 3V5WA 3FLNC 4FZAB 4Y8DA 2OF2A 2LAVA 3RINA 5CAOA 2BZKB 5AA8A 4L67A 4L7SA 3PJCA 4U45A 4AA0A 1YWVA 3OWPA 1XHAA 4QPMA 3TZ8A 2B52A 1FOTA 1BL6A 3DJ6A 2W9ZB 2JKOA 4AA5A 3PG3A 2E9PA 4ZOGA 2WMUA 5F4NA 3ZONA 2W06A 2F49A 2P2HA 2XEZA 2G9XA 4MHAA 4DA5A 1E1VA 5FUTA 4L3LA 3VW8A 4BCNA 3NDMA 2BAKA 4FV7A 5H8GA 3GC7A 2X39A 4PTCA 4O7YA 4CT1A 3NLBA 3A7GA 4C61A 5AAGA 4PPAA 1RW8A 2VO0A 3CPBA 3BGZA 4APCA 3ALOA 5HD4A 1W7HA 4DGNA 4LMNA 2YCFA 3QZHA 3E63A 4FT5A 3E8CA 2WMAA 4EOPA 4JQ8A 5J7HA 1OUYA 3F2AA 5H9BA 3FY2A 1G8SA 3QX4A 2VTLA 5AAFA 4V05A 3UOLA 3PXFA 4FIJA 3DBDA 4IVBA 3P0MA 3GFEA 4QYGA 3Q4ZA 4M84A 5ETAA 1IRKA 2JIIA 2XJ1A 3BHYA 5DEYA 3UOHA 2G2IA 2HXQA 2X4ZA 3BBTB 4HJOA 3RVGA 4RC2A 3ZOSA 1ZZ2A 3RPYA 2WEVA 3HMPA 4D1ZA 2VTJA 4F1OA 4UALA 3FQEA 4QYHA 2Z2WA 5DRBA 2RF9A 3MESA 3TCPA 2UZBA 3QA0A 2A27A 4Y46A 4YURA 5CQWA 4FKGA 3FL5A 3DKCA 5M08A 4NSTA 5GIPE 2CLXA 1B6CB 2C5XA 2JD5A 2QOBA 3HL7A 3HX4A 4OBQA 3HGKA 2CNQA 4DH7A 4ZTNA 1U46A 4ZSLA 1NVRA 2VTPA 3COKA 1PMEA 2WOTA 4JLCA 4M67A 2YJRA 4P7EA 3KK8A 2VN9A 3CQEA 1LP4A 3EN5A 5AAEA 4EOSA 1UNLA 3Q4UA 3FQSA 4L46A 3A60A 4EBWA 3TNQB 3D83A 4AUAA 1H08A 1UNGA 4JG8A 3GVUA 4YJPA 5T68A 4KKGA 3QTXA 3QU0A 1Q24A 3QRUA 3MH0A 3FZOA 1PRYA 4ANQA 1HCKA 3C50A 3VJOA 4YZBA 5A4EA 5JRSA 4CV8A 4RSSA 3D5WA 2J0KA 4E26A 4DGMA 2FVDA 1YXXA 3E8EA 3HMOA 3QLGA 5DLSA 4BI1A 4QOXA 3IGGA 4YSMA 3VIDA 3R04A 5AR8A 5IEXA 4TYJA 1ZOEA 3UIBA 5DBXA 4IDTA 1H01A 4BFMA 1F5QA 3VAPA 3L9NA 2YERA 4I5MA 4I6HA 4TWPA 2GFCA 2A1AB 3IOKA 3MVHA 4CFFA 2GHLA 4L3JA 3F5UA 3ORPA 4IX5A 1U59A 4GFGA 2XIRA 4NZWB 5E4HA 3GQIA 3U9NA 1WAKA 3MGYA 3NCZA 4RQVA 3NX8A 2PZ5A 5JGAA 2VUWA 3C0GA 3U51A 5HIDA 1FVTA 3DJ5A 2OICA 3FSFA 4CFWA 4X2KA 3AC3A 4PUZA 2PVLA 4WNMA 5BMSA 3U6IA 3WYXA 4RWLA 2PWLA 3W2OA 3LXKA 2YAKA 4CT2A 1REJA 2ZVAA 4ZIMA 2PVYA 1YDTE 4JG6A 2C0OA 2JBOA 2JGZA 4EH6A 3KMMA 2RFEA 4A9TA 3R2YA 3TIZA 2Q0NA 3GC0A 4XV3A 4EQCA 2JFMA 3LCTA 1Q8UA 2X9FA 2NP8A 3WE4A 3MVMA 3CLYA 4MCVA 3TG1A 4Q9ZA 2ZMDA 3PRFA 4PMMA 4RVLA 2WFYA 3HUCA 4TWCA 5IUHA 4HYSA 2E9UA 2W99B 4F7JA 5HBHA 1O6LA 4MWHA 3MA6A 2CN5A 3JY9A 5FXRA 1ZMWA 2CCIA 4D1SA 2XP2A 5AP2A 1JKKA 3NUPA 2ITNA 4JDIA 4W4XA 3EZVA 4G6NA 3CS9A 4HZRA 4NIFA 3CTJA 4WOVA 4YZDA 4FTJA 2A0CX 2XS0A 5L8JA 1OBDA 4F7SA 1LUFA 4JDKA 4QP7A 1SVEA 2YWPA 3RWPA 4EOQA 2OI4X 3DK7A 5EFQA 4EOIA 5F20A 3FJQE 5AM6A 1FPUA 3F88A 3UODA 4NJDA 4BYIA 1IEPA 1WBWA 3UP2A 2XYUA 3HV3A 3PE2A 4FX3A 4RIOA 3PXKA 2PMIA 1ND4A 3RPSA 2UW3A 3SD0A 2IG7A 3NUSA 2B0QA 2YM6A 4IAZA 3C4ZA 1YWNA 5EM5A 2YM5A 5DH3A 2AUHA 2WELA 3ACJA 5L4QA 3ORNA 3ORIA 2C6OA 1UA2A 3O8TA 4BCPA 1UNHA 3NAYA 4K77A 1BKXA 4FEQA 4DTAA 2BDJA 4O2ZA 4EWQA 5JSMA 4CFNA 4I21A 5CS6A 5D41A 2C0TA 1YQJA 3AC8A 4DG0E 4FZDB 4GT3A 2VNYA 4ZS0A 2QOHA 2CNUA 2BVAA 2C47A 4ZTRA 4BB4A 4CFXA 2EWAA 4DTBA 2VD5A 4G3DA 5HCZA 1UU9A 5ACKA 4XOYA 4JQ7A 5FP5A 1VYZA 3ZLSA 5M55A 3LFSA 4WD5A 5DHJA 4UWYA 3UG2A 4RA5A 1PF8A 5EM7A 4TKSA 4HNIA 2WMSA 4XMOA 3KF7A 4YZCA 3NNUA 4RVMA 3O2MA 1O6KA 3NUUA 4GT4A 1NT2A 5CAVA 4BDAA 3SKCA 4O1OA 3BBWA 4CTBA 5AUYA 5HORA 5JZJA 4UXQA 4RIXB 3RP9A 2JDSA 4UBAA 4DBXA 5TE0A 2CKOA 5LVNA 3HA8A 2WXVA 3GNIB 3QGYA 4O0YA 3F3TA 3PIXA 5EQYA 2PVJA 2I0HA 3LJ0A 2ZV7A 2ETRA 3MN3A 3OBJA 4JAIA 5EYCA 4L52A 2EXEA 3FHRA 3IQ7A 3QZIA 4L45A 5HE1A 3R9HA 4X6RA 4CFVA 1QPCA 1MP8A 4EBVA 4YC6A 3BHVA 5HVKA 3R7OA 3UNZA 2XNBA 1YXVA 3LMHA 4D5HA 2OIBA 3BPRA 4DFXE 4HVGA 3R30A 4DFYA 3W32A 4C2WA 1OKVA 3C13A 4ZJJA 4D5KA 3PFQA 4M8TA 2VZ6A 4AFJA 3RAHA 2I7QA 2XNOA 4OAUC 2NRUA 3A7IA 2UW0A 4E20A 4TN6A 4ARKA 3DA6A 4E93A 5IUGA 4ZXTA 4ACCA 4EONA 