3W8QA

Structure of the human mitogen-activated protein kinase kinase 1 (mek1)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
344
structure length
318
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in "DFG-Asp Out" conformation
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 318
sequence length 344
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w8qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w8qA01
2PMNX 2WTKB 3KF4A 4U8ZA 5EQEA 1O9UA 4V01A 3C4FA 1JBPE 4L43A 4NW6A 1UNGA 4Y5HA 4GFOA 4EZ3A 3DZQA 2ZDTA 5M06A 2E9PA 1ZZ2A 4I22A 3ATSA 4W8EA 1UNLA 3P08A 3EYHA 2FYSA 2WMTA 4MAOA 5AP1A 4O6EA 3MVMA 2IVTA 2XK8A 3ZFXA 4XG9A 5AP2A 2H96A 5A9UA 4KAOA 4FV5A 3HAMA 1H1QA 2PULA 4FKQA 3Q9WA 5HIBA 3SKCA 3TTJA 4X3FB 2BR1A 2YIYA 4IZYA 4NW5A 4RX7A 4U44A 4GH2A 4MQ1A 5J9LA 2WTCA 3F5GA 3VHKA 4B0GA 5AUTA 1VR2A 4QP3A 4CLJA 1ND4A 4QQCA 2B53A 1WFCA 5F95A 1RW8A 3QF9A 3LXNA 4GVAA 4MXXA 4PL3A 4U80A 5CT0A 5M4CA 4G3FA 5C26A 2QU6A 4MBLA 5ANGA 1GOLA 1H1PA 1KSWA 2ETRA 4MH7A 4E4LA 5J87A 4FKSA 4A07A 4YHFA 3UC3A 4IAKA 2WQEA 4KBAA 4AGUA 4JIAA 2YJRA 4QTCA 3OXTA 4FKPA 1ZOEA 3UYTA 3DNEA 5BQ0A 4Q2AA 1ERKA 2YCFA 3GB2A 4I94A 4GK3A 4QYYA 5CU4A 4EQMA 4DN5A 5CF6A 1Z9XA 5IQIA 3HP5A 2BRHA 1QL6A 3SW4A 3QRIA 3HMNA 5LVLA 2R3NA 1Q8YA 1ZMUA 1B39A 1KE8A 1Y6BA 3H30A 2B7AA 3P5KA 3PP0A 4HYHA 4I5CA 2RFSA 4BKZA 4C34A 3A61A 1OBDA 3DTCA 3EN4A 1GY3A 4JBPA 2R3KA 4FA2A 3G2FA 4EHZA 3TUDA 4A9TA 3UNZA 1H01A 2WEVA 1RDQE 3DNDA 3C5IA 3NZ0A 3UIUA 1FVVA 3P7BA 5L2QA 5CU0A 1STCE 2CSNA 2SRCA 3ZBXA 1VYZA 5HO6A 4QMMA 3PRIA 3IQ7A 3TZ7A 2I0YA 3F82A 4PWNA 5LVMA 2VWUA 3FDNA 3EQHA 3OD6X 5KKRB 2WMXA 3LW0A 3CXWA 2XM9A 3Q4UA 4BWXA 1F0QA 3IW4A 1SM2A 2J0IA 4DE4A 2R3RA 4XUFA 4WNPA 3O50A 4LL5A 3MSSA 2JGZA 3PVBA 3C9WA 5HLPA 4IFCA 5GINE 3ORPA 4IB3A 1SVHA 3GC9A 3HMPA 4PUZA 3UZTA 2CLQA 3ZLYA 4WUAA 5HESA 2J5EA 4C02A 3QC9A 3CY2A 1JVPP 3NUAA 2YIWA 5CF5A 2JDVA 2VNYA 4IEBA 3ZCLA 4UZHA 3KXXA 4S33A 2V62A 3QHRA 4XH6A 3WZJA 3ZDIA 4L53A 4P7EA 2XIRA 4QT1A 1XH5A 1WVWA 4ZTNA 3BBTB 4S2ZA 5KCVA 4IAFA 5HBHA 2IJMA 1H28A 4B9DA 4BDIA 1JSVA 4H1JA 3LAUA 3PG1A 4GJ3A 5AP7A 4C4FA 5CX9A 2X2LA 4GVJA 2WMSA 2WAJA 4MBIA 3Q32A 1KOAA 3QCSA 3THBA 4F1TA 4GKHA 3HL7A 3A99A 3D5WA 3IW7A 4R1YA 5HE0A 3RCDA 2DQ7X 1LUFA 4GYIA 1U54A 2VZ6A 2XNEA 4HYUA 5FRIA 3VS4A 2QU5A 4UV0A 4D55A 2OZOA 3GCQA 3TZ8A 4FL1A 4R3RA 4TXCA 4KINA 3U51A 3VUMA 2NP8A 5FTOA 2QOHA 5CI7A 4EK6A 2C6MA 3MGYA 2WTDA 4YJPA 4D5HA 1SZMA 1ZXEA 3SX9A 4A9YA 3CBLA 4Q5HA 1U59A 3NUYA 5H3QA 4CCUA 2WELA 4RIWA 4WIHA 1CKJA 1P4FA 4X21A 4F9YA 5LMKC 4FIEA 3BHYA 2PZYA 2JBOA 1LP4A 3I0QA 4OTGA 2VN9A 5FM3A 4OTDA 1UWHA 2W9ZB 4R3CA 5J9ZA 4PNKA 4FIFA 5DFPA 3FLZA 4H05A 5ETCA 2VTHA 4AS0A 2BALA 3DAEA 1M2PA 3FXXA 3W8QA 2W1ZA 3W32A 2XIXA 4O7TA 3FE3A 2PVMA 4O82A 4O0RA 4O7ZA 4W8DA 3VBTA 2HWPA 4TWNA 4WSYA 4JBVA 3W33A 4V0GA 4AXAA 3ODYX 3GC8A 2HW7A 2RSVA 3MFRA 3N51A 4OTWA 3FYKX 3OVVA 4RJ3A 2IO6A 4TW9A 2YAKA 3W1FA 4HVIA 4TZRA 3AC2A 4FVRA 4AGCA 1OKZA 1PYXA 5C01A 1KV2A 3CJGA 2EU9A 2VO7A 4UMTA 2UZTA 2WMUA 4EWQA 3BU5A 2WU6A 3MBLA 1IG1A 2CLXA 3QL8A 4C4GA 3IO7A 1T46A 3PSCA 2XYUA 4M8TA 1O6KA 3DGKA 4W4YA 5AM7A 3WZDA 1FINA 5D7VA 5HQ0A 1YHWA 4FTRA 4E6QA 3KRJA 4WSQA 1KV1A 3L8XA 4O1PA 5FDXA 1UU8A 5IH4A 4KUJA 3CQUA 3EYGA 3A62A 1ZYDA 3KL8A 3PIXA 2YM7A 3I6WA 3AD4A 4QOXA 1H27A 5EDQA 5EM7A 3IOKA 5K4IA 2ITPA 1DS5A 2BRMA 4KS8A 5DOSA 4ENYA 4QMWA 5HNGA 3Q4TA 4FZFB 3PIYA 1SYKA 3MA3A 5LVOA 4FZAB 5FEQA 3ETAA 4FT5A 3FAAA 5E4HA 4XV2A 4HCTA 3OUNB 3NCGA 4BRXA 1Q8ZA 2VX3A 2OW3A 3EH9A 3SDJA 2J6MA 2QHNA 2R3IA 3R7EA 4EK3A 4WBBB 5DVRA 1CSNA 3Q60A 4BDHA 1WBPA 1XH6A 5CU2A 2PZPA 3O71A 4GK4A 4RQKA 3F7WA 4HPTE 2GHGA 4EKKA 4TKSA 5B0XA 3E3PA 3QQLA 2FA2A 2JDOA 3GGFA 3LKMA 2UZEA 3ZMMA 3E62A 3QZFA 3NVKI 4FT3A 4NJDA 5T6KA 4AG8A 5M4UA 2CN5A 2XMYA 4D9UA 3O8PA 2QOLA 3IOPA 2W0JA 3MW1A 4NUSA 4U3ZA 5L6WL 4AN2A 3WILA 5BMSA 1ZLTA 4O0YA 2WMAA 4RZWA 5FUTA 4IWPA 3SVVA 1U4DA 5TOZA 4QQ5A 3EKNA 4ZK5A 5CI6A 5IEVA 1TQPA 4DTBA 2XUUA 3OWLA 1GJOA 3PJ8A 2X4FA 4IX5A 5CEMA 2B52A 5GJFA 2Y0AA 4C35A 2YZLA 1PYEA 4NEUA 1OKWA 3OC1A 5HO8A 2UVZA 3FHIA 4ANMA 1ZMVA 1AGWA 4ANBA 4FIGA 2C1AA 2W5HA 4NU1A 4Y46A 2PVKA 5FG8A 5K5XA 5EM5A 4M69B 4YO6A 4BDKA 3PPZA 3EN9A 1M2QA 3EQBA 4YJUA 4BTFA 3KXHA 1BL6A 3R9NA 3MIYA 1OPJA 4K6ZA 4X2NA 4USFA 4JAIA 4EKLA 3QKMA 4AGDA 5DMZA 3FSFA 2J0KA 3UVQA 4X7QA 4EHGA 4A7CA 2W4JA 2C30A 5EYCA 3I4BA 1YDSE 4R1VA 2QOBA 1YOMA 4J52A 4CXAA 5HG7A 4CYJA 3HRCA 5BMMA 3HA6A 2AC3A 2YA9A 1YXSA 3SRVA 3ZSGA 5IUGA 3R7OA 1JKTA 3ELJA 5DR2A 4EBVA 3ANRA 4NK9A 2F2CB 4LV8A 4F70A 5IMEA 4BWPA 3S2PA 3Q4ZA 2IZUA 3O0GA 3PIZA 2W99B 4JNWA 3QC4A 5IA5A 3UO4A 2OIQA 4OTIA 4I6QA 3FPMA 4NWMA 3CE3A 3H9RA 3V8TA 3D7TA 3ZU7A 3FMNA 5DYJA 4RT7A 3NX8A 5AAEA 2X7FA 2FH9A 1W8CA 2EB2A 4ZTQA 3R1YA 4G3DA 4AZEA 1YI6A 2IPXA 4ID7A 4FV6A 3K5VA 3O7LB 2EVAA 4ZAUA 3T3UA 4CTCA 4L00A 4L3PA 2WMRA 3OXIA 1BL7A 1OITA 3GU4A 4GCJA 2AYPA 4IFGA 5L6PA 4ASDA 1UU3A 5AEPA 5CAVA 2BAQA 3EOCA 1YQJA 4E5WA 3PSDA 2W1GA 4XG2A 4IAYA 4QMXA 3D4QA 5ETFA 4BCIA 5I0BA 4KIOA 5DEWA 3HV5A 1Q61A 4F1MA 1PXJA 3EFKA 3RPVA 2J51A 4ARKA 