3QGYA

Crystal structure of itk inhibitor complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
246
Chain Sequence
HMVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIKEGSMSEDDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 246
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qgyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qgyA01
4CQGA 1XH6A 4KSQA 3BV2A 3OHTA 3Q52A 3PSCA 3ZLXA 1UU8A 3UIBA 2CKPA 4FKGA 4GS6A 1OL2A 5A4CA 2PPQA 1NVQA 5HI2A 4B99A 3Q5ZA 4DTKA 4HYIA 5CXZA 3QQHA 3EN4A 1ZOEA 1H1RA 4M0YA 4I6FA 5DT3A 4RC3A 3FL4A 2UZLA 4L45A 3PPZA 3KF4A 2YERA 3V8TA 3QRIA 4IAIA 4O0WA 5AA8A 3F66A 3LCOA 3P4KA 3IONA 3OZ6A 3CQUA 1APME 2EVAA 4U8ZA 3GCUA 5B0XA 4EONA 3A4OX 3F2NA 5LARA 1XH7A 4XEYA 5M57A 4KRDA 5AAEA 4YZDA 3LJ1A 2JFLA 4G3DA 4O0UA 4ZTQA 2XZSA 1SZMA 3FAAA 5GINE 4RG0A 1UWJA 3HKOA 2C30A 3FXWA 4KIQA 4NCTA 1UVRA 1M17A 4XV1A 5G1XA 4G17A 4Y5HA 4ANMA 1H26A 3FQEA 3BBTB 3AMAA 4D2RA 4I6HA 3AC5A 2HWPA 4CFVA 5A54A 5CALA 2A4LA 2OW3A 4M8TA 3TUCA 2YAAA 4AACA 3VWAA 3DQWA 3TIYA 4ANLA 3TL8A 3HAMA 4AWIA 3AC2A 5IA5A 4GT4A 3BU5A 4O1OA 3EL7A 2CNQA 2VWYA 4M15A 4AS0A 5C26A 5LVNA 3W2OA 4UB7A 4ZTSA 3U54A 5FUTA 2CSNA 4L9IA 2F2UA 2VWVA 3IPHA 3MW1A 4I94A 4G9CA 3Q4TA 4BDCA 3O51A 3QCSA 1G8AA 1TVOA 5KX8A 3VS5A 3O8PA 3ZM9A 1SNUA 4C3PA 4DFXE 4QYYA 2XIZA 4BCOA 2CGWA 3NMUF 1YWVA 4PPBA 4DGGA 5B2LA 5LWNA 5GIOE 4HOKA 4GH2A 4FBXA 3RZBA 3MFRA 3R02A 2YLFA 4J95A 5E8ZA 4BWKA 1OPLA 2H9VA 3TNHA 4YJUA 2JD5A 5CU3A 3TJCA 3PY1A 4JAIA 3GB2A 3R8VA 5KE0A 1FGIA 5CAOA 3MSSA 1Q8WA 4JRVA 4BDEA 1Z9XA 4HZRA 1ZYSA 4RJ8A 5FTQA 3VJNA 4AZSA 4BRXA 3BHYA 1ZZLA 5CS6A 3U4WA 4XG6A 4U44A 2PVNA 4DEDA 4IIRA 2RFNA 1PW2A 3H10A 4YJOA 1H27A 2KULA 1UKIA 4RIWA 2Q0NA 3F9NA 4M69B 3ZUUA 1GIIA 1NY3A 4KRCA 4F7SA 3ORKA 1Y8GA 2W5BA 3C4WA 2EB3A 4RQKA 3TZ9A 1Q99A 3FZOA 3NAYA 2OGVA 4KB8A 1GY3A 2UW4A 4OTIA 4UXLA 2XA4A 4YC8A 4YO6A 4JBPA 4I41A 1R78A 4EZ3A 4CVAA 4MCVA 4F9BA 4PY1A 4RWIA 4L3LA 2VX1A 3IW4A 3GCVA 3GU8A 5DRBA 1S9IA 3KA0A 3BLQA 4C8BA 3QCYA 3TG1A 5A4TA 4M7IA 1B38A 2UW6A 3NIZA 2P3GX 5TR6A 4MBLA 4YC6A 4GIHA 3EHAA 3OOGA 4FV8A 4GSBA 4UMQA 2QC6A 4JQ8A 4R6VA 3HRBA 3TZMA 3ET7A 3DFAA 4BTKA 4FSYA 5CYIA 2OXXA 3QX2A 4IE9A 1XWSA 4K6ZA 3DKOA 2R9SA 2CN8A 4I6QA 4QMOA 4IB3A 4YR8A 2DWBA 4YNOA 1YDRE 2GQGA 4CZYB 3EQCA 3DA6A 3FMEA 3AQVA 3FZPA 4F9YA 4AZWA 3Q3BA 3QTQA 3DBDA 3U8WA 5JRQA 2W1DA 2XK8A 3ORMA 4JG6A 4WNMA 4FK3A 1OMWA 3NUUA 4NUSA 4GW8A 2QOIA 3HAVA 3DTCA 2C6EA 4RZVA 3CS9A 5IQAA 2QURA 3SRVB 3WBLA 3COKA 1XKKA 4RJ3A 3UIMA 5I9XA 2EXMA 4FKOA 4BDIA 3OEZA 4C33A 2QO9A 2XB7A 4UEUA 3CY2A 3EB0A 4YTIA 3EFKA 2XYUA 4BZNA 5FM3A 4Y8DA 4JBQA 4IM2A 1OIRA 4FSRA 2O3PA 4ZIMA 4XLVA 4BBFA 4F7LA 4MXOA 5EK7A 4AGDA 5F20A 5C4KA 1QPDA 2C1BA 2FSTX 2GNFA 4XS2A 2ZB1A 3PPKA 2RIOA 3RK5A 4PNKA 4P90A 3QWKA 2R3PA 4WT6A 2WQOA 4HNIA 4YMJA 2JIUA 2YA9A 4QMTA 1IA9A 2HXLA 4LV5A 3WF9A 1IEPA 3WILA 4M67A 3VUKA 2PVKA 3FDNA 3UDBA 3LQ3A 2RG6A 3LFSA 3CC6A 4FV1A 5CSVA 4FNYA 2ZOQA 4WNPA 2GNLA 5AP7A 1KUTA 4I93A 4ALWA 3KULA 1PXPA 2CGUA 1YXXA 4F0FA 3TV4A 3KXMA 4EZ5A 2GMXA 3E8NA 3V04A 2YABA 3SOAA 2X9FA 2HAKA 2XEYA 5DE2A 3BLHA 4UMTA 4U80A 2QKRA 2VTPA 3CBLA 2J5FA 2R5TA 1KE5A 4FTTA 2VWUA 4XOZA 4YBJA 4NM3A 4RZWA 3FI2A 4XMOA 4PL4A 4DTAA 5KZ0A 4WBOA 1ZYDA 4X2FA 1JBPE 3Q9ZA 4XLIA 2JITA 4FR4A 3V3VA 4W8EA 2B55A 3OCTA 2IN6A 3GC7A 4FG9A 1QPJA 1Y8YA 5CU6A 1UNGA 4RLLA 3I5NA 4QT1A 5DG5A 4ACGA 2PU8A 1KV2A 1OKYA 3BZ3A 4MF1A 3HP2A 4EKLA 3P0MA 4G3EA 3UYTA 4D5HA 4JIKA 3RPRA 3MA6A 3C9WA 5L8KA 3RI1A 5HNIX 3DT1A 3KXGA 3FKNA 2VV9A 3A4PA 4D4SA 3ORXA 3RAWA 5DOSA 3TNWA 2VTRA 3H3CA 3FMMA 3F3ZA 4ARKA 4BDJA 2X6EA 4ORKA 2Y6OA 5T6KA 4IJPA 2ACXA 5FP6A 1W7HA 4KIOA 1IASA 1M2PA 4RIYB 3KRRA 3NSZA 4QQTA 3CY3A 2OBJA 2NP8A 1MQ4A 2YLEA 2XBJA 3UGCA 4AW1A 4B6LA 5M4IA 3HV5A 2FSOX 3MA3A 5J5SA 3SXRA 1MQBA 4BCFA 2JFMA 3DPKA 4LUEA 3UG1A 4JDKA 5FLFA 5KHXA 2YCRA 4C2WA 4YSJA 4D58A 5LWMA 3ZDUA 3DNDA 4JRNA 4DAWA 3GCPA 4C4IA 2YM3A 4O6LA 5M07A 4EL9A 1NA7A 4NJDA 5EOBA 2BTRA 5E8VA 2BRNA 5JFXA 2W4JA 4B9DA 4OGRA 4MAOA 3UODA 5JH6A 5AUYA 4F9CA 4EYMA 4E4LA 2VTOA 3B2TA 4ACCA 3NUAA 4OW8A 4FEQA 4XG2A 3F5PA 4ASEA 1JOWB 4ITIA 5FTOA 3UOLA 4PNIA 4M68A 5LOHA 3NLBA 5EQEA 2GS2A 4Q2AA 2ETMA 4DE4A 2PVLA 4CV9A 3KXNA 4G6LA 1CKJA 3H9FA 3FC1X 5FD2A 4O38A 4YJNA 3FY0A 2ZV7A 5FEEA 2IW8A 2JBPA 3SVVA 1YQJA 4RFYA 5LJJA 2GFCA 4LMNA 3RPVA 2WIPA 2H96A 3I4BA 2BHEA 2JDRA 3PYYA 4RX9A 5HE1A 4ZSEA 4EOQA 1QL6A 4W4VA 3DNEA 4QP4A 4HGTA 2QHMA 3ZUVA 1WBPA 2PUPA 2WEVA 3R9HA 2BKKA 3JVSA 3H0ZA 4JQEA 4GKHA 2VRXA 4EHZA 3OG7A 3MIYA 5A6NA 1DI8A 4NCTC 4V04A 5ANJA 2XJ1A 4WO5A 2C47A 5IH4A 1H0VA 3PG1A 1PMEA 5J79A 3CCNA 3OC1A 2QOCA 2AC3A 3GC0A 4OTDA 3ZO3A 4ACMA 3NX8A 3OY3A 1OBGA 3FPQA 3CJGA 3UPZA 3TTIA 5EI6A 2WPAA 1OI9A 5HBHA 4BBMA 4IC8A 4EOJA 5E8WA 4O0VA 3AT4A 4KBKA 1ZLTA 2F7EE 1FVRA 5A9UA 3BWJA 3EJ1A 4G2FA 4NIFB 4TN6A 3L9NA 4IX4A 3IW8A 4V05A 4UZDA 5HX8A 3E62A 3IW6A 3R9DA 3VUGA 2HCKA 5ANEA 3PXFA 2WAJA 4OR5A 4FKPA 5I4NA 3OWLA 5IF1A 4GU6A 3BQCA 5E8TA 4BCPA 5AP1A 4P4CA 2CLQA 5FTGA 3TEIA 4J8MA 2ERZE 4GK2A 3ZFXA 3NNUA 5IA3A 2XRWA 2UZWE 4HNFA 2P33A 