3QGYA

Crystal structure of itk inhibitor complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
246
Chain Sequence
b'HMVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIKEGSMSEDDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 246
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qgyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qgyA01
2J9MA 4RG0A 3C4FA 2E2BA 4I5PA 5AP6A 1KE9A 3AGLA 3Q2MA 3C4ZA 4QYEA 4ZTNA 2B53A 3PZEA 1NA7A 4QYGA 2HCKA 2WQOA 2XNPA 3FMEA 4EK3A 4A4LA 4QTEA 3QUEA 5HEZA 3TIZA 1OPLA 3C51A 5IH5A 5JFSA 4TYIA 2GNIA 5CASA 3KL8A 2WU6A 4S30A 4TYEA 3QD2B 1J7LA 3QQKA 4YZ9A 2ERKA 4HGLA 5E90A 2ZOQA 2CN8A 3A7IA 3FMHA 3QRTA 4WG3A 1H00A 4PWNA 5E8ZA 4OT6A 3EQHA 1G3NA 3OEFX 4N57A 5CEKA 4GYGA 3UOHA 3D14A 4FKOA 3ZH8A 1NW1A 1XH7A 4EOMA 1Q97A 1UU3A 1DAWA 4FSUA 4IAAA 4JAIA 3ZXTA 4W4XA 2PVMA 4YNEA 1Q8ZA 5DWRA 3P79A 1YHSA 5IA3A 3UOJA 4DEGA 5IA1A 1H8FA 4R7BA 1TVOA 4YZBA 3EIDA 1O6KA 3FUPA 3UVPA 3ACJA 1W82A 4USDA 3DTWA 3BLHA 3CGFA 5ANIA 3AC5A 2G01A 4JG8A 2PVYA 3FPQA 3C5IA 3S3IA 1GZKA 2B9HA 4XV1A 3ZC5A 1STCE 4C4GA 5C26A 4DC2A 4WOVA 5E1SA 4H3QA 3ZCLA 5A9UA 3TKUA 4ERWA 4J95A 5IQBA 4KS8A 3BV3A 2O65A 1CKIA 2ZJWA 3ZS5A 2UW3A 3FDNA 4WNMA 3Q60A 4ONAA 3QRUA 2I0YA 3PY0A 3TV6A 3AT4A 5CEOA 5J5SA 2C6IA 3I7CA 4D5HA 2G15A 3VBWA 3OCGA 3W2OA 1ZOEA 2ITXA 2SRCA 5DHJA 5F94A 5LMAA 4F0IA 3IPHA 4KS7A 3O7LB 4O1OA 3KULB 5HO7A 1ND4A 4XP0A 4FT7A 5M06A 5D41A 3RPVA 2GS7A 4BICA 3U4WA 4FZ7A 1CTPE 3C1XA 3TTIA 1FVRA 3R71A 4W4VA 4DEEA 5KE0A 5BVFA 3RAWA 3NVKI 2P4IA 5HBEA 2UZBA 4JQEA 4YLJA 1JBPE 3UZPA 3WF5A 2UW4A 5L2SA 2J5EA 3DXQA 4FTUA 4HYHA 4AN2A 4LI5A 3NIZA 2PU8A 2RFSA 1F0QA 4K6ZA 5AM7A 4RGJA 3UMXA 5HIEA 5HHWA 5IEYA 3DK7A 3UQGA 4BDHA 3QFVA 4J97A 4G3CA 5CNOA 4USFA 4M69A 2YACA 1BMKA 5HCYA 4N6YA 2GS6A 2KULA 4QTCA 2BTSA 4E26A 2OFVA 2VX3A 4O7RA 4LV8A 3BQCA 4M3QA 1YXSA 2VO7A 3CD8A 3P7CA 5EW8A 4FKGA 4CT2A 4X7QA 2R3OA 1NVRA 2QCSA 4RVMA 4CRLA 2PVRA 4ZJJA 1MRYA 1MUOA 4FV4A 4FTNA 3RMFA 4BCJA 5CF5A 5IQGA 1K2PA 4KKEA 4CSVA 1ZY4A 3GBZA 2XCKA 4TNBA 1YI6A 3R9RA 3F2NA 4S32A 1U54A 4LL5A 4NUSA 2UVZA 1U59A 2X7GA 2A27A 1UKHA 4FTLA 4KRCA 4MXXA 3SLSA 4BTJA 4O7TA 4CG8A 4MNEA 3MW1A 5L2QA 3FMKA 3PIYA 1BX6A 3V8SA 3Q9YA 5L2TA 5EHOA 3CTQA 4OTDA 3IQ7A 4KIOA 3TUDA 3VF9A 2C4GA 1KOBA 2OJGA 2IZUA 3ZM4A 1KE7A 3VUKA 1LEZA 2QU6A 2ERZE 2PZ5A 4CCUA 4WUNA 3CTJA 3LCOA 2QHNA 3IGOA 4KA3A 4NCTC 4WG4A 1XBBA 4XHKB 4UB7A 2QOBA 1ERKA 4ANNA 4FX3A 3DJ5A 5AP0A 5EYMA 5AAEA 3ZU7A 4FVRA 4ZS0A 4MQ1A 4EH8A 4HVGA 2YM4A 3ORZA 4FZ6A 3PLSA 5FDPA 5HO6A 2IW9A 4CFWA 3EFKA 3WARA 2W1ZA 5LARA 3QQLA 3CEKA 4ZIMA 3HV6A 2BRHA 4GFGA 5A46A 1JSVA 2IVVA 2CMWA 3OG7A 4L3PA 5GZ9A 4C8BA 3E5AA 2J51A 5ETCA 3FZTA 1ZYCA 2HAKA 2EXCX 4ALWA 5CU0A 3SXSA 4G16A 2ZB0A 4G5JA 3EFWA 4BGHA 1NVQA 4BFMA 4ZLOA 5LVOA 2HZIA 3NX8A 4FKJA 4XG7A 1KV1A 2WTWA 4DCEA 4EKLA 5AV4A 3FI3A 4FIIA 4I20A 2ZV2A 4FE2A 4RFZA 3KREA 4CVAA 1Q8TA 3QWJA 3R7IA 2A19B 4LMUA 4RLKA 2OJFE 4XV3A 4YHTA 4FOCA 1XH6A 3JY0A 3LQ3A 2QO9A 3EYGA 3QLGA 4DAWA 5K9IA 3ZZEA 4V0GB 2GQRA 2OKRA 4O21A 3ZMMA 1GIJA 3VULA 2PUNA 1SNXA 2CSNA 4ZMFA 4RRVA 4G34A 4H1MA 4BKJA 1KUTA 2BRNA 4C3RA 4YMJA 2WOTA 1VR2A 5CI6A 5HG5A 4QMQA 4AGWA 1PMVA 3WIGA 4I3ZA 5FTQA 4HPUE 4U0IA 4FR4A 5HD7A 3UQFA 3RWPA 5DR9A 4EYJA 1ZZ2A 4WRSA 4LOQA 2C1BA 2IW6A 2JDRA 2BRGA 2ZAZA 3ENMA 3VVHA 2G9XA 3K3IA 2X2KA 3R6XA 4FTAA 4TKSA 3A62A 4GVJA 3U87A 2B9JA 3A60A 4J7BA 3LCSA 4PPAA 4YC3A 4MX9A 4QD6A 5J9YA 2YIRA 3QA8A 2J4ZA 3CKXA 4D4YA 1WAKA 4H3BA 1PYXA 5ANGA 3IO7A 2CDZA 2BZKB 3UPZA 3FKNA 5K0KA 2QNJA 2OJ9A 4L53A 5AR8A 3OUNB 1CKJA 4FV5A 5L4QA 3B8QA 4AXAA 1WBOA 2W1GA 4A9UA 4ZTRA 2Z02A 3F3WA 2FH9A 5DEYA 1O9UA 3PLAE 4J8MA 4XG2A 1ZZLA 2XK3A 3D94A 2B7AA 4P90A 2XNNA 4WG5A 3BYVA 4B7TA 3G2FA 2V55A 1UNGA 3PE1A 1Y8YA 4N6ZA 4BDBA 4FBXA 4ZSJA 3K2LA 4AACA 5FDXA 2UVXA 1XH9A 5CQUA 3RK9A 3KF4A 2PZYA 4JT3A 3E64A 3ZRKA 3ZUVA 4AWIA 4IC8A 4PNKA 3EFLA 2OW3A 3K54A 1OL5A 4BL1A 4O2PA 5EDQA 2HXQA 2WGJA 3MBLA 4AW5A 3EQRA 1XH5A 2XNOA 1V0BA 4FSNA 1J91A 4A9SA 2VD5A 1JAMA 3O23A 2P33A 3OHTA 4FKPA 4TYJA 4CKIA 5M4CA 2X9EA 3FQHA 3WF6A 3D7ZA 4AT5A 2VNWA 3RAIA 1U4DA 2PMLX 5TE0A 3KXMA 2PUPA 5AV1A 3KULA 3KMUA 3QKKA 4GU9A 4CRSA 3GQIA 4QMPA 3RVGA 2PHKA 2XKCA 4U8ZA 2W4KA 5FTOA 2O63A 4XJ0A 3A7JA 4LRMA 2YLFA 4ZTHA 4EK5A 3ELJA 4YJUA 3GOKA 3R8MA 5JGBA 2X8IA 4PNIA 4ZSEA 5EQEA 4IANA 4E4NA 3CC6A 3OWJA 5CWZA 5GNKA 5LCJA 2QODA 2XK7A 2GFSA 4NIFA 3GU7A 4BDCA 4EONA 4ZTSA 3WE8A 2X4ZA 1X8BA 2BRBA 2C6LA 2GU8A 3EQBA 4OW8A 5EYDA 2AUHA 4PMSA 3E93A 2CLQA 3KFAA 3LFEA 4CQEA 4O22A 4RJ3A 4RZVA 3H9RA 2CJMA 2JDOA 3O8TA 4DLIA 4EQUA 1BKXA 2YWPA 3DLSA 4X3JA 4BTMA 4KABA 5L2WA 5KX8A 2F7EE 4ASZA 3O51A 4J96A 2EU9A 2VWBA 3II5A 3P5KA 4Z55A 5FD2A 1H24A 4DGLC 4EYMA 5JSMA 4QQTA 3F82A 5EI6A 3ZLSA 5D10A 3DK3A 4MXYA 3OOMA 4DFNA 2WQEA 3R9DA 1JQHA 2BAQA 4WA9A 1SVEA 2BHHA 4EWQA 2VTIA 4U6RA 2QOCA 2JIVA 4R5SA 2OXXA 2XBJA 3FI8A 2PE1A 4YHJA 4ZZMA 4GU6A 2Z8CA 3AC3A 2RFDA 3HUBA 3DXPA 3RZFA 3HV4A 3QKMA 2HWOA 3F3UA 3O8PA 4LUEA 2IJMA 5TOZA 3CS9A 4O84A 2WB8A 5J9ZA 3DBEA 5E9EA 5L3AA 5FGKA 3E8CA 3EYHA 2Q0BA 3FZOA 3OT3A 