4G2FA

Human epha3 kinase domain in complex with compound 7
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
275
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITPSNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords EPH receptor A3
publication title Discovery of a novel chemotype of tyrosine kinase inhibitors by fragment-based docking and molecular dynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 275
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g2fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g2fA01
2JFLA 5EHOA 5EI6A 4EOLA 2VX1A 3Q6UA 5HHWA 4E4NA 3UG2A 1PXNA 3GU6A 3CGOA 5CXHA 1NT2A 3DA6A 3PIZA 4FKJA 3MB6A 3FMNA 2XKFA 2J51A 2QG7A 4DYMA 3BHHA 1WVWA 4QPAA 1BKXA 2BRNA 3GFWA 3GP0A 4X2JA 4K6ZA 3RGFA 2ERKA 3VF8A 3A7HA 4CT1A 3QHRA 4IC7A 5HI2A 5L8LA 4ACMA 3UQCA 5HLNA 3BU5A 1OGUA 2B55A 2A4LA 4BCQA 4XV1A 4OAVB 3LIJA 3E92A 3F69A 2PY3A 3O23A 4FT7A 5ETCA 4QMZA 5J5TA 4I6FA 3EL8A 3TM0A 4MKCA 3FQEA 4I1ZA 3COIA 5E8XA 3TUBA 2VTTA 2YHVA 4AOJA 2R3RA 3C0IA 3L9MA 4C36A 2BRBA 2VTSA 5HX8A 3MFSA 5I9VA 3UG1A 3O96A 2AC3A 2OH4A 4H3BA 4C4EA 3Q4TA 3TNQB 3HMIA 3ZFMA 5CVGA 4E4XA 1STCE 3OXTA 2WELA 3BIZA 3KGAA 4HNIA 4J99A 3DNDA 5GZAA 4IZYA 2XK3A 3FSKA 5ETFA 3UVRA 5E8VA 3GI3A 3FZSA 2OLCA 3LE6A 4L42A 1Z57A 4DITA 4PMMA 3DB6A 5HIBA 3CD8A 1DI9A 4JDJA 4QQJA 2JC6A 3R04A 4L7SA 3UNKA 2Z02A 4JL9A 5CSHA 4EH5A 1YW2A 3OY1A 1JKLA 1GZOA 2WMTA 1W82A 4I3ZA 5FM2A 4BTJA 3O71A 4EYMA 4ZY4A 2IVSA 3MB7A 2BUJA 2BHHA 3VS5A 3R0TA 5A46A 4WD5A 4FKLA 1PXLA 4RC2A 4EUTA 4RA4A 2VWYA 3LFNA 3NS9A 4BTKA 2YM6A 4C3RA 4C59A 3RPRA 4BB4A 3CXWA 2R0UA 2GFCA 5HO6A 3FZPA 3ZO2A 4L3LA 4RSSA 4MXZA 4TPTA 5IH5A 4IACA 4X3JA 4YC3A 1DS5A 4U8ZA 5JFVA 3QHWA 3QTWA 4IWPA 2ZM3A 4ZTLA 4FTJA 4Q2AA 5HG7A 4JR3A 4XRLA 1XH7A 1SVGA 2PVLA 5L2WA 2I0EA 5E1EA 2XNOA 2X7FA 4NK9A 3ZUUA 4C34A 