5BPYA 2O5KA 2C69A 4QMUA 5AR8A 3SGCA 3Q5IA 4C36A 1IEPA 3DXPA 3JVSA 3VBVA 4ANLA 4EOJA 1QPEA 4XG8A 3UG1A 3ATTA 3UBDA 5IISA 1JKLA 4ITJA 4APCA 3W2SA 2UW9A 2W05A 2WEIA 3DLSA 5JRSA 1NA7A 3IECA 5EKOA 1TQMA 4FT9A 4CKIA 4D2RA 3IW6A 5CU3A 1G8AA 2XK4A 3BI6A 4ZJJA 4M13A 4B8MA 4IB5A 4IXPA 5JH6A 3ZLWA 1MUOA 1PMEA 4MD9E 4EBWA 3SA0A 3F5PA 3MS9A 1AD5A 2BDFA 5DT0A 3BCEA 3Q53A 4KKHA 1OL2A 4F63A 3PSBA 4FTMA 3EFJA 3D5VA 2ERKA 3E93A 4FV3A 5LOHA 4D4YA 2R3FA 4R7HA 1H1RA 1NW1A 3A7JA 4MNEA 3QU0A 2WB8A 5HO7A 4N0SA 2IZRA 4F99A 1OPLA 3OT8A 3QAME 4O96A 1BYGA 1MP8A 4OAUC 4CTBA 3DV3A 2C1BA 4IDTA 4TTHB 2WTVA 4TYHA 3GFWA 4M12A 4O7YA 4PTEA 3K2LA 4U45A 3R83A 4LI5A 3ZLSA 2YM6A 3GU8A 3NW5A 4KKGA 3SG9A 5E8TA 2FGIA 4AW5A 3DXNA 4JVGA 2PE1A 5DH3A 5A4QA 2Y9QA 4U9AA 3F69A 3A8WA 3EFLA 4QMSA 3W55A 2ERZE 2UW5A 3O2MA 1G3NA 3LCTA 4OTHA 4OTPA 3A60A 4J99A 3WF9A 5A6OA 2Y4PA 4FV9A 5CANA 2Z02A 5FEDA 5A54A 3DS6A 3LOKA 1U54B 2PL0A 4H39A 3AD5A 4CZYB 4O0WA 5CSHA 4ZY4A 3KN6A 3R8VA 3FY2A 2PUUA 4CEGA 3G90X 3FLNC 1UU7A 2QODA 5J5SA 4GT3A 2F7ZE 4C33A 4YZCA 3RTPA 2CGVA 2YACA 2FVDA 5IQFA 1JQHA 4CFNA 5B2KA 4CLIA 2JD5A 4D1ZA 1R0PA 4YHTA 5T3QA 3RBWA 1Q97A 4U3YA 4KRCA 5LXMA 3D5UA 3FI2A 2BCJA 4FIJA 3VVHA 3GCUA 4IWDA 3OMVA 2VUWA 3KF7A 3KRRA 5E8SA 3R9HA 4YNOA 3G0EA 1E9HA 5FBNC 3TZ9A 2X81A 4S30A 4D5KA 5DLSA 4BBEA 4TYIA 3NR9A 2O2UA 3KVWA 2ITQA 2XNNA 3ZONA 2VGOA 3KB7A 5IQAA 2JBPA 4XBUA 4IQ6A 4FNYA 2FB8A 5F1ZA 3VS2A 4ASZA 2YCSA 3LFEA 5HE1A 4NT4A 3RGFA 3ET7A 3W2PA 4LFIA 2KTYA 4YP8A 3FZOA 3LPBA 5E90A 3DCVA 3R9DA 3VNTA 4DEBA 4FSTA 3RPSA 3SD0A 2UVXA 5AIRA 3ANQA 3II5A 1E1VA 2V7OA 4UALA 4EI4A 2BKKA 4EJ7A 3G6HA 2ONLC 3LVPA 4O0XA 3R22A 1WBOA 2OK1A 5ANDA 5J1WA 5BVDA 2JITA 2XBAA 4QNAA 5DBXA 5AR5A 4AE9A 4AZWA 2DYLA 3OG7A 4B8LA 4DGOA 2P2HA 4EK8A 4TL0A 4ACGA 3FZSA 3MB6A 4CKRA 4YTFA 5KMJA 2BILB 2DUVA 4YLKA 3LXPA 4Z55A 4X2GA 2BHEA 2RFDA 4D0XA 2NRYA 1O6YA 4H1MA 3RMFA 4EORA 3UVRA 3T9IA 1EH4A 3QZGA 4HGEA 4UEUA 3QCXA 5DRDA 3EQGA 3MPTA 3NNVA 5IA2A 2WQOA 3F3ZA 3AQVA 1JKSA 4IMYA 5HU3A 3KKVA 3V3VA 4ANSA 3LHJA 4QYHA 4DFZE 4EOQA 4FT0A 2YLEA 4G2FA 2R0UA 4AP7A 1XBCA 5HU9A 3UP7A 4E20A 2XRWA 5LARA 1XJDA 2Z60A 3H3CA 4P5ZA 4W9WA 4FZ6A 3QX2A 1V0PA 4D9TA 2UZUE 4MYGA 2YM3A 4FGBA 3FYJX 2Z7LA 1UVRA 3R1SA 1LEZA 2P33A 4LGDA 4M67A 4CZUA 4F09A 2OZAA 5ANIA 4BDJA 3QQJA 4E8AA 1DM2A 5HZNA 3E5AA 4CT1A 3GT8A 3JYAA 2W5BA 2I0VA 3BE2A 4N6ZA 5DNRA 3UMXA 4MD8E 3DKOA 3CGOA 3QZIA 4GEOA 4LGGA 3ZO1A 2BHHA 4L7SA 2ZV9A 2DWBA 3QCQA 2XIKA 3R21A 4HZSA 4QMTA 5L2IA 2GTNA 3CP9A 1SVEA 1QPJA 4U41A 3AMBA 1DAWA 2QO7A 2ZM3A 4Y72A 5BX0A 4ZTSA 3C13A 3WF8A 2EUFB 1SMHA 4XBRA 2O0UA 2QC6A 4FSRA 1PW2A 5LMAA 3KXZA 2RF9A 5LWNA 5JN2A 3EKKA 2HENA 3UVPA 4JAJA 4G1WA 4FKUA 2VD5A 3FXWA 3GUBA 1ZYSA 2PUPA 2FSTX 3QTQA 1AQ1A 1K3AA 5AP6A 5JFVA 5CZIA 1TQIA 2YHVA 4I5PA 3CC6A 3WF5A 1E1XA 2OG8A 5HLNA 4BBFA 2CJMA 3UTOA 5IQHA 2QOCA 3IKAA 3GVUA 4M84A 3RHKA 2OBJA 5HE2A 3ZM4A 1A9UA 4KB8A 2PSQA 1M7NA 2OJ9A 4E73A 3NLBA 4EH5A 2I7QA 2E9UA 2G2IA 3SXSA 3DKFA 3TKHA 2FSLX 1M52A 3UZPA 4U40A 4R78A 1F3MC 2X1NA 3HDMA 3KK8A 3OOGA 5JGDA 4RWJA 3V5JA 4KSPA 3UQFA 2YIRA 5D1JA 4IX3A 4DG3E 4BKJA 3FZTA 3MESA 2VWYA 4DH7A 2W1HA 3OFMA 2OFUA 4IX6A 4DGGA 5KMOA 4L6QA 3UYSA 3VN9A 2VTNA 5HD4A 4WNKA 3IDCA 4H3BA 2JKOA 2GS6A 2WIHA 3RALA 4RIYA 4DGNA 5HTBA 5JGAA 1NVQA 2WMBA 3DT1A 3IGGA 3RK7A 1A48A 5IQCA 3CQWA 3OWJA 2O64A 4O81A 4EOOA 2XF0A 5FTQA 4CFUA 3V51A 3ORNA 3NCZA 4PX6A 5EOLA 4CV9A 5ACBC 3R9RA 5A14A 4Y85A 1URCA 4OR5A 2W17A 5IH5A 3EMGA 4PQNA 4FYNA 4JG6A 2QOFA 2QNJA 5BUJA 4DBXA 4FX3A 3REPA 3LM5A 5I9YA 5A4LA 5AUXA 3GEQA 4RC3A 5JKGA 1CKPA 2CCHA 3ITZA 4BYJA 2VWZA 4TNBA 4R8QA 3NUUA 1P4OA 3LQ8A 2PVLA 3LCKA 3N4TA 3KGAA 3UP2A 1XBAA 2B9IA 2R2PA 3FQHA 2I6LA 2JIUA 3VUIA 4BF2A 5LVNA 3FMHA 4UMQA 4XEYA 5FXQA 4Y73A 2NPQA 3GFEA 3R30A 3ZO4A 3I5NA 4CCBA 3G15A 3I0OA 3KA0A 3L8PA 3PP1A 3E63A 1H08A 4PMTA 1PRYA 2X2MA 5EI2A 5DHJA 4ZSGA 4PP7A 3U6HA 4DG2E 4GKIA 1J7UA 3TV6A 4CG8A 4YJOA 3PUPA 5BNJA 4CYIA 4C58A 5K5NA 4R3PA 5DWRA 1Q62A 4BCHA 3U6JA 3D7ZA 4MNEB 5HCZA 3OW3A 3EN5A 3FC1X 3PPKA 4QQJA 2Y6OA 5BVEA 3WBLA 4EOIA 4AW1A 3OEFX 1NT2A 3GQIA 2WTWA 1W84A 2BRGA 3TT0A 4EEVA 4G6NA 2ITNA 2C6OA 4JG7A 5E8XA 3OT3A 2GNJA 2CNUA 4TY1A 5CNNA 3ZC6A 4BHZA 3BU3A 5FDPA 3BWJA 5IQGA 2XK9A 3BEGA 4J8MA 3M11A 5AAFA 3TDWA 2WFYA 2H8HA 3QD3A 4IZ5A 3KXGA 2OF2A 4A9UA 3RP9A 3FMKA 5I3OA 2YEXA 3H4JA 4K2RA 4CFFA 1YHSA 3ZO2A 2QR7A 4LUEA 5JEBA 3BYSA 4L45A 2E9NA 3L8VA 4X2FA 1Q41A 4HGSA 3A4PA 5BVKA 2CNVA 2VNWA 3MJ2A 3ZSHA 4NSTA 4AFJA 4QNYA 4ERKA 5HBJA 4PDYA 3TNIA 4F0GA 2WU7A 3KREA 3OCTA 3Q6UA 3OXZA 3QD2B 3GQLA 1YHVA 2LAVA 2F7XE 2PTKA 3ZUVA 3FV8A 3DTWA 3WF7A 3CPBA 4Z3VA 3DBEA 1NVRA 3BLHA 1PXNA 2YERA 2VTIA 3H9FA 4MWHA 4DFUA 4C59A 3QFVA 2Y6MA 4EUTA 4LMUA 4ZSAA 5BVNA 3LJ2A 1NY3A 4U43A 3R7UA 2W4OA 2R3PA 3RAWA 4EH4A 2BUJA 5L2WA 3ENMA 3U9CA 3AC1A 1PMUA 3D5XA 4EC8A 5K4JA 4IE9A 5HI2A 3VWAA 4FUYA 4YJTA 5E1SA 4U97A 4KBKA 4JR7A 3NAYA 2R5TA 2W1EA 4QMZA 4DFXE 4J53A 3C0GA 1WAKA 2W96B 2ACXA 4YBKA 4ANOA 4P4CA 3ZBFA 4AUAA 1OIRA 4GMYA 3CIKA 5KZIA 5BYYA 2GPHA 4FOBA 1YWRA 5E8YA 5A4TA 1S9IA 4FG9A 1OI9A 