3QGWA 4AW1A 3QA0A 2DYLA 5EM5A 4BIBA 4U97A 4RVTA 3MESA 4YP8A 2X8EA 4MCVA 3NUNA 1Y6BA 5D9HA 4AW2A 4NTSA 3EQFA 2C0OA 2C30A 3DU8A 3O96A 1Y57A 4LV5A 4EORA 4O0VA 3C4EA 3PXZA 5AA8A 5IUHA 4FIJA 1NXKA 1BL6A 3QC4A 3ROYA 4V01A 5IEVA 3MIYA 3BHVA 4O6LA 2RL5A 4EZ5A 3KRLA 1NVSA 3H9OA 3MFUA 3GT8A 4EH5A 5GJGA 5HG9A 4BDKA 2B4SB 2QLQA 3NSZA 3QRJA 4IWOA 4MKCA 4GT5A 4J1RA 4YBJA 5C01A 4DFXE 2QG5A 4O81A 2YAKA 3R9OA 3VRYA 3H30A 5K4JA 3QALE 4S34A 3K3JA 2OFUA 3KMMA 3QD0A 3NAYA 4ZLYA 4ZY5A 4ZXTA 1IRKA 3OXIA 3PWDA 5IMXA 2WHBA 4Y72A 4BTFA 4RX7A 3S00A 1H1SA 3FZRA 3V04A 3E87A 5HE0A 2UW6A 3OCSA 3KK9A 4ASXA 3EB0A 1T45A 5CXZA 4BBMA 5FLFA 3CGOA 2OXYA 4BCOA 5EYKA 2PWLA 4MBJA 4EUUA 2W5BA 4BCFA 3KRJA 2JLDA 4RJ5A 4WIHA 2BFYA 4IVBA 5HLWA 4WUAA 3LFAA 5IQFA 2V5QA 5KMNA 1Z5MA 4F9CA 3L8XA 2OICA 3C4CA 5HIBA 3FAAA 5T68A 1E1VA 2JEDA 3PIXA 1JNKA 4ITJA 3QRIA 1H1RA 2R4BA 2WTJA 3HAVA 5JFVA 2H6DA 3HEGA 1ZAOA 3KF7A 3C4WA 4IZ7A 3QAME 3OS3A 2XKEA 2WIPA 4YBKA 4UMPA 3OBJA 2I0VA 3NW6A 2XIXA 5IEXA 3NZ0A 5F20A 3UIUA 3O17A 4FIEA 4O0WA 3W2RA 5AX9A 3C13A 4FZFB 1YWRA 5HTBA 3LMHA 3THBA 1RW8A 1YI4A 5IH4A 4L7FA 3U54A 3V5PA 4AA5A 4R1VA 3AG9A 4GUEA 2YJSA 4I6BA 2PZIA 5EG3A 3RCJA 5HX6A 5IDNA 4AAAA 5KUPA 3IKAA 4UMQA 3CP9A 4YJVA 5HCZA 3BGQA 3H3CA 3WE4A 5DGZA 4Y5HA 3DQWA 2BR1A 2WEIA 2Y4IC 3HMOA 2OH4A 4X2JA 3GU6A 3WF7A 3V01A 3ZDIA 4QPMA 3Q4CA 4MF1A 3EHAA 4E1ZA 1PXOA 3JVRA 2XS0A 2WOUA 2IW8A 2YA9A 3V5QA 1H1WA 5CSPA 5M56A 4FNYA 3WI6A 3UIMA 4TY1A 4R78A 4GK3A 5K4IA 2IVSA 3UG1A 3R22A 3TUBA 3U55A 3GCUA 4IB1A 2YDKA 3RK7A 5F4NA 4FSRA 3R21A 5A6NA 3PG3A 3PP1A 4MWIA 2EB3A 1PXJA 3TACA 2X81A 4I1ZA 4MK0A 3UYTA 4ID7A 1QMZA 4E7WA 3CTHA 4UZDA 3AGMA 3QC9A 3MH3A 3VIDA 2XF0A 4FV6A 2BUJA 5CSXA 1LR4A 2V7AA 3GI3A 4CZTA 1W98A 2CCIA 3V6RA 4AQCA 4RJ7A 4MF0A 1KE5A 4GJ2A 3LAUA 1M2RA 3DB6A 3NYOA 4L44A 5CEMA 3GNIB 3O8UA 4KIKB 4XG6A 2YZLA 5BMSA 4LYNA 4BRXA 4WSQA 4DGNA 2AC5A 2HY0A 3VBXA 4DFUA 4AUAA 4XG9A 3R9NA 1OB3A 2B9IA 3GQLA 3V8WA 5DFPA 3MY5A 2QQ7A 3FZPA 3GCVA 4EOLA 2ITUA 3BEAA 5CZIA 4MQ2A 5L8JA 5HX8A 5FBOA 4FVQA 3VS2A 5EI8A 2XNBA 4QP6A 4HNFA 5DLSA 3ZTXA 3MPMA 3QZIA 4I41A 2RF9A 3MIAA 3R1SA 5JN2A 4APCA 1JKTA 3OVVA 4IWDA 3LMIA 4OAUC 1U5RA 4O38A 4KIQA 2ETRA 3R1QA 3MVJA 4QNAA 5IISA 5B2KA 1NY3A 3RAKA 4B99A 1R39A 4R5YA 4I5CA 4E73A 1PKGA 4JX3A 5FBNC 3FXXA 3L8VA 2YN8A 5AAGA 1WMKA 4FGRA 4JRNA 4RX5A 2ZDTA 2J0JA 2BALA 2YLEA 4OUCA 3DLZA 5HKMA 5A14A 1OITA 3HUCA 3R7OA 2XB7A 5CALA 3SA0A 5AM6A 3TNPC 4DT9A 3ROCA 3F7WA 4IE9A 3RNIA 1P14A 2JKOA 3MH2A 1UNHA 3Q04A 2UZOA 2ITTA 2H9VA 3ETAA 4EKKA 4RPVA 3TZMA 4IIRA 3EQIA 4PL4A 5EDPA 2QOIA 2VAGA 5HVKA 4EZ3A 4UEUA 4APPA 3PE2A 4E93A 1G5SA 4XV9A 2G1TA 1AQ1A 1XBCA 3LE6A 3QXPA 5A3XA 5A4CA 2R64A 2WMSA 1GIHA 2WTCA 4CKRA 3R7GA 1G8SA 5IQEA 3EZVA 4D9UA 3LKMA 3FI4A 5FEEA 5FWKK 4G3FA 4FK3A 5CTPA 3AOXA 3BHYA 2C6OA 2YDIA 2ONLA 1OM1A 2GQGA 2C3LA 3HMIA 5CF6A 1NT2A 2OZAB 4AT4A 4W4YA 5CVHA 4AZVA 2WZJA 2XEYA 4KSPA 4XOYA 2W9ZB 1PXLA 3H10A 1CSNA 3NUSA 4TWPA 4ZOGA 3QGYA 3DJ6A 4BKYA 3NNXA 2UZVA 4I6HA 4I93A 4EJNA 3Q5ZA 4RSSA 4BYIA 1FMOE 2R7IA 4O0YA 4I0TA 1I09A 4H3PA 1TKIA 4P4CA 1W0XC 4RQVA 5FQDC 2X8DA 3FV8A 4BF2A 5CT0A 3RM7A 5JFWA 2C1AA 4N70A 4D2RA 4AE6A 2QOLA 2C3IB 2W5AA 4S31A 5KMOA 3Q32A 3D7TB 3G6GA 2NRYA 1CDKA 3I7BA 4G2FA 2YISA 1QPEA 5H2UA 4JLCA 4RC4A 3VF8A 1PMUA 4RX8A 3O50A 4CFNA 2CKOA 5AA9A 4A06A 3BYSA 3BV2A 2O64A 3MFRA 4Q9ZA 2W1HA 2YEXA 4XOZA 4F4PA 2W99B 5J5TA 3BU5A 3PWYA 2GNLA 2WMQA 3UODA 1M2QA 3W10A 3R02A 3R83A 5M53A 3IDBA 1YWVA 3ULIA 5M08A 4IVAA 4KBKA 3IG7A 2PVKA 4FA2A 3BHTA 3EQCA 2ESMA 2X2LA 2C6TA 3IDPA 3LHJA 4UWCA 3UIXA 1Z9XA 3PTGA 1ZYDA 4DITA 4EOJA 3F61A 5DR6A 5LVMA 2E9NA 5HCXA 4M0ZA 1Z57A 2PVHA 4B8LA 3JPVA 4EH7A 3ENHA 4JI9A 3LLTA 4QTAA 3P86A 4OBOA 3OC1A 4FOBA 5JQ5A 4JG7A 4TT7A 1WBWA 1UWJA 3TJDA 2WTKB 4CFUA 4JOAA 3RGFA 3EL8A 1OBGA 4FTIA 1M17A 3AXWA 2WMWA 1OL6A 4WBOA 5EI2A 1FPUA 2VU3A 2VTPA 4FSWA 2C69A 1SYKA 5HG7A 3SXFA 2QHMA 3ORIA 4C4EA 5A6OA 4FSTA 5DA3A 3KXNA 5C8KA 4FV1A 4GT3A 3TN8A 3F7ZA 4ANQA 2ITZA 3LXLA 4H05A 2UZNA 3IS5A 4Q5HA 5I3OA 2G2HA 3WZEA 4QTDA 3FXZA 1CMKE 3SW7A 2XJ1A 4U5JA 4E8AA 4D1XA 4ZLZA 3NYVA 2ZM4A 3LFSA 4ITHA 3DBCA 3GB2A 3RM6A 1OPKA 3ZM9A 5DVRA 3W18A 4E5AX 3QTRA 1FMKA 4L42A 4ZSGA 5BVOA 4C35A 4PDOA 3S0OA 5JRSA 3TZ8A 3VBYA 4MEDA 4NU1A 3SD0A 2W5HA 4PDYA 3POOA 3R8UA 3L9MA 3M42A 5BVKA 1MRUA 5B2MA 3MN3A 1FGKA 3HMMA 4P5ZA 2GTMA 4L7SA 5IQDA 5AIRA 3FWQA 3KRWA 3NRMA 4BWPA 2XKDA 3EQDA 4FEQA 2RIOA 3Q52A 3TUCA 1KV2A 4KIKA 1O6LA 4WBBB 5ETIA 3KXGA 5CZHA 3R7VA 3E3BX 3VS3A 4F65A 1H4LA 3FY2A 2LAVA 3S1HA 4DGGA 4ZJIA 1H0WA 3LW0A 4CYIA 1URWA 4XYFA 3TI1A 5ANOA 4BBEA 3COHA 5BPYA 2ZMCA 1VYWA 4O7LA 2B1PA 4X3FC 3TIYA 3TNQB 4TW9A 5A54A 3NEWA 2J90A 2J6MA 2FSLX 2JDVA 4BZOA 4NYEA 1KOAA 4FL1A 3COMA 4RMZA 4IACA 2E9OA 3EWHA 5DRBA 3VJNA 2PUIA 4UWBA 3HLLA 5CEPA 2OO8X 4K0YA 2XCHA 4QQJA 4XUFA 4CTBA 4FTMA 3QLFA 4W8EA 4BC6A 4FKUA 5AUYA 3D5WA 3ZEPA 5D11A 4IZ5A 3OW4A 4H1JA 4I0SA 4I6QA 5EOBA 2BAKA 3ZXZA 1BLXA 1MQBA 4J99A 3QCQA 4JR7A 3FL4A 3HECA 3RBWA 3Q6WA 4GH2A 2GQSA 3DCVA 4TPTA 4D1ZA 3AMYA 4GV1A 3G9LX 4D58A 2A4LA 2DWBA 1H08A 