4F4PA 1Q41A 4MXOA 2R7IA 5CY3A 1UU3A 2YN8A 2YZAA 4G3FA 5HZNA 4ZMEA 2YIRA 4IFCA 5DR2A 4DA5A 2ITNA 3G90X 4MBJA 3QWKA 4F9AA 3ZDUA 5LWMA 1W0XC 2VWZA 2IW6A 1Q3WA 4WG5A 5HGIA 1ZY5A 1GY3A 4Z7HA 4GRBA 5A4LA 3BYSA 5I4NA 4EK6A 4MXXA 2VUWA 4E6AA 5LVPA 4AGCA 3HAVA 3ULZA 2E9OA 3TACA 2FSOX 3OG7A 4H3PA 4I93A 3QQJA 4Q9SA 1NW1A 5LMAA 2WTKB 4YZBA 4H1MA 5H2UA 4G3DA 3QXPA 1Z9XA 4EH9A 3SDJA 2BKKA 3MVMA 3C5UA 4EHEA 4MCVA 4JAIA 3ORIA 5EYDA 4EC9A 5CWZA 4RX9A 2I0YA 2ITYA 3JUHA 5AX3A 1K3AA 5DRBA 3UVPA 5JEBA 5CYIA 3F3WA 4O2PA 2VTRA 4EYJA 4O7YA 5AIKA 3FYJX 1H25A 1GJOA 4GU9A 4TYHB 4QPMA 4HGTA 5IMEA 5TR6A 2UW6A 4EOSA 1OPLA 5K0KA 3GU8A 3L8XA 5DYJA 2CCHA 4OTRA 2X0GA 2WD1A 2I1MA 4XV9A 3GB2A 4KINA 2OSCA 3OUNB 3ZH8A 4MXAA 4TTHB 4CKIA 2YFXA 3ZSHA 5K4JA 4G34A 3AMBA 3UDBA 3ORPA 2KTYA 3IW5A 5DA3A 2HOGA 2Q83A 4FODA 4UZHA 4YNEA 4WG4A 1JWHA 1ZZ2A 2WB8A 4FG9A 5CF4A 1ERKA 4BWKA 4R77A 4O7VA 5C8MA 1JKSA 5T6KA 2JIUA 3QUDA 3RAKA 3CJGA 4YC6A 2BTSA 4TZRA 3MA3A 4EOMA 3F2NA 2YABA 4V0GB 4YJSA 4NSTA 5IPJA 4G6NA 5JZJA 5HESA 2YDIA 2W1ZA 2C1AA 2BHEA 2R3QA 3DB8A 3EHAA 4L44A 4O27B 2QHMA 4RWLA 4USDA 5AUYA 3U8WA 5KHXA 2X7OA 4GG5A 5E8UA 2VTQA 1UU7A 4PUZA 3C0GA 4BGGA 4JT3A 2C6IA 4MNEB 4BBMA 5HE1A 5AR3A 1A9UA 4CNHA 4LUDA 1DI8A 1MRVA 3NIZA 3TZ7A 2OFVA 3OEFX 3W2PA 5FXRA 2YITA 3HP5A 5TOZA 4EQUA 3SGCA 4CFWA 2B52A 4MH7A 4Q5EA 3P7CA 3R8PA 1FMKA 5H3QA 3HKOA 4O38A 4DEHA 2QODA 1E9HA 4FR4A 4GYGA 4PTEA 4AUAA 4BI2A 2CLXA 4C2WA 1L3RE 5ACKA 4UMPA 4O7NA 3O8TA 2Y6OA 2YM4A 4RWIA 4UXQA 2XP2A 4M69B 3D7TB 5IA4A 1BYGA 3OT3A 1PXJA 3QZHA 3GCSA 5CX9A 5H9BA 3QLGA 4FK3A 3MTFA 5CAVA 5IQBA 3FLSA 2VU3A 3FHIA 4ZTRA 3Q60A 4DEEA 3HV7A 2J4ZA 2R3IA 2WO6A 5J5SA 4ALWA 3CKWA 3HAMA 1J1CA 3LQ5A 5T68A 5CSWA 2OBJA 2PZYA 3DPKA 3FAAA 1ZYCA 3IGGA 2J0MB 5DHJA 4E3CA 3POZA 5HVKA 5AUTA 5IUHA 4CT2A 3FKOA 4G1WA 3NUUA 3NZ0A 4FEQA 4IB3A 3BWFA 4BN1A 