3VS1A 3NPCA 4UWBA 2GHMA 1YI3A 3POZA 3DBCA 2AC5A 3SV0A 2X4ZA 3U9NA 3R01A 1L8TA 4E6CA 2CKQA 2C47A 4U79A 3ORXA 2CNQA 4IC7A 3VUDA 1PKDA 3V5TA 5M51A 2BRBA 2RFEA 3QQHA 3EZRA 3TNHA 1H1SA 1WVXA 3PVGA 5H2UA 2QOQA 2YCQA 4D28A 3PXZA 4AGWA 3EN6A 5J5TA 3F9NA 2UV2A 5EDPA 3QRTA 5CY3A 4H58A 4FBXA 3TIZA 1FBNA 3DAJA 3C4EA 2PMLX 5IU2A 3TKUA 2QHMA 3WIKA 1BI8A 3ID6C 2Y8OA 2W1IA 4MWIA 3DK3A 2RIOA 5KBRA 3VJNA 1M2RA 1FPUA 2CGUA 4I20A 5M4FA 1JLUE 2YDKA 2J5FA 3BZ3A 4CFMA 1UU9A 2QQ7A 3R9OA 3EQDA 1GIJA 4YTIA 4ALWA 4IWOA 1YXXA 4FSQA 5CF8A 5HORA 4J71A 4MEDA 4FGRA 4D2TA 1BKXA 5CASA 2C5VA 1VJYA 5EYDA 3O7LD 1MRYA 3A7IA 2OKRA 5M55A 4AA0A 3JXWA 3P1AA 4BIEA 1YXTA 2VX0A 4G31A 4DH3A 4AFEA 5B7VA 1M7QA 5CVFA 4O6LA 3SXFA 3TWJA 2QG5A 4QMYA 5AMNA 5K0XA 2PMIA 2YIXA 2XK3A 4AOTA 4FVQA 3DBFA 1A06A 4CG9A 3PRFA 3WYYA 2RG5A 4H36A 4ZEGA 4OT5A 5DG5A 4APPA 3BHTA 5AADA 3FI3A 4O7WA 4CGAA 4I3ZA 5F4NA 3RWPA 3RAKA 4GK2A 2OXXA 4EQCA 2IVVA 2GQRA 3CS9A 3ZZEA 4ZZMA 2VV9A 3HEGA 4BIBA 5TE0A 4E7WA 2J90A 4C2WA 3QRKA 2VTLA 4HYSA 4I1ZA 4JRNA 3KFAA 4XP0A 2C0OA 3OCBA 3I60A 5HEZA 4CQEA 4YO4A 5E7RA 4RIXA 3AD6A 1ZRZA 4CFVA 5DGZA 1NVSA 3BQRA 5KZ0A 4DCEA 3H10A 3LFNA 4K9YA 3UIXA 2J4ZA 3QTIA 4M3QA 4XS2A 3DB8A 3IPHA 4S32A 3COKA 3QUPA 4XYFA 5C8MA 4DCAA 1QMZA 1YXUA 3NNWA 3U4UA 3CLYA 5CEOA 5HTCA 4IBMA 3ODZX 3QTWA 5E1EA 3M42A 3P79A 2BRNA 2C3LA 3PA3A 3PLAE 5AIKA 2C6LA 3ZFMA 4JDKA 1APME 3UGCA 2B9HA 2EXMA 3FSKA 4D2PA 4HW7A 2W9FB 5KBQA 4GL9A 2YAAA 3BGPA 4HGTA 4JJRA 2J0LA 3VJOA 5HIDA 5DN3A 4D2VA 5DR6A 3SQQA 3NRMA 3BV3A 4ITIA 1OBGA 3MH3A 1MQBA 4M97A 4NKAA 3TEIA 5I4NA 5IG1A 5BUIA 5AV0A 2OJGA 2Q0NA 4E93A 3RZFA 3GP0A 4EONA 3E87A 4UBAA 2CDZA 4PMPA 4OBPA 2ITVA 3ORIA 1HCKA 1R78A 3MPMA 2R3JA 4BTJA 4PL4A 1G5SA 1PY5A 3DZOA 4A4LA 4QYGA 5G1XA 2EWAA 1GZNA 2QURA 3TUBA 3OF0A 3MPAA 3DQXA 1OL1A 4F9CA 4UWCA 2BDWA 3UE4A 4XRLA 1FMKA 3IG7A 5CSXA 4UZDA 2G01A 2UZBA 1PXIA 3VQUA 1LEWA 1ZZLA 4FTAA 4BHNA 4JL9A 3KULA 4I6FA 3SC1A 5J7HA 3K5UA 5AR3A 2JFLA 1YWVA 4PMMA 4QP4A 2QOKA 2ZM1A 4JQ7A 4U42A 4PRJA 4O7SA 4L3LA 2C0IA 3Q2JA 1H0WA 1H25A 5FP5A 1JOWB 3RVGA 3AMAA 3P23A 3R0TA 2HY81 1G8SA 4BCGA 3QQKA 4DEEA 5HX8A 5EHOA 4DTAA 1P2AA 1QPCA 3P78A 4BWKA 3HV7A 4G5PA 3KK9A 4CV8A 1R3CA 4F7SA 3N4UA 5EW8A 4WO5A 4A4OA 2GNHA 3ZM9A 5ITAA 3KCKA 4YSMA 4FNWA 4OBOA 5IH6A 1ZAOA 2UW8A 4BY9E 4NH1A 1YOJA 2CHLA 4ZP5A 3FKLA 3JPVA 5CEIA 5AUZA 4YTCA 3LCSA 3NIEA 4RIOA 2YWPA 2HCKA 3MY1A 2NRUA 4YJNA 3UPZA 5C8NA 3NNUA 4IX4A 2HZIA 5D41A 4YBJA 4XV1A 2GFCA 3PXQA 3LFFA 2W5AA 1K2PA 3NW6A 4HNFA 4PV0A 4W4WA 5L4QA 1M17A 3JS2A 3LFAA 2GS2A 4IAZA 2C5NA 2GTMA 3K54A 2BIYA 5AP5A 3VS5A 4F7LA 5HE3A 5EM6A 3WI6A 3F61A 3FMEA 4UYAA 2HXQA 1W83A 1RQQA 2GSFA 2PY3A 4I24A 5AX3A 4DITA 4WNOA 3V6SA 1JPAA 3V5WA 3F3TA 3UNKA 2YM4A 2BKZA 4XOYA 3S4QA 1Y6AA 3HRFA 4DLJA 3R28A 4MXOA 2ZAZA 4W9XA 4GU9A 3ALOA 2FO0A 3GCPA 4BGGA 4AU8A 1OL7A 4E26A 2VTTA 2X8DA 3AT2A 5FWKK 4O22A 4WHZA 3NDMA 4BTKA 3A7FA 4F9AA 2VWWA 2J9MA 4NM7A 4IACA 3R73A 5CAUA 4GW8A 3UOLA 1OIUA 4JOAA 2UW7A 2PVYA 4YLJA 4BBMA 5EH0A 5L6OA 3FXZA 3QHWA 2XEZA 3ZSIA 5JFWA 4KIPA 4DTKA 2P2IA 2PZRA 5DR9A 3ENHA 2ITZA 4QD6A 5L2TA 1J7IA 2PZ5A 3Q2MA 3HDNA 5AV1A 3S0OA 4CVAA 3MY5A 3QQUA 4U7ZA 2B9FA 2WHBA 3QTXA 4ENXA 2WMQA 4FL2A 3BLRA 4F65A 1L3RE 2OSCA 3QWKA 2PZIA 2EXEA 3IK3A 4JT3A 4XP3A 1H07A 5FLFA 4R5SA 5KNJA 4X2JA 3FKNA 4FEXA 4ANQA 4IWQA 4RVLA 3OW4A 3NEWA 1ZYJA 3ORTA 5DT4A 5ETIA 2G2FA 5ACKA 3UOJA 1FVTA 5AR7A 4RX5A 5JGBA 4ACMA 4M0ZA 5I9UA 1ZOHA 3F2AA 3O23A 1H4LA 4GJ2A 3EJ1A 4HYIA 4RX9A 3ZC5A 4F7JA 4AX8A 3FPQA 4M7IA 4O1OA 2J2IB 4EOLA 3MH1A 4JBOA 5K3YA 4DINA 5IEXA 1UKHA 4J7BA 2C6KA 1SNUA 3FHRA 4UWYA 5HCYA 4AWIA 4BKYA 5AUUA 3PY3A 4O83A 3LMHA 4R77A 3BV2A 4MD7E 1QCFA 5FM2A 3D2IA 2OU7A 4KRDA 2QR8A 3PFQA 5AUYA 4NIFA 1YXVA 3POOA 3U6IA 3P0MA 3B2TA 1XKKA 5KE0A 3FKOA 5TT7A 3W8LA 4BB4A 4YLLA 3RK5A 3D83A 4DBNA 5G6VA 4GRBA 2XZSA 3HKOA 2RL5A 3W2RA 2PVNA 2J50A 4QMPA 2VO6A 3HP2A 2ZDUA 4GIHA 5CEKA 2WXVA 2OXYA 4C4EA 1Q8TA 3IS5A 5CQUA 4ZXTA 4N70A 1J3HA 4ZLYA 1Y57A 2VTAA 3LXLA 3EL8A 5E8UA 4RWLA 4JBQA 3QCYA 4WA9A 3TUCA 4UMUA 4ZSEA 3HMOA 4R7BA 2XKFA 4C7TA 4Z16A 2HXLA 4MX9A 5CVGA 4E5AX 1SVGA 3BEAA 4BCKA 4MXAA 4OLIA 1Q3WA 4HVDA 4J96A 4UMRA 4CKJA 3PVUA 5JFSA 1OMWA 3ZZWA 2WOTA 4XHKB 3WZKA 4FK3A 3NSZA 3QTSA 4Q5EA 4Y8DA 5EG3A 5FTGA 4WD5A 5GIPE 3RAIA 1S9JA 4XOZA 3TXOA 3EQRA 2C6DA 3AGLA 3MVHA 1KOBA 2X0GA 3HV4A 4JLCA 5DE2A 1ZWSA 5TO8A 3VHEA 5EHLA 3I6UA 4FF8A 4Q9SA 3VW8A 4CD0A 2WQMA 3MFTA 4EUUA 4XP2A 2I40A 1YDRE 4YZNA 3C0HA 3ORKA 2C68A 4HGLA 2ITYA 4JX7A 5KHXA 2JFMA 4L7FA 4RWIA 4ZS4A 4DHFA 3FLSA 4RIWB 4JDJA 2YFXA 4RFYA 2CKEA 3UC4A 5M08A 1PMNA 3QTRA 4EL9A 5IUHA 4CRSA 5DEYA 3E88A 2A4LA 3RM7A 3MH2A 5DPVA 5C9CA 3S3IA 4Z9LA 4WUNA 5AP3A 3EN7A 3QLFA 4X3FA 1KWPA 3G9NA 5FGKA 3TJCA 3SG8A 4KD1A 2CCIA 4XMOA 4YPSA 1OIYA 4RVMA 2X7GA 1UV5A 4V0GB 4TYGA 3QQFA 4RIXB 2IW8A 5AV3A 4Q9ZA 4FSMA 2X9EA 5EYMA 5CXZA 5IA1A 3GCSA 4C4IA 2WD1A 4FVPA 5JQ8A 3VBXA 2QVSE 2C3KA 5AR4A 1YVJA 1W82A 4W4VA 3SOAA 4BZDA 4BDDA 2YIQA 3VUTA 4A06A 2YDIA 3MFSA 1DAYA 1YRPA 4FV7A 4PDOA 4CMTA 3ZRMA 1J7LA 2YLFA 3BX5A 5DA3A 4FV0A 4QTDA 