4MXAA 4EOOA 1J7IA 1OUKA 3PDTA 2J0KA 4BHZA 3VRZA 3FC1X 4IJ9A 3IGGA 3CBLA 3MVLA 4UMUA 3EKKA 3DAEA 2QI8A 4JIAA 3UZRA 3HA6A 4CMOA 5AUXA 4RBLA 3MA3A 1UV5A 4HYIA 1UWHA 5BNJA 4FZAB 4ZY4A 2J7TA 3DFAA 3MWUA 4U40A 4F63A 4I24A 4BDIA 1ATPE 2WPAA 2ETMA 3R04A 5E8WA 4CV8A 5BUIA 3IW7A 3CKWA 4FL2A 3MGYA 4QMZA 4U3YA 3E7VA 5CU3A 4IC7A 3KXXA 3L8PA 3ZHPC 1R0PA 5JK3A 1OBDA 5HI2A 4DINA 2WELA 4DT8A 5HU3A 2OZAA 2HK5A 4QYYA 1Q3WA 4G31A 5AJQA 3OCBA 3KGAA 4K18A 2VTAA 5I9WA 1OI9A 1YQJA 2C3KA 2Z7LA 4C02A 1OIRA 4XLIA 2Z7SA 1YDSE 4BTKA 4QP8A 1WVXA 1UU7A 4Y8DA 3TV7A 3E63A 2ZM1A 3MY0A 3W1FA 2NRUA 4W9WA 2W1IA 4HGTA 4YJSA 4D5KA 3DOGA 1V1KA 1J1BA 4DYMA 4AOJA 3TWJA 3UIBA 2XK4A 4RC2A 3CQUA 4I21A 1REKA 3A4PA 3HDNA 4IB0A 3QF9A 2F2CB 4TYHB 4E4XA 2ONLC 5J1WA 2F2UA 4GRBA 3PG1A 5CAUA 3QXOA 3V51A 3VBVA 2CGWA 4Y95A 3FKOA 3QYWA 4ANOA 2Z7RA 1JKSA 5KKRC 4X0MA 4QP9A 1UKIA 4AE9A 5HTIA 4DH1A 4R77A 4K8AA 3VC4A 4UBAA 1H07A 2VTRA 5JRQA 4JS8A 4CT1A 3ORNA 2BKKA 4MTAA 4KINA 2H96A 5LMKA 4CFVA 2BFXA 1OGUA 4D0WA 3OMVA 4W9XA 4JXFA 3MS9A 4ALUA 5K5XA 3KCKA 1MQ4A 1WBTA 4O91A 3OXTA 2VWWA 2ITQA 4Y73A 3CPBA 3JYAA 3BLQA 4L45A 2OJJA 4TYGA 3RINA 2V0DA 4BCNA 4LFIA 4R8QA 4PTCA 3QL8A 1YHVA 3MVHA 4DF3A 3L1SA 2FUMA 2Z7QA 5AP7A 2ITVA 3LFFA 3KC3A 2PL0A 4QQCA 4EC9A 3C7QA 4E3CA 1U46A 3DTCA 4HVSA 2R2PA 5JGAA 3MB7A 2BMCA 3QQGA 2VTQA 4U9AA 4QOXA 3ZFYA 4D1SA 5IA0A 3VQHA 4C0TA 4F08A 3N4UA 5AR7A 5H3QA 3FZSA 1XQZA 3KXZA 2B0QA 4DH3A 5LOHA 2Y6MA 4F7NA 4DBXA 2FGIA 2HW6A 3I0OA 4IHPA 3UVQA 3CY3A 3U6HA 4A9RA 4TWNA 3Q4TA 4E6DA 2QR8A 4TXCA 3ZDUA 3U6IA 4CTCA 4MD8E 2KTYA 2YCQA 2A1AB 3CPCA 4R6VA 5AUWA 3IW6A 3EQGA 4FVPA 3DV3A 4QMSA 2XBAA 4LGHA 1VJYA 3NGAA 4DTKA 2EXMA 4EHEA 5JZJA 1XH4A 3ORLA 3IECA 4D2SA 3LFBA 5E8TA 4BY9E 5CXHA 5J7BA 3OOGA 3HVCA 1Q99A 4DEIA 2QOOA 2PMNX 4M8TA 2PY3A 4B4LA 3ZRMA 4UZHA 3U9CA 2BDJA 5I3RA 3W8LA 4X21A 4HPTE 3E8EA 2C6EA 2PVFA 4HZSA 3PFQA 1K3AA 4CMUA 5LMBA 2OIDA 1W83A 3MJ2A 4R3PA 1DM2A 4WKQA 4BI1A 2YM5A 1YDTE 5HE1A 1PMNA 5LVPA 3DZQA 3NR9A 4JBVA 1KSWA 3ZFXA 3RCDA 4IDTA 5LJJA 2ITNA 3LXKA 4RFMA 4EL9A 3KY2A 1OL7A 5HOAA 3IOPA 1UVRA 3D2IA 4NTTA 2Z2WA 3PY3A 2FA2A 4XBRA 4FSZA 4X2KA 2XUUA 1IA9A 1B6CB 1YKRA 3DDQA 3DXNA 3EOCA 1H28A 4UWYA 3P1AA 4AN3A 3KEXA 5C8NA 3DK6A 3SGCA 3GEQA 2UZWE 4LG4A 2YCSA 3LM0A 4J71A 1OECA 4OBQA 4C34A 3MYGA 2WAJA 4XG8A 4F9YA 1PRYA 3SXRA 3HL7A 3RHKA 2IPXA 3PJ3A 4EZ7A 3I6WA 5DT0A 3UMWA 4YPSA 3SQQA 4W8DA 5AP3A 1Q8WA 2GS2A 5D7VA 2OIBA 4HYSA 4JBPA 3UJGA 1FGIA 2QO2A 4YSJA 4L6QA 4DTBA 3KU2A 2HW7A 3D15A 5KO1A 4Y5QA 5E1EA 4EJ7A 2RGPA 4QMVA 4OAVB 5AUUA 2BILB 2CPKE 3PVGA 3GUBA 4QMMA 5J95A 3K5UA 4F0FA 2CGXA 2WIHA 4IWQA 3MFSA 4O6EA 4OTQA 4YO6A 5FRIA 5J87A 3AQVA 1GZNA 4Z16A 3FEGA 3W2CA 1QL6A 5EH0A 5IUIA 2XK9A 2IO6A 2VRXA 2WO6A 3C50A 4WT6A 3DNEA 4GG7A 4XBUA 5CX9A 3ALNA 4DG2E 4RLLA 3OWKA 5LVNA 4FV7A 4HJOA 3RPSA 3ZYAA 3E3PA 3OD6X 3HX4A 3QYZA 5EK7A 4IX3A 2YM6A 3UOKA 3OWLA 4JNWA 4Z3VA 4P5QA 2C5XA 3NIEA 2PZPA 2ZDUA 4OTPA 4PP9A 4BKZA 5CVGA 5EHYA 4J98A 4NW6A 2WTDA 2XH5A 5C9CA 5AFVA 2YJRA 4HVIA 5CF4A 2BPMA 4Q9SA 2WMVA 3VS5A 2I40A 2VWVA 1M2PA 5M07A 3DNDA 3T3UA 1A06A 3FLNC 4NL0A 1O6YA 3NCGA 5CENA 3SOAA 2R3LA 3U8WA 3RP9A 4ACMA 3JY9A 1RE8A 3MVMA 5GIOE 3BX5A 2OU7A 1OMWA 3HMNA 4GS6A 4MYGA 3ITZA 1YI3A 3UG2A 2IZRA 3RAHA 2VUWA 1MP8A 3A8WA 3RPOA 3N4VA 3AC1A 3H4JA 4D2VA 4U45A 1ZY5A 1GY3A 5EW9A 3B2WA 4GFMA 2UW7A 2XM8A 4G9RA 4O0RA 4LRJA 4EH4A 3PJCA 5BX0A 3VS7A 3NNVA 4XRJA 2WMAA 3BCEA 5CEQA 3EN7A 4C4HA 4UYAA 4G3GA 2WXVA 4FTOA 3HP5A 1Q41A 2FYSA 3W2SA 5AR2A 3QUPA 2UW0A 4CZYB 2W1EA 2IN6A 1R1WA 3TZ7A 3KVXA 5BVWA 4V05A 3EZRA 2VWZA 3BWJA 2X9FA 4II5A 2E9UA 3U9NA 3FY0A 2EWAA 4YUQA 3KA0A 4E4MA 4UY9A 4TL0A 5EM7A 3UDBA 4FSYA 2ZYBA 3ET7A 5H8EA 4IZYA 4QMNA 3AT3A 3DAKA 2W4OA 4ARKA 4O0XA 5A4EA 4K2RA 4XLVA 1AD5A 2BHEA 3MI9A 2HELA 1ZMUA 1GJOA 3WYYA 1P4OA 1KWPA 2C6KA 2R9SA 3LPBA 4GUBA 1ZRZA 3V8TA 3WZJA 2UW9A 2FSMX 3F69A 3PPZA 1YXTA 4KBAA 1GZ8A 5EM6A 4ZTQA 3NCZA 4C38A 2CHLA 3PPKA 4QRCA 5GZAA 3SHEA 3BGPA 3QQUA 4BCMA 2BIKB 3COIA 4ZP5A 3BHUA 3JS2A 4OTFA 5KMIA 2CKQA 4UXLA 4XP2A 4V0GA 1YOJA 5DT3A 3R8LA 3VUIA 5ANEA 1R0EA 3F3TA 4FTRA 4CFMA 3RKBA 4AGCA 3FYKX 4MBIA 5DNRA 3WBLA 4XX9A 1ZWSA 4XRLA 4B6LA 4EBWA 5KBQA 4IX6A 1BUHA 4C58A 3VO3A 5F1ZA 3OCTA 4GK2A 3UOLA 3B8RA 3QTXA 1TQMA 1PXKA 2WMXA 2R3PA 4X6RA 4CV9A 4CYJA 3LM5A 3R63A 5J1VA 5HD4A 4FYNA 5LMKC 3DBDA 1Q62A 2W1CA 2Q83A 4HVDA 5D12A 5ANDA 2YERA 4YZDA 4DEAA 3P0MA 4RWLA 1DS5A 2UV2A 3G33A 4JVGA 1ZXEA 4KIPA 4LM5A 5FM3A 4BIEA 3HMPA 3BQRA 4FKIA 3A4OX 3ULZA 2HENA 2PVNA 3ZBFA 3SVVA 4F6UA 4LUDA 4FI1A 3DBFA 3WF8A 3IW8A 2R3KA 4NH1A 3LJ2A 3ERKA 3R8VA 2R3NA 4DTAA 2H34A 3DFCB 2C0TA 2FVDA 2VO6A 3QTUA 4ANMA 5J79A 5L6OA 2JFLA 4NM7A 4PPCA 4RIWB 3WZDA 3VUDA 2VO0A 3E88A 4DFYA 4FV3A 2R7BA 5CEIA 4DEDA 2B54A 1BYGA 4WNPA 4ZTLA 4E6AA 3GC7A 4JBOA 4QMTA 3H0YA 2R3QA 4C2WA 4YURA 1Y91A 2WTKC 4PRJA 4FTKA 4X2FA 3LFQA 4AZTA 4BCPA 3DT1A 1YHWA 4DEHA 1B38A 4BCHA 1H25A 3TNIA 2PYWA 3Q4ZA 2GDOA 3ALOA 3QTSA 4AS0A 3SW4A 2B55A 4OLIA 2JC6A 2VN9A 5C4LA 4U7ZA 2RKUA 4FIGA 2PMOX 2WTIA 2XNGA 3QTIA 3R73A 5IQHA 4JIKA 3ZO1A 5LXMA 2W96B 