4ZIMA 1CTPE 2WQOA 2XIXA 3CBLA 1BL6A 3NNVA 4RFMA 4PF4A 4PDYA 4AZFA 4G16A 4RQVA 4YJTA 3N51A 1ZLTA 3RALA 4ZSEA 1H26A 4BZOA 2WZJA 4DEGA 4BHNA 1OMWA 2XNEA 3R21A 4U97A 4D2VA 3CQEA 3JVSA 4DLIA 3P23A 4B0GA 2XIKA 3AT3A 4JLCA 2XK9A 3UZPA 3BELA 4Z55A 5L3AA 3U9CA 2YM8A 2QKRA 3SV0A 3UOJA 1HCLA 4KBCA 3PRIA 3UE4A 3LCTA 5JRQA 1Q99A 4HPTE 4E93A 3IW4A 4KIOA 4AGWA 3U6HA 3FMJA 4EOJA 2OF2A 2YDJA 3ORZA 3HYHA 3WZDA 5A4TA 2JDTA 2QVSE 3IDPA 4RBLA 1H1SA 4TYJA 5KMJA 4H36A 5HO7A 4FVQA 4AW2A 1SVEA 4S32A 3UGCA 4OAUC 5EKOA 3MTLA 4WBBB 2FO0A 4IZ5A 2E9VA 3NPCA 3R9OA 1KV1A 3NW7A 4HCVA 3TZ8A 1KOAA 3NW6A 4AE6A 4Z3VA 2J5EA 4AA5A 3GVUA 2A1AB 4IDVA 3MJ1A 5TF9A 3CP9A 4ZTMA 2IZSA 3ZEWA 3ZRKA 1XWSA 2C5YA 4LL0A 3KREA 2PVJA 3Q4CA 2WOUA 3CPBA 2Y9QA 3DOGA 4BCMA 4F1OA 2CJMA 3ELJA 1ZOGA 4R6VA 4ZSGA 3S2PA 5JFWA 4LMNA 4C02A 3PPZA 4M68A 2VTPA 4I4FA 4YO6A 1JSTA 2ZM1A 3DS6A 3UO5A 3CTJA 2JKQA 2R9SA 3BLQA 3GNIB 1BMKA 4XG6A 3SX9A 5EG3A 2EU9A 3UPZA 2VAGA 4X2GA 1VYWA 2WEIA 3OTVA 5AV1A 3D4QA 3RTPA 3G9NA 2CNQA 3EFLA 4Y5QA 1YVJA 4X3FB 2J5FA 4IX6A 4EHZA 3AT2A 4ZOGA 5IQGA 3K5VA 5IQAA 4O91A 3FKLA 2YIWA 5HO8A 2XEYA 4GCJA 3HUBA 4AA0A 4CFFA 4JBQA 2GNHA 1Q62A 1P2AA 3QQUA 4RJ7A 1PXPA 3R8ZA 4I0TA 5KKRC 5J9LA 5A6OA 5B2MA 3EFJA 3OY3A 3TDVA 1UV5A 4GKIA 5C4LA 3S3IA 3AT4A 3ZO4A 3EZRA 5KNJA 2YIXA 3L8PA 5FUTA 3WZEA 4BDIA 4JI9A 4BDAA 4ZTSA 4IWDA 2B4SB 4G3GA 5KX8A 5ANIA 3EIDA 3W2QA 3MV5A 4FSRA 4HVIA 2OWBA 3ORNA 3PVUA 4CXAA 3CTHA 4ZSJA 1YKRA 5LVMA 2WOTA 3OVVA 2ITQA 4XP3A 3R01A 3ODYX 4XCUA 2VWXA 1Q8UA 5J95A 4MVFA 3S1HA 1SNXA 3BE9A 3VUTA 4H05A 4BTFA 3K5UA 1V0PA 3NWWA 4JG7A 4NCTA 4RIYA 4E5BA 1OBGA 2YM3A 1CMKE 4AF3A 2XRUA 3FDNA 2C6MA 3RAHA 2A2AA 4O7ZA 4IANA 4U3ZA 4L9IA 1RJBA 4UMQA 3ZTXA 2GTNA 5EYCA 5BVOA 2X2LA 4W9WA 2C30A 3GXLA 3LOKA 4O0WA 4OBOA 2IPXA 2W06A 1PF8A 5GJGA 3LKMA 1QMZA 2C6EA 3SW4A 4MX9A 3V3VA 4A9SA 