2BAKA 4CFWA 2OXDA 3AC4A 1F5QA 2YWVA 2CN8A 3BU6A 1OM1A 4U6RA 4FNZA 1XH4A 3LFBA 3EIDA 1CDKA 4L52A 3R7IA 4BCNA 5KMIA 5AR2A 3GCVA 4P5QA 3WE8A 3KVXA 4L67A 4DH5A 2W7XA 4D58A 4E4XA 3RINA 2W06A 4D4VA 3W2OA 4USEA 4I0TA 3BLQA 5EK7A 3RZBA 2ZMCA 1OECA 3CQEA 4G5JA 4L44A 4DT8A 3EB0A 3F3UA 3G51A 3MI9A 4XV3A 4FKWA 3LMIA 4D2SA 3MIAA 3WOWA 3WYXA 1YDTE 4FE2A 4CQGA 2BIKB 4O0VA 3EZVA 4YURA 2C0TA 4AZVA 3COIA 2BZIB 3G0FA 4AAAA 2YM5A 2QONA 3RJCA 3A2CA 4BYIA 4MXZA 4R5YA 3Q6WA 3QBNA 3HV6A 3R7VA 3KULB 4QP7A 3W2CA 3IDBA 4ZMFA 3FL4A 3IONA 2B1PA 3AXWA 5HIEA 5GZAA 2OWBA 4I0RA 1J1BA 2HY0A 3DPKA 5E8WA 2C3IB 4BI2A 2UW3A 1TVOA 2XK6A 3DFAA 3UQCA 3R7YA 2GU8A 3MYGA 2VTQA 4JS8A 4JDIA 4HVHA 2BZJA 2I0HA 4GUBA 2ESMA 3QX4A 4EZ5A 4L68A 1PXMA 2H9VA 3E8CA 4KBCA 4NL0A 2W1FA 4ASXA 3LE6A 5AP4A 4ZY6A 4NTTA 1DI9A 3M2WA 4UYNA 5CLPA 4YNEA 5M07A 4FTIA 4P90A 3T8OA 4IAIA 1BUHA 3LMGA 3FLWA 3OZ6A 3KCFA 3BWFA 3C50A 1DI8A 2GCDA 3R04A 2CGWA 4ACCA 5CYIA 2ZV7A 1Z57A 5K0KA 4LG4A 3D2KA 2B0QA 2OLCA 1FGIA 4MXCA 3LQ5A 4OTRA 3FI8A 3NVMB 4JQ8A 2EXCX 2HELA 1IRKA 2C5XA 2ETMA 3VRZA 4L3JA 4UB7A 5LVPA 2ZVAA 5LCKA 4GUEA 2X2KA 2XCKA 3TKIA 3TV7A 1Q24A 3KN5A 2R9SA 4ZTHA 3SRVB 3HV3A 4EHVA 2OF4A 1PHKA 4FV8A 2ZV8A 5IA3A 3DLZA 3C4WA 3TNPC 5JSMA 4O91A 3KEXA 4O7NA 3HMMA 4DFBA 4JRVA 4Y83A 2QKWB 3JY0A 3BBWA 1PMVA 4IANA 4J98A 3VBYA 4AF3A 4RWKA 3LLAA 3VUHA 4J1RA 3VS6A 2ITWA 3QKKA 3QD4A 2PHKA 2YJSA 3D7TB 4I5HA 3CTHA 2NO3A 3TN8A 4WG5A 4K11A 4MF0A 3VULA 1B38A 3S00A 3EWHA 2W4KA 2GMXA 4K1BA 3D0EA 3TM0A 1LPUA 2RG6A 4QRCA 4RVKA 4USDA 3MVJA 3UIMA 2C4GA 3ZRKA 3FZPA 4DEGA 4XJ0A 3E7VA 1UA2A 2PE2A 2WMWA 2XNPA 4L01A 4CSVA 3HAVA 3SW7A 4O0TA 3U4WA 4AT4A 4EHEA 4JI9A 4RRVA 5EI6A 2C5YA 4G17A 1T45A 1O6LA 4E4MA 4XG6A 5CALA 2WGJA 5JZJA 3B8QA 3Q3BA 2GNGA 2X7OA 4TNDA 1BI7A 2OO8X 4MF1A 3TDVA 2J0JA 2BTRA 4D1XA 4ZZNA 4YZMA 5A4CA 1Y8YA 4BGQA 4RA5A 4G9CA 3SOCA 4Z7GA 5HVKA 2IW6A 2R3OA 2JKMA 3ZO3A 4LOQA 4HVSA 3PJ3A 3R2BA 4RBLA 4FTOA 3UZRA 3NIZA 5AV2A 3RCJA 4DEAA 5HHWA 1URWA 4ZZOA 1IA9A 2JAMA 4BDEA 3PWYA 4YZDA 4HCUA 3RHXA 1OKVA 3PDTA 5ANEA 5M53A 4BICA 5TF9A 4DEIA 5FD2A 1TKIA 1PF8A 1JSTA 2ZM4A 1I09A 4IZAA 4LL0A 4IM3A 2C6IA 2HZ4A 2WZJA 4S31A 5DIAA 5IMXA 2F57A 3HECA 1IA8A 2GNIA 2HK5A 2Z7QA 4EOPA 1GZOA 2R7IA 5GZ9A 3DBDA 2G2HA 3C51A 3JVRA 4NIFB 4MCVA 5E91A 2JDRA 4G3EA 5FP6A 5GHVA 2P4IA 3LLTA 4ALVA 4QQTA 5JT2A 3OOMA 3L9LA 5KX8A 4EOKA 5C8KA 1REJA 3LIJA 4I92A 2VWVA 3Q9ZA 4TWCA 5JQ5A 2OIDA 2ZB0A 3Q4CA 4JDHA 4GT4A 5CTPA 3ZXZA 3F2RA 2OH4A 2WOUA 2ZV2A 5IDNA 5CT7A 3W10A 4F1OA 3EHAA 1KE5A 5H8GA 1Q8WA 4XG4A 1Y8GA 2BAJA 3Q52A 3C0IA 3FMLA 4FV1A 4TYHB 3JUHA 4ZMEA 4BDGA 2WTIA 2XBJA 3QRUA 4RVTA 3PTGA 4II5A 2QO2A 2ETKA 4FEQA 1P14A 2FSOX 4QMVA 4QPMA 2GQGA 4FKLA 1PXKA 5HG8A 2PVFA 3T3VA 2GS7A 4NM3A 3QA0A 4EH6A 5HVJA 4D2WA 3HZTA 3CY3A 5C4KA 3MN3A 1U46A 1YWNA 3CEKA 3T9TA 4FNXA 4FTLA 1PXLA 1PXPA 3GENA 3NUPA 4I21A 4NFMA 4LV5A 4WOVA 4NCTA 5CF4A 5CNOA 3TIYA 5GIOE 3V8SA 4IB0A 2R3MA 1REKA 4GIIA 2Y7JA 3AOXA 2BVAA 4BDCA 2BZHB 5F94A 3U54A 3FC2A 4L8MA 3MJ1A 4RLKA 4OTQA 4JG8A 1H00A 3QXOA 3AC8A 2VTMA 3BYUA 2VTOA 2OJIA 3KQ7A 4QO9A 3PA4A 4WBOA 2UZOA 3UG2A 2ZJWA 3DDPA 3PJ2A 2PYWA 4N57A 3PXKA 4X3JA 4FEWA 2P55A 2JC6A 2NNWB 1WBWA 2I1MA 4FSZA 4WRGA 2XRUA 3C1XA 4LRMA 4XG3A 4BCQA 5KHWA 4QTAA 4AOJA 4LUDA 5EKNA 3QALE 3UQGA 4YJSA 3FWQA 3ACKA 4I0SA 3RI1A 5DI1A 4I5MA 4ITHA 2XCHA 3HA8A 3R8ZA 1R39A 2G9XA 4RPVA 2R3GA 3GI3A 3KMUA 5IA0A 4B4LA 3I7CA 3OWKA 3PVWA 3R1QA 4IB1A 2VX1A 3KRWA 3ZOSA 4Z7HA 3VS3A 3DA6A 2XIYA 4G9RA 3B8RA 2UZWE 3FMDA 3PE1A 3PZHA 4LRJA 4MK0A 3PA5A 3ULIA 3S95A 2CPKE 3EQFA 1NXKA 5KMKA 4GFGA 3K3JA 4YZBA 4EH8A 2BDJA 4B7TA 2O63A 4FSUA 1R1WA 4F08A 2XH5A 4QP2A 5AAGA 3E3BX 4QTBA 4BCPA 4QTEA 4ANNA 1V1KA 1XH8A 2X8IA 1ZYLA 1OL6A 4NM0A 4FTNA 1R0EA 2QKRA 4YC3A 4RA4A 2YM8A 4DF3A 3I5ZA 2X39A 4FODA 2HIWA 4R7IA 5AP0A 5KMMA 4TYJA 2B9JA 5HVYA 5IF1A 1OGUA 3B2WA 4C3RA 3HUCA 1QPDA 3VF8A 5AX9A 4YJVA 1FVRA 4AA5A 4DT9A 4YGAA 3CPCA 2XNMA 1SNXA 1KE9A 5CS6A 3NWWA 3CKWA 1J91A 4OUCA 1IAHA 4IH8A 3BE9A 1XR1A 3OTVA 3LFCA 4FG7A 4U5JA 3ZLXA 3FQEA 3KMWA 1JSUA 2R3LA 2FSMX 4G3GA 5DRBA 5CSPA 4GT5A 2JIIA 2Z7RA 4IVDA 5C03A 3ZFYA 2OJFE 3BQCA 2UW0A 3PXRA 4YR8A 4AZTA 2OZAB 3M1SA 3V5QA 3ZHPC 1MRVA 5HOAA 3CTJA 3LFDA 3V5LA 2OFVA 4FKOA 3LCOA 3BELA 4OBQA 1K9AA 1IAJA 5GNKA 4KNBA 4RJ5A 3VAPA 4K0YA 1CMKE 2PE0A 5M44A 1FOTA 2P3GX 5JK3A 2G15A 3LFQA 4IVAA 3NAXA 4FTTA 3NYOA 4ORKA 3K3IA 4X6QC 4V05A 5J8IA 1YI4A 3ZH8A 2UZNA 2W1DA 4BN1A 3R2YA 4PPAA 4MQ2A 2HAKA 2XNBA 1VZOA 4N4SA 4ZTLA 4EYJA 5A6NA 5I9XA 2VU3A 3IGOA 3QRJA 2XM8A 3C4CA 4XG7A 3UODA 4FT7A 3V6RA 3GC0A 2F2UA 4GV1A 2HWOA 1PXOA 2YCRA 3E8NA 4DC2A 4I4EA 5IA4A 4WG4A 3QLGA 3WZUA 1CTPE 5AUVA 3V8WA 3FJQE 4K33A 4KKEA 4F9BA 4DEHA 2Y4IC 3ZDUA 3ACJA 2C3JA 4QPSA 5HNBA 4C62A 2O65A 3BHHA 3BYMA 5CQWA 2PK9A 3DAKA 5D7AA 5HG5A 3H0YA 4MTAA 2F7EE 4DYMA 5AA8A 3F88A 3RPRA 4CT2A 4C4HA 4C8BA 4MKCA 4IHPA 3ZTXA 2PVRA 4FTQA 4G6OA 2X6DA 5JMSA 3ORLA 3L1SA 5IKWA 3R02A 3ZEPA 2XK7A 2CMWA 4C2VA 3SAYA 2DS1A 3EQPA 2OGVA 2H34A 5LJJA 4YHJA 4UX9A 4ZTMA 4X0MA 1LR4A 4TT7A 1WBNA 2YITA 2XB7A 4Y95A 3KXMA 2IW9A 1VYWA 