2GFCA 2YM8A 5CS6A 5ICPA 1TQPA 2O3PA 2XRUA 5FXSA 4X2GA 4O7WA 5DR2A 2CKPA 4EUTA 4L52A 2XIKA 1E9HA 4M12A 4U3ZA 2PSQA 3R8PA 1P4FA 2GCDA 5KHXA 4QP3A 3UZTA 1A48A 3UE4A 4LGGA 3KKVA 4CXAA 4ENXA 5M4FA 3KB7A 1OIQA 5AR3A 3TNHA 2YWVA 4JQ7A 2PE2A 3LQ8A 3BKBA 5I0BA 3I6UA 4JRVA 4QYHA 4WRGA 2JAVA 4C4FA 3W55A 4F1MA 3FI2A 3MSSA 5AV3A 4PMTA 5C27A 5E7RA 3I5ZA 3ATTA 4PDPA 3UNJA 4XMOA 2P2IA 2VWUA 5ACKA 4BYJA 1PW2A 2QOQA 5J7HA 5C4KA 1XR1A 3V5WA 3UNKA 5F9EA 3BELA 4FKRA 4TWOA 2JIUA 4IFCA 3HGKA 4HCTA 3MB6A 4C2VA 3ZSGA 5L6PA 2HIWA 4FEWA 2REIA 4H36A 3Q96A 3F5UA 4UALA 3FC2A 2CLXA 3OP5A 4IFGA 3TG1A 4HW7A 2CNUA 2ITWA 3R2YA 5HNGA 1IG1A 4CEGA 4O7NA 4RJ6A 4OTRA 4NJDA 3QD3A 4PPBA 5HIDA 4D2PA 2H8HA 2QKWB 5HVYA 3SOCA 1OIUA 3A8XA 5BYZA 4LMNA 4G6NA 5FP6A 4JDKA 4EQCA 5CQWA 2F57A 3OBGA 3QD4A 4QPAA 1JPAA 4NEUA 3AMAA 5AADA 3F3ZA 3BU6A 5EM8A 4S2ZA 1IAJA 5CT7A 4A9YA 4NM0A 4I6FA 4XG4A 4DBNA 1XH8A 2V62A 3KRRA 4RA4A 1Y6AA 1PXIA 3TTJA 4YGAA 4TWCA 2W9FB 2JKKA 4J52A 4F6WA 3SG8A 5M09A 3O7LD 3P23A 3BHHA 4D0XA 4EH2A 2WD1A 4TTHB 4CQGA 3E8NA 4IQ6A 3LJ0A 3TJCA 3GC0A 2GNGA 4B8MA 1Q3DA 4GW8A 2DS1A 4R7IA 4GKHA 3RNYA 3M2WA 2B9FA 5CF8A 2CNVA 3B2TA 4QP7A 2RFEA 2JAMA 3T9TA 3D0EA 4AFJA 3DAJA 4FTQA 5KZIA 2GHMA 5B7VA 2BRMA 2UZLA 2YIWA 4M68A 3DS6A 1REJA 3PVBA 2VTTA 4QMUA 3SV0A 4F9AA 2NP8A 1K9AA 1L8TA 3PSBA 2DQ7X 3Q53A 5M57A 1ZYJA 4M69B 4M66A 2G2IA 2X6DA 2Y4PA 3A7GA 1V0OA 4K33A 4OTIA 4P7EA 4NSTA 5BYLA 2YM3A 3QCXA 2XEZA 5IG1A 2XMYA 5E91A 4ZS4A 2GNHA 4GIHA 2HOGA 3AMBA 5CNNA 3VN9A 4OTHA 3TEIA 5D7AA 4O7VA 4EC8A 1QPJA 3COKA 3PJ8A 3G0EA 3NUAA 4KD1A 5TT7A 2P0CA 4F1TA 4F70A 3L9LA 3RZBA 4ZSAA 4S33A 4F09A 1H27A 5KCVA 2YM7A 4FNWA 2R0UA 3BEGA 4GEOA 3PXYA 4IDVA 5DBXA 2WQBA 4FNZA 4O0TA 3ODZX 2VV9A 4C4IA 4MNEB 1E1XA 3VS4A 4B9DA 2X1NA 3GU4A 3DA6A 4E5WA 1T46A 2XIZA 2IVTA 2OXDA 5J9LA 4M14A 3FMNA 2O0UA 4YJRA 2J0IA 5CU6A 5E92A 4O2ZA 2UW8A 4FKLA 2QR7A 4ZSLA 3FSKA 4IX4A 3HV5A 3DB8A 2RG5A 3NPCA 3OT8A 4BZDA 4JDJA 4ANLA 3QUDA 4PMMA 3BBTB 4K77A 5TR6A 4NK9A 3ZLWA 1QPDA 2FSOX 2OWBA 4DA5A 2X6EA 3F5PA 5FG8A 1WBPA 2WKMA 4H58A 1HCKA 3FE3A 3GENA 5DI1A 2ETKA 3MH1A 4PP7A 4RWJA 4YZCA 5AUVA 5EDRA 4GKIA 5AWMA 5AR4A 3N51A 3RALA 3ID6C 2JBPA 2WMBA 3D2KA 3PY1A 3E62A 4FMQA 3W2PA 4Z7HA 4OGRA 3TKHA 2QONA 3PRFA 2BAJA 4GCJA 5IQCA 1PMEA 4YC8A 2NNWB 1Q24A 5IA2A 5I9YA 2BIYA 4DN5A 4D2TA 4J53A 4CZUA 4BVUA 3ZSHA 2Y8OA 4EOSA 5IMEA 2OGVA 5JEBA 4U81A 2Y6OA 5GJFA 4AG8A 4K9YA 4PL3A 3WZKA 2Y7JA 4RIWA 4BIDA 3BLRA 2YIXA 4BCGA 3OEZA 3R01A 1WFCA 2OI4X 2NO3A 4O1PA 4YJQA 4I4FA 1ZOGA 4D55A 1LP4A 3NNUA 4NM3A 2VTMA 3UO4A 4U43A 5AMNA 3AT2A 3CQWA 4FGBA 4LL0A 4WD5A 1XJDA 2GPHA 3D4QA 5L6WL 5ACBC 4I94A 1IASA 2W7XA 3MFTA 1JKKA 3AC2A 3BZ3A 4R1YA 4QTBA 1MRVA 4QMYA 4AOTA 4HCVA 3E8DA 2W1FA 3BE9A 4YU2A 1S9IA 3ORXA 3DQXA 4MAOA 5M51A 2OBJA 4IW0A 2J0LA 4HNIA 4L9IA 4XEYA 4Y83A 4R3RA 3ORPA 4IADA 2QC6A 2VTHA 2W17A 3NNWA 3VUHA 3W32A 4D4RA 2Y4IB 5ETAA 3I4BA 3R9HA 4MXZA 4YO4A 3DJ7A 1QPCA 3PJ2A 1W7HA 4K1BA 3W16A 4D2WA 1L3RE 4EK8A 3AD6A 4QP2A 1CM8A 4FG9A 3FSFA 3KQ7A 2IG7A 1XBAA 4GL9A 4JDIA 4IB5A 5A4LA 5L8KA 4BDAA 4ZJVA 4M84A 4UYNA 2I0EA 4F6SA 4BZNA 4RZWA 2XVDA 2QURA 2WQNA 3R00A 5EKNA 3F6XA 1PXPA 5HE3A 1KE8A 4DHFA 4F0GA 1FINA 1RQQA 5LQFA 4I22A 2VTNA 4RVLA 2PZRA 3QWKA 4ZAUA 4ITIA 3UBDA 2F7XE 5IUGA 4F9WA 3SC1A 1OUYA 2QLUA 4AA4A 4BWXA 5CAQA 4XP3A 5JMSA 4YSMA 5BVEA 1A9UA 2R3HA 4DEBA 4TN6A 3OUKA 3W8QA 3MTLA 4D4VA 5IU2A 3Q9ZA 4UMTA 3OFMA 3TL8A 4DE4A 3MDYA 4D9TA 3MPAA 4PV0A 5H8BA 2DUVA 2I7QA 1M7NA 4YLLA 4KKHA 3KN6A 5GJDA 4A7CA 1J1CA 4L00A 3FKLA 4F1OA 2PUUA 5HTCA 5CSWA 5I9UA 4J8NA 3Q6UA 3GCPA 5AP4A 3L9PA 2QU5A 2F7ZE 2RG6A 5J8IA 3C0IA 2JD5A 1YOLA 3R0TA 1GZOA 4RQKA 4CLJA 4U44A 3CLYA 3MY1A 3P4KA 4V04A 3EL7A 3V3VA 5M44A 4RWKA 2VTJA 3PRIA 3GU5A 5HE2A 4FEXA 1DAYA 5DEWA 3F3VA 5K0XA 4O27B 4C36A 1F3MC 4KUJA 3A7FA 5HZNA 4O7YA 3VUGA 2YIQA 5CSVA 4CFXA 1GAGA 4ZZNA 1LUFA 2R3JA 4YJTA 5IA5A 3VWAA 3HP2A 5IKWA 4RIOA 3EJ1A 4ZMEA 3EN6A 4NIFB 2ITYA 3UP7A 4L3JA 3CD3A 4F7JA 2UZEA 3LFNA 3SDJA 2IVUA 4JJRA 4DLJA 1PHKA 2JIIA 4W4WA 1XKKA 1DI8A 3LIJA 3GOPA 1DI9A 3VNTA 4ALVA 4I92A 4M13A 3DKCA 1B39A 4C62A 4L01A 5FP5A 2E9PA 2OF4A 5FUTA 2YHVA 4FV8A 5AUZA 3TV4A 2I1MA 3DY7A 2HZ4A 3IK3A 3CR0A 4KKGA 3S95A 2YAAA 3F2AA 5JZNA 3C0HA 1APME 2VX1A 3O2MA 4A9TA 4H39A 2A0CX 3A7HA 2PMIA 3EFJA 3GP0A 4GT4A 4BDEA 1H01A 3I0QA 3HYHA 1UNLA 3Q4UA 4QMWA 3L9NA 3ZEWA 5HNBA 2VX0A 3SAYA 4BN1A 4E6QA 3QQJA 3REPA 5IZFA 4DFZE 1ZMVA 5E8YA 3A99A 4FIFA 4FICA 3ANRA 2ZMDA 2R3FA 3Q9XA 1FVTA 4GFOA 4YHFA 2XKFA 4C59A 4BI0A 3Q2JA 3P78A 3G51A 3HV7A 2W0JA 3FMJA 5FEDA 2UZDA 3QBNA 2OJIA 3RK5A 4A4XA 4YJOA 1LPUA 2ZV8A 5CU2A 3CCNA 4QYFA 4L67A 3ZUUA 4IM0A 5A4TA 5L2IA 4MD7E 3PUPA 2C5VA 5FTGA 4FL3A 4AZSA 3DKFA 2WMUA 4U79A 4O0UA 4ZEGA 4FKVA 2UVYA 3D7TA 2YFXA 3FYJX 4AOIA 4I4EA 3R1YA 4FV0A 5G1XA 4F7LA 4AGUA 4YZNA 4ACGA 4N0SA 2YABA 3JVSA 4AP7A 1Y8GA 1OL1A 2V7OA 4ZZOA 5C1QB 5CAVA 2ZV9A 2XIYA 1EH4A 1VYZA 4HVHA 3LLAA 2AC3A 3DKOA 2PTKA 3QTZA 1M7QA 5KMKA 3NYNA 4IAKA 2ZB1A 3OF0A 4ERKA 5AP2A 1UA2A 3NWWA 4EWHA 3DZOA 4QO9A 2ITOA 3PA4A 4I23A 4GG5A 4AA0A 2W4JA 4OBPA 2WNTA 