1O6YA 5BYLA 2OJFE 1V1KA 2HENA 1FPUA 1JQHA 1XH5A 3K3IA 4C3FA 3C50A 3BEGA 1H0WA 4TRLA 4AQCA 3PVGA 2UW5A 3D2KA 4ITJA 3FI4A 4AOTA 3LFEA 4V04A 2C47A 4RJ5A 5LARA 3DXQA 5FTGA 4CSVA 5FBNC 3LHJA 3C13A 1Q5KA 4NW5A 4IAFA 3LFBA 3I7BA 1IASA 2JKKA 4KIKA 5CVFA 1K9AA 3R7UA 5EKNA 4EWQA 1REKA 4QPSA 5IKWA 4D9TA 4QMWA 4DFUA 2HZ0A 3W16A 3NYVA 5AV2A 2HWOA 4FNYA 3W18A 2W1DA 3NUSA 4IWQA 3WE8A 4EH8A 4FI1A 4JBOA 4U40A 5HVJA 2DUVA 3EQPA 4MBLA 5AP4A 2PVRA 2PZ5A 3B2WA 3FXWA 5BUEA 4O83A 3SG9A 4QP9A 5FEQA 5ETAA 4I21A 4D4SA 3E88A 2YEXA 3C7QA 3FLNC 3R7YA 3RCDA 3KRWA 4HNFA 4UWYA 2F49A 1PJKA 2WMUA 3BYOA 3QQFA 3FI3A 1KSWA 4N0SA 5F9EA 2IZRA 1FVRA 4PMTA 4BGHA 3U87A 4NIFB 1W84A 3WZJA 2F2UA 4ARKA 2WMWA 5FEEA 3ZYAA 4RIXA 1WVXA 4NKAA 5I9UA 5DLSA 3QRUA 3RNYA 4OBQA 3RZBA 1BX6A 3V8TA 3DT1A 5I9XA 3GEQA 3DKFA 2WEVA 2J7TA 3BGPA 1OI9A 1SM2A 2OGVA 2WPAA 2Y4IC 4L53A 1U59A 2X8EA 2C3KA 4X7QA 1V0BA 3KXGA 4YHFA 5J7BA 1M2PA 4OTGA 4JRNA 3CE3A 4CTBA 5BYZA 2YJRA 4WNOA 3GOKA 4HYSA 3UP2A 4A06A 3KK9A 3ZLXA 4HPUE 2WQBA 2WTJA 2YM5A 3CEKA 3EN4A 5EQYA 2XVDA 1JSUA 1UKIA 4FG7A 1G8SA 2YAKA 5CASA 2GTMA 3A8WA 4G5JA 4M66A 1ND4A 5LCJA 2RFEA 2WMSA 4DG3E 3VAPA 5A54A 4FL2A 1Y8YA 4QMTA 4X2NA 4CV9A 4YJQA 3QTUA 4DFNA 2J6MA 3JYAA 3D5VA 3KXXA 3AC3A 3ROYA 1DM2A 2OZOA 4AT4A 5AP1A 4X21A 4PQNA 3QL8A 2WQEA 3CLYA 5BVDA 3PIYA 4PWNA 2NRUA 4DCAA 3ZONA 4YJVA 3BV3A 4U81A 3ZO1A 4QTBA 1PHKA 1WBVA 1R0PA 2W4OA 5L2SA 4J98A 5HTIA 4FUXA 3OUKA 4E26A 3QZFA 5CAOA 3PLAE 3MJ2A 5CEIA 1URWA 4OTDA 2WMAA 4FYNA 1PMVA 4FA2A 4BCHA 4FTNA 2WTWA 3PP1A 3UNJA 2W5BA 4APCA 5M4IA 1PXIA 1YXVA 2ZDUA 4AFEA 3R7OA 1XH8A 5CS6A 5L8KA 4XP0A 2PK9A 1AD5A 4Y85A 1JKTA 3FZ1A 4JIAA 2OW3A 1YDTE 4JG6A 4UB7A 1KE9A 2OK1A 4FIHA 4TYEA 5AADA 2WMXA 3DV3A 3A7IA 3OW3A 4NCTC 2IZTA 2QO2A 3PPKA 4FV7A 4EKKA 4USEA 3BV2A 4AP7A 4YZDA 3V8SA 4O6EA 1UU9A 3KKVA 2PMNX 4KD1A 5CXZA 