5J5SA 3GT8A 5JFXA 5FTOA 2XNEA 3EQIA 3ETAA 4FSNA 4RIYA 2F7EE 3BE2A 3VUIA 1MRYA 4QMQA 4O7SA 4GK2A 3FHIA 4G6OA 2DYLA 2PVNA 4GKIA 1WBSA 2YCSA 2ZB0A 3COIA 5IQIA 1H0VA 1K3AA 3FI3A 3Q96A 4FNZA 4KABA 4QMSA 5M56A 2HOGA 3SHEA 3KXMA 3LFNA 2NNWB 3HP2A 3ZEPA 4U8ZA 4WNPA 3UQGA 3NRMA 3ODYX 5HESA 1E1XA 1Q8YA 3ZFYA 2QOCA 3RBWA 3U87A 4QRCA 4A9UA 1Y8YA 2XIZA 4J99A 2ESMA 5JQ5A 1YXUA 3LFAA 4WNKA 2P3GX 4AZWA 2BZHB 2PUNA 5A46A 5HTIA 3TDVA 4XLVA 1P4FA 3I0OA 2F57A 3OT3A 3QD3A 4HZSA 4UMQA 4PP7A 5L2QA 4JIKA 1PKGA 4BBMA 4CFMA 4C3PA 4EWHA 5L2IA 3EB0A 4OAVB 5AUVA 3LM0A 5CWZA 2QU6A 3PP1A 2WEIA 2WMXA 2WTVA 4XEYA 3E93A 3QTSA 2B9HA 3ANQA 1WBPA 3PXRA 4FTRA 3AC5A 4FTNA 4L9IA 1CSNA 4CMUA 4G5PA 2ZM3A 2G15A 4MK0A 2HZ0A 3P7BA 4L8MA 4TNBA 4AE9A 3Q3BA 3DCVA 4Z9LA 5M4UA 2ZV8A 3I79A 5AUXA 4C7TA 4O0UA 2UW6A 4FGBA 3R21A 4PMSA 2QHMA 3LFQA 3ZTXA 4ANSA 5K4JA 5L8KA 3QKMA 3GBZA 1H25A 3PPKA 2DWBA 3QZGA 3TL8A 4W9XA 1KE6A 2EB3A 4EH4A 1KSWA 3O50A 4FEXA 1LPUA 4ZSEA 2YEXA 3AGMA 2XJ2A 2NO3A 3QQGA 2JLDA 2OZOA 4CRSA 3V6SA 2AC5A 2IVVA 1A9UA 3MVLA 2XBJA 5LJJA 3CBLA 4FICA 3LZBA 4FG7A 1OIRA 1UKIA 4IWOA 4UZHA 4PDOA 3P7AA 2PMLX 3MVJA 3IW6A 4M7IA 4N70A 4P4CA 3NMUF 3G33A 3DXPA 4FTUA 4RLKA 4TWNA 3ORLA 4O6LA 4DN5A 1FMOE 3FI4A 3FZ1A 3BYVA 4O1PA 2QOLA 5HIEA 1DAWA 2Y6OA 3R8VA 5M44A 4PNIA 5A4QA 3AGLA 4D2WA 4FKQA 4UXLA 3NVKI 3DOGA 1PJKA 3G9LX 3QYZA 4PL5A 4ZMFA 5FBNC 4GG5A 5AIRA 4RT7A 5E8ZA 3L9LA 3FAAA 2ZM4A 1NXKA 2R3QA 4B99A 2QKWB 2C6KA 3SG8A 2X8IA 3EIDA 3QQLA 3WARA 3LQ8A 4CZUA 3FI2A 3OXTA 3K54A 4BL1A 4YZNA 1M14A 5K5NA 3FV8A 5KZ0A 5KMJA 4IAKA 3MBLA 4F6WA 2Z7RA 3VS4A 4ZS4A 1XH4A 5EHOA 2UW4A 4S34A 5CNNA 2WTKB 3G5DA 3BHHA 2HXLA 3MJ1A 3KXZA 4I0TA 3LJ1A 4G17A 4WBBB 4M12A 5AP6A 3FMNA 5E9EA 4A4XA 4R8QA 3UE4A 4EOLA 3MV5A 4XP0A 4E4LA 5HLPA 3MI9A 5CNOA 2OJJA 2XF0A 1YI4A 3QUPA 4G3EA 4GEOA 5CYIA 3WIKA 4DEBA 3DNEA 2E9VA 3JVSA 1ZYSA 5HD7A 4NL0A 5GHVA 4R78A 3SV0A 4I0SA 1VYWA 4W4WA 5DI1A 1P14A 1Z57A 3GU7A 3SC1A 4JIAA 4EYJA 5EG3A 3C9WA 3OWJA 4W4YA 2YLFA 4ERKA 4MEDA 4FYNA 2YIYA 3AT4A 5LCKA 2VV9A 4CQGA 4J8MA 3LQ5A 2ITZA 5AV0A 5TKDA 1ZMUA 4O81A 2J90A 2RFSA 2PY3A 4N0SA 4YHTA 1ZOHA 2OZAB 3UIMA 2WMQA 4ONAA 5KMKA 4MXZA 4BDCA 5HO8A 3V8TA 4ZJIA 3Q5IA 4WG4A 3PRIA 2ITQA 4AT3A 2R3RA 4UMTA 4Y83A 5CVHA 4JQEA 3WZJA 3FYKX 4ANOA 2YJSA 3UPXA 3QXPA 3DLZA 4WRGA 3DB6A 2C6IA 3QQKA 3UZTA 5JK3A 4MNEB 1JKLA 4RJ8A 2GNIA 5M4FA 3BGQA 4F0GA 4H05A 3W2RA 4H3BA 2I6LA 4R7IA 2PL0A 2UUEA 2XA4A 3FC1X 5EQEA 3OW3A 3V5LA 5GJGA 2H8HA 2BMCA 4NM5A 4DLIA 2YZLA 3PZHA 1A06A 4TTHB 4APPA 5AR3A 1H1RA 2WMBA 3EYGA 4EI4A 1PKDA 1G8AA 4GRBA 3VS2A 1URWA 2XKFA 4B8MA 3KRLA 3SOAA 4BGQA 4AN9A 4DITA 2WMVA 3GGFA 4D9UA 1J1CA 3GCVA 4U43A 3CE3A 2KULA 3FSKA 4G3FA 4IW0A 4NWMA 3NGAA 4IMYA 2OBJA 2IZTA 2IVTA 3NUAA 2QOFA 4QP6A 2C5NA 3SQQA 3VNTA 2O0UA 3HVCA 3BELA 5JT2A 3R9RA 1JWHA 2BROA 4FT9A 1PYEA 3LM5A 3MFRA 3VBVA 5AJQA 1ZYLA 1H8FA 5CI6A 3SXSA 2BRNA 3MH2A 4U44A 5IMXA 1XR1A 2WNTA 5AV3A 3AC1A 3QZFA 4GUBA 4ANMA 5D7VA 2OW3A 3CGFA 2F2CB 1OIQA 4U81A 4I41A 4CNHA 4DCAA 2FO0A 5HI2A 4YJNA 4IEBA 4EH9A 1OL5A 3QQJA 4Y72A 5BMMA 4F64A 3JVRA 2JDTA 1UWJA 3Q5ZA 4RFZA 4FKSA 2JDRA 5ANOA 1ZWSA 2HK5A 3R2BA 4QTEA 2Q0BA 1U54A 4DINA 3HMMA 3R9NA 2GNJA 4LMUA 4MXAA 5AR7A 2OWBA 4IX4A 5HICA 1OECA 3R7IA 5CANA 3TV7A 4WRSA 3ACKA 4IWPA 2VWYA 4XP2A 4M97A 4PDSA 4KSQA 2PVHA 2WO6A 1T46A 4W4VA 2PE0A 3G0FA 4GW8A 1MRVA 5K5XA 1PW2A 4RGJA 4FTOA 3IW7A 5F95A 5GJFA 3DFAA 2Y6MA 3F5GA 2A19B 4BIDA 5BVOA 3LXPA 4C4EA 3A2CA 3MJ2A 2W5AA 4A7CA 2X7FA 3TKIA 2C3IB 4LI5A 4C34A 2YHVA 5HOAA 4ZP5A 