2VNYA 4JX7A 3GCSA 1XHAA 3QZHA 1PY5A 2BZHB 3ZONA 2QO7A 3WF9A 4DH7A 5TKDA 1FVVA 4FT5A 3UVRA 2PULA 1OIYA 3R30A 4RIYB 3BIZA 4PUZA 4B0GA 1SZMA 2BZIB 1IR3A 3EN5A 3MH0A 1FQ1B 3BYMA 5DRDA 3TNWA 4C3PA 4D4SA 1YXVA 2JBOA 4WNOA 5KZ0A 3ANQA 4BHNA 4IAFA 3BYUA 3RWQA 5JFXA 3M11A 5T6KA 3D5XA 2XJ0A 3MV5A 5EOLA 2O8YA 5AUTA 2RSVA 4IWPA 4YTCA 3HA8A 5KMJA 4QP4A 3S4QA 2PK9A 1P2AA 4G3DA 5HGIA 4MXOA 1BI7A 4IBMA 4NFMA 3ZSIA 1FBNA 3PJ1A 3ZLXA 3L8SA 3FQEA 3IDCA 4RIXB 4M67A 1YWNA 4YPDA 4ANBA 4ANSA 5M55A 4DFBA 4KWPA 3LMGA 4IB3A 3R7EA 5HORA 3QX4A 4G9CA 1M52A 3EH9A 1ZOHA 2J2IB 3QZFA 4HOKA 2ZV7A 2JITA 5CYIA 2WU7A 2QOKA 4C4JA 2GHGA 4PMPA 3JUHA 4EH3A 3HNGA 1ZARA 2XJ2A 5DN3A 3AD5A 3P7BA 2IZSA 3TDVA 3UTOA 2X39A 4FK6A 2JDSA 4ACDA 3QRKA 4AX8A 5B2LA 1FOTA 4HZRA 5K3YA 4L3LA 1RDQE 4PY1A 2FO0A 2OF2A 2YZAA 1BI8A 1WBSA 3HDMA 3NUXA 3ZO3A 1Q5KA 3QX2A 3PIZA 3FLYA 1GIIA 2ZM3A 4EBVA 3BYOA 5HO8A 4CG9A 1OKZA 4YTIA 3UPXA 1GNGA 2XK8A 3LXPA 4FV9A 5DT4A 5LWMA 2OZOA 4FF8A 4O96A 5M4UA 3RTPA 1PF8A 3UC3A 2J5FA 5AIKA 3HKOA 1G8AA 3Q9WA 5IQIA 5BVDA 4BBFA 3DPKA 3QZGA 1H1PA 5DOSA 5HESA 3V5TA 2ZVAA 3IW5A 5HG8A 4FTTA 1JKLA 3I1AA 4ZK5A 3FHIA 3NW7A 4X6QC 3MTFA 3SX9A 3NLBA 2R3IA 4PDSA 2F49A 5EHLA 1OVEA 3VS1A 3LJ1A 4QQ5A 3W33A 2UZTA 4PF4A 3UO5A 5I9XA 5HBJA 3OZ6A 3T9IA 3WOWA 5GIPE 2X4FA 4IVCA 5IA4A 1YXXA 3ATSA 5TF9A 5T3QA 1PXMA 4X3FB 4PTEA 2EUFB 2GNFA 2BDWA 2QG7A 3GCQA 1BL7A 4L43A 4OR5A 4IAYA 4FKTA 2XK6A 5CVFA 3NMUF 2Z60A 5FEQA 4FODA 4RT7A 5CI7A 3S2PA 3FL5A 2VTLA 3P08A 4MVFA 4KRDA 3ZBXA 2O5KA 4IJPA 3UNZA 2WMRA 4OTGA 3RPYA 5AR5A 2C5YA 2W1DA 5HBHA 1UU8A 4EH6A 5B0XA 3GU8A 4PL5A 3I79A 4AZFA 4IH8A 5A4QA 2CCHA 2JKMA 3NUYA 2BZJA 2GNJA 3QCSA 5HVJA 3C5UA 4QMOA 2QKRA 2ITPA 3P9JA 5AP5A 2OG8A 1H26A 3RJCA 4MWHA 2JDTA 1JOWB 4WO5A 1OKYA 4FG7A 4RVKA 3TDWA 1HOWA 1WVYA 2WEVA 3I5NA 1M14A 2FB8A 5GINE 4DH5A 2VGPA 4JQ8A 5FXQA 5JGDA 4AW0A 2HZ0A 3PPJA 3G90X 5LWNA 4P2KA 5TO8A 4M7IA 3KCFA 4ZTMA 2XNEA 5KNJA 5ITAA 1XWSA 1H1QA 3PP0A 3T8OA 2VZ6A 4K11A 4JBQA 4CGAA 1HCLA 2I6LA 2C6MA 2XM9A 4O82A 2P2HA 2IWIA 3FMDA 5CLPA 5AAFA 3EQPA 3RHXA 2HXLA 3TCPA 4BGGA 1P5EA 4C7TA 2GSFA 2CKEA 3U6JA 3NAXA 4CFFA 3FBVA 1VEBA 2CN5A 5IQAA 5K5NA 5HNIX 4NKSA 1YOMA 3ACKA 5IH6A 4USEA 5HLNA 2EVAA 3HRFA 2R3GA 4FKWA 2EB2A 3G0FA 4GMYA 4IXPA 2YIYA 2AYPA 4TYHA 3ZC6A 3FHRA 2OLCA 5CU4A 1PKDA 5C8MA 4N4SA 2B52A 2J50A 3C4XA 5ANKA 3QHRA 4MD9E 1WZYA 1PJKA 4QNYA 4KBCA 4XG3A 4UMRA 4C57A 4GYIA 3VBTA 5E8SA 3AD4A 4FEVA 1CKPA 3F66A 4HGEA 4NKAA 4TNDA 5AV0A 2VWXA 5H8GA 3VW8A 4AF3A 4BDDA 4MXCA 2BTRA 2HYYA 1PXNA 5D1JA 4O83A 3GXLA 4F9BA 2R0IA 4AZWA 3VHEA 4CD0A 2PPQA 4OTWA 4MH7A 2XZSA 1ZMWA 4DGMA 2HZNA 2YCRA 3R2BA 3PXRA 1OL2A 4EOKA 4ENYA 3LFCA 4F7SA 4DCAA 4RX9A 3BGZA 3ZZWA 3HRCA 5EFQA 2UZUE 4A07A 4F64A 3KN5A 4OT5A 1XO2B 4R7HA 4LOOA 3FXWA 5AEPA 5KKRB 4MBLA 3F9NA 2Y9QA 4IZAA 4M15A 4Y85A 2X7OA 3QKLA 4JDHA 4Q2AA 4Y46A 5I5ZA 3DKGA 2BKZA 3TZ9A 1W8CA 4HGSA 3V5LA 5IDPA 4RIYA 2A2AA 3TXOA 4NZWB 4E4LA 3QHWA 1WVWA 4Z9LA 1J3HA 4PQNA 5FXRA 5E8VA 1Q8UA 3A61A 3PZHA 4AT3A 2C68A 4WHZA 3IOKA 3QQFA 3KRXA 4FSQA 3HV3A 4YZMA 3RPRA 1JVPP 3SRVB 3DBQA 2I0HA 1OKWA 3F5XA 3PSCA 4M97A 4EK4A 4FUYA 3H0ZA 3UYSA 5CAOA 5LVLA 3DGKA 1ZLTA 2JFMA 4QPSA 3R28A 4BCIA 2Y0AA 3VS6A 3BPRA 1Q4LA 5E4HA 3WIKA 3TM0A 1UU9A 4IAZA 1VZOA 4FG8A 4RIXA 3GFWA 3WYXA 3UQCA 4IMYA 2X2MA 3FLSA 1IAHA 4CMTA 2R3RA 5EW3A 3CY2A 3VW6A 5HQ0A 3LQ5A 3OWPA 4ZY6A 2C6DA 1Q61A 2GTNA 5DPVA 5BMMA 4UX9A 4FT0A 1I44A 4HCUA 4PX6A 5EQPA 3I81A 3BWFA 3FJQE 1S9JA 3IW4A 2J0MB 3CSVA 5BUJA 4QMXA 3AC4A 2VGOA 2WQMA 3CXWA 2XA4A 1ZYSA 2EXEA 4BCQA 5G6VA 3SKCA 3KVWA 3D5VA 1YRPA 4GSBA 4YC6A 2YDJA 3K5VA 4KB8A 5BYYA 3O71A 4RWIA 4IVDA 2P55A 4NM5A 4NT4A 4YTFA 2CGUA 5I9ZA 2QOHA 5BUEA 1RJBA 1JSTA 3NDMA 3UP2A 4QP1A 4GIIA 4CCBA 3Q3BA 3R1NA 3VJOA 2C5OA 4E20A 2V22A 3N4TA 1V0PA 3IONA 4BWKA 4L8MA 3EN4A 5BVNA 4AU8A 4EOQA 3POZA 3EKNA 3R8ZA 3G9NA 3PSDA 3OROA 4O86A 1JSUA 1WBNA 3H9FA 4YJNA 3UGCA 1H0VA 2QVSE 3FZ1A 2BDFA 2XYNA 4FUXA 3HAMA 5DIAA 2X7FA 3F5GA 3FLWA 3OTUA 4FKSA 3BRBA 4MNFA 2BVAA 4YTHA 3AC8A 4EI4A 1IA8A 3FMLA 3VHKA 4BDGA 2HWPA 3WZUA 4LQMA 3PA3A 3LFDA 3PVUA 3KMWA 5CY3A 1SM2A 4L68A 4UXQA 2YCFA 3FLZA 3GC8A 3LOKA 4GJ3A 4JL9A 2RFNA 2O2UA 3D83A 3QQHA 4FSMA 3G5DA 4FV2A 4NJ3A 5E8XA 3PXQA 3TT0A 3PXKA 4FTJA 4R3CA 3JXWA 4FTCA 4QMLA 4X3FA 3WILA 4C33A 4ASDA 3ZUTA 4LOPA 4JR3A 2IZTA 5BQ0A 4GK4A 1IEPA 5KMLA 3ZRLA 2QD9A 3C0GA 3FLQA 3V5JA 1Q8YA 3Q5IA 4FNXA 4IEBA 3BI6A 4IX5A 3KXHA 1R78A 3EMGA 3ORMA 3R7YA 3FMMA 3UC4A 5M4IA 4O7ZA 2FSTX 4E5BA 3VQUA 2VO3A 3W2QA 1YW2A 3O0GA 2XYUA 3G15A 1AGWA 2JGZA 2VWYA 2WMTA 4FKQA 4EK6A 4IM2A 4DFLA 3A2CA 3PVWA 4FZDB 2R3MA 4FEUA 2LGCA 4FC0A 4TRLA 4RJ4A 5I9VA 2QOFA 4U41A 4WSYA 5H9BA 1YVJA 4E6CA 4EHZA 3BU3A 2VWIA 4NWMA 4NFNA 4G6OA 3ZO4A 4EOPA 4UN0C 4O7SA 5L8LA 5EQYA 4BDJA 3ZO2A 1WBVA 3CIKA 4JAJA 3ORTA 2C5NA 4G5PA 2F9GA 3OY1A 2C47A 4F99A 2P3GX 1U5QA 5FM2A 4U80A 4D28A 4BCKA 2VTSA 2OSCA 2HY81 1YDRE 5JT2A 1OKVA 2GMXA 3HRBA 5DE2A 5CAPA 4AGDA 3I60A 4GVAA 2BROA 4ORKA 3M1SA 3ZFMA 5LCKA 2R5TA 4ASEA 2G2FA 4G3EA 2C0IA 2VTOA 4U42A 4WNKA 3OTVA 3ODYX 1W84A 5F95A 2CGVA 