2CN5A 2ZJWA 3HZTA 4WG3A 3JR1A 3TDWA 3W55A 1FGIA 2HXQA 2QCSA 2WIHA 3FL4A 5HBHA 2BMCA 3NAYA 4QMLA 4XG4A 3ZSIA 4UN0C 3BX5A 5DBXA 2J0JA 4ASDA 4D2TA 1OL2A 2QOLA 4Y46A 4Y83A 2BZHB 2IO6A 3OF0A 3OHTA 5AAGA 1P4FA 3MVHA 4AN3A 4CVAA 3HV4A 5CALA 3P86A 5HCZA 1CDKA 5IQEA 5KCVA 4ZP5A 5AR8A 5CF8A 5IA1A 4ZS4A 1JPAA 4G3EA 5LMBA 5LWNA 4BCOA 5FTQA 2C5NA 4XLIA 1HOWA 4KB8A 4DFZE 1ZARA 2FH9A 4ZJIA 3BEAA 3ANQA 3FC1X 3GOPA 4H3QA 3WYXA 4DLJA 1IR3A 3P5KA 3QD4A 1YRPA 3I81A 1GIHA 2FA2A 1OL1A 4DCEA 1LP4A 3HMOA 4GJ3A 4IB0A 4QNYA 2PHKA 4BBEA 4QYHA 5HG9A 3HRFA 3ROCA 2VTLA 4UYNA 2JKMA 4IH8A 2V0DA 4K8AA 3IO7A 4DN5A 3NGAA 3LMIA 4FSQA 5KUPA 4ZTHA 5FBOA 4I5MA 5K9IA 2GU8A 4P4CA 1YXXA 3COHA 4DFLA 4EZ3A 2ITUA 3ZO3A 5C8NA 1P4OA 2X8IA 4MBIA 5DPVA 4XG7A 5HD7A 1H07A 4ITHA 3FC2A 5CAPA 2AC5A 2XK6A 4HVDA 3FMHA 5KMLA 2V5QA 4AG8A 3BYMA 3IW7A 3V5PA 4B99A 2JDSA 3EN6A 4X2FA 3POOA 4M3QA 5FDXA 1PXOA 2BFXA 2OFUA 4FGBA 4U6RA 3R9HA 4WKQA 4EHVA 3E7OA 1H1WA 1YHWA 1IG1A 4FV5A 4GIIA 5JMSA 1OB3A 1OZ1A 5IQFA 4QD6A 4DGNA 3ALOA 4ERKA 5IUGA 2HZIA 2GNLA 1KOBA 3ZC6A 4WO5A 2VTMA 4WSQA 4O82A 2AYPA 5CAUA 5L2IA 2R3LA 1NVQA 2PE0A 3NR9A 5CEQA 5EQPA 1SMHA 5AR5A 5IEVA 3S4QA 1URCA 4U44A 1W7HA 2VZ6A 2G15A 3PDTA 3QTRA 2X9EA 4FT9A 4IXPA 2WU6A 4BKZA 3FKNA 4UMTA 1YI6A 3EQRA 1XH9A 3BQRA 2ZOQA 3DLSA 4ID7A 4YSJA 4IAIA 4EK5A 2OZAB 2UZBA 4MF1A 4PMPA 1JLUE 2V55A 2ZYBA 2VO6A 2XJ0A 3L8SA 4W4XA 3EN9A 2VD5A 3FI2A 4NM7A 4W9XA 2BIYA 4DH5A 2C6OA 4GH2A 2YIYA 4CZUA 2R3KA 4C4IA 3R6XA 2XIRA 4MK0A 3K3JA 5AP0A 3F7ZA 3V6SA 5KMMA 4NTTA 2V7AA 3ZU7A 4OTPA 2BVAA 3TTJA 1P5EA 2HYYA 3KXHA 4ZTQA 3KVWA 1BI8A 1B39A 2XNPA 2JBPA 3QCYA 4BI1A 2G2IA 2R3FA 4I41A 3VUMA 2XJ2A 4EKLA 3KN5A 2VWUA 2WTCA 4FV2A 2VWBA 3EYGA 3F3UA 3OC1A 5H8BA 5DT4A 4FEWA 3KA0A 5D10A 3TJCA 3HDMA 3KMWA 3Q4ZA 3I6UA 3Q3BA 2VNYA 4FSZA 2ZAZA 3VUIA 2QNJA 4H58A 3SKCA 5HIEA 2YCFA 