3VUDA 3Q04A 1SZMA 3ROYA 4JDJA 4IB1A 3S00A 4EL9A 4G9CA 5EW8A 4IX3A 3Q2JA 4YJOA 2ETMA 1R78A 4U3ZA 1ATPE 5FEDA 5B2KA 3W2CA 5JMSA 3W2QA 3UPZA 2XM9A 4U80A 2QVSE 5ANIA 1ZXEA 4BKYA 3ZLYA 3IK3A 4YSJA 5AADA 4BRXA 5T6KA 3UIXA 2WZJA 5BVEA 2E2BA 2RSVA 4RWJA 3CCNA 5LMAA 3ZS5A 4FI1A 4O38A 4BDEA 1R1WA 1H4LA 3BI6A 3PVUA 4LRMA 4PMTA 3F2RA 1XH5A 3ZXZA 3EJ1A 4AAAA 2R4BA 2VWIA 2X2LA 3D14A 3R02A 4NCTA 4BCOA 2CGUA 3OT8A 1MUOA 4XV2A 3V3VA 3PTGA 3PIYA 1WCCA 3FXWA 3G6HA 4L7FA 4RVTA 5FXSA 4EH8A 4EOJA 4R3CA 3W1FA 4AGUA 4ANBA 5CAQA 2YWVA 4R7BA 5CU4A 2YDKA 3ANRA 2VGOA 4IJPA 5HG8A 4YPDA 4BHNA 1CM8A 3DK3A 4NCTC 2QO9A 3U4WA 2PZYA 4G9RA 5DIAA 4BDJA 3LFDA 3HECA 3O7LD 4FODA 4YJRA 3MPAA 3I5ZA 3MW1A 3L8VA 4AX8A 2WTDA 3NNWA 2W17A 3FUPA 4PPCA 4ZZOA 3RZFA 4XRLA 3V5PA 2XK4A 3O71A 4O7TA 3QQHA 3E5AA 1REKA 4ZZMA 2BRHA 4P90A 3RAIA 4A4LA 3UNKA 4DH5A 3QRKA 4I22A 4NUSA 4C4IA 5FM3A 2BRBA 4FL3A 3SGCA 3WF7A 4MWIA 3PG1A 4S32A 4TT7A 2IPXA 4BCGA 3AC2A 2EXMA 2BKZA 4CV9A 2HZNA 1X8BA 1WBNA 3MPTA 2YITA 2UVZA 3R01A 2H96A 1IA9A 4CMOA 3Q9XA 3VRYA 4LGDA 3C4FA 4GS6A 2OXDA 2R3PA 2VTOA 3R8PA 4F70A 1B39A 3W18A 3W33A 4FV0A 4AZSA 2XZSA 2Y7JA 5DEWA 3G15A 3QA8A 5H8EA 3RKBA 3O8PA 4RX7A 5A3XA 1OL2A 3W8LA 5J9LA 2BFYA 4O96A 4B4LA 5EM8A 3OCBA 2QOQA 3H9FA 4JNWA 4PY1A 4E5AX 3L8XA 4FV6A 5EOBA 4ZTMA 4LGGA 5KBQA 3IG7A 3ORZA 5E8TA 4EK4A 4ZEGA 4ZK5A 4DFBA 1BX6A 4ASEA 3MY1A 3D15A 4A06A 3B2WA 4NEUA 5B7VA 5FG8A 4OT5A 3EQDA 4XG4A 3QUEA 4BR3A 3REPA 4FZ6A 2VTAA 4YU2A 4K18A 1UWHA 3F9NA 4FKOA 4EOMA 4EZ3A 4CGAA 2IJMA 5M06A 3POZA 5ANJA 5AP5A 3DBEA 1JKSA 3D5VA 5BYYA 3D7ZA 5CALA 4CMTA 4AWIA 3CY3A 3NIZA 1Y57A 3MTFA 4H3QA 3SG9A 4DTKA 1TKIA 2IVUA 4N6ZA 1U4DA 2ITTA 2VX0A 3TJCA 3V01A 4S31A 5I3RA 4RJ6A 3ZO3A 4OUCA 4IAYA 5L6PA 4M15A 4DT9A 3GU4A 4MQ2A 5HEZA 4JBOA 4WIHA 4AW5A 4FKRA 3AT3A 5IDNA 5JFVA 2Q83A 2V0DA 3ZSHA 4F9WA 3N4TA 5IU2A 4RVKA 4ZTSA 5ACBC 2DQ7X 3NW5A 4PDPA 1W83A 3GUBA 1GIJA 2OJIA 3OXZA 1XH7A 4PX6A 4QMNA 3PJ2A 3PY1A 3UQFA 1MQBA 5JQ8A 1JNKA 5D10A 5L8LA 4LGHA 5DFPA 3JUHA 4YJUA 3P5KA 3NZ0A 4OTFA 3DXQA 4MQ1A 3QCXA 4D4SA 5LCJA 1VZOA 4X21A 4I92A 2R3HA 4BTMA 5GZ8A 5HX6A 3DTCA 2BRGA 4K0YA 4MD9E 3QKLA 4PP9A 4MF1A 3EN9A 3QWJA 2OO8X 4AGDA 2BRMA 3H9OA 4ACGA 2HYYA 4GT5A 4JAJA 4Y85A 4RIWA 3VWAA 5DWRA 3SOCA 3EQGA 1FGKA 3SXFA 4O7ZA 5LMBA 2FYSA 2C6TA 2HAKA 3QCYA 2OGVA 4FT7A 1AGWA 1NW1A 1FVRA 1R3CA 5LWNA 3QRJA 2JDVA 4GU9A 5TF9A 1OGUA 1XH8A 4O0SA 5D7AA 4F6UA 3E3PA 4WO5A 3KMWA 5AP4A 1RQQA 5HZNA 4FNXA 3BV3A 1VJYA 5IA5A 4LYNA 4BDFA 4ZSAA 2VTMA 3PA3A 4O22A 1WBTA 3ENHA 3ENMA 5IPJA 4QMUA 4FTCA 4USEA 3TDWA 2DUVA 4LL5A 5EH0A 1LR4A 3VULA 3U6HA 3G51A 4O0TA 3FKOA 3MB7A 4AQCA 5CSWA 4KNBA 1ZYDA 3ATTA 2UVYA 3LPBA 3ZUTA 1YXTA 1OI9A 1FMKA 1OL6A 3DBQA 2UZWE 2R7BA 5M57A 3UOKA 4MAOA 4BCHA 4F65A 1UV5A 4YJVA 4IHPA 4TYHB 3LJ2A 3CTHA 2OF4A 4FNYA 3UQCA 5D9HA 3AMYA 4RMZA 4BY9E 4BVUA 1H24A 4AU8A 3C1XA 5IH4A 4L53A 3N4UA 2C5VA 5DT0A 4TZRA 3MWUA 2IN6A 4MH7A 1DS5A 3DZOA 2A4LA 3NIEA 4LQMA 4DGOA 1QCFA 3R1SA 4IACA 2GCDA 1SVGA 5LMKA 4BYJA 3TM0A 5CEIA 3NW7A 4GV1A 1OZ1A 4EKLA 4CCUA 5IQFA 4IM0A 3MIAA 3FLWA 3VUKA 5M07A 3IPHA 2QO2A 4G1WA 3AT2A 4RBLA 2BZIB 2JEDA 3I1AA 5DR2A 3TV4A 4O27B 3HRBA 4Y73A 3VQHA 3WE8A 4CFUA 5HBJA 3EQHA 2HELA 5AX9A 4BDIA 4O0VA 1STCE 3RM6A 3M2WA 3PA5A 5LMKC 3QTIA 2REIA 3OFMA 3CP9A 4USDA 4FSQA 4KS7A 4FTKA 4E6CA 4WG3A 4XG9A 4JRVA 3S3IA 5CSXA 4YZ9A 5JGDA 3BYSA 5A9UA 2I40A 4EOKA 2ZV9A 4ERWA 4KD1A 2J5FA 4YTHA 1OM1A 3DPKA 5J1WA 5KMOA 2QOIA 1U5RA 3F7WA 3HDNA 4OTIA 3G0EA 4QT1A 3NS9A 2YABA 4U79A 2XJ0A 2SRCA 1OL7A 2QR7A 