5DEWA 4ANNA 4UX9A 3EYGA 3GFEA 4G1WA 2X2LA 3ZXTA 3A7FA 3TM0A 2W0JA 2R3JA 2I0EA 3HRCA 2PTKA 4EH6A 2WD1A 4QRCA 4KNBA 4WUAA 5JKGA 1PHKA 4AW0A 1M7QA 1I09A 2OICA 3DK7A 4A9YA 1BX6A 5FEDA 5IEXA 1YI6A 4M12A 3UIXA 2W1ZA 4CRSA 3NW6A 5LVMA 3HYHA 3HMMA 3AC3A 4R5SA 4XV2A 4YURA 3KKVA 2W4OA 2QLQA 3N4UA 2Y7JA 4GIIA 4EK4A 3HMNA 5CWZA 4CD0A 3RHXA 2E2BA 1STCE 3P9JA 3OW4A 3ZH8A 5IQFA 2O5KA 3E3BX 4IQ6A 3QXOA 2QOKA 1M7NA 1OUYA 4E93A 2OG8A 3OTVA 5EW9A 4W4XA 3A7HA 1OPKA 2PL0A 3NUYA 4L6QA 3DXNA 3HEGA 3O8TA 3O50A 1YHWA 5E7RA 5EM5A 4E6QA 5IMXA 3E7VA 5GJDA 3NCZA 1CTPE 1UA2A 4IWOA 5IZFA 4AW5A 1KOAA 5HNGA 4HW7A 3BE9A 4TYGA 3PXQA 1O6LA 3R8ZA 1E1XA 3D9VA 1YHSA 3T3VA 4C4JA 4QPMA 2CLXA 4FA2A 4I0TA 3QZIA 5CLPA 2J0JA 2WMVA 3QU0A 1V0PA 2WU6A 3D14A 4R8QA 3BGZA 5AV3A 5CAQA 2HIWA 4ZY5A 3GU5A 2JAMA 4HJOA 2DYLA 4JNWA 2FYSA 3RPOA 2WMTA 3CEKA 1YDSE 3BWFA 1PF8A 3R7VA 2J5EA 3FMLA 4X2GA 5HX6A 4QMYA 2BFYA 4TWNA 3R71A 1X8BA 3HDNA 5EG3A 4JDIA 4NJ3A 4F7NA 1IR3A 1WBSA 4F7JA 4O2ZA 2BFXA 4ASDA 4R7HA 1U5QA 4DFYA 4XG9A 1KOBA 3D4QA 3MFSA 2XKFA 5HOAA 3TV6A 4XG4A 2WTWA 4E20A 2C5VA 4IFGA 3PJ8A 2QG5A 3FYJX 3KMUA 4ZLOA 4O7TA 3QALE 3MH0A 5HEZA 4U79A 3Q53A 3KN5A 3T9TA 4AA0A 4F0GA 3VF8A 5EKOA 2YWPA 3KF7A 4TZRA 4K8AA 4ANBA 4TYEA 4D2TA 4GYGA 3T3UA 2J50A 3CTJA 4Q9ZA 3PA5A 5J9LA 4EOKA 5CAPA 1XJDA 4L7SA 4WRSA 2CGVA 4I22A 2HXQA 3UVPA 4I6BA 3BHTA 3QD4A 1PXMA 1K3AA 3TI1A 4H1MA 4L52A 4IACA 4Z16A 3U6HA 1IAJA 3KRWA 4FUYA 3BIZA 4FEUA 1MRUA 3HP5A 4F9WA 4MH7A 1IA8A 2E9NA 2ITZA 1ZMVA 5L3AA 4P2KA 4C35A 5HU3A 4L43A 4U40A 5DIAA 4BTMA 5A4QA 1OITA 5AAGA 3DKGA 3IOKA 1GZNA 2R3MA 4BI0A 3CSVA 4U45A 3KULB 5ITAA 2XKEA 3MFUA 5L2SA 4C4HA 3QC9A 3ROCA 2R2PA 3MY0A 4G5PA 2C6MA 4QP9A 4YLLA 3ZSGA 1PMNA 4X2NA 2CDZA 3FXXA 3ELJA 4O0TA 4AUAA 3OT8A 1JPAA 4XG8A 3SD0A 4AGCA 3QX4A 4M69A 2XJ0A 2X81A 4C4EA 2X7GA 4A4LA 3UMXA 4BL1A 5CASA 3REPA 3R9RA 1WBNA 3GOPA 5AEPA 3LCDA 1PMVA 3MDYA 3R73A 5IA1A 4D0XA 4AN2A 4RLKA 3OOMA 2OH4A 5EFQA 3COHA 3SQQA 3ZONA 3TKHA 2X2KA 4M3QA 3K54A 4P5QA 2PULA 5D7AA 2BVAA 3F3VA 3GBZA 3MH1A 2WXVA 3MY1A 3QTIA 3Q9XA 1JKTA 4HGEA 2JAVA 2O63A 2VU3A 4LOQA 1OM1A 3V5PA 3VJOA 3GFWA 3MPTA 4I5HA 4QOXA 3VUTA 4PTCA 5D12A 5FG8A 4CFNA 3R7UA 4CT2A 4JG8A 4L42A 4DEBA 4G16A 4Z3VA 2R3OA 3U6IA 2ZJWA 4RVKA 1ZOGA 3C5IA 3FJQE 3AG9A 3I0QA 3NGAA 3CLYA 4PX6A 3DBCA 3UG2A 1FVVA 3GC8A 3P7CA 4ZMEA 1OZ1A 3ZM4A 3V5QA 3C0IA 4OTRA 3U4UA 2HZ0A 2W1IA 2CPKE 2PWLA 4RVLA 2WKMA 3E88A 3EQBA 2NRYA 4QMUA 2PE0A 2C4GA 2YN8A 1Q5KA 1WVXA 2VTQA 5EOLA 3CKXA 1H1PA 3UE4A 3UTOA 2IZRA 3BELA 4EOOA 3N4TA 3K3IA 3VIDA 2YACA 5IH5A 5GNKA 4E5WA 1WBVA 3ZEPA 1OL5A 3QLFA 2WZJA 4QO9A 3LXPA 2BDFA 4GK3A 5K4IA 4O7WA 3DK3A 4FT9A 3VUHA 5HESA 2PHKA 4DBXA 4YHJA 2A1AB 4TYHA 2VTJA 2XEZA 3NUSA 3UYSA 5AM7A 4NL0A 3ALOA 4LYNA 5H8EA 5LCKA 3D15A 4FTQA 4FV2A 4NM7A 2ETRA 1VR2A 5TOZA 3R1NA 3MESA 5EH0A 2QOQA 2UZNA 3KL8A 4J1RA 4JOAA 2VWZA 5AIKA 4F9AA 1BLXA 4BKJA 5KMLA 2HW7A 2HZ4A 5KUPA 4APCA 4X6RA 4KBCA 4FVRA 3FQHA 2B52A 4FT7A 4KWPA 3QYWA 3FLWA 3RK7A 5IQBA 3Q6WA 2RFSA 1OUKA 4IAAA 4BHNA 4KIKB 5L6PA 2QD9A 2XNNA 4OBOA 3O23A 5CI6A 3KREA 3TNQB 3WZDA 4EH4A 2X6DA 4FSZA 3MB7A 3UMWA 5GZ8A 2WMUA 3DZQA 3NWWA 3QZFA 4PMPA 3ZYAA 5IA2A 3PFQA 3HNGA 4JJRA 2ITXA 5JQ8A 4D2VA 3NYNA 4GUBA 4BDBA 4AX8A 3ORNA 4FKJA 4LGHA 1CDKA 3RP9A 4FL1A 2FO0A 1G8SA 2J9MA 4MEDA 3MTLA 4AT4A 3WZEA 2R3KA 1CKIA 2R3GA 3KK9A 3VS4A 4JVGA 5CEKA 4QMNA 2WMAA 2WQNA 3O8UA 5ACBC 2I1MA 4EORA 1Q3WA 4AOIA 5H2UA 5DNRA 3VBTA 4RJ6A 4ZTRA 3QWJA 3R8PA 4NTTA 3OY1A 4U97A 4WA9A 3Q04A 4PL5A 4RQVA 3ZRKA 2C6KA 4E73A 5HO7A 4FSNA 4G6NA 5EHLA 1GZOA 1P14A 3FLZA 5ETCA 3KK8A 4R3RA 3RNIA 3R01A 4DH3A 4EKKA 4JX3A 2VWIA 5TKDA 3RM7A 3NZ0A 2C5OA 4CLJA 3PIZA 2WTVA 3THBA 5LMKA 4TRLA 1FPUA 4EHVA 4YTFA 3LJ0A 4RJ7A 2OSCA 3LFCA 2WFYA 4FTCA 1RJBA 3DKFA 4FL3A 3PP0A 5DR9A 1U46A 2REIA 1HCLA 3WARA 4BC6A 4EHEA 5BUEA 3O7LD 4O7RA 4TWOA 4RIYA 3ZRLA 4CCBA 3NW5A 3G6HA 2VWXA 1A06A 1R1WA 1OVEA 4FZFB 2UZOA 4GEOA 1XH8A 5LVPA 4AA4A 1FOTA 3DAEA 5EDQA 3S3IA 2UW0A 2XUUA 2XNPA 1LEWA 4RX7A 3UOKA 5B2MA 3QBNA 4ANSA 3ANQA 3KVXA 4O7YA 3MGYA 1JVPP 1QPEA 5LQFA 2NNWB 4IX5A 5FBOA 3IDBA 1Y6AA 1W82A 3F82A 3SW4A 5DYJA 2FSMX 2I7QA 1SYKA 2VN9A 5I3OA 3PZEA 3GUBA 3ACJA 4NM0A 1J91A 2OJFE 3W18A 4IJ9A 4GKIA 4JLCA 2C1AA 4NSTA 4RFZA 3W2QA 3D7ZA 4WUNA 2QNJA 4YO4A 3BYUA 4XV3A 2VX0A 5JQ5A 5BVNA 4ANOA 2ITQA 4CFFA 2B53A 4U81A 2XM8A 3ZLSA 2J0KA 3VUDA 5LCJA 3KRJA 4I23A 4RIOA 4GVAA 3P79A 4X0MA 3R1QA 5TO8A 3CPCA 3HGKA 1H1SA 4K11A 4UWYA 3K2LA 4AE9A 5JGDA 4QYFA 2DQ7X 3AGMA 3WF5A 2QQ7A 4B4LA 1JAMA 4EJ7A 4U6RA 5CANA 2P2IA 3K5VA 1KV1A 3M1SA 3E93A 3E92A 5HE2A 4EH3A 4X7QA 3OVVA 1QCFA 5E8SA 4RIXB 2GFSA 4WHZA 4H58A 3Q60A 3R63A 5EHYA 3WIGA 5AUUA 4KD1A 4J52A 4FTRA 1GAGA 4C61A 1P2AA 3NS9A 3FZTA 3I79A 1XQZA 3D0EA 4RWJA 3AMYA 2VAGA 4BCHA 3ID6C 5A4LA 2R3NA 2FB8A 2WTCA 3LE6A 3P86A 4D2PA 2QR7A 3JY9A 3JPVA 4IAFA 5L2WA 3D83A 3NVKI 3KRXA 5KMOA 4O96A 2J0MB 3G0FA 3IO7A 2W9FB 5E8XA 1VJYA 3V5LA 4H3QA 5CQUA 3V51A 2FUMA 4FZ6A 5IISA 4NIFA 4ZY4A 3TNPC 3ENMA 4DF3A 3AD6A 5IQGA 3O71A 2C5NA 1JSTA 3UVQA 3CGOA 1ZMUA 3SC1A 4QD6A 1NXKA 3R30A 1H4LA 