2JBOA 1DAYA 4RX7A 2ZV8A 4K77A 4O7RA 3UBDA 3C4EA 3VW6A 4BZNA 5HIDA 4Y95A 2XYUA 3V04A 2ZVAA 1KE7A 3SW7A 4ITIA 4YSMA 4ZTNA 2C0OA 5AV0A 4CLJA 4EWHA 5HLPA 4D0WA 4Y72A 3LXKA 3R1QA 4AGUA 4YGAA 4M7IA 3P0MA 3UIUA 2BILB 4G31A 4OLIA 5HBJA 4O6LA 1YWVA 3VQUA 4DH3A 2O5KA 3MYGA 5HORA 3MIAA 3MESA 4DF3A 1S9IA 2R3OA 3BYUA 3DDPA 4D55A 5M44A 2Z7QA 4FL1A 3L1SA 5LVOA 5CU4A 2R4BA 1IEPA 2BR1A 4K1BA 3SHEA 4D4VA 4F9CA 3KU2A 3P1AA 3M42A 1YXUA 3KULB 5DNRA 3P79A 4K33A 2R3NA 5E8SA 5IH6A 4IZAA 1GZKA 3VUDA 2QG5A 4BDGA 2NPQA 5DGZA 2ITVA 2X6EA 3EFKA 3ZZEA 3ZC5A 4XMOA 4FBXA 5DR6A 2J2IB 3MPTA 3QTSA 4J96A 2CMWA 4WNPA 3NMUF 5CEKA 3MIYA 3P7BA 1SVHA 3QRJA 4W4WA 4HYHA 3R1NA 1MRYA 4YJUA 3D7ZA 1LUFA 3LAUA 4HGSA 4IAAA 5FXQA 3OOMA 4S30A 2UVXA 1X8BA 2H9VA 4FKIA 2QOOA 3CCNA 3OCBA 4KRCA 4LFIA 4OT5A 4RIOA 4Z16A 3V5WA 5CF6A 3OMVA 4O0YA 5DVRA 4XP2A 3GQLA 3R2YA 1OPKA 4O0RA 2ONLA 3CTQA 3R63A 4FX3A 1XH4A 1YOLA 4M8TA 4RWKA 4EBWA 3ZCLA 3ACJA 3M11A 3IQ7A 2OG8A 4D2SA 3Q2MA 3PYYA 5CSPA 1J7IA 5CTPA 2CLQA 2OKRA 3FPMA 1A06A 2R3JA 3F6XA 2XIYA 4FTRA 4RIWB 4BGQA 2PPQA 4A4XA 5L2QA 4JS8A 4FV0A 4M0ZA 5DMZA 2R7BA 5F94A 2REIA 2ITPA 2F7EE 2UW3A 3DXNA 2QURA 5E90A 4RRVA 4UX9A 4YMJA 3PE1A 2VGPA 5E7RA 4JJRA 2VTIA 3NYOA 4KA3A 4D28A 3PVBA 3G51A 5D1JA 2C5VA 4BCIA 4L3PA 4V0GA 5CZIA 1WBTA 4OBPA 4ACHA 2Z7RA 5G6VA 2BTRA 4F6WA 1PKDA 4LOQA 4FNXA 4KS7A 4AZTA 2C5OA 4FKRA 2PWLA 4WT6A 3COMA 3OCGA 5E1SA 5GIPE 5DEWA 3CPCA 4YBKA 3VS6A 2BRMA 5FXSA 3D83A 4KIQA 4OGRA 2W99B 4NTSA 2VTNA 3QA0A 3C4ZA 4AU8A 4TWOA 4XG3A 2OJGA 3D0EA 3E8EA 2DWBA 3BHYA 3LCDA 3DK7A 3I7CA 3W8QA 4DT8A 2PU8A 4IZ7A 2QR7A 1PXMA 2Y8OA 3HMPA 4FTIA 1V0OA 3ZXTA 2UZVA 3HUCA 3U9NA 4N57A 4U0IA 4QMXA 5EM6A 4BHZA 4ZLOA 2C6KA 1QPJA 4M69A 3D7TA 4QO9A 4O0TA 4XUFA 4QOXA 3OWKA 1VYZA 4PDOA 5FM3A 4YLLA 3VVHA 3F88A 4L01A 1FVVA 4IB5A 2CDZA 4XS2A 1UKHA 2XNMA 4YNOA 5FLFA 4YR8A 