4AN3A 4LOPA 3K2LA 3KVXA 4ITHA 2W5HA 3F3UA 3KN5A 2JBPA 2JKKA 3OTVA 4RQKA 5J8IA 4AGWA 4C3FA 4I4EA 4CVAA 2VTHA 3OP5A 3FE3A 2C6MA 2B53A 2BIYA 2X7GA 4XP3A 3NW6A 5HVJA 3ZDIA 5AUUA 2VX1A 1XH9A 3UVRA 3A61A 2CHLA 2G1TA 2PPQA 3S4QA 5CZIA 2VGPA 4ZLZA 4BTKA 3OCGA 4GIIA 3ATSA 4UWBA 5J9ZA 4BCIA 2BR1A 3TNHA 1PYXA 1IAJA 2FA2A 5K3YA 4RX8A 4EH2A 5DN3A 3E7VA 4KS8A 2CJMA 5M4CA 4IX6A 1PXIA 2J0IA 4GYGA 4YJSA 3WI6A 3ZLXA 4QMWA 3V5TA 5IA2A 1KUTA 3QL8A 4FKIA 2VTSA 3BLRA 3ZRLA 4DFZE 5L2TA 1JBPE 5M4IA 3UOJA 4DE4A 4J8NA 4QD6A 4MBJA 1DM2A 1ERKA 5CAUA 2WQOA 1H26A 4LG4A 3VBWA 4O7LA 4ALVA 4NM0A 4X3JA 4B0GA 3P7CA 4EORA 4XH6A 3O23A 3F5PA 1E9HA 4FL1A 3W8QA 3VS7A 3TZ9A 1ZAOA 2PYWA 3PDTA 5CU2A 4BKJA 5IEYA 3W2SA 3BEGA 3EFJA 4BTJA 5EHLA 4FIHA 3FZPA 3QC4A 1PXMA 3S0OA 3ZC6A 4U5JA 1GAGA 4FTLA 4OBOA 4OTDA 4ENYA 1YDSE 3AD5A 3WOWA 5I9YA 4HVHA 1YRPA 3OF0A 4AOIA 2PE1A 3OMVA 4YTIA 2ERKA 1KV1A 4O84A 1JVPP 2XMYA 2R3GA 3DY7A 1RE8A 4AF3A 3EZRA 2BAQA 2IO6A 4X3FB 3LAUA 4BBEA 5HO6A 5KKRC 3TNWA 5CASA 4XS2A 4F08A 3ZM9A 5I9WA 3HP5A 3DFCB 1NVSA 3BIZA 1Q8WA 4PMPA 1YWRA 3OW4A 2O65A 3E7OA 4Q2AA 3C0HA 3IW5A 4QTBA 4AZVA 4YTCA 2XIYA 2O64A 1PXLA 4FBXA 2AC3A 3F6XA 2P4IA 3PVGA 3I81A 1IR3A 2UZVA 2UZLA 3C7QA 3T9IA 4GK3A 2O3PA 4L68A 3V8WA 5DMZA 3EYHA 4R3PA 5CXZA 3D7TB 3OUKA 2VRXA 1FBNA 1H28A 3H9RA 2G2HA 1Z5MA 2GNGA 3A8WA 3BGPA 5CSVA 5FWKK 4ASDA 5E1EA 4I23A 5KX8A 3ODZX 2RGPA 3OBGA 4IANA 4X0MA 5AUWA 3AMBA 4DF3A 3QAME 5FEEA 3R0TA 2QCSA 4JRNA 4LUEA 4O7WA 3KXGA 3DGKA 5D11A 3SW4A 2QD9A 2J9MA 3I6WA 5M09A 4GFOA 4CZYB 4DEGA 4DH3A 4GKHA 4R6VA 3R1QA 2XIXA 3FZTA 3KGAA 4HYIA 5DRDA 3R9DA 4HVDA 2PUPA 4IXPA 4TY1A 5I9XA 3Q60A 3VUMA 4NFMA 4NKAA 2HW6A 4B7TA 2ITVA 1WBOA 4FTIA 4NTTA 3R83A 4MXYA 4NKSA 3VS1A 2V7AA 3EKNA 2I0EA 4XG7A 5FDPA 4D0WA 3H3CA 4DYMA 5A14A 4JBQA 1Y6BA 2PUIA 4ITIA 2PVKA 3CIKA 5J87A 3IDCA 2I1MA 4FTAA 2B4SB 4PWNA 3DTWA 2R3JA 3H4JA 3KULA 3PSBA 4NT4A 3FBVA 4DEHA 1H1WA 3UP7A 2YCQA 1HCLA 1PMNA 4XNEA 4NU1A 4MBIA 5C4LA 5GZ9A 4AW1A 2F7ZE 1OPLA 1XJDA 5AP0A 5C8NA 2VTIA 5E8YA 5LVPA 3UIUA 2R3OA 4M69A 2FSMX 3UJGA 4YLKA 2YM4A 3L1SA 4TL0A 1UU8A 3POOA 4PTGA 4EH5A 4KIKA 3QBNA 4QMMA 5BUIA 3RZBA 4EK8A 2ITOA 2I0VA 4MKCA 3D9VA 4OW8A 3ZC5A 4AG8A 2XIKA 4GFMA 4P5QA 4Z7HA 3PA4A 4JXFA 4Y5QA 5KMLA 4UMUA 1GNGA 3IONA 3CJGA 2GS7A 3KB7A 4D2TA 4BZOA 3LVPA 5AX3A 4NM3A 5BVKA 4FSRA 4HYUA 4FGRA 3R7VA 3L8SA 3O0GA 2VO3A 2C0IA 2HIWA 2J6MA 3R71A 4C38A 2P33A 3BEAA 2ZB1A 4LV8A 3FPQA 4OTWA 2V22A 2WPAA 5EKOA 3LQ3A 3TNIA 5AV2A 3I7CA 4YO4A 5EQPA 3UGCA 2R64A 2WU7A 4YC3A 5FQDC 5I9VA 3UO5A 4FL2A 2RKUA 4CYIA 3Q6UA 3VUHA 5E8XA 4JOAA 1VEBA 5HLWA 3UNJA 3PXZA 4DH1A 4TW9A 5HX8A 1CMKE 4R7HA 4Y95A 2W4KA 4L01A 3NYNA 1J91A 3H10A 4FKWA 4KSPA 3CGOA 4F7NA 4DT8A 4C2VA 3DAKA 3K3JA 4J7BA 2G2FA 4C58A 3RM7A 2J50A 2PMNX 3R7GA 2OH0E 2XNPA 3R63A 5KNJA 1WMKA 2C68A 4PPBA 4OR5A 3A99A 4GJ3A 1M2RA 2WTWA 4D58A 5TT7A 4RFYA 5CEPA 2HY81 2XM8A 3EMGA 5HNBA 4IJ9A 2IW6A 3ALNA 3R8ZA 3GU6A 3IKAA 3RWQA 3JR1A 4UN0C 5IQEA 3DKOA 4C4JA 5ANKA 5C8KA 5M53A 4RJ5A 3GC8A 3KQ7A 4WA9A 4DH8A 1AQ1A 3FYJX 3QCSA 4ANNA 2IWIA 4C57A 1M52A 2W0JA 1GZ8A 3NUYA 5CZHA 3B2TA 3L8PA 3A7HA 3QD0A 4EK3A 4I20A 3C4WA 5HG5A 3KCKA 2GQSA 4JX3A 2CCHA 3UMXA 2B9IA 3GCPA 1SMHA 4WBOA 3OG7A 4RJ3A 2HY0A 1V1KA 1XO2B 3DQXA 3PLSA 4FOBA 4G2FA 4UB7A 3V04A 3PJ8A 5HNIX 4LUDA 1YOJA 5BYZA 4HGTA 3H0ZA 3LCSA 1ZYJA 4AS0A 1OVEA 3FLYA 5IMEA 3RK5A 2WTIA 3TTJA 1Q3DA 3QD4A 4TRLA 5BVDA 3NAXA 3ERKA 5KZIA 3WIGA 3ZLWA 4ZSJA 2CSNA 3EWHA 3HYHA 5TR6A 5CSHA 2ZDTA 1QL6A 5E8VA 4NYEA 4C4GA 5IA0A 2NRYA 3UZRA 4BF2A 4E4NA 3CKXA 1H1PA 4FV8A 2X6DA 5FLFA 3GXLA 4GU6A 1Y8GA 4II5A 4OTQA 3CTQA 3ZM4A 3IGOA 5EYMA 5FP6A 2QURA 4D28A 5CSPA 1OBGA 3U54A 4IB3A 3T3VA 5KBRA 2O5KA 4GVAA 2XK8A 3QRTA 5A6OA 4NIFB 1GOLA 3VRZA 3GENA 2X0GA 3JXWA 3RNYA 4TWOA 3UC3A 3E62A 4EQUA 1UU7A 1W0XC 4AW2A 3PLAE 3EN7A 4M13A 4KINA 4O2PA 4CXAA 5JFSA 4X2FA 3FZSA 5E1SA 2OU7A 2GDOA 1S9JA 3CSVA 4E5WA 2WIPA 2RG6A