3ZEWA 2WMVA 2XNGA 4O0SA 1ZY5A 4EK4A 4RIYB 2Z8CA 4UY9A 5K9IA 2VWIA 4E1ZA 1YKRA 3TJDA 4I6BA 4XLVA 3ZRLA 5AFVA 2XA4A 4BDBA 4QMOA 1ZARA 4LGHA 5HKMA 1GAGA 1YW2A 2CKOA 4GYGA 4G34A 4IM2A 5LMKA 1XH7A 1Q3DA 2PWLA 1Q99A 3H9OA 4CMOA 5IZFA 4XLIA 3OHTA 5LWMA 4LOPA 4FSNA 4CZTA 3NYXA 3L9MA 4RJ7A 4F6SA 1Q5KA 4RC4A 4J97A 1WMKA 5C1QB 5L2SA 2XJ2A 3C5UA 4AW2A 5M56A 3RWQA 3DU8A 3MDYA 1U5RA 3ZS5A 3DB6A 3E92A 2QG7A 4KIKA 4QP8A 4C3FA 2OICA 3OS3A 3OCGA 3KC3A 1VEBA 2UZDA 4ZIMA 3KU2A 2VTSA 2XP2A 4BZNA 4XCUA 4UN0C 3WIGA 2PVJA 2UUEA 4RSSA 2O8YA 5DT3A 3MH0A 5JZNA 3HGKA 3UO6A 4E4NA 5BVOA 4AOIA 3LQ3A 1IASA 3CD8A 4HJOA 3ROCA 1Q4LA 3JR1A 3O51A 4BL1A 3KRXA 3TL8A 4AT3A 1JNKA 2XIZA 4GU6A 5M4IA 5H8EA 1Y91A 4C61A 3AMYA 1W98A 2PUNA 1JWHA 5BYLA 1J1CA 2BTSA 4FICA 2ITTA 2B54A 5J1VA 4ZS0A 2KULA 1BMKA 3LXKA 2GNLA 2VGPA 2ITXA 4L46A 5CENA 3SXRA 5L8KA 3I1AA 3QZHA 4K8AA 2QLUA 5E92A 2IG7A 3GU6A 2E9OA 3DKCA 5CVHA 4TRLA 1BX6A 3DBQA 3DJ5A 3ORMA 3W18A 4RZVA 2HOGA 4C38A 5HTIA 3DK6A 3PLSA 3EFWA 2E2BA 3TG1A 4ZSLA 4BZOA 5CEQA 4TN6A 4WRSA 2C6EA 1OVEA 3GU7A 4KIQA 2WQNA 1OL5A 4PTGA 2GFSA 4FTJA 4YC8A 1X8BA 1ZYCA 2QLQA 3EQCA 3NW7A 3OROA 3Q9XA 3DFCB 4LM5A 5BVWA 5J95A 3C4ZA 3ERKA 4IIRA 3BKBA 5L3AA 3RNIA 4P2KA 4WNMA 5ANKA 5C4LA 1RJBA 4PP9A 1OB3A 5KMNA 4E3CA 1M14A 2Q83A 1MQ4A 2UW4A 3HLLA 1IR3A 2REIA 1GNGA 3ZXTA 4FTCA 4G3CA 4ZLZA 1H24A 4BCOA 3AC3A 1XWSA 4PF4A 4FKIA 1UWJA 4FEUA 2JDTA 4BI1A 2BPMA 1JKKA 4FC0A 4EOMA 4TWOA 5EW3A 2FUMA 3BGQA 2VO3A 1XHAA 4YPDA 2Z7SA 3RK9A 3VBWA 4F7NA 2BZKB 4NYEA 4IVBA 3R8LA 3AC5A 4DH8A 3RNYA 4FR4A 4ACDA 2YISA 5C27A 4A9SA 1XH9A 2A0CX 4LRKA 3PWDA 3BIZA 4L42A 1HOWA 2OI4X 3DJ7A 2R0IA 4D4RA 1V0BA 5LMBA 3U55A 2PPQA 4MVFA 4BI0A 1JAMA 1Q8UA 2VTRA 5HLWA 4FK6A 4QMQA 3OP5A 4JXFA 3WE4A 3FBVA 5TR6A 4RGJA 3PYYA 2JIVA 5EDRA 3AT4A 1FQ1B 4XV9A 2QO9A 3AGMA 5LCJA 1OUKA 5M57A 2RKUA 2IVUA 4RLLA 2R4BA 1H0VA 4CRLA 3PJCA 3UIBA 2H6DA 2YABA 4D4SA 2A1AB 2Z2WA 2YDJA 2ZMDA 3A8XA 3IDPA 3OTUA 5E8ZA 3RPOA 3UDBA 5EQPA 4E5BA 4EK5A 2V22A 4YTHA 3F2NA 3D15A 1H1WA 3MB7A 4I93A 4YUQA 3COMA 4IZ7A 5JRQA 5L8LA 3DK7A 2WPAA 3RPYA 4AN9A 4FKJA 1CKIA 3SHEA 4L9IA 4AA4A 3EL7A 5D11A 4JIKA 4E6AA 1XO2B 1XQZA 4DA5A 3QYWA 4BDAA 5CU6A 3ZUTA 4H3PA 4ZSJA 5CAQA 5EM8A 3BGZA 5D12A 5E8VA 2GDOA 3Q9YA 2RGPA 4EOSA 4EH9A 4AACA 3BYVA 2XKEA 4KWPA 5CSVA 4EH3A 4FSWA 3MV5A 4RMZA 5HG9A 3R71A 4LQMA 3AG9A 5I9VA 3D14A 4DAWA 3FZ1A 3PXFA 2XNOA 3QXPA 3NNXA 3R7GA 3VS0A 5HNIX 5CZHA 4E6DA 5ANOA 3MTFA 1WCCA 3VC4A 2WTKC 2HW6A 4IM0A 3HMIA 3WZEA 3VS7A 2Q0BA 4FMQA 4PDPA 4FOCA 2BFXA 1ZY4A 2WIPA 2A19B 3E64A 3VO3A 2ZOQA 4OGRA 1OIQA 1UKIA 4C3PA 3OUKA 3FL5A 3TZMA 4EJNA 3TCPA 3FEGA 4PNIA 3OBGA 2V55A 4X3FC 2ZYBA 4QP6A 4YJQA 3VF9A 4F4PA 5LQFA 3Q96A 4PDSA 3QA8A 3PZEA 4AW0A 2X6EA 3A4OX 1WBVA 2JKKA 3NUXA 5EHYA 3R8MA 3HYHA 5BYZA 3G9LX 3QUEA 3TI1A 4C4JA 4XRJA 5I9ZA 4O2ZA 4BR3A 3NUNA 3JY9A 1W7HA 4PPCA 3GU5A 1WBSA 3Q5ZA 3KRLA 5HGIA 3VQHA 3NGAA 4U81A 3TV4A 4ZLOA 5FXRA 4QYEA 4CMUA 1WVYA 4GS6A 2R3QA 5IUIA 3L9PA 4D0WA 3GNIB 4EC9A 4RFZA 5ANJA 3Q04A 4NKSA 4K77A 4YSJA 4GG7A 4EZ7A 5KUPA 2WTJA 4G6LA 4BTMA 4FTKA 5A46A 2UW6A 3I7BA 2C6TA 3COHA 4BC6A 4AZFA 1WBTA 4FV2A 2E9VA 4CNHA 2GQSA 4BDFA 2XEYA 2F4JA 4JX3A 3ROYA 5KMLA 5BVFA 2BROA 3A7GA 4LYNA 2QOIA 4I4FA 4B6LA 1ATPE 4IJ9A 3HNGA 2AUHA 4EWHA 2VO0A 4FKVA 4LMNA 4BFMA 3PG3A 3KXNA 2PVHA 3N4VA 4HZRA 5AA9A 2PUIA 2VWBA 3DY7A 4RG0A 2C5OA 3FLYA 3LM0A 2WNTA 2HZ0A 5L8JA 3ULZA 2O3PA 3G33A 4RJ4A 4W4XA 4OT6A 3CSVA 5H9BA 2UZVA 3U8WA 3PE2A 2CKPA 3R8PA 4DLIA 4YC6A 2V7AA 3UOHA 4RX8A 4FKTA 3R00A 1HCLA 3I79A 5IPJA 3R8UA 1OPKA 3F3WA 4O86A 3UMWA 5KKRC 2B4SB 5JFXA 1YOLA 3KMMA 4CFXA 4KSQA 4O38A 4F0IA 3TNWA 2XS0A 2IZSA 2Y4IB 4FG8A 1GIIA 4IADA 3U87A 3LFSA 4FKRA 5AWMA 3F5XA 5GZ8A 5I3RA 3W16A 4YU2A 3QKLA 3O8UA 4C37A 2WO6A 4O0UA 4DFNA 2JKQA 3ZUUA 3BPRA 5D9HA 4FIHA 2XKDA 1ZOGA 5EFQA 2PU8A 2HYYA 4PMSA 4O2PA 4M15A 2JEDA 2X8EA 1FGKA 2V0DA 4PTCA 5CEPA 2R3HA 3FMMA 1OZ1A 3MWUA 4ZTRA 4BCMA 4FZDB 3UOKA 3CR0A 3OWPA 3AT3A 3OEZA 4TYEA 1UNHA 1V0OA 4MNFA 2CGXA 3A7HA 3WARA 3G6GA 5ICPA 3UO5A 1B6CB 3QTUA 4JQEA 5EI8A 4QYFA 4ONAA 2ITOA 3O96A 3OCSA 5F20A 3OY1A 4KIKB 4ZY5A 1H26A 3QWJA 5CWZA 3F66A 2XKCA 2JAVA 3DDQA 4WG3A 3BHVA 3CJFA 3C4XA 4IVCA 5KO1A 4NZWB 4G16A 3V01A 4F6WA 3NUSA 2F49A 4M68A 3E7OA 3LZBA 4O21A 5FXSA 4A4XA 1H8FA 4J8NA 4XX9A 1XBBA 3RM6A 4AT5A 4NM5A 4AZSA 4C0TA 3H0ZA 3VRYA 4DGLC 2EB3A 4LOOA 2IVSA 2XJ1A 3TNQB 2ONLA 3HRBA 4ASEA 4YMJA 2B55A 4UXQA 4R6VA 2VTPA 4K18A 4M66A 5HCXA 4UMPA 3ALNA 4RC2A 2J0MB 3P86A 3VW6A 4ALUA 4BVUA 3VUGA 3PXYA 4A9RA 1MRUA 4F64A 4O7RA 4PL5A 2V5QA 4GSBA 4ZJVA 2UVYA 5AV4A 5EYKA 1W0XC 4NTSA 3CD3A 3EQIA 1RE8A 1P5EA 4F9WA 4KS7A 2J7TA 4FTUA 1U5QA 3C7QA 5HICA 3F6XA 5A3XA 3GC7A 2XJ0A 1FMOE 5AJQA 5B2LA 3D9VA 3MY0A 3FZRA 4TWPA 3RKBA 5TKDA 2ZB1A 2F9GA 2OIBA 4FL3A 4DGMA 3F5UA 4FI1A 1KE7A 4U0IA 5B2MA 5E9EA 5AM6A 5T68A 4MBJA 3FMJA 4FZ7A 1PKGA 1WZYA 2WQBA 5I9WA 3FUPA 4F6UA 4GFMA 2GNFA 4Y5QA 5FQDC 5GJDA 4UXLA 5M09A 1OKYA 4GG5A 3UPXA 1Z5MA 3MVLA 2WKMA 2RFNA 5ETAA 1GZ8A 4BIDA 2OH0E 4B99A 2HZNA 4IW0A 4O27B 2JDSA 2P0CA 3DJ6A 3DKGA 3F7ZA 3R6XA 4MHAA 