3O96A 4BR3A 5IKWA 2QLUA 5CU0A 3C1XA 3R9OA 4FTIA 3A60A 5KCVA 4GJ3A 2HOGA 1QPCA 5C1QB 3KVWA 4XOYA 3BYOA 4FKWA 3PIXA 3NNVA 3F69A 3EMGA 3JR1A 4CG8A 1U4DA 4RX8A 5D11A 1URWA 1ZYJA 4QP8A 5TE0A 4BCQA 4QMQA 2OZAB 5I9YA 3L9MA 4FKTA 3DK6A 3QQKA 5J9YA 3CIKA 3QRJA 4CYIA 5EI2A 5HKMA 4C37A 1OL6A 4JQ7A 4O0YA 3ZC5A 4CZTA 4ANQA 3GCQA 3PZHA 4EWHA 3ATSA 4I5CA 4J71A 3TTJA 3DJ5A 5CVGA 3OCBA 4RA5A 2CCIA 3ZLYA 4A07A 1S9JA 4U42A 4G34A 4EH7A 5CEIA 3V8SA 3W8LA 3SA0A 4JBVA 4KBAA 5J5TA 4I5MA 3ZDIA 1VZOA 5IQIA 3DTWA 4ALUA 3EH9A 5L6OA 3KFAA 3UPXA 4R3PA 4AOTA 1H01A 3ZSIA 2XK3A 2PSQA 2QOLA 4P7EA 5BUJA 1CSNA 2YM8A 4LV8A 3RPYA 3SOCA 5JFSA 1XHAA 3P7AA 4C59A 4TNBA 3FI3A 2YCQA 4IWQA 2PZIA 4FIFA 2O2UA 4IZ7A 4NWMA 2IVTA 3QAME 4IADA 1IG1A 4IZAA 4BCIA 5E4HA 4BIBA 4DT9A 3BEAA 3TUDA 4IB5A 3S4QA 4JIAA 5EKNA 3B8QA 3MTFA 3ATTA 4JS8A 1XH9A 3VS3A 4IBMA 3SXSA 4O84A 3W2CA 5AV0A 3TZ7A 2R3QA 1L8TA 1P4OA 2C6OA 1FGKA 5K3YA 3LCKA 3OUKA 3DXQA 1Q8TA 1XBAA 2YDKA 3RALA 2JGZA 4DHFA 5IU2A 5I9ZA 3ZO1A 5CU2A 2CKQA 3IGGA 2XF0A 3RAIA 4ZTHA 5DVRA 2JKKA 5AR4A 2QU6A 1PXOA 3DLZA 4L3JA 3GOKA 4L67A 2ERKA 3KCFA 5BVEA 3LXLA 5C4LA 4XBRA 1XBBA 2OK1A 1ERKA 2Y8OA 3TWJA 3NUXA 3VS2A 4C58A 2GU8A 2Y6MA 4DH5A 4PWNA 2X1NA 4CCUA 3EQDA 3QC4A 2PE2A 4ACHA 2BROA 4FL2A 4TYHB 3ZFYA 3POZA 4K33A 3KMMA 4WOVA 3HA8A 4ZP5A 1UV5A 4Z7GA 2WMQA 1JLUE 2W1CA 4HCTA 4I20A 4PMSA 4AGWA 2ZAZA 1OPJA 4NTSA 3U55A 5HORA 1A48A 2IZTA 3WYXA 4O0SA 5JFVA 1NT2A 5DPVA 2JKMA 4AXAA 1LEZA 5EW8A 4Q9SA 3A99A 3P23A 4BWPA 4IC7A 4TTHB 3VUIA 2P55A 2PZRA 5H8BA 1G3NA 3R6XA 2V7AA 4FODA 2OFUA 3VBQA 4LOOA 5J7HA 4O7NA 1OBDA 3ORTA 4D4RA 2CGXA 5F1ZA 1JQHA 3QUPA 3UNJA 5J95A 3MH3A 3VULA 3F5UA 2O65A 2YISA 3PXYA 3LXKA 2RFEA 4RT7A 3ORPA 4UYNA 3TDWA 4F99A 3IGOA 3ZUTA 4MXYA 4F64A 4Y85A 2C3LA 2C0OA 2XCHA 3MWUA 5DBXA 1PRYA 3MBLA 2W1GA 3WIKA 2ITPA 1V0BA 4E6CA 4MVFA 1H24A 3LVPA 5CEPA 3MY5A 5JGBA 3FKLA 1HCKA 2QVSE 2V5QA 3HV4A 3S00A 1DM2A 2HELA 3LFAA 3AC4A 4FNWA 2GTMA 4JDHA 5E91A 3LW0A 4QP3A 3ETAA 2YZLA 2JC6A 1BKXA 4EQCA 4EZ7A 3HVCA 3WF6A 2GS6A 2VO6A 4QPAA 2CHLA 1SM2A 2OF4A 4G31A 3A7JA 4RJ4A 4ZXTA 4FUXA 4AT5A 3PJ1A 3A7IA 4AZTA 5CSWA 2ITUA 2AC5A 5AUTA 2EXEA 4UZHA 4MXXA 3R2YA 2IPXA 4D1ZA 1W98A 4D9UA 2BRHA 4NYEA 4A9TA 3LFDA 4RRVA 2YDIA 2ETKA 3OF0A 4MXAA 3MPAA 1Q8UA 1FMKA 2BAJA 5FDXA 5T3QA 4HYUA 3R83A 3WZUA 4CT1A 4DINA 1YDTE 3EFLA 4DG0E 2RG5A 4XH6A 1BL7A 1GZKA 2GQRA 5AR5A 2UW3A 5HBJA 2AYPA 2OFVA 3PTGA 5LMKC 5DFPA 4D4YA 4BY9E 4G6OA 1DAYA 1YOMA 2WTIA 1OB3A 3KGAA 3F3TA 3MV5A 3U6JA 3RGFA 2YCFA 3MI9A 3SG9A 3V8WA 3VF9A 4FKIA 3RCDA 5ETAA 5AUXA 1YXSA 2X8IA 4QQ5A 3FY2A 1BYGA 2J2IB 5TT7A 1E9HA 2Z60A 3HUBA 3A8WA 4XJ0A 4GU9A 3LMIA 4FKSA 4DFBA 3FZ1A 5H8GA 3D5UA 2SRCA 4R3CA 4DT8A 1WMKA 4YZBA 3BPRA 1P4FA 4IM3A 3DOGA 5IG1A 4A06A 4DG3E 4HVGA 4C38A 4CEGA 4EJNA 3UNKA 4UN0C 3VBXA 3MVLA 5FXQA 4YHFA 4WSQA 4WNKA 4BKZA 2VZ6A 3CPBA 4MD7E 4UMPA 2LGCA 3CP9A 3FXZA 3LCTA 4CKJA 2J90A 3QRUA 3F3UA 1Z57A 5A6OA 4UXQA 3BKBA 4EC8A 5E9EA 5GZ9A 1OKVA 3E3PA 1OECA 3GENA 3IW7A 5AR7A 5HGIA 2YM7A 3F7ZA 3EKKA 1TQIA 2OIQA 3I6WA 3KXZA 4AFEA 4QMPA 4ZMFA 1OIUA 4Y95A 4DH8A 1YW2A 5E8YA 4FK6A 4KIKA 3WOWA 2RSVA 4I0SA 2BRGA 5HICA 1ZARA 2PE1A 4N57A 4F65A 5HE0A 2VNWA 3AC1A 4XV9A 3DU8A 3OEFX 4O0XA 4C02A 3QQUA 3U87A 4BKYA 5KMMA 4KS8A 3VNTA 2VTMA 3QD2B 3HLLA 4IM0A 5AUVA 3AT2A 3GNIB 3G6GA 4XUFA 5T68A 3TT0A 3LQ8A 3HECA 2XCKA 4LL0A 4ZSGA 5IEYA 5AIRA 4CFXA 5JK3A 3QTUA 2WQBA 4U0IA 3OCSA 4F6UA 3UO5A 3COIA 4AP7A 4ITJA 4LRKA 2WOUA 4E7WA 3FZRA 4IXPA 3PP1A 4FZAB 4O6EA 5ANOA 4IVDA 3AT3A 3U51A 5KMJA 3PE2A 2C6LA 2O0UA 3S95A 4RWLA 2XNBA 4DITA 3LMGA 3ZCLA 3SXFA 4FKRA 5E90A 1V0OA 3A61A 3FE3A 2E9OA 4MNFA 4TWCA 4APPA 2C6DA 1R3CA 3LFFA 2BR1A 3E7OA 2E9PA 4BCKA 1ND4A 3R7EA 1OIQA 4ENXA 3GU6A 5AA9A 4F0IA 4M14A 1FINA 2EWAA 4OTGA 3L9PA 4YC3A 3DZOA 3FL5A 3LQ5A 4O2PA 2BIYA 3IG7A 3DFCB 5I9UA 2UW7A 3FLSA 3ZU7A 5K0KA 4PP7A 3SG8A 2R4BA 3OXZA 4IAYA 5AR2A 4EH2A 3UQFA 1BMKA 4XNEA 2ZB0A 4FG8A 4F4PA 4FOCA 5IA0A 4ZAUA 4FZ7A 1A9UA 2YHVA 3BX5A 3VAPA 3I6UA 3ORZA 1WBOA 4JI9A 2VGOA 2C68A 4PPCA 1NW1A 1W8CA 4AAAA 4FEWA 5BUIA 2Z2WA 3DCVA 4BF2A 2ZM3A 2G9XA 2XNEA 4MBIA 2ITTA 2QG7A 4JAJA 1YKRA 3ULIA 4EOLA 1MRVA 3HRFA 4X2JA 5CVFA 3SLSA 1H25A 3ORLA 2XVDA 3NAXA 1XBCA 3EL8A 3ERKA 4XYFA 5G6VA 5C27A 3OD6X 3EQGA 1MRYA 3I7CA 1R0EA 3PG3A 5HCXA 3W2SA 3W8QA 3I1AA 4C57A 2VTIA 1UNLA 3CJFA 4FVQA 3PUPA 4WSYA 5A46A 1U54B 1Q41A 1U59A 4J99A 5EYMA 4F09A 2F49A 3ZMMA 2G01A 2H8HA 4RIXA 4XP0A 2X8EA 2H6DA 4FGBA 3H30A 3QQJA 4EQUA 5DI1A 4EK8A 4Y5QA 4RSSA 5BPYA 5FP5A 4X3FA 2UVZA 2V22A 2GHLA 4CSVA 4PMMA 5C8NA 5CEMA 4USEA 5BYYA 2G15A 2IVSA 3L8XA 4CMOA 4JDJA 2I40A 2Z02A 3QYZA 5HIEA 3I81A 3Q4ZA 3UJGA 5M51A 4A4OA 3PJ2A 3RHKA 3P5KA 2XNMA 4IAZA 4YHTA 2VO7A 3MVMA 5K0XA 2ITYA 3L8SA 4YJRA 4FE2A 4U3YA 4I4EA 4BDAA 4LUDA 5CF5A 2Q83A 4DFLA 1LP4A 1MP8A 3ODZX 1P5EA 3MJ2A 3EQIA 4FC0A 3SKCA 4CXAA 5CSPA 3H9OA 4BI2A 4GVJA 5DHJA 4O1PA 4C4FA 5CF6A 1ZXEA 2GPHA 4A9RA 4K2RA 2J0LA 3HMIA 5KNJA 4EC9A 4FV5A 3IW5A 2B4SB 1Q3DA 3PE1A 3L1SA 5BVKA 4I3ZA 2HZNA 3GVUA 2IVUA 2W96B 4TXCA 4TKSA 2P0CA 2F4JA 2C3JA 2B9FA 2WO6A 4NKAA 