2ZV2A 3H9FA 2BROA 2XKEA 4USFA 5HCXA 4C7TA 5EHYA 2HIWA 3F9NA 4YZNA 4EJNA 4EONA 2QU6A 3Q9WA 1Q8ZA 3VWAA 2CN8A 4I6BA 4FT0A 4ZZMA 1G3NA 2VV9A 3FQHA 2O3PA 1TQPA 2B9JA 2VRXA 3H10A 4ENXA 3FZRA 1UWJA 3SXFA 2P2IA 4GS6A 4J95A 4RJ6A 4AAAA 4Y5HA 1TKIA 1WCCA 3AC5A 3LCSA 5I0BA 3SLSA 3F2RA 3PXRA 3TKUA 2YIQA 3SRVA 2I0HA 3PXQA 3VUKA 5M4CA 3E64A 5D41A 4QMMA 3O7LD 5D11A 4ASEA 1LEZA 4MHAA 4EH7A 2YM7A 4JR7A 5DH3A 3ORKA 5AWMA 4E20A 1JBPE 3FY0A 4W4VA 5ANGA 1GIIA 2PTKA 3LJ1A 2GQRA 4FEXA 3WF7A 5ACBC 2XNBA 4C2VA 5AEPA 1B38A 2E2BA 4RLKA 3QC4A 2R3MA 3Q53A 4IE9A 3PY3A 5HCYA 1CSNA 4FEUA 4BI0A 3DZQA 3EKNA 3TL8A 1LEWA 4QP8A 4ZLYA 3I0QA 4LRJA 3EYHA 5J9ZA 4D0XA 4DGMA 2ERZE 3NW5A 4U42A 2GSFA 4ASXA 3PFQA 2CKOA 3FLWA 3A8XA 2YAAA 1F0QA 2C68A 2G2HA 3RK5A 4AXAA 4O81A 3FWQA 4KS8A 2RFSA 4D2RA 3N4UA 4GVAA 3VS2A 3IG7A 4GFMA 2KULA 1E1VA 4FIJA 2ONLC 2RGPA 4DC2A 4TYIA 4K2RA 4GL9A 3MS9A 2YJSA 2PZRA 3DGKA 3BQCA 4G5PA 5AUVA 3QX2A 4EH6A 2F4JA 4FTKA 5AV3A 3VHEA 2WXVA 4L67A 4QMVA 1OKZA 2PVYA 4PV0A 4A9YA 5M57A 1HCKA 2QOFA 3EJ1A 4BBFA 5C1QB 2BZJA 1H0VA 2EB3A 3O8UA 4IQ6A 2YACA 4DINA 3TT0A 2GNJA 4IVCA 3F3ZA 4F09A 4RWJA 2BKZA 5I3OA 2PE2A 4L45A 3VBWA 5HD4A 5AFVA 4IM3A 5EDQA 5E92A 3OCSA 4YTHA 3UOLA 4EQCA 4RT7A 4DEBA 5BMSA 5CEMA 3SOAA 3W32A 4I0RA 4NKSA 4CZYB 4D2PA 5A4QA 3TUDA 3R8UA 3TKIA 4UMRA 3U6IA 4TWNA 2HAKA 3DFCB 4ACGA 1JOWB 4FKGA 1MUOA 2UZUE 4G6LA 3QKLA 5C26A 2OO8X 2XH5A 1ZYDA 3JPVA 3CIKA 3KRRA 3FXXA 4DEDA 2WNTA 3JY0A 2E9PA 2IW8A 4MWHA 3S00A 4YC8A 2PZIA 2QO7A 3BU6A 3QYWA 4LGGA 3VN9A 4AX8A 3Q04A 5BVNA 2UZLA 4O7WA 3G6GA 5CANA 5M07A 2ZMCA 1QPDA 4AA4A 4AFJA 3CSVA 4YHJA 1Y6BA 2EVAA 3IDCA 3GC7A 3QX4A 3F66A 5M55A 5F95A 5IMXA 4KKHA 3EQBA 3EL7A 4ONAA 3M1SA 4E73A 4BDJA 4DBNA 4TXCA 4FT3A 1IRKA 2CKEA 2PE1A 3QKKA 3JXWA 4TW9A 4KBKA 3RM7A 3OXIA 1OIYA 3TNIA 4GFGA 4WNKA 3ENMA 2WFYA 4IJ9A 4O1OA 1Z5MA 