chains in the Genus database with same CATH superfamily
2P2IA 1PXKA 1MRUA 4I3ZA 5H3QA 3CY2A 4ALWA 4FRFA 2X9EA 2UV2A 3KN6A 4FUYA 5DT3A 1P5EA 2R3KA 4YGAA 1Q8TA 4H1JA 4B6LA 5AP7A 4UY9A 2XRUA 3D5UA 3ORKA 2PMOX 2YM3A 4L3PA 4F9AA 1JSUA 4QP9A 4BTFA 4QTDA 4D4YA 4U6RA 5IQDA 3OROA 5L3AA 4DHFA 2O63A 1J7LA 4AW0A 3Q6WA 2Z7LA 4H39A 4O0XA 5AFVA 2XNGA 4GK4A 5ICPA 3RI1A 3VS6A 4R1YA 1T45A 2R9SA 3OXIA 3BU3A 5I5ZA 5D1JA 4QMYA 3FMJA 1YOLA 5K0KA 4HGLA 4EH3A 5F94A 4O83A 5FRIA 4BI2A 5JEBA 4O86A 2UW9A 4ORKA 3BQCA 4F1TA 1YVJA 4ZAUA 3II5A 4EHZA 4RWIA 2C6DA 4KWPA 2ITWA 3GU5A 1KE8A 4QPSA 2QR8A 4WT6A 1G8KA 4L44A 1OB3A 3MYGA 5HGIA 4AXAA 3VS3A 4C36A 1Q99A 1OKWA 2YACA 3RCJA 4IVCA 1W84A 3F66A 4GYIA 5CLPA 4DFUA 2R5TA 2JIUA 2X7OA 4FVPA 4HOKA 1TQPA 4K1BA 4BKZA 3MPMA 2C1AA 2OXXA 4V01A 4W9WA 5CI7A 5HIBA 2AYPA 4BWXA 1IASA 4ZY6A 2BDWA 2H34A 2PE2A 3RPVA 3A7FA 4NK9A 5IA4A 3KIOC 4I6LA 2GTMA 5J95A 3MFTA 3R9OA 4IDVA 3DAEA 4HCTA 2GNLA 4QYFA 4TXCA 4YBJA 2BALA 3KREA 4FV2A 3E87A 4CLJA 3BV2A 3GEQA 3MH3A 4WUNA 1DI8A 1WVYA 3A8XA 4FKVA 2P55A 4W8EA 4IIRA 5EDQA 1H0WA 3T9TA 4PL3A 4JVGA 5AR4A 5HE2A 2R3FA 2ZAZA 3DBCA 1YW2A 2OJ9A 2BAJA 1XBCA 4H1MA 1TQMA 4ZTHA 3ZEWA 2W05A 2YIQA 3LW0A 3NNXA 2Y4IC 4JG7A 3Q52A 4RIYB 4CQEA 4C3RA 3UTOA 2Z7SA 2OH4A 1JLUE 5HE0A 4XJ0A 3SLSA 4FSUA 5HG9A 3NR9A 2JC6A 5AEPA 1V0PA 3FWQA 3O7LB 4FVRA 4J53A 1APME 3TXOA 2C6EA 3MY0A 2WD1A 3HMIA 3TNPC 4EC8A 4PDYA 2B55A 4OTPA 2J0LA 5I4NA 2BDFA 3V5JA 4FKUA 4BHZA 3FXXA 3MTLA 1IG1A 3RAWA 4BZDA 2EU9A 3DJ7A 4M68A 2VWXA 5FDXA 3ZDUA 3AKLA 2XUUA 2HCKA 4DGGA 3OEFX 4U97A 2YDIA 3Q4TA 3ZRMA 4FSTA 4IWDA 4IVDA 1QMZA 3LXLA 3OUNB 4AOJA 2JKMA 3P4KA 1KWPA 4IFGA 4F0IA 4O7NA 3EOCA 1W2DA 1KOBA 4KA3A 1SM2A 2B9FA 3SRVA 5M51A 3PE1A 3F3WA 3OY3A 3RPOA 3MA3A 3VHEA 4M69B 2R3LA 1W2FA 4BGHA 4DLJA 5FEQA 3ROCA 4RZVA 5HO7A 3TUDA 3VN9A 2WTJA 2CGVA 3CD8A 2OXYA 5E90A 2YN8A 2CNVA 4AZEA 3U55A 2RIOA 1OIUA 3BYOA 4M0ZA 4F9CA 4MF0A 1PHKA 2W9FB 3ZSIA 5IH6A 3UC4A 2BTSA 3KKVA 3QALE 3Q9WA 4EOOA 4V0GA 3KRWA 1L3RE 5IISA 5KO1A 2ITYA 4KIQA 1PMUA 3EFLA 3HUBA 3QFVA 5K0XA 2ONLA 2W1DA 1BMKA 3LIJA 4D55A 2Z8CA 2C5OA 2JDOA 3ZHPC 2UZTA 3NUXA 3KRRA 3ITZA 4A9RA 4DEEA 3RCDA 5EYKA 4NJ3A 5IA3A 4IFCA 4PF4A 2WU6A 1QPDA 2XANA 2VO7A 3PVWA 3PUPA 4CYJA 2GS2A 2XVDA 3D94A 4UYNA 1R39A 2V5QA 5JGBA 2ITXA 3C51A 1B38A 3IS5A 4HVIA 2GU8A 4J95A 5IZFA 1OITA 2HZIA 2XNNA 4W8DA 3FZRA 2Y4PA 4BIBA 2ZV2A 4E7WA 4YO6A 2ONLC 3UO4A 2WQBA 3GCUA 3TTIA 2QU5A 1WVWA 5CY3A 3VVHA 4U41A 3I5NA 3Q9ZA 5KMIA 2PZRA 1JPAA 3QYWA 4GJ2A 4PQNA 2ITPA 2OJGA 4IH8A 4ANLA 2VWBA 4GUEA 5JKGA 3BHTA 3WZDA 5C9CA 1R0PA 2IZUA 3BU6A 3R7EA 4EC9A 5K4IA 3E64A 4LL0A 5AV1A 3K5UA 5E7RA 4D9TA 3SXRA 4D2RA 4L00A 4BN1A 2ETKA 4LOOA 3ZYAA 5CVFA 3VHKA 3BLHA 3KL8A 2AQXA 3B8RA 5JRQA 5KMMA 1G3NA 3BHUA 4BI0A 3JY0A 3NEWA 3PPZA 4DC2A 5AA9A 4RIXA 2J0MB 5EW3A 4K8AA 2VTRA 4TNDA 2ITUA 2UZEA 4USFA 3DV3A 3F5XA 4S33A 5EK7A 3WZKA 5HCXA 3I7BA 4ZSGA 4KBAA 5B2MA 4EK6A 5A4LA 1R0EA 4OTHA 2YM7A 2YDJA 4FV3A 2ZJWA 2CGWA 3VUGA 4UZDA 5FXQA 5ITAA 2PU8A 1ZYCA 2ERZE 3ML1A 2X81A 4J52A 4I1ZA 2P0CA 4X2NA 3U4UA 4C59A 4RC3A 3R7UA 3L9PA 4NM7A 2FSLX 2XB7A 4DEDA 5HTBA 1ZMVA 3EQPA 1J1BA 4WHZA 