2E9VA 4UV0A 4KNBA 5IF1A 3R7UA 3LZBA 4X2NA 5HU9A 3E7OA 4EHGA 4EHVA 4XH6A 3TKIA 3CJGA 4QT1A 2XNMA 4YR8A 3D9VA 5KMMA 4RC3A 4XS2A 4XNEA 4YJPA 2X0GA 2WFYA 3E92A 2NPQA 4A4OA 4XCUA 5E8UA 4NCTA 5HICA 4BR3A 2W06A 1YXUA 3P7AA 3LXNA 2BCJA 5AP1A 1JLUE 2GHLA 5GHVA 3LCDA 3ORKA 3QCYA 5GZ8A 5JKGA 3MA6A 3NYXA 4YLKA 4EH9A 1GOLA 4YNOA 5I4NA 1TQIA 4MHAA 3MJ1A 3LCTA 2XP2A 1U54B 2F4JA 4EOIA 4FYOA 3NS9A 2PE0A 4ACHA 2C3JA 2WTVA 3PA5A 4RJ8A 2OIQA 3HZTA 3RI1A 4M0YA 3NUUA 4RFYA 5EKOA 4AZEA 4C37A 4KSQA 3GVUA 4JG6A 5CSHA 3PXFA 4AN9A 5DYJA 4KAOA 3U4UA 3BE2A 3CQEA 3F88A 2CNQA 1J7UA 4DG3E 4EQMA 1ZYLA 4CNHA 5JQ8A 1OPJA 2XIRA 4XV2A 3N9XA 5C03A 1R3CA 4I5MA 5CANA 5KHWA 3FQSA 5DG5A 3EN9A 3DDPA 3D5UA 3FPMA 4Q5EA 5AX3A 3T3VA 3V6SA 4DH8A 1QCFA 1SVHA 1OZ1A 3GFEA 3G6HA 3OXZA 4I0RA 5HLPA 3ZOSA 5DH3A 3SRVA 4CKJA 2PVJA 3CE3A 2UW5A 5ANJA 4FIHA 4LRKA 4G1WA 3MPTA 3SG9A 4ACCA 2PVLA 2OK1A 3LVPA 4EEVA 3NVMB 3OY3A 3ZLYA 5KBRA 3JR1A 1F5QA 3UO6A 3QTWA 4DGOA 1SVGA 3OW3A 4L46A 3U51A 3VS0A 3GGFA 3QTQA 4AFEA 1LEWA 1PYEA 4C61A 2YITA 1SMHA 2XRWA 2Q0NA 4G17A 5EYCA 3LCKA 4FT3A 4CLIA 3VUMA 2W05A 4DG0E 4IM3A 3C9WA 4BDFA 5ETFA 3GC9A 4BI2A 4IAIA 3PYYA 4Z7GA 2OH0E 4BB4A 1JWHA 3NW5A 4C3FA 3F2RA 4HYUA 1SNUA 3CJFA 3VBQA 4BGQA 4TZRA 3VAPA 4NW5A 3BBWA 4G6LA 4RA5A 3NUPA 3QU0A 2JKQA 4O0SA 4PTGA 3VUTA 2ACXA 3KK8A 4FT9A 4I5HA 4LGDA 1URCA 5JH6A 1WCCA 5DMZA 5AV2A 1KE6A 5IPJA 2UUEA
chains in the Genus database with same CATH superfamily
2J9MA 4RG0A 3C4FA 2E2BA 4I5PA 5AP6A 1KE9A 3AGLA 3Q2MA 3C4ZA 4QYEA 4ZTNA 2B53A 3PZEA 1NA7A 4QYGA 2HCKA 2WQOA 2XNPA 3FMEA 4EK3A 4A4LA 4QTEA 3QUEA 5HEZA 3TIZA 1OPLA 3C51A 5IH5A 5JFSA 4TYIA 2GNIA 5CASA 3KL8A 2WU6A 4S30A 4TYEA 3QD2B 1J7LA 3QQKA 3BLAA 4YZ9A 2ERKA 4HGLA 5E90A 2ZOQA 2CN8A 3A7IA 3FMHA 3QRTA 4WG3A 1H00A 4PWNA 5E8ZA 4OT6A 3EQHA 3AKLA 1G3NA 3OEFX 4N57A 5CEKA 4GYGA 5BV3A 3UOHA 3D14A 4FKOA 3ZH8A 1NW1A 1XH7A 4EOMA 1Q97A 1UU3A 1DAWA 1W2DA 4FSUA 4IAAA 4JAIA 4W4XA 2PVMA 3ZXTA 4YNEA 1Q8ZA 5DWRA 3P79A 1YHSA 5IA3A 3UOJA 4DEGA 5IA1A 1H8FA 4R7BA 1TVOA 4YZBA 3EIDA 1O6KA 3FUPA 2AQXA 3UVPA 3ACJA 1W82A 4USDA 3DTWA 3BLHA 3CGFA 5ANIA 3AC5A 2G01A 4JG8A 2PVYA 3FPQA 3C5IA 3S3IA 1GZKA 2B9HA 4XV1A 3ZC5A 1STCE 4C4GA 5C26A 4DC2A 4F78A 4WOVA 5E1SA 4H3QA 3ZCLA 5A9UA 3TKUA 4ERWA 4J95A 5IQBA 4KS8A 3BV3A 2O65A 1CKIA 2ZJWA 3ZS5A 2UW3A 3FDNA 4WNMA 3Q60A 4ONAA 3QRUA 2I0YA 3PY0A 3TV6A 3AT4A 5CEOA 5J5SA 2C6IA 3I7CA 4D5HA 2G15A 3VBWA 3OCGA 3W2OA 1ZOEA 2ITXA 2SRCA 5DHJA 5F94A 5LMAA 4F0IA 3IPHA 4KS7A 3O7LB 4O1OA 3KULB 5HO7A 1ND4A 4XP0A 4FT7A 5M06A 5D41A 3RPVA 2GS7A 4BICA 3U4WA 4FZ7A 1CTPE 3C1XA 4O4EA 1FVRA 3R71A 4W4VA 3TTIA 5KE0A 4DEEA 3RAWA 5BVFA 2P4IA 3NVKI 5GIOE 5HBEA 2UZBA 4JQEA 4YLJA 1JBPE 3UZPA 3WF5A 2UW4A 5L2SA 2J5EA 3DXQA 4FTUA 4HYHA 4AN2A 4LI5A 3NIZA 2PU8A 2RFSA 1F0QA 4K6ZA 5AM7A 4RGJA 3UMXA 5HIEA 5HHWA 5IEYA 3DK7A 3UQGA 4BDHA 3QFVA 4J97A 4G3CA 5CNOA 4USFA 4M69A 2YACA 1BMKA 5HCYA 4N6YA 1G8JA 2GS6A 2KULA 4QTCA 2BTSA 4E26A 2OFVA 2VX3A 4O7RA 4LV8A 3BQCA 4M3QA 1YXSA 2VO7A 3CD8A 3P7CA 5EW8A 4FKGA 4CT2A 4X7QA 2R3OA 1NVRA 2QCSA 4RVMA 4CRLA 2PVRA 4ZJJA 1MRYA 1MUOA 4FV4A 4FTNA 3RMFA 4BCJA 5CF5A 5IQGA 1K2PA 4KKEA 4CSVA 3BL7A 1ZY4A 3GBZA 2XCKA 4TNBA 1YI6A 3R9RA 3F2NA 4S32A 1U54A 4LL5A 4NUSA 2UVZA 1U59A 4O4BB 2X7GA 2A27A 1UKHA 4FTLA 4KRCA 4MXXA 3SLSA 4BTJA 1TFFA 4O7TA 4MNEA 4CG8A 3MW1A 5L2QA 3FMKA 3PIYA 1BX6A 3V8SA 3Q9YA 5L2TA 5EHOA 3CTQA 4OTDA 3IQ7A 4KIOA 3TUDA 3VF9A 2C4GA 1KOBA 2OJGA 2IZUA 3ZM4A 1KE7A 3VUKA 1LEZA 2QU6A 2ERZE 2PZ5A 4CCUA 4WUNA 3CTJA 3LCOA 2QHNA 3IGOA 4KA3A 4NCTC 4WG4A 1XBBA 4XHKB 4UB7A 2QOBA 1ERKA 3UDSA 4ANNA 4FX3A 3DJ5A 5AP0A 5EYMA 5AAEA 3ZU7A 4FVRA 4ZS0A 4MQ1A 4EH8A 4HVGA 2YM4A 3ORZA 4FZ6A 3PLSA 5FDPA 5HO6A 2IW9A 4CFWA 3EFKA 3WARA 2W1ZA 5LARA 3QQLA 3CEKA 4ZIMA 3HV6A 2BRHA 4GFGA 5A46A 1JSVA 2IVVA 2CMWA 3OG7A 4L3PA 5GZ9A 4C8BA 3E5AA 2J51A 5ETCA 3FZTA 1ZYCA 2HAKA 2EXCX 4ALWA 5CU0A 3SXSA 4G16A 2ZB0A 4G5JA 3EFWA 4BGHA 1NVQA 4BFMA 4ZLOA 5LVOA 2HZIA 3NX8A 4FKJA 4XG7A 1KV1A 2WTWA 4DCEA 4EKLA 5AV4A 3FI3A 4FIIA 4I20A 2ZV2A 4FE2A 4RFZA 3KREA 4CVAA 1Q8TA 3QWJA 3R7IA 2A19B 4LMUA 4RLKA 2OJFE 4XV3A 4YHTA 4FOCA 1XH6A 3JY0A 3LQ3A 2QO9A 3EYGA 3QLGA 4DAWA 5K9IA 3ZZEA 4V0GB 2GQRA 2OKRA 4O21A 3ZMMA 1GIJA 3VULA 2PUNA 1SNXA 2CSNA 4ZMFA 4RRVA 4G34A 4H1MA 4BKJA 1KUTA 2BRNA 4C3RA 4YMJA 2WOTA 1VR2A 5CI6A 5HG5A 4QMQA 4AGWA 1PMVA 3WIGA 4I3ZA 5FTQA 4HPUE 4U0IA 4FR4A 5HD7A 3UQFA 3RWPA 5DR9A 4EYJA 1ZZ2A 4WRSA 4LOQA 2C1BA 2IW6A 2JDRA 2BRGA 2ZAZA 3ENMA 3VVHA 2G9XA 3K3IA 2X2KA 3R6XA 4FTAA 4TKSA 3A62A 4GVJA 3U87A 2B9JA 3A60A 4J7BA 3LCSA 4PPAA 4YC3A 4MX9A 4QD6A 5J9YA 2YIRA 3QA8A 2J4ZA 3CKXA 4D4YA 3W0PA 1WAKA 4H3BA 1PYXA 5ANGA 3IO7A 2CDZA 2BZKB 3UPZA 3FKNA 5K0KA 2QNJA 2OJ9A 4L53A 5AR8A 3OUNB 1CKJA 4FV5A 5L4QA 3B8QA 4AXAA 1WBOA 2W1GA 4A9UA 4ZTRA 2Z02A 3F3WA 2FH9A 5DEYA 1O9UA 3PLAE 4J8MA 4XG2A 1ZZLA 2XK3A 3D94A 2B7AA 4P90A 2XNNA 4WG5A 3BYVA 4B7TA 2X0PA 3G2FA 2V55A 1UNGA 3PE1A 1Y8YA 4N6ZA 4BDBA 4FBXA 4ZSJA 3K2LA 4AACA 5FDXA 2UVXA 1XH9A 5CQUA 3RK9A 3KF4A 2PZYA 4JT3A 3E64A 3ZRKA 3ZUVA 4AWIA 4IC8A 4PNKA 3EFLA 2OW3A 