4BGHA 4IDVA 3NMUF 4EYMA 3VUKA 3E8EA 3GBZA 4HPUE 4IJPA 4M0YA 4RQVA 3W2QA 3QUDA 2PMOX 4I23A 3IW5A 5FEEA 4YZ9A 3UNJA 3HVCA 2IN6A 4MXYA 2R64A 3GOKA 4ZJIA 2BMCA 3PY0A 4QMNA 4ZOGA 2VRXA 2YN8A 3WF6A 3HUBA 4NJ3A 4OW8A 4F0FA 4OAVB 3R63A 5CAPA 3TTIA 5HBEA 5HX6A 3R1NA 3DQWA 5D10A 4OTFA 4NFNA 4XNEA 3FI4A 2QOOA 3VIDA 1BLXA 4IC8A 4O7VA 4FSYA 4EH7A 4ERWA 5I5ZA 4FV4A 5GJGA 1KE6A 3CGFA 3P7CA 3P4KA 4FYOA 4X6RA 5EQYA 2A2AA 5BUEA 5AUWA 3RAHA 3LCDA 2GHLA 4I6HA 4YJRA 5H8BA 3QGYA 2A27A 5A4EA 4EQUA 3L8SA 3ZYAA 3NYNA 3GOPA 4S34A 2VAGA 3NYVA 4WT6A 3O8TA 5IQBA 3KY2A 4DG0E 4AN3A 3F3VA 3CCNA 3O17A 3OY3A 5CAOA 4RJ8A 3UJGA 5IDPA 4HNIA 4AE6A 1KUTA 2UZLA 3LJ0A 4FUXA 4M14A 4QP1A 3GXLA 2IZTA 3QGWA 4DEDA 3E8DA 3MTLA 2W1CA 5J79A 3P7AA 3DOGA 3QTZA 2QI8A 3OBJA 3P9JA 4HOKA 4WKQA 4NCTC 3V04A 3PY1A 4D1SA 4KA3A 4J95A 1GZKA 2I0EA 1CM8A 4PY1A 1GIHA 3CKXA 4RJ6A 3VBQA 5J7BA 4TPTA 3G5DA 3PPJA 2IWIA 3MFUA 2BFYA 2R7BA 3LJ1A 4FKGA 4V04A 4BCJA 4EH2A 5IQDA 4I41A 3SLSA 5EOBA 3IW8A 4H3QA 5EW9A 4O7LA 4FIIA 2XVDA 4O84A 3S1HA 4DFLA 3FLQA 4QPAA 4AQCA 2G1TA 4ACHA 4DFYA 5IEYA 1PJKA 4HCVA 5J9YA 5FBOA 3HX4A 2YZAA 4JR3A 4N6YA 3CTQA 5CSWA 3N9XA 3D94A 3PJ1A 3MA6A 2X9FA 2QCSA 3BYOA 3TACA 4BCFA 1ZMWA 4QP9A 4C57A 4X2KA 3ORZA 4RFMA 5F9EA 2ITUA 3FQSA 4M69A 4FEVA 3QQGA 3L9NA 2JLDA 3BHUA 4KABA 2OJJA 1I44A 3BRBA 5HD7A 4PPBA 2VTJA 3FY0A 3V5PA 4IAAA 1OUYA 2QD9A 2VWXA 5CXHA 3NS9A 5IQEA 3QYZA 3I81A 2XYNA 3QD0A 4DH1A 3DXQA 4HVGA 2LGCA 4QMLA
chains in the Genus database with same CATH superfamily
2PMNX 2WTKB 3KF4A 4U8ZA 5EQEA 1O9UA 4V01A 3C4FA 1JBPE 4L43A 4NW6A 1UNGA 4Y5HA 4GFOA 4EZ3A 3DZQA 2ZDTA 5M06A 2E9PA 1ZZ2A 4I22A 3ATSA 4W8EA 1UNLA 3P08A 2XALA 1W2FA 3EYHA 2FYSA 2WMTA 4MAOA 5AP1A 4O6EA 3MVMA 2IVTA 2XK8A 3ZFXA 4XG9A 5AP2A 2H96A 5A9UA 4KAOA 4FV5A 3HAMA 3W0NA 1H1QA 2PULA 4FKQA 3Q9WA 5HIBA 3SKCA 3TTJA 4X3FB 2BR1A 2YIYA 4IZYA 4NW5A 4RX7A 4U44A 4GH2A 4MQ1A 5J9LA 2WTCA 3F5GA 3VHKA 4B0GA 5AUTA 3PFYA 1VR2A 4QP3A 4CLJA 1ND4A 4QQCA 2B53A 1WFCA 5F95A 1RW8A 3QF9A 3LXNA 4GVAA 4MXXA 4PL3A 4U80A 5CT0A 5M4CA 4G3FA 5C26A 2QU6A 4MBLA 5ANGA 1GOLA 1H1PA 1KSWA 2ETRA 4MH7A 4E4LA 5J87A 4FKSA 4A07A 4YHFA 3UC3A 4IAKA 2WQEA 4KBAA 4AGUA 4JIAA 2YJRA 4QTCA 3OXTA 4FKPA 1ZOEA 3UYTA 3DNEA 5BQ0A 4Q2AA 1ERKA 2YCFA 3GB2A 4I94A 4GK3A 4QYYA 5CU4A 4EQMA 4DN5A 5CF6A 1Z9XA 5IQIA 3HP5A 2BRHA 1QL6A 3SW4A 3QRIA 3HMNA 5LVLA 2R3NA 1Q8YA 1ZMUA 1B39A 1KE8A 1Y6BA 3H30A 2B7AA 3P5KA 3PP0A 4HYHA 4I5CA 2RFSA 4BKZA 4C34A 3A61A 1OBDA 3DTCA 3EN4A 1GY3A 4JBPA 2R3KA 4FA2A 3G2FA 4EHZA 3TUDA 4A9TA 3UNZA 1H01A 2WEVA 1RDQE 3DNDA 3C5IA 3NZ0A 3UIUA 1FVVA 3P7BA 5L2QA 5CU0A 1STCE 2CSNA 2SRCA 3ZBXA 1VYZA 5HO6A 4QMMA 3PRIA 3IQ7A 3TZ7A 2I0YA 3F82A 4PWNA 5LVMA 2VWUA 3FDNA 3EQHA 3OD6X 5KKRB 2WMXA 3LW0A 3CXWA 2XM9A 3Q4UA 4BWXA 1F0QA 3IW4A 1SM2A 2J0IA 4DE4A 2R3RA 4XUFA 4WNPA 3O50A 4LL5A 3MSSA 2JGZA 3PVBA 3C9WA 5HLPA 4IFCA 5GINE 3ORPA 4IB3A 1SVHA 3GC9A 3HMPA 4PUZA 3UZTA 2CLQA 3ZLYA 4WUAA 5HESA 2J5EA 4C02A 3QC9A 3CY2A 1JVPP 3NUAA 2YIWA 5CF5A 2JDVA 2VNYA 4IEBA 3ZCLA 4UZHA 3KXXA 4S33A 2V62A 3QHRA 4XH6A 3WZJA 3ZDIA 4L53A 4P7EA 2XIRA 4QT1A 1XH5A 1WVWA 4ZTNA 3BBTB 4S2ZA 5KCVA 4IAFA 5HBHA 2IJMA 1H28A 4B9DA 4BDIA 1JSVA 4H1JA 3LAUA 3PG1A 4GJ3A 5AP7A 4C4FA 5CX9A 2X2LA 4GVJA 2WMSA 2WAJA 4MBIA 3Q32A 1KOAA 3QCSA 3THBA 4F1TA 4GKHA 3HL7A 3A99A 3D5WA 3IW7A 4R1YA 5HE0A 3RCDA 2DQ7X 1LUFA 4GYIA 1U54A 2VZ6A 2XNEA 4HYUA 5FRIA 3VS4A 2QU5A 4UV0A 3TYKA 4D55A 2OZOA 3GCQA 3TZ8A 4FL1A 4R3RA 4TXCA 4KINA 3U51A 3VUMA 2NP8A 5FTOA 2QOHA 5CI7A 1XMLA 4EK6A 2C6MA 3MGYA 2WTDA 4YJPA 4D5HA 1SZMA 1ZXEA 3SX9A 4A9YA 3UDSA 3CBLA 4Q5HA 1U59A 3NUYA 5H3QA 4CCUA 2WELA 4RIWA 4WIHA 1CKJA 1P4FA 4X21A 4F9YA 5LMKC 4FIEA 3BHYA 2PZYA 2JBOA 1LP4A 3I0QA 4OTGA 2VN9A 5FM3A 4OTDA 1UWHA 2W9ZB 4R3CA 5J9ZA 4PNKA 4FIFA 5DFPA 3FLZA 4H05A 5ETCA 2VTHA 4AS0A 2BALA 3DAEA 1M2PA 3FXXA 3W8QA 2W1ZA 3W32A 2XIXA 4O7TA 3FE3A 2PVMA 4O82A 4O0RA 4O7ZA 4W8DA 3VBTA 2HWPA 4TWNA 4WSYA 4JBVA 3W33A 4V0GA 4AXAA 3ODYX 3GC8A 2HW7A 2RSVA 3MFRA 3N51A 4OTWA 3FYKX 3OVVA 4RJ3A 2IO6A 4TW9A 2YAKA 3W1FA 4HVIA 4TZRA 3AC2A 4FVRA 4AGCA 1OKZA 1PYXA 5C01A 1KV2A 3CJGA 2EU9A 2VO7A 4UMTA 2UZTA 2WMUA 4EWQA 3BU5A 2WU6A 3MBLA 1IG1A 2CLXA 3QL8A 4C4GA 3IO7A 1T46A 3PSCA 2XYUA 4M8TA 1O6KA 3DGKA 4W4YA 5AM7A 3WZDA 1FINA 5D7VA 5HQ0A 1YHWA 4FTRA 4E6QA 3KRJA 4WSQA 1KV1A 3L8XA 4O1PA 5FDXA 1UU8A 5IH4A 4KUJA 3CQUA 3EYGA 3A62A 1ZYDA 3KL8A 3PIXA 2YM7A 3I6WA 3AD4A 4QOXA 1H27A 5EDQA 5EM7A 3IOKA 5K4IA 2ITPA 1DS5A 2BRMA 4KS8A 5DOSA 4ENYA 4QMWA 5HNGA 3Q4TA 4FZFB 3PIYA 1SYKA 3MA3A 5LVOA 4FZAB 5FEQA 3ETAA 4FT5A 3FAAA 5E4HA 4XV2A 4HCTA 3OUNB 3NCGA 4BRXA 1Q8ZA 2VX3A 2OW3A 3EH9A 3SDJA 2J6MA 4I6LA 2QHNA 2R3IA 3R7EA 4EK3A 4WBBB 5DVRA 1CSNA 3Q60A 4BDHA 1WBPA 1XH6A 5CU2A 2PZPA 3O71A 4GK4A 4RQKA 3F7WA 4HPTE 2GHGA 4EKKA 4TKSA 5B0XA 3E3PA 3QQLA 2FA2A 2JDOA 3GGFA 3LKMA 2UZEA 3ZMMA 3E62A 3QZFA 3NVKI 4FT3A 4NJDA 5T6KA 4AG8A 5M4UA 2CN5A 2XMYA 4D9UA 3O8PA 2QOLA 3IOPA 2W0JA 3MW1A 4NUSA 4U3ZA 5L6WL 4AN2A 3WILA 5BMSA 1ZLTA 4O0YA 2WMAA 4RZWA 5FUTA 4IWPA 3SVVA 1U4DA 5TOZA 4QQ5A 3EKNA 4ZK5A 5CI6A 5IEVA 1TQPA 