4KSPA 2A2AA 5LMAA 4FX3A 2JDOA 1PKDA 3NW7A 1RDQE 3IDCA 4FYOA 2OZAA 4O7LA 4R78A 4XHKB 3PPJA 4A4XA 3DS6A 3H9RA 5GJGA 1XH5A 2YFXA 4B8LA 5L4QA 3QQGA 5JGAA 4N70A 3PJ3A 4FYNA 1WBTA 2V62A 4L01A 4M66A 3ZXZA 1REJA 5ACKA 2IO6A 2P4IA 1PXLA 4Z9LA 2GHGA 4L00A 4DYMA 1ZY4A 2A0CX 4F6WA 2PVFA 3NIEA 4CNHA 1OIYA 2ZM1A 2Y4PA 4ENYA 2IW9A 2WOTA 1PKGA 4LRJA 5DRDA 3CTHA 4NU1A 3ROYA 4UALA 4K1BA 2G2FA 4YJTA 3C0HA 3D5WA 4BBEA 4ZS4A 4FKLA 4IMYA 3N9XA 4ZK5A 4YPDA 2UZTA 3VRZA 4HVIA 5EDPA 2I0YA 2NRUA 4U43A 4ONAA 4G3FA 4W4YA 2B9IA 2QONA 4L53A 5AWMA 3UO4A 1H8FA 2ITNA 1H00A 4AGUA 2OIDA 3VC4A 4WG5A 3R22A 2PUNA 3BRBA 4KKHA 4C34A 2GTNA 3D5VA 4H39A 4NFMA 3KQ7A 1CM8A 5HLNA 4D1SA 1YWNA 4JR7A 4RBLA 3FEGA 3G9LX 2J6MA 5IH6A 3LMHA 2W1HA 3ENHA 4ZSJA 3S2PA 4IDVA 3AGLA 5IDPA 2X4ZA 4YZMA 2VTSA 4EBVA 2HYYA 3U9NA 4IWDA 5AAFA 1XR1A 2VTNA 3PSBA 5CSXA 4FNXA 4IB0A 4G3CA 3DV3A 1Q61A 4FT5A 1H1QA 4GYIA 4H3BA 4QP1A 4V0GA 1J1BA 3N51A 4BWXA 4C3RA 3KB7A 1H07A 4FEVA 5EQPA 1H1WA 3VBYA 4EOSA 5BVDA 2WHBA 2PZ5A 4Z55A 2UZUE 3F88A 3QRKA 1UU3A 2XRUA 2GHMA 1JWHA 3EQHA 4G5JA 3BLRA 3NUNA 4X21A 3W1FA 1URCA 3IQ7A 2OLCA 1M2RA 1B6CB 3PLSA 4V01A 4J53A 4CQEA 3QTZA 3DJ6A 5F4NA 2PMNX 2PMIA 4FSUA 4QMWA 4QYEA 3R8MA 3RMFA 3LZBA 4ZZOA 4E26A 3OWKA 2PZYA 2Z7SA 3RWQA 4RJ5A 4E1ZA 5CVHA 1OKWA 3QHRA 2YIQA 3BBWA 3PA3A 5AUZA 4ACDA 5KMIA 2W5AA 4S32A 2XNGA 3ZO2A 5C8KA 2ITOA 3PVBA 4L7FA 3HUCA 3SDJA 4XP2A 4FTNA 3ZZWA 5DH3A 4WIHA 4E4MA 3IOPA 1KWPA 2BILB 3NEWA 2I0HA 3OCGA 5JZNA 4R77A 2I6LA 1WAKA 4XG3A 4HVHA 3ZEWA 4RX5A 1F5QA 1YI3A 1YXVA 3FKOA 4A9UA 1J3HA 2Z7LA 5E8UA 4J8NA 5AM6A 3H4JA 4QP7A 4TL0A 4NW5A 4AN9A 3EFJA 4HGSA 3S0OA 3R0TA 3RJCA 4MWHA 4O86A 4D5KA 2VO3A 5DA3A 3FMKA 3QCXA 3RTPA 4UWCA 5BVFA 3E8CA 4ALVA 3DBEA 3GP0A 3FV8A 4KUJA 1J7IA 3P78A 4A9SA 4LFIA 4BZOA 5E1SA 4CMTA 3QKKA 3CGFA 2BALA 3C50A 5JSMA 2W99B 2WMWA 1ZAOA 4S34A 4GFOA 2UVYA 2FGIA 4YZ9A 4ZLZA 5IA4A 1FVTA 4QTDA 4WD5A 2QOOA 5JFWA 2UV2A 4BB4A 4QP2A 3OFMA 4FG7A 4EH9A 1SVHA 5BYZA 3NPCA 5CY3A 3LJ2A 4DLIA 4O7SA 3V5JA 3I60A 4H05A 4GK4A 3FSKA 3S1HA 3O7LB 5DEYA 4PPAA 1O6KA 4YPSA 4QNAA 4EBWA 4MYGA 4FOBA 3CXWA 3G0EA 3BYSA 4QMXA 4NKSA 3Q2JA 4NM5A 5IQCA 3BHHA 3NNXA 4A7CA 2CJMA 5M4FA 2J7TA 2CNVA 2ZV8A 4FKQA 3D7TA 4KKEA 3E63A 4E6DA 4YLJA 3F61A 3TNIA 3FUPA 3KXHA 1YHVA 5IUGA 4I92A 4F1OA 2HY81 3LHJA 4U9AA 4YJQA 4YLKA 5F95A 3NNWA 2UVXA 2GNJA 4ID7A 3VUMA 3ZRMA 5M06A 3DLSA 5AP2A 3KRLA 3R7YA 4OTPA 2QU5A 4DEEA 2BZJA 4IW0A 2VWBA 3O17A 3PXRA 5DR2A 5L2IA 4DCAA 5GIPE 4QQJA 5HVJA 1H28A 3OWJA 2XIRA 4WNOA 4NT4A 1LR4A 3K3JA 4FTJA 4GJ2A 3BGPA 3OXTA 4NFNA 5JEBA 4UY9A 3UZPA 2HWOA 3FZSA 3II5A 5C03A 4EH5A 3MYGA 3QA8A 1QMZA 1WVWA 3PY3A 3SX9A 2GCDA 2OO8X 3DGKA 3G9NA 3TJDA 4G9RA 4IX6A 5H3QA 2BAQA 3R8UA 5AADA 5BQ0A 5CZIA 3EFWA 4FICA 4MXCA 3LFEA 2F9GA 4EK3A 2JIVA 3SAYA 2WQMA 3WF8A 2B54A 5HHWA 3WYYA 1ZZ2A 4AZFA 5D10A 5FGKA 4MHAA 4Y72A 3W2RA 5EM7A 2X8DA 1R0PA 4L44A 3A2CA 3K5UA 4FIJA 4EOIA 1Z5MA 1JNKA 2BIKB 1YXUA 3FHRA 4ERWA 4EUUA 3VS1A 2Q0BA 4GG5A 5EQYA 2R3FA 4PRJA 3ZTXA 4HVSA 2OF2A 2W1FA 4O0RA 3KMWA 4ZJIA 3ZLWA 4BN1A 3Q9YA 4C2VA 1JKKA 4H36A 5CT0A 3ZBFA 5AR3A 4ZTNA 3AOXA 3BE2A 3LLTA 4RVTA 4U5JA 1GOLA 3MIAA 2C6TA 3R7GA 4CTBA 5KMNA 4CMUA 4BTFA 2YWVA 4WG3A 5HIDA 2PK9A 1O9UA 5FBNC 3OUNB 2X4FA 1IAHA 3MJ1A 4PF4A 2EB2A 3LM0A 5AUWA 4PDSA 4X3FB 3ZBXA 1RW8A 1ZYLA 3PDTA 4HZSA 3HMOA 5C01A 5EYCA 1JKSA 2VTLA 4RFMA 2B7AA 3ZZEA 4KAOA 3HA6A 1ZOHA 5KO1A 3TV7A 2ZV9A 4H1JA 3KN6A 1DS5A 4X3FC 5DT4A 1XH4A 2LAVA 1O6YA 3PY0A 3T8OA 3BU3A 4MWIA 1TQPA 1JKLA 3SW7A 3QUEA 2WIHA 3BYVA 4WBBB 3EN5A 5K5XA 2JDVA 2V7OA 4GFMA 3OTUA 5HG8A 3TZ8A 3V6RA 2W17A 2R3RA 4FV3A 2JBOA 2PVRA 2YIWA 2R3IA 3MS9A 2CNUA 4HCUA 4EYJA 4WRGA 2VTAA 4FNZA 4BVUA 5AV1A 5KBRA 4EOPA 1Y91A 1UU9A 3QKMA 2XNOA 1PY5A 5ETFA 3RVGA 4OAVB 2HENA 1BI8A 2BZKB 3BGQA 3OROA 2QI8A 5HQ0A 4XG7A 4EK5A 4FI1A 4FT3A 5DWRA 3TACA 1KSWA 4W9WA 5IDNA 1YVJA 3RINA 3TKIA 4DG2E 5D9HA 1YOLA 3LFQA 5LXMA 2EUFB 4G3GA 4U7ZA 2BHHA 3RBWA 2Z7QA 2ZMDA 1OGUA 2OJIA 2OJ9A 4IHPA 4TW9A 1W83A 2QHNA 3ZHPC 2XIYA 4JBOA 4N6ZA 1GIJA 3E8EA 2PMLX 4XRLA 3I0OA 4BGGA 5KHWA 4BDFA 1YXTA 3EQFA 4ZZMA 4OT6A 5FRIA 3PXZA 5DMZA 5IPJA 3AD5A 1OKZA 4NEUA 4IVCA 4ZTLA 2J0IA 4MK0A 5LVOA 2IWIA 5AJQA 5KMKA 3FBVA 5GZAA 2J4ZA 3HZTA 2BKZA 4BI1A 3SV0A 4FKUA 3AXWA 2X39A 3GCSA 2FH9A 3NYOA 3RNYA 5I5ZA 3BYMA 3JXWA 2E9UA 3QGWA 5DT0A 3H0YA 4HGLA 4FV0A 2IVVA 4MNEA 5CX9A 1Y6BA 3VHKA 2OZOA 2G2IA 5KZIA 2VO0A 3JUHA 4USFA 3NYXA 2VWWA 2GNGA 2ZDUA 3ANRA 4QQCA 1KE8A 5FWKK 5DN3A 2ZDTA 4FTMA 2BPMA 3FMHA 3NR9A 3QLGA 3W32A 2I0VA 3F5GA 4ZJVA 3F5XA 2YZAA 3V01A 3VW8A 4QYGA 4IWPA 1BI7A 4D2WA 1ZMWA 4FIIA 5I3RA 4MQ2A 1J1CA 4LQMA 4E3CA 4FSWA 3CKWA 1ZRZA 2R3HA 2B9JA 4XCUA 1U54A 5E92A 5L8JA 1GIHA 2EU9A 3KXXA 3NVMB 4UMUA 4CYJA 4M97A 3Q2MA 2PMOX 4O7ZA 4PTEA 3RM6A 3Q4CA 4R7IA 2UZBA 4J7BA 4YU2A 5L2TA 1M2QA 4V0GB 3EQRA 3M11A 2XM9A 3LFBA 4RPVA 1Q24A 3ZFMA 4DTBA 4AA5A 2ESMA 2KTYA 3OP5A 1UWHA 3GT8A 3P08A 3QQLA 5EYKA 4IFCA 3QFVA 4B8MA 4MF0A 1I44A 5EI8A 3IECA 2R0UA 3OXIA 3RZFA 2G1TA 4CTCA 1R39A 4AU8A 4GUEA 4FKVA 2IW6A 5CF4A 2PVMA 1RQQA 1YWRA 3POOA 2BDWA 3W33A 5BMSA 