3DDPA 2W4OA 5DYJA 3AD6A 4YJTA 5E8UA 2VX3A 5BUEA 3W10A 4ZZNA 4C4HA 2WMRA 1M2QA 1LEZA 1W98A 2XYNA 3BE9A 1RJBA 5ETCA 4S2ZA 2Z60A 3F3ZA 4HVSA 4R77A 2CKQA 3EL7A 4JBPA 4U9AA 3S1HA 2IEWA 4IZ5A 1CKJA 3K5VA 3PWDA 1S9IA 4PTEA 3GQLA 2F7XE 3VJNA 3B8QA 3OZ6A 4QP3A 3RK7A 4JL9A 3VW6A 1ZZLA 4YHJA 4EZ5A 4LRKA 3MFUA 2EVAA 4G3CA 4K11A 1TFFA 3ORMA 3GI3A 5EI6A 1OMWA 2CDZA 4J98A 4E4MA 2JAMA 4FA2A 3ID6C 3P78A 4E8AA 3LFFA 3LCDA 5CF6A 3GFWA 5DG5A 2JKQA 4HCVA 5L6WL 5LWMA 4FTQA 4I6FA 2X0PA 5C03A 3V8SA 4FG8A 3IDBA 4KKHA 2XNMA 3EQBA 5CAPA 2W1FA 4J97A 1K9AA 4R1VA 2VWWA 3GOKA 4JX7A 4DBNA 1WVXA 4XBUA 3DNDA 5AR2A 2OFUA 4FSYA 3P5JC 4QP2A 3TZMA 4WSQA 4ASXA 2GQRA 3IW8A 3P08A 1SNXA 2XK7A 3GU8A 4KUJA 3QXOA 3OEZA 2QI8A 4IC7A 4YHFA 2BZJA 4LOQA 5IKWA 3ZRKA 3LCOA 4BBFA 5KHXA 4AT4A 3IOPA 3ZMMA 2QODA 3HA6A 5LVOA 3D4QA 3EFKA 4PRJA 3BCEA 2XKCA 3TWJA 4F4PA 3C5UA 2CKPA 3TYKA 3AXWA 3UYTA 3HAVA 3MB6A 1GY3A 1MQ4A 3UVQA 4YNOA 4BWKA 4RLLA 3VF9A 2J5EA 3DAJA 4FZFB 3R28A 3KY2A 5J5TA 3R8UA 4IZAA 4FIGA 4FSMA 4QQJA 4FUXA 4RJ7A 2FB8A 4A9SA 4YBKA 5IDPA 4UV0A 5E8WA 2YISA 1BL7A 4HYHA 2PVMA 3LMIA 5J1VA 3QTUA 2QO7A 4FMQA 4YMJA 1XBBA 4J96A 3RALA 4HGEA 4BDBA 4CTCA 2BCJA 5CU0A 3R73A 5L2WA 4G3GA 4RG0A 2PVFA 1OPJA 3R00A 4EKKA 2UZUE 2WHBA 4QPAA 1BUHA 3PP0A 3HKOA 5ANGA 4DFLA 5B2LA 1YKRA 1UKHA 3N9XA 2W1CA 1M7NA 4XRJA 4DFNA 2BKKA 1YHWA 3UDZA 4DHJA 2GS6A 2X2MA 3FC2A 3NSZA 2IF8A 3D2IA 5HHWA 1GIHA 2HWOA 4RZWA 3BKBA 5ANEA 3U9CA 4LM5A 1U54B 2KTYA 2Y4IB 3O8UA 4IE9A 4XV9A 3QGWA 5HVYA 3W16A 4ACMA 4UWCA 4F7LA 3PWYA 5EKNA 3N4VA 2W1GA 5JFWA 3FMLA 2PK9A 3PYYA 4KB8A 3GCQA 3KF4A 1PXPA 2CMWA 3W0PA 5C8MA 3RJCA 4FT0A 2DS1A 2BPMA 3IECA 4YP8A 2YIRA 1H07A 3G90X 3IO7A 3ZO2A 3QHRA 4MTAA 4NTSA 5T3QA 2F9GA 4L6QA 4EUTA 2Y9QA 3FEGA 3U6JA 2PTKA 3C4XA 3DLSA 4AE6A 3DK6A 4H58A 4YLLA 5CU3A 3CR0A 4IZYA 1KV2A 3KFAA 3VQUA 4HPTE 4Q5HA 4XV1A 3V51A 2GHMA 3C4EA 2QLQA 3G6GA 4QP8A 3EH9A 4IB5A 4MXOA 5HCYA 3TV6A 3CQUA 4MX9A 2A2AA 5BX0A 4QDEA 2OIDA 4OBPA 1W8CA 2GMXA 3RPRA 2X2KA 3SX9A 4E6QA 2YCRA 4XG6A 5A4CA 4RJ4A 4KKEA 4IAIA 4D1XA 2XBAA 4BWPA 2GQGA 1F0QA 3DQWA 4ID7A 5EOLA 1F3MC 3NPCA 3NWWA 3AKJA 4UEUA 4EYMA 3K3IA 4KIPA 4RC4A 4QMVA 2GFSA 2WTKC 3LFCA 3OOMA 3MY5A 5EDPA 5C27A 3VS5A 4HNFA 3ZO1A 4CG8A 3CPCA 4ZLOA 5HKMA 4QNAA 4IVAA 4EZ7A 3SRVB 2GNHA 4C4FA 2JIVA 2XRWA 3KMUA 3LFEA 3PSCA 1UVRA 4C35A 4A4OA 3TZ7A 3I4BA 2W96B 3EN4A 5H2UA 4PNKA 1WZYA 4XOZA 2R7IA 3OVVA 4QMOA 4QMLA 5CU6A 4R5SA 3KK9A 3HV5A 4HGSA 4JJRA 4C8BA 5IQHA 5DPVA 3Q9YA 2PZPA 1BYGA 2GSFA 4FT3A 4H36A 4XX9A 5J79A 3WZEA 4TYGA 2OZAA 3P86A 3WF5A 3R8MA 4ZLYA 4E4XA 4R5YA 3F3VA 1GZNA 2ZYBA 4V0GB 4C62A 4DEIA 3KU2A 1ZOGA 4M0YA 5AV4A 4FV9A 5HU3A 5J7BA 1SVHA 4QMXA 4F1MA 4UX9A 2ZOQA 5BPYA 3W0MA 3JPVA 1H1QA 2YIXA 3W0SA 1XWSA 1PY5A 3DB8A 4GVJA 5LOHA 2BHHA 2R0UA 3VONA 2BTRA 4MNEA 4RX5A 5IEVA 2B7AA 3OC1A 3FQHA 5C01A 3WF8A 2YA9A 2V7OA 3PSDA 3RGFA 3ZUUA 4G16A 1YXSA 4NH1A 2E9NA 2VTTA 5HBEA 1Q41A 2W5BA 1M17A 4GSBA 3VBYA 4EHEA 4F99A 1U5QA 2IZRA 2EXCX 2QLUA 4B8LA 4Z3VA 1Q8ZA 5A54A 1XH6A 3ZCLA 4G31A 4O91A 2WMWA 4Z16A 3FL4A 3WILA 2UZNA 2R3MA 3FI8A 2ACXA 4KBKA 1Q97A 1L8TA 1NY3A 4BGGA 3KXHA 1M2PA 1YDRE 2NPQA 2XKEA 5CQUA 4HW7A 5C4KA 2YZAA 3R7YA 2BUJA 3IDPA 3TACA 4WKQA 3QWKA 1KE5A 4D2PA 1TVOA 4LDTA 4HCUA 4P2KA 5AUZA 4ZJVA 2C1BA 3A7JA 2R2PA 2XK9A 4IM3A 4KBCA 5E8SA 3FLSA 5C1QB 3EQRA 3OWKA 4FSZA 4IB0A 2WIHA 2FGIA 1HOWA 3Q53A 5IF1A 3QHWA 3KA0A 2BILB 2X8DA 3M42A 5GNKA 3COHA 3QTQA 4PV0A 5HNGA 5LQFA 4IADA 4QMZA 2XKDA 2W7XA 4G6LA 4M14A 4K2RA 1CKPA 2FSTX 5LXMA 5ETFA 1SNUA 4IM2A 4K9YA 