4DTBA 2XUUA 3OWLA 1GJOA 3PJ8A 2X4FA 4IX5A 5CEMA 2B52A 5GJFA 2Y0AA 4C35A 2YZLA 1PYEA 4NEUA 1OKWA 3OC1A 5HO8A 2UVZA 3FHIA 4ANMA 1ZMVA 1AGWA 4ANBA 4FIGA 2C1AA 2W5HA 4NU1A 4Y46A 2PVKA 5FG8A 5K5XA 5EM5A 4M69B 4YO6A 4BDKA 3PPZA 3EN9A 1M2QA 3EQBA 4YJUA 4BTFA 3KXHA 1BL6A 3R9NA 3MIYA 1OPJA 4K6ZA 4X2NA 4USFA 4JAIA 4EKLA 3QKMA 4AGDA 5DMZA 3FSFA 2J0KA 3UVQA 4X7QA 4EHGA 4A7CA 2W4JA 2C30A 5EYCA 3I4BA 1YDSE 4R1VA 2QOBA 1YOMA 4J52A 4CXAA 5HG7A 4CYJA 3HRCA 5BMMA 3HA6A 2AC3A 2YA9A 1YXSA 3SRVA 3ZSGA 5IUGA 3R7OA 1JKTA 3ELJA 5DR2A 4EBVA 3ANRA 4NK9A 2F2CB 4LV8A 4F70A 5IMEA 4BWPA 3S2PA 3Q4ZA 2IZUA 3O0GA 3PIZA 2W99B 4JNWA 3QC4A 5IA5A 3UO4A 3UDZA 2OIQA 4OTIA 1OGYA 4I6QA 3FPMA 4NWMA 3CE3A 3H9RA 3V8TA 3D7TA 3ZU7A 3FMNA 5DYJA 4RT7A 3NX8A 5AAEA 2X7FA 2FH9A 1W8CA 2EB2A 4ZTQA 3R1YA 4G3DA 4AZEA 1YI6A 2IPXA 4ID7A 4FV6A 3K5VA 3O7LB 2EVAA 4ZAUA 3T3UA 4CTCA 5BV3A 4L00A 4L3PA 2WMRA 3OXIA 1BL7A 1OITA 3GU4A 4GCJA 2AYPA 4IFGA 5L6PA 4ASDA 1UU3A 5AEPA 5CAVA 2BAQA 3EOCA 1YQJA 4E5WA 3PSDA 2W1GA 4XG2A 4IAYA 4QMXA 3D4QA 5ETFA 4BCIA 5I0BA 4KIOA 5DEWA 3HV5A 1Q61A 2XANA 4F1MA 1PXJA 3EFKA 3RPVA 2J51A 4ARKA 5BPYA 2O5KA 2C69A 4QMUA 5AR8A 3SGCA 3Q5IA 4C36A 1IEPA 3DXPA 3JVSA 3VBVA 4ANLA 4EOJA 1QPEA 4XG8A 3UG1A 3ATTA 3UBDA 5IISA 1JKLA 2AEGA 4ITJA 4APCA 3W2SA 2UW9A 2W05A 2WEIA 3DLSA 5JRSA 1NA7A 3IECA 5EKOA 1TQMA 4FT9A 4CKIA 4D2RA 3IW6A 5CU3A 1G8AA 2XK4A 3BI6A 4ZJJA 4M13A 4B8MA 4IB5A 4IXPA 5JH6A 3ZLWA 1MUOA 1PMEA 4MD9E 4EBWA 3SA0A 3F5PA 3MS9A 1AD5A 2BDFA 5DT0A 3BCEA 3Q53A 4KKHA 1OL2A 4F63A 3PSBA 4FTMA 3EFJA 3D5VA 2ERKA 3E93A 4FV3A 5LOHA 4D4YA 2R3FA 4R7HA 1H1RA 1NW1A 3A7JA 4MNEA 3O5AA 3QU0A 2WB8A 5HO7A 4N0SA 2IZRA 4F99A 1OPLA 3OT8A 3QAME 4O96A 1BYGA 1MP8A 4OAUC 4CTBA 3DV3A 2C1BA 4IDTA 4TTHB 2WTVA 4TYHA 3GFWA 4M12A 4O7YA 2A98A 3K2LA 4PTEA 4U45A 3R83A 4LI5A 3ZLSA 2YM6A 3GU8A 3NW5A 4KKGA 3SG9A 5E8TA 2FGIA 4AW5A 3DXNA 4JVGA 2PE1A 5DH3A 5A4QA 2Y9QA 4U9AA 3F69A 3A8WA 3EFLA 4QMSA 3W55A 2ERZE 2UW5A 3O2MA 1G3NA 3LCTA 4OTHA 4OTPA 3A60A 4J99A 3WF9A 5A6OA 2Y4PA 4FV9A 5CANA 2Z02A 5FEDA 5A54A 3DS6A 3LOKA 1U54B 2PL0A 4H39A 3AD5A 4CZYB 4O0WA 5CSHA 4ZY4A 3KN6A 3R8VA 3FY2A 2PUUA 4CEGA 3G90X 3ML1A 3FLNC 1UU7A 2QODA 5J5SA 4GT3A 2F7ZE 4C33A 4YZCA 3RTPA 2CGVA 2YACA 2NYAA 2FVDA 5IQFA 1JQHA 4CFNA 5B2KA 4CLIA 2JD5A 4D1ZA 1R0PA 4YHTA 5T3QA 3RBWA 1Q97A 4U3YA 4KRCA 5LXMA 3D5UA 3FI2A 2BCJA 4FIJA 3VVHA 3GCUA 4IWDA 3OMVA 2VUWA 3KF7A 3KRRA 5E8SA 3R9HA 4YNOA 3G0EA 1E9HA 5FBNC 3TZ9A 2X81A 4S30A 4D5KA 5DLSA 4BBEA 4TYIA 3NR9A 2O2UA 3KVWA 2ITQA 2XNNA 3ZONA 2VGOA 3KB7A 5IQAA 2JBPA 4XBUA 4IQ6A 4FNYA 2FB8A 5F1ZA 3VS2A 4ASZA 2YCSA 3LFEA 5HE1A 4NT4A 3RGFA 3ET7A 3W2PA 4LFIA 2KTYA 2X0QA 4YP8A 3FZOA 3LPBA 5E90A 3DCVA 3R9DA 3VNTA 4DEBA 4FSTA 3RPSA 3SD0A 2UVXA 5AIRA 3ANQA 3II5A 1E1VA 2V7OA 4UALA 4EI4A 2BKKA 4EJ7A 3G6HA 2ONLC 3LVPA 4O0XA 3R22A 1WBOA 2OK1A 5ANDA 5J1WA 5BVDA 2JITA 2XBAA 4QNAA 5DBXA 5AR5A 4AE9A 4AZWA 2DYLA 3OG7A 4B8LA 4DGOA 2P2HA 4EK8A 4TL0A 4ACGA 3FZSA 3MB6A 4CKRA 4YTFA 5KMJA 2BILB 2DUVA 4YLKA 3LXPA 4Z55A 4X2GA 2XARA 2BHEA 2RFDA 4D0XA 2NRYA 1O6YA 4H1MA 3RMFA 4EORA 3UVRA 3T9IA 1EH4A 3QZGA 4HGEA 4UEUA 3QCXA 5DRDA 3EQGA 3MPTA 3NNVA 5IA2A 2WQOA 3F3ZA 3AQVA 1JKSA 4O4DA 4IMYA 5HU3A 3KKVA 3V3VA 4ANSA 3LHJA 4QYHA 4DFZE 4EOQA 4FT0A 2YLEA 4G2FA 2R0UA 4AP7A 1XBCA 5HU9A 3UP7A 4E20A 2XRWA 5LARA 1XJDA 2Z60A 3H3CA 4P5ZA 4W9WA 4FZ6A 3QX2A 1V0PA 4D9TA 2UZUE 4MYGA 2YM3A 4FGBA 3FYJX 2Z7LA 1UVRA 3R1SA 1LEZA 2P33A 4LGDA 4M67A 4CZUA 4F09A 2OZAA 5ANIA 4BDJA 3QQJA 4E8AA 1DM2A 5HZNA 3E5AA 4CT1A 3GT8A 3JYAA 2W5BA 2I0VA 3BE2A 4N6ZA 5DNRA 3UMXA 4MD8E 3DKOA 3CGOA 3QZIA 4GEOA 4LGGA 3ZO1A 2BHHA 4L7SA 2ZV9A 2DWBA 3QCQA 2XIKA 3R21A 4HZSA 4QMTA 5L2IA 2GTNA 3CP9A 1SVEA 1QPJA 4U41A 3AMBA 1DAWA 2QO7A 2ZM3A 4Y72A 5BX0A 4ZTSA 3C13A 3WF8A 2EUFB 1SMHA 4XBRA 2O0UA 2QC6A 4FSRA 1PW2A 5LMAA 3KXZA 2RF9A 5LWNA 5JN2A 3EKKA 2HENA 3UVPA 4JAJA 4G1WA 4FKUA 2VD5A 3FXWA 3GUBA 1ZYSA 2PUPA 2FSTX 3QTQA 1AQ1A 1K3AA 5AP6A 5JFVA 5CZIA 1TQIA 2YHVA 4I5PA 3CC6A 3WF5A 1E1XA 2OG8A 5HLNA 4BBFA 2CJMA 3UTOA 5IQHA 2QOCA 3IKAA 3GVUA 4M84A 3RHKA 2OBJA 5HE2A 3ZM4A 1A9UA 4KB8A 2PSQA 1M7NA 2OJ9A 4E73A 3NLBA 4EH5A 2I7QA 2E9UA 2G2IA 3SXSA 3DKFA 3TKHA 2FSLX 1M52A 3UZPA 4U40A 4R78A 1F3MC 2X1NA 3HDMA 3KK8A 3OOGA 5JGDA 4RWJA 3V5JA 4KSPA 3UQFA 2YIRA 5D1JA 4IX3A 2X0OA 4BKJA 4DG3E 3FZTA 3MESA 2VWYA 4DH7A 2W1HA 3OFMA 2OFUA 4IX6A 4DGGA 5KMOA 4L6QA 3UYSA 3VN9A 2VTNA 5HD4A 4WNKA 3IDCA 4H3BA 2JKOA 2GS6A 2WIHA 3RALA 4QDVA 4RIYA 4DGNA 5HTBA 5JGAA 1NVQA 2WMBA 3DT1A 3IGGA 3RK7A 1A48A 5IQCA 4BJJA 3CQWA 3OWJA 2O64A 4O81A 4EOOA 2XF0A 5FTQA 4CFUA 3V51A 3ORNA 3NCZA 4PX6A 5EOLA 4CV9A 5ACBC 3R9RA 5A14A 4Y85A 1URCA 4OR5A 2W17A 5IH5A 3EMGA 4PQNA 4FYNA 4JG6A 2QOFA 2QNJA 5BUJA 4DBXA 4FX3A 3REPA 3LM5A 5I9YA 5A4LA 5AUXA 3GEQA 4RC3A 5JKGA 1CKPA 2CCHA 3ITZA 4BYJA 2VWZA 4TNBA 4R8QA 3NUUA 1P4OA 3LQ8A 2PVLA 3LCKA 3N4TA 3KGAA 3UP2A 1XBAA 2B9IA 2R2PA 3FQHA 2I6LA 2JIUA 3VUIA 4BF2A 5LVNA 3FMHA 4UMQA 4XEYA 5FXQA 4Y73A 2NPQA 3GFEA 3R30A 3ZO4A 3I5NA 4CCBA 3G15A 3I0OA 3KA0A 3L8PA 3PP1A 3E63A 1H08A 4PMTA 1PRYA 2X2MA 