5BX0A 2IZUA 3B2WA 4BDHA 3DXPA 2OH0E 2FSLX 2WNTA 2ONLC 2WELA 3Q32A 1LPUA 4GL9A 4OTQA 4GCJA 3C4ZA 3OS3A 2IJMA 3FI4A 3NDMA 3R1SA 2YIRA 3PSDA 4ITHA 5HD4A 3QZGA 2BZHB 2JDTA 4I24A 4YZNA 3WF7A 1T46A 2XJ2A 4R7BA 3FSFA 3R1YA 2WTJA 3CD8A 3JY0A 5BMMA 3T9IA 4QNYA 4ZY6A 1UU7A 1PMUA 2XIKA 4CFUA 1KE7A 3E64A 1CMKE 2RKUA 4RA4A 3CR0A 4W9XA 3C0GA 2VGPA 5CENA 3MB6A 3LIJA 5I9WA 2GNIA 4QTEA 2W9ZB 4FF8A 2ITVA 4L3PA 4FV9A 4IB1A 5HO8A 3R2BA 3UQGA 4KIPA 2C3IB 3BI6A 1Q8YA 3DKCA 5IEVA 4FTKA 3QKLA 4GT5A 3VRYA 3DAJA 5ETIA 5L8LA 3IKAA 4I5PA 4U41A 3UC3A 3FWQA 3L9LA 3M2WA 2A19B 5M08A 2W06A 5EDRA 4YSMA 2OI4X 3VS7A 5LMBA 1E1VA 3TXOA 4BDDA 4ZSAA 2RL5A 5CEOA 1G5SA 1SMHA 1VYZA 3FLQA 3IK3A 3ULZA 3LLAA 1WCCA 2WTDA 3BCEA 5J9ZA 4E6AA 4BGHA 3RAHA 4DFNA 2W4KA 4FV7A 3C5UA 4AQCA 2C0IA 4L68A 4ZZNA 1YOJA 2PYWA 4DEIA 4ZS0A 2OJJA 2EXCX 3JYAA 5CNOA 3V5TA 4C0TA 5HTBA 2IG7A 2ZMCA 3GI3A 4ZSLA 3FI8A 2OXDA 4ZEGA 4LG4A 3D7TB 5IUHA 1DI9A 3FYKX 4HYHA 4FSQA 4DLJA 2V55A 1K2PA 3EN9A 3QF9A 4RVMA 4CKRA 4MKCA 4YGAA 3G51A 2HZIA 3EZVA 3HV7A 3OWPA 3A62A 3QRTA 4Y83A 4YJPA 1GNGA 1TKIA 2YIYA 3LCSA 4EUTA 4LI5A 2BRBA 3OT3A 4N6YA 5HLWA 4PDOA 4XBUA 5HE3A 3NUPA 3A8XA 5F94A 2BAKA 4OBQA 4FIHA 4M13A 3IS5A 4QP6A 4TY1A 4X6QC 4LM5A 4KS7A 4IVBA 2Y9QA 5CNNA 5J8IA 3PJCA 5FDPA 5IQHA 3EOCA 4TYIA 3EZRA 2WQEA 3QHWA 5AMNA 2ZV2A 4N4SA 1HOWA 4RWKA 4X3JA 2RGPA 2Z8CA 1SVGA 3TUBA 4BZDA 3ZS5A 5HCYA 4GT3A 4K18A 3SGCA 4HCVA 3Q5IA 4CFWA 5H9BA 4AW2A 4AZVA 4IZYA 1KE9A 3EQPA 3DBQA 3LXNA 2WB8A 3MN3A 3OBGA 5AP0A 4UYAA 2YM5A 4IAKA 4IEBA 3VS0A 5M56A 3FQSA 4WG4A 5M09A 2W7XA 4CLIA 5CZHA 3RK9A 2DS1A 4JG7A 2B9HA 1M14A 4MD9E 5KBQA 4FVPA 4BICA 1OL7A 4ZOGA 5L6WL 4EK6A 1NVRA 5EHOA 4JX7A 4BDKA 4RMZA 2OWBA 4C3FA 3KU2A 4F63A 3ITZA 3ZOSA 4MBJA 2IZSA 2JIIA 3VS6A 5IUIA 2FA2A 2YM6A 4MD8E 4IZ5A 3G2FA 5E1EA 3VN9A 5K9IA 4NK9A 4H3PA 4DA5A 2PUIA 4I1ZA 3B8RA 5CEQA 1W84A 4OLIA 4W8DA 3CQEA 3RPSA 1WZYA 4E4NA 5AP3A 4B0GA 2UZDA 4L8MA 3NYVA 3QUDA 4CZUA 5CXHA 5BVWA 3ACKA 3UVRA 5HZNA 1WFCA 1W0XC 3GQLA 3R00A 4EH8A 4FSTA 1LUFA 4EEVA 3HDMA 5K5NA 2QCSA 2R0IA 3KCKA 3W16A 3NRMA 4S33A 3G5DA 4PP9A 2BCJA 2C0TA 5M53A 2WMXA 3GGFA 2PVHA 5FEQA 2O8YA 2JKOA 2YJSA 4X2KA 3UP2A 4O21A 4BCJA 4D0WA 4UMRA 5AP4A 5IMEA 1F3MC 4R1VA 5BNJA 1GJOA 4O83A 3OBJA 4AOJA 3R04A 5ANDA 4F08A 1KE6A 5A4EA 5ANGA 5J1WA 4IH8A 3VW6A 5HLPA 5AP5A 5BVOA 3UOJA 1JSUA 2WMSA 4IANA 5AR8A 5M4CA 4EOMA 2Y0AA 3RKBA 5J7BA 5HO6A 2WMRA 4IVAA 4CGAA 3RCJA 3EKNA 3GEQA 4IX3A 4LOPA 5JRSA 3OW3A 4QPSA 2QOBA 1B39A 3L8VA 4DN5A 3Q4UA 2JDSA 2XBAA 4XP3A 5CTPA 4PDYA 3G33A 3O2MA 3IDPA 2X7FA 2YAKA 3P7BA 3LAUA 2XIXA 5M55A 3F7WA 2BUJA 5FM2A 3MVHA 5CAUA 5ANKA 2BMCA 3JVRA 5EM8A 5J87A 4CG9A 3GU4A 4GV1A 4Y46A 3DJ7A 3F2AA 4KKGA 1FMOE 3EN6A 4BIDA 4TT7A 3Q9WA 4I21A 4KA3A 4PDPA 3RWPA 4BTJA 5ICPA 3WI6A 3FHIA 2JKQA 1FBNA 5F9EA 2GQSA 2QOHA 2P2HA 5GJFA 4PTGA 1V1KA 2XKCA 2R64A 1RE8A 2W05A 4MNEB 2BDJA 4C62A 3BHUA 4WKQA 1ZY5A 2NO3A 2XKDA 4UV0A 3R7IA 4W4WA 4DFUA 4O27B 4BCNA 3GQIA 3VBVA 2C6IA 5HVKA 4J96A 1J7UA 3PIYA 2F57A 3WZKA 4ZJJA 2GS7A 4RIWB 4D55A 2CN5A 3FMDA 3EIDA 2F7ZE 2Y4IB 2GNHA 3Q6UA 5CU4A 2X2MA 3ODYX 4EWQA 2FVDA 4GFGA 5FXRA 3E5AA 4YTCA 1GZ8A 4NW6A 2PZPA 4M84A 2JLDA 2Y4IC 3C7QA 3DY7A 4FTLA 3LM5A 3HMPA 1PXIA 4FIEA 4PL3A 4KABA 5D41A 3QQFA 1AD5A 5HG7A 4DBNA 5D7VA 4YUQA 5JT2A 2PVYA 2CMWA 4MTAA 4D4VA 4YJSA 5JMSA 4F6SA 4XX9A 4BYIA 4OTWA 3PLAE 1XO2B 2BTSA 3DAKA 2WEIA 2OXYA 2QO7A 4HVDA 4GG7A 4AF3A 3PVWA 1PYXA 4I0RA 2CKOA 3G90X 3COMA 5AX9A 2B1PA 2YDJA 3R28A 4Z7HA 5ANIA 4AFJA 4PMTA 4BFMA 3C4FA 4Q5HA 3I7BA 3DDQA 2YEXA 2WU7A 3QTRA 3BQRA 1Y57A 3CD3A 3QD3A 1BUHA 4FZDB 4J98A 4I4FA 4NH1A 3UC4A 3WZJA 4D28A 1PXJA 3QZHA 3KEXA 4TPTA 4O7VA 4DC2A 4OT5A 5I9VA 3ZC6A 5HTIA 2VUWA 2VTTA 4P5ZA 4OTFA 5M44A 4LMUA 5JN2A 3ZO4A 3UZRA 2GSFA 2C5YA 4QTCA 4YP8A 5HG9A 1ZYCA 3TCPA 5DR6A 1SVEA 1K9AA 2OKRA 3QCQA 2UZVA 3BV3A 3VBWA 3MH2A 4F70A 2XS0A 4EHGA 3FMNA 3UOHA 1U5RA 4O82A 2VTHA 4ASZA 1MUOA 5CT7A 4FT0A 4UWBA 4C7TA 4K77A 4YBKA 4O91A 4TYJA 5HG5A 4RC4A 3TDVA 4S30A 3C4XA 4Y73A 5AP6A 4AN3A 3GC9A 4FV6A 2HW6A 4FSMA 4TWPA 5HTCA 1VYWA 2UUEA 5M4UA 4DFZE 1REKA 4BCMA 4FV4A 5CAVA 3LFNA 3HX4A 3PVGA 1NVSA 4FTAA 2VD5A 2R7IA 1Q62A 4USDA 5HVYA 3UQCA 4OTHA 3U9CA 4FTOA 3HL7A 2OU7A 2WMBA 3EWHA 4JR3A 4FGRA 1DAWA 2JEDA 4PQNA 5CQWA 3UBDA 5I0BA 4FIGA 4BHZA 1IRKA 4DEAA 2RF9A 5B2KA 4YNEA 3D94A 5C8MA 4EI4A 2F2CB 2B0QA 2OJGA 1YRPA 2PVJA 1TQMA 3CQWA 3DQXA 3QXPA 3C4CA 2PY3A 2VNYA 5HD7A 1BL6A 3C13A 4HPTE 4QMLA 4B7TA 3EYHA 2XP2A 5GHVA 4DH1A 3FLYA 3TIZA 3N4VA 4DCEA 3JS2A 5AV2A 3R7OA 3BU6A 3GXLA 4PUZA 3R8LA 5KKRB 4ERKA 4DEGA 3G15A 5EM6A 2QO2A 3DB6A 2QKWB 3SHEA 4CFMA 5LVLA 4DEHA 2F7XE 3PWDA 2CKEA 4BIEA 2E9VA 4LL5A 5JZJA 5KKRC 1WBWA 4QYHA 2ZVAA 2UZEA 3KY2A 4MX9A 3TN8A 3HV6A 4L46A 4AE6A 4DGLC 1M52A 3UO6A 2XH5A 3RAKA 3W10A 2O64A 4BYJA 2YCSA 3VQHA 3P1AA 2ZYBA 1PYEA 3AMBA 3DB8A 4LGGA 5A14A 1ZWSA 4MQ1A 2R3LA 3ALNA 5A3XA 3CE3A 3UZTA 3MFTA 5EYDA 2CCHA 3D5XA 4CV8A 2PUUA 4O81A 2YM4A 3TKUA 4GRBA 4DGMA 3AD4A 1Q4LA 1YI4A 3LKMA 4JT3A 5TF9A 3LPBA 4D9TA 2ONLA 1L3RE 4YTHA 4HPUE 3FLNC 3PRFA 4DH7A 2UW5A 3PXKA 4QMZA 