3K54A 1OL5A 4BL1A 4O2PA 5EDQA 2HXQA 2WGJA 3MBLA 4AW5A 3EQRA 1XH5A 2XNOA 1V0BA 4FSNA 1J91A 4A9SA 2VD5A 1JAMA 3O23A 2P33A 3OHTA 4FKPA 4TYJA 4CKIA 5M4CA 2X9EA 3FQHA 3WF6A 3D7ZA 4AT5A 2VNWA 3RAIA 1U4DA 2PMLX 5TE0A 3KXMA 2PUPA 5AV1A 3KULA 3KMUA 3QKKA 4GU9A 4CRSA 3GQIA 4QMPA 3RVGA 2PHKA 2XKCA 4O4FA 4U8ZA 2W4KA 5FTOA 2O63A 4XJ0A 1G8KA 3A7JA 4LRMA 2YLFA 4ZTHA 4EK5A 3ELJA 4YJUA 3GOKA 3R8MA 5JGBA 2X8IA 4PNIA 4ZSEA 3PUFC 5EQEA 4IANA 4E4NA 3CC6A 3OWJA 5CWZA 5GNKA 5LCJA 2QODA 2XK7A 2GFSA 4NIFA 3GU7A 4BDCA 4EONA 4ZTSA 3WE8A 2X4ZA 1X8BA 2BRBA 2C6LA 2GU8A 3EQBA 4OW8A 5EYDA 2AUHA 4PMSA 3TMOA 3E93A 2CLQA 3KFAA 3LFEA 4CQEA 4O22A 4RJ3A 4RZVA 3H9RA 2CJMA 2JDOA 3O8TA 4DLIA 4EQUA 1BKXA 2YWPA 3DLSA 4X3JA 4BTMA 4KABA 5L2WA 5KX8A 4LDTA 2F7EE 4ASZA 3O51A 4J96A 2EU9A 2VWBA 3II5A 3P5KA 3AKKA 4Z55A 5FD2A 1H24A 4DGLC 4EYMA 5JSMA 4O4CA 4QQTA 3F82A 4DDGA 5EI6A 3ZLSA 5D10A 3DK3A 4MXYA 3OOMA 4DFNA 2WQEA 3R9DA 1JQHA 2BAQA 4WA9A 1SVEA 2BHHA 4EWQA 2VTIA 4U6RA 2QOCA 2JIVA 4R5SA 2OXXA 2XBJA 3FI8A 2PE1A 4YHJA 4ZZMA 4GU6A 2Z8CA 3AC3A 2RFDA 3HUBA 3DXPA 3RZFA 3HV4A 3QKMA 2HWOA 3F3UA 3O8PA 4LUEA 2IJMA 5TOZA 3CS9A 4O84A 2WB8A 5J9ZA 3DBEA 5E9EA 5L3AA 5FGKA 3E8CA 3EYHA 2Q0BA 3FZOA 3OT3A 3QGWA 4AW1A 3QA0A 2DYLA 5EM5A 4BIBA 4U97A 4RVTA 3MESA 4YP8A 2X8EA 4MCVA 3NUNA 1Y6BA 5D9HA 4AW2A 4NTSA 3EQFA 2C0OA 2C30A 3DU8A 3O96A 1Y57A 4LV5A 4EORA 4O0VA 3C4EA 3PXZA 5AA8A 5IUHA 4FIJA 1NXKA 1BL6A 3QC4A 3ROYA 4V01A 5IEVA 3MIYA 3BHVA 4O6LA 2RL5A 4EZ5A 3KRLA 1NVSA 3H9OA 3MFUA 3GT8A 4EH5A 5GJGA 5HG9A 4BDKA 2B4SB 2QLQA 3NSZA 3QRJA 4IWOA 4MKCA 4GT5A 4J1RA 4YBJA 5C01A 4DFXE 2QG5A 4O81A 2YAKA 3R9OA 3VRYA 3H30A 5K4JA 3QALE 4S34A 3K3JA 2OFUA 3KMMA 3QD0A 3NAYA 4ZLYA 4ZY5A 4ZXTA 1IRKA 3OXIA 3PWDA 5IMXA 2WHBA 4Y72A 4UMRA 4BTFA 4RX7A 3S00A 1H1SA 3FZRA 3V04A 3E87A 5HE0A 2UW6A 3OCSA 3KK9A 4ASXA 3EB0A 1T45A 5CXZA 4BBMA 5FLFA 3CGOA 2OXYA 4BCOA 5EYKA 2PWLA 4MBJA 4EUUA 2W5BA 4BCFA 3KRJA 2JLDA 4RJ5A 4WIHA 2BFYA 4IVBA 5HLWA 4WUAA 3LFAA 5IQFA 2V5QA 5KMNA 1Z5MA 4F9CA 3L8XA 2OICA 3C4CA 5HIBA 3FAAA 5T68A 1E1VA 2JEDA 3PIXA 1JNKA 4ITJA 3QRIA 1H1RA 2R4BA 2WTJA 3HAVA 5JFVA 2H6DA 3HEGA 1ZAOA 3KF7A 3C4WA 4IZ7A 3QAME 3OS3A 2XKEA 2WIPA 4YBKA 4UMPA 3OBJA 2I0VA 3NW6A 2XIXA 5IEXA 3NZ0A 5F20A 3UIUA 3O17A 4FIEA 4O0WA 3W2RA 5AX9A 3C13A 4FZFB 1YWRA 5HTBA 3LMHA 3THBA 1RW8A 1YI4A 5IH4A 4L7FA 3U54A 3V5PA 4AA5A 4R1VA 3AG9A 4GUEA 2YJSA 4I6BA 2PZIA 5EG3A 3RCJA 5HX6A 5IDNA 4AAAA 5KUPA 3IKAA 4UMQA 3CP9A 4YJVA 5HCZA 3BGQA 3H3CA 3WE4A 5DGZA 4Y5HA 3DQWA 2BR1A 2WEIA 2Y4IC 3HMOA 2OH4A 4X2JA 3GU6A 3WF7A 3V01A 3ZDIA 4QPMA 3Q4CA 4MF1A 3EHAA 4E1ZA 1PXOA 3JVRA 2XS0A 2WOUA 2IW8A 2YA9A 3V5QA 1H1WA 5CSPA 5M56A 4FNYA 4BJJA 3WI6A 3UIMA 4TY1A 4R78A 4GK3A 5K4IA 2IVSA 3UG1A 3R22A 3TUBA 3U55A 3GCUA 4IB1A 2YDKA 3RK7A 5F4NA 4FSRA 3R21A 5A6NA 3PG3A 3PP1A 4MWIA 2EB3A 1PXJA 3TACA 2X81A 4I1ZA 4MK0A 3UYTA 4ID7A 1QMZA 4E7WA 3CTHA 1ST0A 4UZDA 3AGMA 3QC9A 3MH3A 3VIDA 2XF0A 4FV6A 2BUJA 5CSXA 1LR4A 2V7AA 3GI3A 4CZTA 1W98A 2CCIA 3V6RA 4AQCA 4RJ7A 4MF0A 1KE5A 4GJ2A 3LAUA 1M2RA 3DB6A 3NYOA 4L44A 5CEMA 3GNIB 3O8UA 4KIKB 4XG6A 2YZLA 5BMSA 4LYNA 4BRXA 4WSQA 4DGNA 2AC5A 2HY0A 3VBXA 4DFUA 4AUAA 4XG9A 3R9NA 1OB3A 2B9IA 3GQLA 3V8WA 5DFPA 3MY5A 2QQ7A 3FZPA 3GCVA 4EOLA 2ITUA 3BEAA 5CZIA 4MQ2A 5L8JA 5HX8A 5FBOA 4FVQA 3NFFB 3VS2A 5EI8A 2XNBA 4QP6A 4HNFA 5DLSA 3ZTXA 3MPMA 3QZIA 4I41A 2RF9A 3MIAA 3R1SA 5JN2A 4APCA 1JKTA 3OVVA 4IWDA 3LMIA 4OAUC 1U5RA 4O38A 4KIQA 2ETRA 3R1QA 3MVJA 4QNAA 5IISA 5B2KA 1NY3A 3RAKA 4B99A 1R39A 4R5YA 4I5CA 4E73A 1PKGA 4JX3A 5FBNC 3FXXA 3L8VA 2YN8A 5AAGA 1WMKA 4FGRA 4JRNA 4RX5A 2ZDTA 2J0JA 2BALA 2YLEA 2XARA 4OUCA 3DLZA 5HKMA 5A14A 1OITA 3HUCA 3R7OA 2XB7A 5CALA 3SA0A 5AM6A 3TNPC 4DT9A 3ROCA 3F7WA 4IE9A 3RNIA 1P14A 2JKOA 3MH2A 1UNHA 3Q04A 2UZOA 2ITTA 2H9VA 3ETAA 4EKKA 4RPVA 3TZMA 4IIRA 3EQIA 4PL4A 5EDPA 2QOIA 2VAGA 5HVKA 4EZ3A 4UEUA 4APPA 3PE2A 4E93A 1G5SA 4XV9A 2G1TA 1AQ1A 1XBCA 3LE6A 3QXPA 3W0NA 2IEWA 5A3XA 5A4CA 2R64A 2WMSA 1GIHA 2WTCA 4CKRA 3R7GA 1G8SA 5IQEA 3EZVA 4D9UA 3LKMA 3FI4A 5FEEA 5FWKK 4G3FA 4FK3A 5CTPA 3AOXA 3BHYA 2C6OA 2YDIA 2ONLA 1OM1A 2GQGA 2C3LA 3HMIA 5CF6A 1NT2A 2OZAB 4AT4A 4W4YA 5CVHA 4AZVA 2WZJA 2XEYA 4KSPA 4XOYA 2W9ZB 1PXLA 3H10A 1CSNA 3NUSA 4TWPA 4ZOGA 3QGYA 3DJ6A 4BKYA 3NNXA 2UZVA 4I6HA 4I93A 4EJNA 3Q5ZA 4RSSA 4BYIA 1FMOE 2R7IA 4O0YA 4I0TA 1I09A 4H3PA 1TKIA 4P4CA 1W0XC 4RQVA 5FQDC 2X8DA 3FV8A 4BF2A 5CT0A 3RM7A 5JFWA 2C1AA 4N70A 4D2RA 4AE6A 2QOLA 2C3IB 2W5AA 4S31A 5KMOA 3Q32A 3D7TB 3G6GA 2NRYA 3W0QA 1CDKA 3I7BA 4G2FA 2YISA 1QPEA 5H2UA 4JLCA 4RC4A 3VF8A 1PMUA 4RX8A 3O50A 4CFNA 2CKOA 5AA9A 4A06A 3BYSA 3BV2A 2O64A 3MFRA 4Q9ZA 2W1HA 2YEXA 4XOZA 4F4PA 2W99B 5J5TA 3BU5A 3PWYA 2GNLA 2WMQA 3UODA 1M2QA 3W10A 3R02A 3R83A 5M53A 3IDBA 1YWVA 4DHZA 3ULIA 5M08A 4IVAA 4KBKA 3IG7A 2PVKA 4FA2A 3BHTA 3EQCA 2ESMA 2X2LA 2C6TA 3IDPA 3LHJA 4UWCA 3UIXA 1Z9XA 3PTGA 1ZYDA 4DITA 4EOJA 3F61A 5DR6A 5LVMA 2E9NA 5HCXA 4M0ZA 1Z57A 2PVHA 4B8LA 3JPVA 4EH7A 3ENHA 4JI9A 3LLTA 4QTAA 3P86A 4OBOA 3OC1A 4FOBA 4DHJA 5JQ5A 4JG7A 4TT7A 1WBWA 1UWJA 2XAOA 3TJDA 2WTKB 