5EI2A 5DHJA 4ZSGA 4PP7A 3U6HA 4DG2E 4GKIA 1J7UA 3TV6A 4CG8A 4YJOA 3PUPA 5BNJA 4CYIA 4C58A 5K5NA 4R3PA 5DWRA 1Q62A 4BCHA 3U6JA 3D7ZA 4MNEB 5HCZA 3OW3A 3EN5A 3FC1X 3PPKA 4QQJA 4JMQA 2Y6OA 5BVEA 3WBLA 4EOIA 4AW1A 3OEFX 1NT2A 3GQIA 2WTWA 1W84A 2BRGA 3TT0A 4EEVA 4G6NA 2ITNA 2C6OA 4JG7A 5E8XA 3OT3A 2GNJA 2CNUA 4TY1A 5CNNA 3ZC6A 4BHZA 3BU3A 4FRFA 3BWJA 5FDPA 2XK9A 5IQGA 3BEGA 4J8MA 3M11A 5AAFA 3TDWA 2WFYA 2H8HA 3QD3A 4IZ5A 3KXGA 2OF2A 4A9UA 3RP9A 3FMKA 5I3OA 2YEXA 3H4JA 4K2RA 4CFFA 1YHSA 3ZO2A 2QR7A 4LUEA 5JEBA 3BYSA 4L45A 2E9NA 3L8VA 4X2FA 1Q41A 4HGSA 3A4PA 5BVKA 2CNVA 2VNWA 3MJ2A 3ZSHA 4NSTA 4AFJA 4QNYA 4ERKA 5HBJA 4PDYA 3TNIA 4F0GA 2WU7A 3KREA 3OCTA 3Q6UA 3OXZA 3QD2B 1ST4A 3GQLA 1YHVA 2LAVA 2F7XE 2PTKA 3ZUVA 3FV8A 3DTWA 3WF7A 3CPBA 4Z3VA 3DBEA 1NVRA 3BLHA 1PXNA 4QDEA 2YERA 2VTIA 3H9FA 4MWHA 4DFUA 4C59A 3QFVA 2Y6MA 4EUTA 4LMUA 4ZSAA 5BVNA 3LJ2A 1NY3A 4U43A 3R7UA 2W4OA 2R3PA 3RAWA 4EH4A 2BUJA 5L2WA 3ENMA 3U9CA 2X0PA 1PMUA 3AC1A 3D5XA 4EC8A 5K4JA 4IE9A 5HI2A 3VWAA 4FUYA 4YJTA 5E1SA 4U97A 4KBKA 4JR7A 3NAYA 2R5TA 2W1EA 4QMZA 4DFXE 4J53A 3C0GA 1WAKA 2W96B 2ACXA 4YBKA 4ANOA 4P4CA 3ZBFA 4AUAA 1OIRA 4GMYA 3CIKA 5KZIA 5BYYA 2GPHA 4FOBA 1YWRA 5E8YA 5A4TA 1S9IA 4FG9A 1OI9A 3VS1A 3NPCA 3BL9A 4UWBA 2GHMA 1YI3A 3POZA 3DBCA 2AC5A 3SV0A 2X4ZA 3U9NA 3R01A 1L8TA 4E6CA 2CKQA 2C47A 4U79A 3ORXA 2CNQA 4IC7A 3VUDA 1PKDA 3V5TA 5M51A 2BRBA 2RFEA 3QQHA 3EZRA 3TNHA 1H1SA 1WVXA 3PVGA 5H2UA 2QOQA 2YCQA 4D28A 3PXZA 4AGWA 3EN6A 5J5TA 3F9NA 2UV2A 5EDPA 3QRTA 5CY3A 4H58A 4FBXA 3TIZA 1FBNA 3DAJA 3C4EA 2PMLX 5IU2A 1VLRA 3TKUA 2QHMA 3WIKA 1BI8A 3ID6C 2Y8OA 2W1IA 4MWIA 3DK3A 2RIOA 5KBRA 3VJNA 1M2RA 1FPUA 2CGUA 4I20A 5M4FA 1JLUE 2YDKA 2J5FA 3BZ3A 4CFMA 1UU9A 2QQ7A 3R9OA 3EQDA 1GIJA 4YTIA 4ALWA 4IWOA 1YXXA 4DHZA 4FSQA 5CF8A 5HORA 4J71A 4MEDA 4FGRA 4D2TA 1BKXA 5CASA 2C5VA 1VJYA 5EYDA 3O7LD 1MRYA 3A7IA 2OKRA 5M55A 4AA0A 3JXWA 3P1AA 4BIEA 1YXTA 2VX0A 4G31A 4DH3A 4AFEA 5B7VA 1M7QA 5CVFA 4O6LA 3SXFA 3TWJA 2QG5A 4QMYA 5AMNA 5K0XA 2PMIA 2YIXA 2XK3A 4AOTA 4FVQA 3DBFA 1A06A 4CG9A 3PRFA 3WYYA 2RG5A 4H36A 4ZEGA 4OT5A 5DG5A 4APPA 3BHTA 5AADA 3FI3A 4O7WA 4CGAA 4I3ZA 5F4NA 3RWPA 3RAKA 4GK2A 2OXXA 4EQCA 2IVVA 2GQRA 3CS9A 3ZZEA 4ZZMA 2VV9A 3HEGA 4BIBA 5TE0A 4E7WA 2J90A 4C2WA 3QRKA 2VTLA 4HYSA 4I1ZA 4JRNA 3KFAA 4XP0A 2C0OA 3OCBA 3I60A 5HEZA 4CQEA 4YO4A 5E7RA 4RIXA 3AD6A 1ZRZA 4CFVA 5DGZA 1NVSA 3BQRA 5KZ0A 4DCEA 3H10A 3LFNA 4K9YA 3UIXA 2J4ZA 3QTIA 4M3QA 4XS2A 3TMOA 3DB8A 3IPHA 4S32A 3COKA 3QUPA 4XYFA 5C8MA 4DCAA 3W0OA 1QMZA 1YXUA 3NNWA 3U4UA 3CLYA 5CEOA 5HTCA 4IBMA 3ODZX 3QTWA 5E1EA 3M42A 3P79A 2BRNA 2C3LA 3PA3A 3PLAE 5AIKA 2C6LA 3ZFMA 4JDKA 1APME 3UGCA 2B9HA 2EXMA 3FSKA 4D2PA 4HW7A 2W9FB 5KBQA 4GL9A 2YAAA 3BGPA 2XAMA 4HGTA 5JFSA 4JJRA 2J0LA 3VJOA 5HIDA 5DN3A 4D2VA 3AKLA 5DR6A 3SQQA 3NRMA 3BV3A 4ITIA 1OBGA 3MH3A 1MQBA 4M97A 4NKAA 3TEIA 5I4NA 5IG1A 5BUIA 5AV0A 2OJGA 2Q0NA 4E93A 3RZFA 3GP0A 4EONA 3E87A 4UBAA 2CDZA 4PMPA 4OBPA 2ITVA 3W0SA 3ORIA 1HCKA 1R78A 3MPMA 2R3JA 4BTJA 4PL4A 1G5SA 1PY5A 3DZOA 4A4LA 4QYGA 5G1XA 2EWAA 1GZNA 2QURA 3TUBA 3OF0A 3MPAA 3DQXA 1OL1A 4F9CA 4UWCA 2BDWA 3UE4A 4XRLA 1FMKA 3IG7A 5CSXA 4UZDA 2G01A 2UZBA 1PXIA 3VQUA 1LEWA 1ZZLA 4FTAA 4BHNA 4JL9A 3KULA 4I6FA 3SC1A 5J7HA 3K5UA 5AR3A 2JFLA 1YWVA 4PMMA 4QP4A 2QOKA 2ZM1A 4JQ7A 4U42A 4PRJA 4O7SA 4L3LA 2C0IA 3Q2JA 1H0WA 1H25A 5FP5A 1JOWB 3RVGA 3AMAA 3P23A 3R0TA 2HY81 1G8SA 4BCGA 3QQKA 4DEEA 5HX8A 5EHOA 4DTAA 1P2AA 1QPCA 3P78A 4BWKA 3HV7A 4G5PA 3KK9A 4CV8A 1R3CA 4F7SA 3N4UA 5EW8A 4WO5A 4A4OA 2GNHA 3ZM9A 5ITAA 3KCKA 4YSMA 4FNWA 4OBOA 5IH6A 1ZAOA 2UW8A 1TFFA 4BY9E 4NH1A 1YOJA 2CHLA 4ZP5A 3FKLA 3JPVA 5CEIA 5AUZA 4YTCA 3LCSA 3NIEA 4RIOA 2YWPA 4AXEA 2HCKA 3MY1A 2NRUA 4YJNA 3UPZA 5C8NA 3NNUA 4IX4A 2HZIA 5D41A 4YBJA 4XV1A 2GFCA 3PXQA 2ZFYA 3LFFA 2W5AA 1K2PA 3NW6A 4HNFA 4PV0A 4W4WA 5L4QA 1M17A 3JS2A 3LFAA 2GS2A 4IAZA 2C5NA 2GTMA 3K54A 2BIYA 5AP5A 3VS5A 4F7LA 5HE3A 5EM6A 3WI6A 3F61A 3FMEA 4UYAA 2HXQA 1W83A 1RQQA 2GSFA 2PY3A 4I24A 5AX3A 4DITA 4WNOA 3V6SA 1JPAA 3V5WA 3F3TA 3UNKA 2YM4A 2BKZA 4XOYA 3S4QA 1Y6AA 3HRFA 4DLJA 3R28A 4MXOA 2ZAZA 4W9XA 4GU9A 3ALOA 2FO0A 1XMMA 3GCPA 4BGGA 4AU8A 1OL7A 4E26A 2VTTA 2X8DA 3AT2A 5FWKK 4O22A 4WHZA 3NDMA 4BTKA 3A7FA 4F9AA 2VWWA 2J9MA 4NM7A 4IACA 3R73A 5CAUA 4GW8A 3UOLA 1OIUA 4JOAA 2UW7A 2PVYA 4YLJA 4BBMA 5EH0A 5L6OA 4DDGA 3FXZA 3QHWA 2XEZA 3ZSIA 5JFWA 4KIPA 4DTKA 2P2IA 2PZRA 5DR9A 3ENHA 2ITZA 4QD6A 5L2TA 1J7IA 2PZ5A 3Q2MA 3HDNA 5AV1A 3S0OA 4CVAA 3MY5A 3QQUA 4U7ZA 2B9FA 2WHBA 3QTXA 4ENXA 2WMQA 4FL2A 3BLRA 4F65A 1L3RE 2OSCA 3QWKA 2PZIA 2EXEA 3IK3A 4JT3A 4XP3A 1H07A 5FLFA 4R5SA 5KNJA 4X2JA 3FKNA 4FEXA 4ANQA 4IWQA 4RVLA 3OW4A 3NEWA 1ZYJA 3ORTA 5DT4A 5ETIA 2G2FA 5ACKA 3UOJA 1FVTA 5AR7A 4RX5A 3AKKA 5JGBA 4ACMA 4M0ZA 5I9UA 1ZOHA 3F2AA 3O23A 1H4LA 4GJ2A 3EJ1A 4HYIA 4RX9A 3ZC5A 4F7JA 4AX8A 3FPQA 4M7IA 4O1OA 2J2IB 4EOLA 3MH1A 4JBOA 5K3YA 4DINA 5IEXA 1UKHA 4J7BA 2C6KA 1SNUA 3FHRA 4UWYA 5HCYA 4AWIA 4BKYA 5AUUA 3PY3A 4O83A 3LMHA 4R77A 3BV2A 4MD7E 1QCFA 5FM2A 3D2IA 2OU7A 4KRDA 2QR8A 3PFQA 5AUYA 4NIFA 4AXDA