4C36A 2DUVA 5IQDA 5DLSA 1Q97A 4ASXA 5L2QA 2BRMA 2UW8A 5AFVA 2BZIB 4E4XA 3FPMA 5FXSA 5FQDC 4QMVA 2VX3A 4MXZA 4O22A 4N0SA 1AGWA 3PRIA 4BCGA 2YIXA 4QMMA 3SRVA 4DGOA 2XK7A 1UNHA 3Q96A 4K0YA 4QTAA 4IDTA 2RFDA 3VHEA 3W55A 4UBAA 2C3KA 3PA4A 3PVUA 3E87A 1J7LA 3NCGA 3R21A 1AQ1A 4BDGA 5AX3A 2OIBA 4QMSA 2GDOA 1Q8ZA 4TNDA 3BEGA 5EW3A 3V5WA 1OL1A 3PWYA 4II5A 4J97A 4AT3A 4ZTMA 2QOFA 4KINA 4F1TA 2R7BA 2ZM4A 4M0ZA 4NZWB 3WE8A 3QA0A 4LRMA 5HIBA 2YITA 4OBPA 5C9CA 2ITWA 3QTWA 4LGDA 3VVHA 5CF8A 4AZEA 1WVYA 2AUHA 1UKHA 5IQEA 3FMJA 5BYLA 3GU7A 4QTBA 2V0DA 3A7GA 2G2HA 5DGZA 4D2SA 3F3WA 2Z7RA 4S31A 4F1MA 1H0WA 2NPQA 4C4GA 2XK4A 4OUCA 1PJKA 3CTQA 4U3ZA 4DGNA 3V6SA 4HYSA 5D1JA 4BGQA 4FMQA 4FTUA 2X9EA 2W1EA 2YJRA 2XMYA 3FC2A 2HY0A 3W2PA 4JL9A 4AG8A 5HU9A 2C5XA 2A27A 4YJVA 3UIUA 3F2RA 2UW9A 4RC2A 2J51A 2QR8A 3QL8A 3M42A 3O0GA 3R9NA 4OAUC 3QTXA 4E5AX 4PV0A 2QODA 4D1XA 2XK9A 1JSVA 2HK5A 3QTSA 4YZCA 2H34A 1SNXA 3DBFA 4E5BA 3DDPA 1VEBA 4GMYA 5K4JA 1H08A 4JXFA 3QD0A 3F6XA 3ORIA 4FEXA 4RGJA 2WTKB 1ATPE 2WGJA 1CKPA 1PXNA 5CSHA 3VO3A 2W5HA 3VQUA 5B7VA 3I5ZA 1FQ1B 5AV4A 3ZSHA 2XK6A 3C51A 3AC8A 2WTKC 1F0QA 5HCZA 1PXKA 5J1VA 2X7OA 3D2IA 3BHVA 3UNZA 3C4EA 4R1YA 2C69A 3KC3A 3MVJA 3EN7A 3UP7A 4E8AA 3LOKA 3E8DA 4Q5EA 3MPMA 4S2ZA 3OMVA 2X0GA 2XYNA 1EH4A 4K9YA 3QGYA 5HBEA 4CRLA 3D2KA 4R5YA 4XRJA 5CI7A 5HNBA 1T45A 3WE4A 3L8PA 4EQMA 4CKIA 4ZLYA 3HV3A
chains in the Genus database with same CATH superfamily
4CQGA 1XH6A 4KSQA 3BV2A 3OHTA 3Q52A 3PSCA 3ZLXA 1UU8A 3UIBA 4O4BB 4FKGA 2CKPA 4GS6A 1OL2A 4QDEA 5A4CA 2PPQA 1NVQA 5HI2A 4B99A 3Q5ZA 4DTKA 4HYIA 5CXZA 3QQHA 3EN4A 1ZOEA 1H1RA 4M0YA 4I6FA 5DT3A 4RC3A 3FL4A 2UZLA 4L45A 3PPZA 3KF4A 2YERA 3V8TA 3QRIA 4IAIA 4O0WA 5AA8A 3F66A 3LCOA 3P4KA 3IONA 3OZ6A 3CQUA 1APME 2EVAA 4U8ZA 3GCUA 5B0XA 4EONA 3A4OX 3F2NA 5LARA 3BLAA 1XH7A 4XEYA 5M57A 4KRDA 5AAEA 4YZDA 3LJ1A 2JFLA 4G3DA 4O0UA 4ZTQA 2XZSA 1SZMA 3FAAA 5GINE 4RG0A 1UWJA 3HKOA 2C30A 3FXWA 4KIQA 4NCTA 1UVRA 1M17A 4XV1A 5G1XA 4G17A 4Y5HA 4ANMA 1H26A 3FQEA 3BBTB 3AMAA 4D2RA 4I6HA 3AC5A 2HWPA 4CFVA 5A54A 5CALA 2A4LA 5IQFA 2XARA 2OW3A 4M8TA 3TUCA 2YAAA 4AACA 3VWAA 3DQWA 3TIYA 4ANLA 3TL8A 3HAMA 4AWIA 3AC2A 5IA5A 4GT4A 3BU5A 4O1OA 3EL7A 2CNQA 2VWYA 4M15A 4AS0A 5C26A 5LVNA 3W2OA 4UB7A 4ZTSA 3U54A 5FUTA 2CSNA 4L9IA 2F2UA 2VWVA 3IPHA 3MW1A 4I94A 4G9CA 3Q4TA 4BDCA 3O51A 3QCSA 1G8AA 1TVOA 5KX8A 3VS5A 3O8PA 3ZM9A 1SNUA 4C3PA 4DFXE 4QYYA 2XIZA 4BCOA 4FJVA 2CGWA 3NMUF 1YWVA 4PPBA 4DGGA 5B2LA 5LWNA 5GIOE 4HOKA 4GH2A 4FBXA 3RZBA 3MFRA 3R02A 2YLFA 4J95A 5E8ZA 4BWKA 2ZFYA 1OPLA 2H9VA 3TNHA 4YJUA 2JD5A 5CU3A 3TJCA 3PY1A 4JAIA 3GB2A 3R8VA 5KE0A 1FGIA 5CAOA 3MSSA 1Q8WA 4JRVA 4BDEA 1Z9XA 4HZRA 4BJJB 1ZYSA 4RJ8A 5FTQA 3VJNA 4AZSA 4BRXA 3BHYA 1ZZLA 5CS6A 3U4WA 4XG6A 4U44A 2PVNA 4DEDA 4IIRA 2RFNA 1PW2A 3H10A 4YJOA 1H27A 2KULA 1UKIA 4RIWA 2Q0NA 3F9NA 4M69B 3ZUUA 1GIIA 1NY3A 4KRCA 4F7SA 3ORKA 1Y8GA 2W5BA 3C4WA 2EB3A 4RQKA 3TZ9A 1Q99A 3FZOA 3NAYA 2OGVA 4KB8A 1GY3A 2UW4A 4OTIA 4UXLA 2XA4A 4YC8A 4YO6A 4JBPA 4I41A 1R78A 4EZ3A 4CVAA 4MCVA 4F9BA 4PY1A 4RWIA 4L3LA 2VX1A 3IW4A 3GCVA 3GU8A 5DRBA 1S9IA 3KA0A 3BLQA 4C8BA 3QCYA 3TG1A 5A4TA 4M7IA 1B38A 2UW6A 3NIZA 2P3GX 5TR6A 4MBLA 4YC6A 4GIHA 3EHAA 3OOGA 4FV8A 4GSBA 4UMQA 2AEGA 2QC6A 4JQ8A 4R6VA 3HRBA 3TZMA 3ET7A 3DFAA 4BTKA 4FSYA 5CYIA 2OXXA 3QX2A 4IE9A 1XWSA 4K6ZA 3DKOA 2R9SA 2CN8A 4I6QA 4QMOA 4IB3A 4YR8A 2DWBA 4YNOA 1YDRE 2GQGA 4CZYB 3EQCA 3DA6A 3FMEA 3AQVA 3FZPA 4F9YA 4AZWA 3Q3BA 3QTQA 3DBDA 3U8WA 5JRQA 2W1DA 2XK8A 3ORMA 4JG6A 4WNMA 4FK3A 1OMWA 3NUUA 4NUSA 4GW8A 2QOIA 3HAVA 3DTCA 2C6EA 4RZVA 3CS9A 5IQAA 2QURA 3SRVB 3WBLA 3COKA 1XKKA 4RJ3A 3UIMA 5I9XA 2EXMA 4FKOA 4BDIA 3OEZA 4C33A 2QO9A 2XB7A 4UEUA 3CY2A 3W0QA 3EB0A 4YTIA 3EFKA 2XYUA 4BZNA 5FM3A 4Y8DA 4JBQA 4IM2A 1OIRA 4FSRA 2O3PA 4ZIMA 4XLVA 4BBFA 4F7LA 4MXOA 5EK7A 4AGDA 5F20A 5C4KA 1QPDA 2C1BA 2FSTX 2GNFA 4XS2A 2ZB1A 3PPKA 2RIOA 3RK5A 4PNKA 4P90A 3QWKA 2R3PA 4WT6A 2WQOA 4HNIA 4YMJA 2JIUA 2YA9A 4QMTA 1IA9A 2HXLA 4LV5A 3WF9A 1IEPA 3WILA 4M67A 3VUKA 2PVKA 3FDNA 3UDBA 3LQ3A 2RG6A 3LFSA 3CC6A 4FV1A 5CSVA 4FNYA 2ZOQA 4WNPA 2GNLA 5AP7A 1KUTA 4I93A 4ALWA 3W0SA 3KULA 1PXPA 2CGUA 1YXXA 2X0PA 4F0FA 3TV4A 3KXMA 4EZ5A 2GMXA 3E8NA 3V04A 2YABA 3SOAA 2X9FA 2HAKA 2XEYA 5DE2A 3BLHA 4UMTA 4U80A 2QKRA 2VTPA 3CBLA 2J5FA 2R5TA 1KE5A 4FTTA 2VWUA 4XOZA 4YBJA 4NM3A 4RZWA 3FI2A 4XMOA 4PL4A 4DTAA 5KZ0A 4WBOA 1ZYDA 4X2FA 1JBPE 3Q9ZA 4XLIA 2JITA 4FR4A 3V3VA 4W8EA 2B55A 3OCTA 2IN6A 3GC7A 4FG9A 1QPJA 1Y8YA 5CU6A 1UNGA 4RLLA 3I5NA 4QT1A 5DG5A 4ACGA 2PU8A 1KV2A 1OKYA 3BZ3A 4MF1A 3HP2A 4EKLA 3P0MA 4G3EA 3UYTA 4D5HA 4JIKA 3RPRA 3MA6A 3C9WA 5L8KA 3RI1A 5HNIX 3DT1A 3KXGA 3FKNA 2VV9A 3A4PA 4D4SA 3ORXA 3RAWA 5DOSA 3TNWA 2VTRA 3H3CA 3FMMA 3F3ZA 4ARKA 4BDJA 2X6EA 4ORKA 2Y6OA 5T6KA 4IJPA 2ACXA 5FP6A 1W7HA 4KIOA 1IASA 1M2PA 4RIYB 3KRRA 3NSZA 4QQTA 3CY3A 2OBJA 2NP8A 1MQ4A 2YLEA 2XBJA 3UGCA 4AW1A 4B6LA 5M4IA 3HV5A 2FSOX 3MA3A 5J5SA 3SXRA 1MQBA 4BCFA 2JFMA 3DPKA 4LUEA 3UG1A 4JDKA 5FLFA 5KHXA 2YCRA 4C2WA 4YSJA 4D58A 5LWMA 3ZDUA 3DNDA 4JRNA 4DAWA 3GCPA 