4CFUA 4JOAA 3RGFA 3EL8A 1OBGA 4FTIA 1M17A 3AXWA 2WMWA 1OL6A 4WBOA 5EI2A 1FPUA 2VU3A 2VTPA 4FSWA 2C69A 1SYKA 5HG7A 3SXFA 2QHMA 3ORIA 4C4EA 5A6OA 4FSTA 5DA3A 3KXNA 5C8KA 4FV1A 4GT3A 3TN8A 3F7ZA 4ANQA 2ITZA 3W0OA 3LXLA 4H05A 2UZNA 3IS5A 4Q5HA 5I3OA 2G2HA 3WZEA 4QTDA 3FXZA 1CMKE 3SW7A 2XJ1A 4U5JA 4E8AA 4AXCA 4D1XA 4ZLZA 3NYVA 2ZM4A 3LFSA 4ITHA 3DBCA 1XMLA 3GB2A 3RM6A 1OPKA 3ZM9A 5DVRA 3W18A 4E5AX 3QTRA 1FMKA 4L42A 4ZSGA 5BVOA 4C35A 4PDOA 3S0OA 5JRSA 3TZ8A 3VBYA 4MEDA 4NU1A 3SD0A 2W5HA 4PDYA 3POOA 3R8UA 3L9MA 3M42A 5BVKA 1MRUA 5B2MA 3MN3A 1FGKA 3HMMA 4P5ZA 2GTMA 4L7SA 5IQDA 5AIRA 3FWQA 3KRWA 3NRMA 4BWPA 2XKDA 3EQDA 4FEQA 2RIOA 3Q52A 3TUCA 1KV2A 4KIKA 1O6LA 4WBBB 5ETIA 3KXGA 5CZHA 3R7VA 3E3BX 3VS3A 4F65A 1H4LA 3FY2A 2LAVA 3S1HA 4DGGA 4ZJIA 1H0WA 3LW0A 4CYIA 1URWA 4XYFA 3TI1A 5ANOA 4BBEA 3COHA 5BPYA 2ZMCA 1VYWA 4MUQA 4O7LA 2B1PA 4X3FC 3TIYA 3TNQB 4TW9A 5A54A 3NEWA 2J90A 2J6MA 2FSLX 2JDVA 4BZOA 4NYEA 1KOAA 4FL1A 3COMA 4RMZA 4IACA 2E9OA 3EWHA 5DRBA 3VJNA 2PUIA 4UWBA 3HLLA 5CEPA 2OO8X 4K0YA 2XCHA 4QQJA 4XUFA 4CTBA 4FTMA 3QLFA 4W8EA 4BC6A 4FKUA 5AUYA 3D5WA 3ZEPA 5D11A 4IZ5A 3OW4A 4H1JA 4I0SA 4I6QA 5EOBA 2BAKA 3ZXZA 1BLXA 1MQBA 4J99A 3QCQA 4JR7A 3FL4A 3HECA 3RBWA 3Q6WA 4GH2A 2GQSA 3DCVA 4TPTA 4D1ZA 3AMYA 4GV1A 3G9LX 4D58A 2A4LA 2DWBA 1H08A 4MXAA 4EOOA 1J7IA 1OUKA 3PDTA 2J0KA 4BHZA 3VRZA 3FC1X 4IJ9A 3IGGA 3CBLA 3MVLA 4UMUA 3EKKA 3DAEA 2QI8A 4JIAA 3UZRA 3HA6A 4CMOA 5AUXA 4RBLA 3MA3A 1UV5A 4HYIA 1UWHA 5BNJA 4FZAB 4ZY4A 2J7TA 3DFAA 3MWUA 4U40A 4F63A 4I24A 4BDIA 1ATPE 2WPAA 2ETMA 3R04A 5E8WA 4CV8A 5BUIA 3IW7A 3CKWA 4FL2A 3MGYA 4QMZA 4U3YA 3E7VA 5CU3A 4IC7A 3KXXA 3L8PA 3ZHPC 1R0PA 5JK3A 1OBDA 5HI2A 4DINA 2WELA 4DT8A 5HU3A 2OZAA 2HK5A 4QYYA 1Q3WA 4G31A 5AJQA 3OCBA 3KGAA 4K18A 2VTAA 5I9WA 1OI9A 1YQJA 2C3KA 2Z7LA 4C02A 1OIRA 4XLIA 2Z7SA 1YDSE 4BTKA 4QP8A 1WVXA 1UU7A 4Y8DA 3TV7A 3E63A 2ZM1A 3MY0A 3W1FA 2NRUA 4W9WA 2X0QA 2W1IA 4HGTA 4YJSA 4D5KA 3DOGA 1V1KA 1J1BA 4DYMA 4AOJA 2AEGA 3TWJA 3UIBA 2XK4A 4RC2A 3CQUA 4I21A 1REKA 3A4PA 3HDNA 4IB0A 3QF9A 2F2CB 4TYHB 4E4XA 2ONLC 5J1WA 2F2UA 4GRBA 3PG1A 5CAUA 3QXOA 3V51A 3VBVA 2CGWA 4Y95A 3FKOA 3QYWA 4ANOA 2Z7RA 1JKSA 5KKRC 4X0MA 4QP9A 1UKIA 4AE9A 2ZFYA 5HTIA 4DH1A 4R77A 4K8AA 3VC4A 4UBAA 1H07A 2VTRA 5JRQA 4JS8A 4CT1A 3ORNA 2BKKA 4MTAA 4KINA 2H96A 5LMKA 4CFVA 2BFXA 1OGUA 4D0WA 3OMVA 4W9XA 4JXFA 3MS9A 4ALUA 5K5XA 3KCKA 1MQ4A 1WBTA 4O91A 3OXTA 2VWWA 2ITQA 4Y73A 3CPBA 3JYAA 3BLQA 4L45A 2OJJA 4TYGA 3RINA 2V0DA 4BCNA 4LFIA 4R8QA 4PTCA 3QL8A 1YHVA 3MVHA 4DF3A 3L1SA 2FUMA 2Z7QA 5AP7A 2ITVA 3LFFA 3KC3A 2PL0A 4QQCA 4EC9A 3C7QA 4E3CA 1U46A 3DTCA 4HVSA 2R2PA 5JGAA 3MB7A 2BMCA 3QQGA 2VTQA 4U9AA 4QOXA 3ZFYA 4D1SA 5IA0A 3VQHA 4C0TA 4F08A 3N4UA 5AR7A 5H3QA 3FZSA 1XQZA 3KXZA 2B0QA 4DH3A 5LOHA 2Y6MA 4F7NA 4DBXA 2FGIA 2HW6A 3I0OA 4IHPA 3UVQA 3CY3A 3U6HA 4A9RA 4TWNA 3Q4TA 4E6DA 2QR8A 4TXCA 3ZDUA 3U6IA 4CTCA 4MD8E 2KTYA 2YCQA 1TZDA 2A1AB 3CPCA 4R6VA 3IW6A 5AUWA 3EQGA 4FVPA 3DV3A 4QMSA 2XBAA 4LGHA 1VJYA 3NGAA 4DTKA 2EXMA 4EHEA 5JZJA 1XH4A 3ORLA 3IECA 4D2SA 3LFBA 5E8TA 4BY9E 5CXHA 2A98A 5J7BA 3OOGA 3HVCA 1Q99A 4DEIA 2QOOA 2PMNX 4M8TA 2PY3A 4B4LA 3ZRMA 4UZHA 3U9CA 2BDJA 5I3RA 3W8LA 4X21A 4HPTE 3E8EA 2C6EA 2PVFA 4HZSA 3PFQA 1K3AA 4CMUA 5LMBA 2OIDA 1W83A 3MJ2A 4R3PA 1DM2A 4WKQA 4BI1A 2YM5A 1YDTE 5HE1A 1PMNA 5LVPA 3DZQA 3NR9A 4JBVA 1KSWA 3ZFXA 3RCDA 4IDTA 5LJJA 2ITNA 3LXKA 4RFMA 4EL9A 3KY2A 1OL7A 5HOAA 3IOPA 1UVRA 3D2IA 4NTTA 2Z2WA 3PY3A 2FA2A 4XBRA 4FSZA 4X2KA 2XUUA 1IA9A 1B6CB 1YKRA 3DDQA 3DXNA 3EOCA 1H28A 4UWYA 3P1AA 4AN3A 3KEXA 5C8NA 3DK6A 3SGCA 3GEQA 2UZWE 4LG4A 2YCSA 3LM0A 4J71A 1OECA 4OBQA 4C34A 1VLRA 3MYGA 2WAJA 4XG8A 4F9YA 1PRYA 3SXRA 3HL7A 3RHKA 2IPXA 3PJ3A 4EZ7A 3I6WA 5DT0A 3UMWA 4YPSA 3SQQA 4W8DA 5AP3A 1Q8WA 2GS2A 5D7VA 2OIBA 4HYSA 4JBPA 3UJGA 1FGIA 2QO2A 4YSJA 4L6QA 4DTBA 3KU2A 2HW7A 3D15A 5KO1A 4Y5QA 5E1EA 4EJ7A 2RGPA 4QMVA 4OAVB 5AUUA 2BILB 2CPKE 3PVGA 3GUBA 4QMMA 5J95A 3K5UA 4F0FA 2CGXA 2WIHA 4IWQA 3MFSA 4O6EA 4OTQA 4YO6A 5FRIA 5J87A 3AQVA 1GZNA 4Z16A 3FEGA 3W2CA 1QL6A 5EH0A 5IUIA 2XK9A 2IO6A 2VRXA 2WO6A 3C50A 4WT6A 3DNEA 4GG7A 4XBUA 5CX9A 3ALNA 4DG2E 4RLLA 3OWKA 5LVNA 4FV7A 4HJOA 3RPSA 3ZYAA 3E3PA 3OD6X 3HX4A 3QYZA 5EK7A 4IX3A 2YM6A 3UOKA 3OWLA 4JNWA 4Z3VA 4P5QA 2C5XA 3NIEA 2PZPA 2ZDUA 4OTPA 4PP9A 4BKZA 5CVGA 5EHYA 4J98A 4NW6A 2WTDA 2XH5A 5C9CA 5AFVA 2YJRA 4HVIA 5CF4A 2BPMA 4Q9SA 2WMVA 3VS5A 2I40A 2VWVA 1M2PA 5M07A 3DNDA 3T3UA 1A06A 3FLNC 4NL0A 1O6YA 3NCGA 5CENA 3SOAA 2R3LA 3U8WA 3RP9A 4ACMA 3JY9A 1RE8A 3MVMA 1XMMA 3BX5A 2OU7A 1OMWA 3HMNA 4GS6A 4MYGA 3ITZA 1YI3A 3UG2A 2IZRA 3RAHA 2VUWA 1MP8A 3A8WA 3RPOA 3N4VA 3AC1A 3H4JA 4D2VA 4U45A 1ZY5A 1GY3A 5EW9A 3B2WA 4GFMA 2UW7A 2XM8A 4G9RA 4O0RA 4LRJA 4EH4A 3PJCA 5BX0A 4I6LA 3VS7A 3NNVA 4XRJA 2WMAA 3BCEA 5CEQA 3EN7A 4C4HA 4UYAA 4G3GA 2WXVA 4FTOA 3HP5A 1Q41A 2FYSA 3W2SA 5AR2A 3QUPA 2UW0A 4CZYB 2W1EA 2IN6A 1R1WA 3TZ7A 3KVXA 5BVWA 4V05A 3EZRA 2VWZA 3BWJA 2X9FA 4II5A 2E9UA 3U9NA 3FY0A 2EWAA 4YUQA 3KA0A 4E4MA 4UY9A 4TL0A 5EM7A 3UDBA 4FSYA 2ZYBA 3ET7A 5H8EA 4IZYA 4QMNA