1FGIA 1URCA 2GNFA 3L9MA 4ACHA 5CVGA 1PXNA 2NYAA 4IWQA 4L42A 4YZMA 2C6LA 4FC0A 4YPSA 1YI3A 1WFCA 2W1ZA 2WKMA 2Y0AA 3O17A 4RX9A 4XG8A 3BQRA 1JOWB 1AD5A 1V0OA 3T8OA 1CDKA 2WQMA 3QCQA 3QRIA 1SYKA 5JZNA 1GJOA 2C69A 1ZY5A 3P23A 4ZTQA 5TOZA 4U0IA 1GZOA 4XCUA 1ZARA 2ZM1A 4L43A 2ZDUA 1PXJA 3FMHA 4TYIA 4O82A 2R0IA 3RNIA 4YUQA 5KCVA 3LFBA 3DS6A 2C3KA 3QTWA 5AM7A 5HE3A 3OCTA 4DG2E 4EUUA 5CT7A 5IQGA 4GMYA 4IQ6A 2YFXA 4J71A 3EHAA 4D4RA 4R3RA 1H1SA 1YI6A 2HENA 4EJNA 4FKPA 1GZKA 1QPEA 4RA4A 3A4PA 3E92A 2A98A 2W1EA 2YAAA 5EI8A 5ANDA 3RAKA 3NYXA 3C4CA 3ORTA 4Z55A 2F2UA 4MXCA 1IA8A 1FINA 4ZY4A 2GHGA 4AFEA 2C5YA 2EB2A 3EL8A 3OOGA 4MVFA 5DT4A 1G8JA 3HAMA 3A62A 1LEWA 3UYSA 1M7QA 4RRVA 4X2GA 4QYYA 4UMPA 4C0TA 4QMTA 3C5IA 3RMFA 2HZ4A 2RL5A 3AD4A 5AR5A 5BVWA 4HPUE 2JFLA 4ZTLA 4OTRA 4LFIA 4RIWB 4K6ZA 4EEVA 4CKJA 5K9IA 2XALA 3P9JA 5HU9A 1O6YA 1OPKA 2RFDA 4E6AA 2OIQA 2R3NA 5F1ZA 2QONA 2QQ7A 3CJFA 3UVPA 4BCJA 1RDQE 1V0BA 2ZMCA 2Z02A 3BYUA 3PJ3A 4FSWA 5IG1A 2XK3A 4FK6A 4MNFA 1FQ1B 2X8EA 3LHJA 3MSSA 3AMAA 3CEKA 3QUDA 5AP1A 2VWZA 3RHKA 3SDJA 5FGKA 3VS0A 3W55A 4EH7A 4A9YA 5C26A 1FVVA 3O5AA 4KIOA 2UW8A 3LKMA 1NA7A 2UW5A 1YHSA 4FIFA 1JKTA 2X6EA 1QPJA 3PXQA 3CXWA 3F61A 4OLIA 3ZZEA 4H3PA 2FSOX 4BCQA 2Z7QA 4MYGA 3LOKA 3EFWA 5CENA 1I44A 5F9EA 4O0RA 3PUFC 1J3HA 3AC4A 4QQCA 5DR6A 3MS9A 4I0RA 1OUKA 5GINE 4I93A 3Q2MA 2PZIA 5HLNA 1P4OA 4NW5A 4IZ7A 4UMRA 4U7ZA 2BFXA 4Z7GA 2OFVA 5I9UA 4V04A 2VTNA 4P5ZA 3F7ZA 2QOOA 2QNJA 3DXNA 3KXNA 4I6BA 3OD6X 5DGZA 3UZPA 4QQTA 4X6QC 3PXYA 3V5QA 4TPTA 2PULA 3QX2A 5BYLA 3HEGA 5KUPA 1W2CA 2X1NA 3KEXA 5DVRA 3ZFXA 5AIKA 3BLAA 4FR4A 4BZNA 3WF6A 2C3JA 2J0JA 1H27A 3RK9A 1Q5KA 3E88A 4AZTA 3FKLA 4F0FA 4O6EA 5CT0A 4QEBA 1JAMA 4DGLC 1H00A 4RWKA 5BVNA 4CRLA 5KMNA 3FY0A 4FTMA 4BDHA 3FMMA 2B1PA 3OTUA 4FKLA 4Q9SA 2W4JA 5DOSA 3EKKA 4F6SA 3W0OA 4QTCA 5CF4A 3UBDA 5E92A 4JI9A 4FK3A 4I24A 4I6QA 4ZY5A 5GZAA 4KAOA 3GB2A 3NNVA 4U42A 4XBRA 3E8NA 4AT5A 4WSYA 5A4TA 5CEOA 4LV5A 1J7UA 4FEVA 2O2UA 2OK1A 3R1YA 4O0WA 3FPMA 3QQUA 2PVRA 4MD8E 3N51A 5IQAA 3R6XA 4K33A 2W1HA 3ZO4A 4GCJA 4RFMA 3VBXA 3F69A 3OWLA 2I0YA 4JT3A 3WYYA 5HTCA 1I09A 2H6DA 4IC8A 4FNWA 4N57A 1Y91A 4DCEA 3UO6A 2J4ZA 3FMDA 2WQEA 3DU8A 4C37A 4OTGA 3AG9A 3HRCA 3O96A 4RPVA 3VUTA 3SVVA 4QMPA 4BDDA 5G1XA 1EH4A 5D12A 1BI7A 1Y6AA 4XLIA 3BU5A 3PY3A 4IAFA 5EYDA 4G34A 4B9DA 4CKRA 5L6OA 2HW7A 1P2AA 4JR3A 3FLQA 1Q3WA 5A6NA 5DA3A 4FZ7A 5DR9A 3TEIA 3BL9A 3AOXA 2O8YA 1JQHA 2J7TA 4CZTA 3ULZA 3VO3A 4ENXA 2E9OA 3O51A 4S30A 3THBA 1OKZA 2CKEA 1OKYA 2PUUA 2UZDA 2X4FA 4CCBA 3DDQA 3TKUA 4BCKA 4D4VA 3MDYA 4E6DA 2VWUA 3SW7A 3I6UA 4FYOA 3G9NA 2UVXA 5B0XA 1BLXA 3TJDA 5BUJA 3U8WA 5EW9A 3BZ3A 2BHEA 3CQWA 4O21A 4AN2A 2B9JA 4ASZA 4D0XA 4BICA 4EQMA 3TUCA 5AUTA 4D2SA 3D2KA 3ULIA 3VBTA 3WBLA 4ACDA 3HMNA 5FD2A 2XAMA 3BWJA 3Q4CA 4I94A 3QTRA 4U40A 4FKTA 5IA1A 3ZBFA 3IW4A 5KKRB 1ST0A 4FOCA 5E91A 3SAYA 4OGRA 1CTPE 3I60A 5FBOA 1ZLTA 3R1NA 4QNYA 5CXHA 5LARA 3D0EA 3FMKA 4OT6A 4XG3A 3FXZA 2XK6A 3LMGA 4C33A 5LVMA 2OSCA 2C30A 4JS8A 4AA4A 1A48A 3GOPA 3BYMA 5BQ0A 4M66A 2B54A 3I0QA 3H30A 3GC9A 4E1ZA 3BRBA 3NCGA 2H9VA 3E8DA 3PY0A 4NFNA 3PPJA 5I3OA 4AZFA 3Q32A 3ZFMA 2IW9A 3KCFA 3LE6A 4E73A 5BNJA 3RHXA 4CLIA 2JITA 4BCMA 5EM6A 4XHKB 4GIHA 5FTGA 2GPHA 3QTZA 5EHYA 1K2PA 5IQCA 4IAAA 4Q5EA 3TN8A 4FE2A 2RFNA 4BC6A 5IH5A 2WOUA 4YLJA 1CKIA 3UMWA 4AP7A 3TT0A 2C3LA 4BCFA 2WB8A 4TYHA 4QP4A 4XG2A 3TKHA 4I5CA 1Q62A 4YC8A 2XCHA 4DHZA 1PXOA 3MIYA 4QP1A 4O7RA 1O9UA 3QLFA 2QC6A 2WGJA 4O7VA 5CEMA 2J51A 4GG7A 1YOMA 2OKRA 3HLLA 2QHNA 