4C4IA 2YM3A 4O6LA 4QDVA 5M07A 4EL9A 1NA7A 4NJDA 5EOBA 2BTRA 5E8VA 2BRNA 5JFXA 2W4JA 4B9DA 4OGRA 4MAOA 3UODA 5JH6A 5AUYA 4F9CA 4EYMA 4E4LA 2VTOA 3B2TA 4ACCA 3NUAA 4OW8A 4FEQA 4XG2A 3F5PA 4ASEA 1JOWB 4ITIA 5FTOA 3UOLA 4PNIA 4M68A 5LOHA 3NLBA 5EQEA 2GS2A 4Q2AA 2ETMA 4O4DA 4DE4A 2PVLA 4CV9A 3KXNA 4G6LA 1CKJA 3H9FA 3FC1X 5FD2A 4O38A 4YJNA 3FY0A 2ZV7A 5FEEA 2IW8A 2JBPA 3SVVA 1YQJA 4RFYA 5LJJA 2GFCA 4LMNA 3RPVA 2WIPA 2H96A 3I4BA 2BHEA 2JDRA 3PYYA 4RX9A 5HE1A 4ZSEA 4EOQA 1QL6A 4W4VA 3DNEA 4QP4A 4HGTA 2QHMA 3ZUVA 1WBPA 2PUPA 2WEVA 3R9HA 2BKKA 3JVSA 3H0ZA 4JQEA 4GKHA 2VRXA 4EHZA 3OG7A 3MIYA 5A6NA 1DI8A 4NCTC 4V04A 5ANJA 2XJ1A 4WO5A 2C47A 5IH4A 1H0VA 3PG1A 1PMEA 5J79A 3CCNA 3OC1A 2QOCA 2AC3A 3GC0A 4OTDA 3ZO3A 4ACMA 3NX8A 3OY3A 1OBGA 3FPQA 3CJGA 3UPZA 4F78A 3TTIA 5EI6A 2WPAA 1OI9A 5HBHA 4BBMA 4IC8A 4EOJA 5E8WA 4O0VA 3AT4A 4EUUA 4KBKA 1ZLTA 2F7EE 1FVRA 5A9UA 3BWJA 3EJ1A 4G2FA 4NIFB 4TN6A 3L9NA 4IX4A 3IW8A 4V05A 4UZDA 5HX8A 3E62A 3IW6A 3R9DA 3VUGA 2HCKA 5ANEA 3PXFA 2WAJA 4OR5A 4FKPA 5I4NA 3OWLA 5IF1A 4GU6A 3BQCA 5E8TA 4BCPA 5AP1A 4P4CA 2CLQA 5FTGA 3TEIA 4J8MA 2ERZE 4GK2A 3ZFXA 3NNUA 5IA3A 2XRWA 2UZWE 4HNFA 2P33A 5DEWA 4ANNA 4UX9A 3EYGA 3GFEA 4G1WA 2X2LA 3ZXTA 3A7FA 3TM0A 2W0JA 2R3JA 2I0EA 3HRCA 2PTKA 4EH6A 2WD1A 4QRCA 4KNBA 4WUAA 5JKGA 1PHKA 4AW0A 1M7QA 1I09A 2OICA 3DK7A 4A9YA 1BX6A 5FEDA 5IEXA 1YI6A 4M12A 3UIXA 2W1ZA 4CRSA 3NW6A 5LVMA 3HYHA 3HMMA 3AC3A 4R5SA 4XV2A 4YURA 3KKVA 2W4OA 2QLQA 3N4UA 2Y7JA 4GIIA 4EK4A 3AKJA 3HMNA 5CWZA 4CD0A 3RHXA 2E2BA 1STCE 3P9JA 3OW4A 3ZH8A 1OGYA 2O5KA 3E3BX 4IQ6A 3QXOA 2QOKA 1M7NA 1OUYA 4E93A 2OG8A 3OTVA 5EW9A 4W4XA 3A7HA 1OPKA 2PL0A 3NUYA 4L6QA 3DXNA 3HEGA 3O8TA 3O50A 1YHWA 5E7RA 5EM5A 4E6QA 5IMXA 3E7VA 5GJDA 3NCZA 1CTPE 1UA2A 2IF8A 4IWOA 5IZFA 4AW5A 1KOAA 5HNGA 4HW7A 3BE9A 4TYGA 3PXQA 1O6LA 3R8ZA 1E1XA 3D9VA 1YHSA 3T3VA 4C4JA 4QPMA 2CLXA 4FA2A 4I0TA 3QZIA 5CLPA 2J0JA 2WMVA 3QU0A 1V0PA 2WU6A 3D14A 4R8QA 3BGZA 5AV3A 5CAQA 2HIWA 4ZY5A 3GU5A 2JAMA 4HJOA 2DYLA 4JNWA 2FYSA 3RPOA 2WMTA 3CEKA 1YDSE 3BWFA 1PF8A 3R7VA 2J5EA 3FMLA 4X2GA 5HX6A 4QMYA 2BFYA 4TWNA 3R71A 1X8BA 3HDNA 5EG3A 4JDIA 4NJ3A 4F7NA 1IR3A 1WBSA 4F7JA 4O2ZA 2BFXA 4ASDA 4R7HA 1U5QA 4DFYA 4XG9A 1KOBA 3D4QA 3MFSA 2XKFA 5HOAA 3TV6A 4XG4A 2WTWA 4E20A 2C5VA 4IFGA 3PJ8A 2QG5A 3FYJX 3KMUA 4ZLOA 4O7TA 3QALE 3MH0A 5HEZA 4U79A 3Q53A 3KN5A 3T9TA 4AA0A 4F0GA 3VF8A 5EKOA 2YWPA 3KF7A 4TZRA 4K8AA 4ANBA 1XMLA 4TYEA 4D2TA 4GYGA 3T3UA 2J50A 3CTJA 4Q9ZA 3PA5A 5J9LA 4EOKA 5CAPA 1XJDA 4L7SA 4WRSA 2CGVA 4I22A 2HXQA 3UVPA 4I6BA 3BHTA 3QD4A 1PXMA 1K3AA 3TI1A 4H1MA 4L52A 4IACA 4Z16A 3U6HA 1IAJA 3KRWA 4FUYA 3BIZA 4FEUA 1MRUA 3HP5A 4F9WA 4MH7A 1IA8A 2E9NA 2ITZA 1ZMVA 5L3AA 4P2KA 4C35A 5HU3A 4L43A 4U40A 5DIAA 4BTMA 5A4QA 4BJJA 1OITA 5AAGA 3DKGA 3IOKA 1GZNA 2R3MA 4BI0A 3CSVA 4U45A 3KULB 5ITAA 2XKEA 3MFUA 5L2SA 1W2CA 4C4HA 3QC9A 3ROCA 2R2PA 3MY0A 4G5PA 2C6MA 4QP9A 4YLLA 3ZSGA 1PMNA 4X2NA 2CDZA 3FXXA 3ELJA 4O0TA 4AUAA 3OT8A 1JPAA 4XG8A 3SD0A 4AGCA 3QX4A 4M69A 2XJ0A 2X81A 4C4EA 2X7GA 4A4LA 3UMXA 4BL1A 5CASA 3REPA 3R9RA 1WBNA 3GOPA 5AEPA 3LCDA 1PMVA 3MDYA 3R73A 5IA1A 4D0XA 4AN2A 4RLKA 3OOMA 2OH4A 5EFQA 3COHA 3SQQA 3ZONA 3TKHA 2X2KA 4M3QA 3K54A 4P5QA 2PULA 5D7AA 2BVAA 3F3VA 3GBZA 3MH1A 2WXVA 3MY1A 3QTIA 3Q9XA 1JKTA 4HGEA 2JAVA 2O63A 2VU3A 4LOQA 1OM1A 3V5PA 3VJOA 3GFWA 3MPTA 4I5HA 4QOXA 3VUTA 4PTCA 5D12A 5FG8A 4CFNA 3R7UA 4CT2A 4JG8A 4L42A 4DEBA 4G16A 4Z3VA 2R3OA 3U6IA 2ZJWA 4RVKA 1ZOGA 3C5IA 3FJQE 3AG9A 3I0QA 3NGAA 3CLYA 4PX6A 3DBCA 3UG2A 1FVVA 3GC8A 3P7CA 4ZMEA 4FRFA 1OZ1A 3ZM4A 3V5QA 3C0IA 4OTRA 3U4UA 2HZ0A 2W1IA 2CPKE 2PWLA 4RVLA 4JMQA 2WKMA 3E88A 3EQBA 2NRYA 4QMUA 2PE0A 2C4GA 2YN8A 1Q5KA 1WVXA 2VTQA 5EOLA 3CKXA 1H1PA 3UE4A 3UTOA 2IZRA 3BELA 4EOOA 3N4TA 3K3IA 3VIDA 2YACA 5IH5A 5GNKA 4E5WA 1WBVA 3ZEPA 1OL5A 3QLFA 2WZJA 4QO9A 3LXPA 2BDFA 4GK3A 5K4IA 4O7WA 3DK3A 4FT9A 3VUHA 5HESA 2PHKA 4DBXA 4YHJA 2A1AB 4TYHA 2VTJA 2XEZA 3NUSA 3UYSA 5AM7A 4NL0A 3ALOA 4LYNA 5H8EA 5LCKA 3D15A 4FTQA 4FV2A 4NM7A 2ETRA 1VR2A 5TOZA 3R1NA 3MESA 5EH0A 2QOQA 2UZNA 3KL8A 4J1RA 4JOAA 2VWZA 5AIKA 4F9AA 1BLXA 4BKJA 5KMLA 2HW7A 2HZ4A 5KUPA 4APCA 4X6RA 4KBCA 4FVRA 3FQHA 2B52A 4FT7A 4KWPA 3QYWA 3FLWA 3RK7A 5IQBA 3Q6WA 2RFSA 1OUKA 4IAAA 4BHNA 4KIKB 5L6PA 2QD9A 2XNNA 4OBOA 3O23A 5CI6A 3KREA 3TNQB 3WZDA 4EH4A 2X6DA 4FSZA 3MB7A 3O5AA 3UMWA 5GZ8A 2WMUA 3DZQA 3NWWA 3QZFA 4PMPA 3ZYAA 5IA2A 3PFQA 3HNGA 4JJRA 2ITXA 5JQ8A 4D2VA 3NYNA 4GUBA 4BDBA 4AX8A 3ORNA 4FKJA 4LGHA 1CDKA 3RP9A 4FL1A 2FO0A 1G8SA 2J9MA 4MEDA 3MTLA 4AT4A 3WZEA 2R3KA 1CKIA 2R3GA 3KK9A 3VS4A 4JVGA 5CEKA 4QMNA 3PFYA 2WMAA 2WQNA 3O8UA 5ACBC 2I1MA 4EORA 1Q3WA 4AOIA 5H2UA 5DNRA 3VBTA 4RJ6A 4ZTRA 3QWJA 3R8PA 4NTTA 3OY1A 4U97A 4WA9A 3Q04A 4PL5A 4RQVA 3ZRKA 2C6KA 4E73A 5HO7A 4FSNA 4G6NA 5EHLA 1GZOA 1P14A 3FLZA 5ETCA 3KK8A 4R3RA 3RNIA 3R01A 4DH3A 4EKKA 4JX3A 2VWIA 5TKDA 3RM7A 3NZ0A 2C5OA 4CLJA 3PIZA 2WTVA 3THBA 5LMKA 4TRLA 1FPUA 4EHVA 4YTFA 3LJ0A 4RJ7A 2OSCA 3LFCA 2WFYA 4FTCA 1RJBA 3DKFA 4FL3A 3PP0A 5DR9A 1U46A 2REIA 1HCLA 3WARA 4BC6A 4EHEA 5BUEA 3O7LD 4O7RA 4TWOA 4RIYA 3ZRLA 4CCBA 3NW5A 3G6HA 2VWXA 1A06A 1R1WA 1OVEA 4FZFB 2UZOA 4GEOA 1XH8A 5LVPA 4AA4A 1FOTA 3DAEA 5EDQA 3S3IA 2UW0A 2XUUA 2A98A 2XNPA 1LEWA 4RX7A 3UOKA 5B2MA 3ML1A 3QBNA 4ANSA 3ANQA 3KVXA 4O7YA 3MGYA 1JVPP 1QPEA 5LQFA 2NNWB 4IX5A 5FBOA 3IDBA 1Y6AA 1W82A 3F82A 3SW4A 5DYJA 2FSMX 2I7QA 1SYKA 2VN9A 5I3OA 3PZEA 3GUBA 3ACJA 4NM0A 1J91A 2OJFE 3W18A 4IJ9A 4GKIA 4JLCA 2C1AA 4NSTA 4RFZA 3W2QA 3D7ZA 4WUNA 2QNJA 4YO4A 3BYUA 4XV3A 2VX0A 5JQ5A 5BVNA 4ANOA 2ITQA 4CFFA 2B53A 4U81A 2XM8A 3ZLSA 2J0KA 3VUDA 5LCJA 3KRJA 4I23A 4RIOA 4GVAA 3P79A 4X0MA 3R1QA 5TO8A 3CPCA 3HGKA 1H1SA 4K11A 4UWYA 3K2LA 4AE9A 5JGDA 4QYFA 2DQ7X 3AGMA 3WF5A 2QQ7A 4B4LA 1JAMA 4EJ7A 4U6RA 5CANA 2P2IA 3K5VA 1KV1A 3M1SA 3E93A 3E92A 5HE2A 4EH3A 4X7QA 3OVVA 1QCFA 5E8SA 4RIXB 2GFSA 4WHZA 4H58A 3Q60A 3R63A 5EHYA 3WIGA 5AUUA 4KD1A 4J52A 4FTRA 1GAGA 4C61A 1P2AA 3NS9A 3FZTA 3I79A 1XQZA 3D0EA 4RWJA 3AMYA 2VAGA 4BCHA 3ID6C 5A4LA 2R3NA 2FB8A 2WTCA 3LE6A 3P86A 4D2PA 2QR7A 3JY9A 3JPVA 4IAFA 5L2WA 3D83A 3NVKI 3KRXA 5KMOA 4O96A 2J0MB 3G0FA 3IO7A 2W9FB 5E8XA 1VJYA 3V5LA 4H3QA 5CQUA 3V51A 2FUMA 4FZ6A 5IISA 4NIFA 4ZY4A 3TNPC 3ENMA 4DF3A 3AD6A 5IQGA 3O71A 2C5NA 1JSTA 3UVQA 3CGOA 1ZMUA 3PUFC 3SC1A 4QD6A 1NXKA 3R30A 1H4LA 3O96A 4BR3A 5IKWA 2QLUA 5CU0A 3C1XA 3R9OA 4FTIA 3A60A 5KCVA 4GJ3A 2HOGA 1QPCA 5C1QB 3KVWA 4XOYA 3BYOA 4FKWA 3PIXA 3NNVA 3F69A 3EMGA 3JR1A 4CG8A 1U4DA 4RX8A 5D11A 1URWA 1ZYJA 4QP8A 5TE0A 4BCQA 4QMQA 2OZAB 5I9YA 3L9MA 4FKTA 3DK6A 3QQKA 5J9YA 3CIKA 3QRJA 4CYIA 5EI2A 5HKMA 4C37A 1OL6A 4JQ7A 4O0YA 3ZC5A 4CZTA 4ANQA 3GCQA 3PZHA 4EWHA 3ATSA 4I5CA 4J71A 3TTJA 3DJ5A 5CVGA 3OCBA 4RA5A 2CCIA 3ZLYA 4A07A 1S9JA 4U42A 4G34A 4EH7A 5CEIA 3V8SA 3W8LA 3SA0A 4JBVA 4KBAA 5J5TA 4I5MA 3ZDIA 3W0NA 3W0OA 1VZOA 5IQIA 3DTWA 4DDIA 4ALUA 3EH9A 5L6OA 3KFAA 3UPXA 4R3PA 4AOTA 1H01A 3ZSIA 4DHZA 2XK3A 2PSQA 2QOLA 4P7EA 5BUJA 1CSNA 2YM8A 4LV8A 3RPYA 3SOCA 5JFSA 1XHAA 3P7AA 4C59A 4TNBA 3FI3A 2YCQA 4IWQA 2PZIA 4FIFA 2O2UA 4IZ7A 4NWMA 2IVTA 3QAME 4IADA 1IG1A 4IZAA 4BCIA 5E4HA 4BIBA 4DT9A 3BEAA 3TUDA 4IB5A 3S4QA 4JIAA 5EKNA 3B8QA 3MTFA 3ATTA 4JS8A 1ST0A 1XH9A 3VS3A 4IBMA 3SXSA 4O84A 3W2CA 5AV0A 3TZ7A 2R3QA 1L8TA 1P4OA 2C6OA 1FGKA 5K3YA 3LCKA 3OUKA 3DXQA 1Q8TA 1XBAA 2YDKA 3RALA 2JGZA 4DHFA 5IU2A 2X0QA 5I9ZA 3ZO1A 5CU2A 2CKQA 3IGGA 2XF0A 3RAIA 4ZTHA 5DVRA 2JKKA 5AR4A 2QU6A 1PXOA 3DLZA 4L3JA 3GOKA 4L67A 2ERKA 3KCFA 5BVEA 3LXLA 5C4LA 4XBRA 1XBBA 2OK1A 1ERKA 2Y8OA 3TWJA 3NUXA 3VS2A 4C58A 2GU8A 3W0RA 2Y6MA 4DH5A 4PWNA 2X1NA 4CCUA 3EQDA 3QC4A 2PE2A 4ACHA 2BROA 4FL2A 4TYHB 3ZFYA 3POZA 4K33A 3KMMA 4WOVA 3HA8A 4ZP5A 1UV5A 4Z7GA 2WMQA 1JLUE 2W1CA 4HCTA 4I20A 4PMSA 4AGWA 2ZAZA 1OPJA 4NTSA 3KIOC 3U55A 5HORA 1A48A 2IZTA 3WYXA 4O0SA 5JFVA 1NT2A 5DPVA 2JKMA 4AXAA 1LEZA 5EW8A 4Q9SA 3A99A 3P23A 4BWPA 4IC7A 4TTHB 3VUIA 2P55A 2PZRA 5H8BA 1G3NA 3R6XA 2V7AA 4FODA 2OFUA 3VBQA 4LOOA 5J7HA 4AXDA 4O7NA 1OBDA 3ORTA 4D4RA 2CGXA 5F1ZA 1JQHA 3QUPA 3UNJA 5J95A 3MH3A 3VULA 3F5UA 2O65A 2YISA 3PXYA 3LXKA 2RFEA 4RT7A 3ORPA 4UYNA 3TDWA 4F99A 3IGOA 3ZUTA 4MXYA 4F64A 4Y85A 2C3LA 2C0OA 2XCHA 3MWUA 5DBXA 1PRYA 3MBLA 2W1GA 3WIKA 2ITPA 1V0BA 4E6CA 3W0PA 4MVFA 1H24A 3LVPA 5CEPA 3MY5A 5JGBA 3FKLA 1HCKA 2QVSE 2V5QA 3HV4A 3S00A 1DM2A 2HELA 3LFAA 3AC4A 4FNWA 2GTMA 4JDHA 5E91A 3LW0A 4QP3A 3ETAA 2YZLA 2JC6A 1BKXA 4EQCA 4EZ7A 3HVCA 3WF6A 2GS6A 2VO6A 4QPAA 2CHLA 1SM2A 2OF4A 4G31A 3A7JA 4RJ4A 4ZXTA 4FUXA 4AT5A 3PJ1A 3A7IA 4AZTA 5CSWA 2ITUA 2AC5A 5AUTA 2EXEA 4UZHA 4MXXA 3R2YA 2IPXA 4D1ZA 1W98A 4D9UA 2BRHA 4NYEA 4A9TA 3LFDA 4RRVA 2YDIA 2ETKA 3OF0A 4MXAA 3MPAA 1Q8UA 1FMKA 2BAJA 5FDXA 5T3QA 4HYUA 3R83A 3WZUA 4CT1A 4DINA 4MUQA 1YDTE 3EFLA 4DG0E 2RG5A 4XH6A 1BL7A 1GZKA 2GQRA 5AR5A 2UW3A 5HBJA 2AYPA 2OFVA 3PTGA 5LMKC 5DFPA 4D4YA 4BY9E 4G6OA 1DAYA 1YOMA 2WTIA 1OB3A 3KGAA 3F3TA 4AXCA 3MV5A 3U6JA 3RGFA 2YCFA 3MI9A 3SG9A 3V8WA 3VF9A 4FKIA 3RCDA 5ETAA 5AUXA 1YXSA 2X8IA 4QQ5A 3FY2A 1BYGA 2J2IB 5TT7A 1E9HA 2Z60A 3HUBA 3A8WA 4XJ0A 4GU9A 3LMIA 4FKSA 4DFBA 3FZ1A 5H8GA 3D5UA 2SRCA 4R3CA 4DT8A 1WMKA 4YZBA 3BPRA 1P4FA 4IM3A 4O4CA 3DOGA 5IG1A 4A06A 4DG3E 4HVGA 4C38A 4CEGA 4EJNA 3UNKA 4UN0C 3VBXA 3MVLA 5FXQA 4YHFA 4WSQA 4WNKA 4BKZA 2VZ6A 3CPBA 4MD7E 4UMPA 2LGCA 3CP9A 3FXZA 3LCTA 4CKJA 2J90A 3QRUA 3F3UA 3TMOA 1Z57A 5A6OA 4UXQA 3BKBA 4EC8A 5E9EA 5GZ9A 1OKVA 3E3PA 1OECA 3GENA 3IW7A 5AR7A 5HGIA 2YM7A 3F7ZA 3EKKA 1TQIA 2OIQA 3I6WA 3KXZA 4AFEA 4QMPA 4ZMFA 1OIUA 4Y95A 4DH8A 1YW2A 5E8YA 4FK6A 4KIKA 3WOWA 1W2FA 2RSVA 4I0SA 2BRGA 5HICA 1ZARA 2PE1A 4N57A 4F65A 5HE0A 2VNWA 3AC1A 4XV9A 3UDSA 3DU8A 3OEFX 4O0XA 4C02A 3QQUA 3U87A 4BKYA 4DDGA 5KMMA 4KS8A 3VNTA 2VTMA 3QD2B 3HLLA 4IM0A 5AUVA 3AT2A 3GNIB 3G6GA 4XUFA 5T68A 3TT0A 3LQ8A 3HECA 2XCKA 4LL0A 4ZSGA 5IEYA 5AIRA 4CFXA 5JK3A 3QTUA 2WQBA 4U0IA 3OCSA 4F6UA 3UO5A 4LDTA 3COIA 4AP7A 4ITJA 4LRKA 2WOUA 4E7WA 3FZRA 4IXPA 3PP1A 4FZAB 4O6EA 5ANOA 4IVDA 3AT3A 3U51A 5KMJA 3PE2A 2C6LA 2O0UA 3S95A 3UDTA 4RWLA 2XNBA 4DITA 3LMGA 3ZCLA 3SXFA 4FKRA 5E90A 1V0OA 3A61A 3FE3A 2E9OA 4MNFA 4TWCA 4APPA 2C6DA 1R3CA 3LFFA 2BR1A 3E7OA 2E9PA 4BCKA