4LRJA 3QD2B 3P1AA 4QYEA 2VU3A 4CEGA 4CKIA 2XH5A 2WQNA 3KXXA 4FTTA 2CN8A 4AACA 3SA0A 3V6RA 4FIEA 5AMNA 5TO8A 2C4GA 5FM2A 5FTQA 4ITJA 2VO6A 4U3YA 4J1RA 5EI2A 3LLAA 3FDNA 2UW7A 1NVQA 3KC3A 4FVQA 3QC9A 2XEYA 3MH1A 2BIKB 4JDHA 3KRJA 3KRXA 5KE0A 3M11A 5G6VA 3NYVA 3WF9A 3JS2A 4EHGA 2FH9A 1XMMA 3KULB 3BWFA 4AGCA 4DG3E 5HQ0A 2WAJA 1UU3A 1XBAA 3CKWA 3S95A 1GIIA 4MBLA 3W2PA 3OY1A 3D5XA 2GTNA 2XCKA 3RTPA 5I9ZA 1G5SA 3BLQA 3PIZA 3VBQA 5KHWA 3NYOA 5JN2A 3HV4A 2YLEA 4M3QA 3OHTA 4X2JA 3ZZWA 4X7QA 3ZH8A 4WUAA 3OS3A 5H8BA 3NVMB 2EUFB 3M1SA 5DNRA 4YTFA 4QTAA 5ETIA 1DI9A 4CD0A 4N4SA 3HV7A 2VNWA 4E5BA 4DEAA 3PJ1A 4KIKB 4QO9A 1OL1A 3VC4A 4G5JA 5DE2A 2OG8A 3QF9A 4I5PA 1KE9A 1J7IA 3H0YA 3HDMA 5L2SA 2V55A 1IAHA 2QG5A 4FG9A 2FUMA 4UYAA 4ALUA 3ZXTA 1W82A 5CEQA 3C0IA 5I0BA 5CX9A 3ZSGA 3JYAA 4I4FA 2J2IB 4ZMEA 1PMVA 3R22A 2UZOA 3EN6A 2QOKA 3FMEA 4JR7A 4IBMA 4YR8A 1VR2A 3QQFA 5J9YA 2VWVA 1JSTA 4BDGA 5GJDA 2QG7A 4FEWA 1KOAA 4YJQA 4N6YA 1XKKA 3G2FA 4F9BA 5CF5A 4FKJA 4E3CA 4AOTA 3VF8A 4NW6A 3COMA 4FV1A 2OJFE 2W1IA 4TYEA 2QKRA 5HG7A 3ZUVA 2RG5A 5CEKA 4GL9A 1YHVA 3T3UA 3WZUA 4EK5A 3LXNA 1JSVA 2YM8A 3FLZA 3QKKA 3TIYA 2G01A 1BI8A 3NUNA 1OIYA 5EDRA 3HNGA 4MD7E 2VTQA 2R3IA 2WMTA 4F09A 2HWPA 3ORXA 1XQZA 4FIIA 3ZBXA 2F4JA 3LCKA 4YNEA 3ZU7A 2PHKA 3AQVA 3CC6A 3DBFA 3HZTA 3S2PA 4F9YA 5BV3A 5IUIA 1ZRZA 3EQCA 4FV4A 5AP3A 3CD3A 2IVSA 3DZQA 2LGCA 3DKGA 2CPKE 1TQIA 1WBVA 3F2NA 3PVBA 3P79A 4GH2A 4WG5A 4FV5A 4Y5HA 3TI1A 5CF8A 1ZY4A 3TUBA 4BDKA 3UDBA 2YIWA 3DKFA 3HRFA 1KE7A 3R8LA 3HV6A 4DDGA 5CTPA 4EJ7A 2Y8OA 2VAGA 3BX5A 3MFSA 3PZEA 2IZSA 5AWMA 1Q4LA 3W0RA 4X3FA 4F78A 3GP0A 3KVWA 3ET7A 3EQFA 3A4OX 4O4DA 4FEUA 1Q61A 4XUFA 5JH6A 4QQ5A 3LLTA 4D2VA 4DAWA 4C02A 3ELJA 4FF8A 4A07A 4WNOA 5BVFA 4BIEA 2CGXA 2JAVA 4MXXA 2PSQA 3FKNA 5IQBA 2CLQA 4CG9A 4JBVA 4KRDA 2OLCA 3UG1A 3OCSA 2IW8A 4X3FC 3F82A 4EHVA 1DAYA 2WTCA 4I5HA 5GIOE 4CSVA 4F63A 4O4FA 4KRCA 2V62A 4PL4A 3DT1A 3GCSA 3E3BX 1Z9XA 3D7TA 4XYFA 5LVLA 3V5WA 3FLNC 4FZAB 4Y8DA 2OF2A 2LAVA 3RINA 5CAOA 2BZKB 5AA8A 4L67A 4AQKA 4L7SA 3PJCA 4U45A 4AA0A 1YWVA 3OWPA 1XHAA 4QPMA 3TZ8A 2B52A 1FOTA 1BL6A 3DJ6A 2W9ZB 2JKOA 4AA5A 3PG3A 2E9PA 4ZOGA 2WMUA 5F4NA 3ZONA 2W06A 2F49A 2P2HA 2XEZA 2G9XA 4MHAA 4DA5A 1E1VA 5FUTA 4L3LA 3VW8A 4BCNA 3NDMA 2BAKA 4FV7A 5H8GA 3GC7A 2X39A 4PTCA 4O7YA 4CT1A 3NLBA 3AKKA 3A7GA 4C61A 5AAGA 4PPAA 1RW8A 2VO0A 3CPBA 3BGZA 4APCA 3ALOA 5HD4A 1W7HA 4DGNA 4LMNA 2YCFA 3QZHA 3E63A 4FT5A 3E8CA 2WMAA 4EOPA 4MUQA 4JQ8A 5J7HA 1OUYA 3F2AA 5H9BA 3FY2A 1G8SA 3QX4A 2VTLA 5AAFA 4V05A 3UOLA 3PXFA 4FIJA 3DBDA 4IVBA 3P0MA 3GFEA 4QYGA 3Q4ZA 4M84A 5ETAA 1IRKA 2JIIA 2XJ1A 3BHYA 5DEYA 3UOHA 2G2IA 2HXQA 2X4ZA 3BBTB 4HJOA 3RVGA 4RC2A 3ZOSA 1ZZ2A 3RPYA 2WEVA 3HMPA 4D1ZA 2VTJA 4F1OA 4UALA 3FQEA 4QYHA 2Z2WA 5DRBA 2RF9A 3MESA 3TCPA 2UZBA 3QA0A 2A27A 4Y46A 4YURA 5CQWA 4FKGA 3FL5A 3DKCA 5M08A 4NSTA 5GIPE 2CLXA 1B6CB 2C5XA 2JD5A 2QOBA 3HL7A 3HX4A 4OBQA 3HGKA 2CNQA 4DH7A 4ZTNA 1U46A 4ZSLA 1NVRA 2VTPA 3COKA 1PMEA 2WOTA 4JLCA 4M67A 2YJRA 4P7EA 3KK8A 2VN9A 3CQEA 1LP4A 3EN5A 5AAEA 4EOSA 1UNLA 3Q4UA 3FQSA 4L46A 3A60A 4EBWA 3TNQB 3D83A 4AUAA 1H08A 1UNGA 4JG8A 3GVUA 4YJPA 5T68A 4KKGA 3QTXA 3QU0A 1Q24A 3QRUA 3MH0A 3FZOA 1PRYA 4ANQA 1HCKA 3C50A 3VJOA 4YZBA 5A4EA 5JRSA 4CV8A 4RSSA 3D5WA 2J0KA 4E26A 4DGMA 2FVDA 1YXXA 3E8EA 3HMOA 3QLGA 5DLSA 4BI1A 4QOXA 4O4EA 3IGGA 4YSMA 3VIDA 3R04A 5AR8A 5IEXA 4TYJA 1ZOEA 3UIBA 5DBXA 4IDTA 1H01A 4BFMA 1F5QA 3VAPA 3L9NA 2YERA 4I5MA 4I6HA 4TWPA 2GFCA 2A1AB 3IOKA 3MVHA 4CFFA 2GHLA 4L3JA 3F5UA 3ORPA