3DBEA 2B7AA 3U4UA 3RMFA 3TJDA 3LFSA 3PJ3A 4IX5A 4BIEA 4DTAA 5CNNA 4CGAA 3JVRA 3DBCA 4A07A 2EXEA 3IPHA 3SA0A 3QZIA 3HX4A 5B2LA 1F5QA 4WNMA 4RG0A 4BF2A 3OFMA 2IZUA 4XOYA 4ZJVA 4QTEA 5AIRA 3NUNA 5C27A 1PMNA 3CY3A 3C4CA 1YI3A 3UO6A 3UMXA 1H1QA 1R39A 4RX8A 3UC3A 3QGYA 3RHXA 3L8VA 4NM5A 4B8LA 4TYGA 1WBSA 4FZAB 3AOXA 3GU4A 4J8MA 2JDVA 3KQ7A 3V5JA 3QQLA 2GHLA 4IB1A 4IM2A 4U43A 5KBQA 2RFDA 5AUWA 5HLWA 4YJRA 2OXYA 4KRDA 3KK8A 3DZOA 3KCFA 5J1VA 4J52A 3FMLA 4ZS0A 3WYYA 3B8QA 4KKEA 4BDCA 4HJOA 3CS9A 3QAME 4KBAA 4FTTA 3BGQA 4R5YA 4RFYA 4ZZOA 3LMGA 3T8OA 3ZZWA 1UNGA 4DH8A 4GK3A 5AMNA 5IG1A 1FQ1B 3HMMA 3KRLA 4LUEA 5H8EA 3SD0A 3QQGA 2YLFA 3MVJA 3K2LA 1H8FA 4GSBA 3DKOA 5FGKA 4ANBA 5IQHA 4BFMA 3CD3A 1KE6A 3DJ7A 5FWKK 2O8YA 1SNUA 2FUMA 4LYNA 2Q0BA 3I6WA 4PL5A 1O9UA 2JAMA 1YDSE 3AC1A 5JGDA 2C3LA 4XBUA 1U4DA 4JOAA 2CSNA 5CF5A 1KUTA 1XR1A 2YDKA 4GT3A 5CU3A 1XQZA 3KFAA 3T3UA 3RPVA 5JFXA 4DEIA 1H28A 2BAJA 3PA5A 3MFUA 3PSDA 2X2KA 3O7LB 3E3PA 4FKPA 5D12A 4BWPA 5KMOA 2C6TA 2Y7JA 4IW0A 3U55A 1FGKA 3V8WA 4IADA 3EH9A 3HEGA 5F4NA 3KC3A 1YWRA 5KMIA 1VEBA 3IKAA 4XOZA 1YWNA 3OT8A 4DTBA 2QD9A 3CJFA 4JX3A 2Y4IB 3MH3A 5JGBA 5IU2A 2B53A 1PXKA 1XBCA 3DAEA 2OF4A 3H3CA 2ITWA 3KMMA 3BHVA 3CY2A 4M13A 3PXKA 1J3HA 4MNFA 5LVNA 4G9CA 1ZRZA 4GU6A 4B4LA 2WIPA 3C4FA 3ET7A 2OU7A 4EORA 1U54B 3QRKA 2ITZA 3CR0A 4HVHA 4EH2A 2GHMA 3ODZX 4PTGA 4DH1A 4UY9A 4B6LA 4AOIA 4F6UA 3G9LX 5AAFA 3FLZA 4HVGA 3QQKA 4TT7A 5JZNA 5HX6A 3AC2A 3GU5A 5GZ8A 4L7FA 1Q8YA 1R1WA 1H08A 4TNBA 3NNWA 3UQGA 3Q32A 4AW0A 3PG3A 3W8LA 2W7XA 2Y4PA 4DEAA 3KB7A 5AJQA 3E87A 5BVFA 2BDFA 4NFMA 2WKMA 4EK4A 5A4CA 2CGUA 4RC4A 1JNKA 5C8KA 4GT4A 3ZS5A 3PWDA 3IW6A 4N4SA 2CGWA 2VTAA 3MI9A 3O17A 4L68A 3TEIA 4D2WA 4E4MA 4ZLZA 2OJ9A 2QLUA 3W33A 2JIVA 4PP7A 3PZHA 2OJJA 4NM0A 2O64A 3FZTA 5HNGA 5CNOA 3LXLA 3NCZA 1AGWA 4IWOA 4MD7E 2ACXA 2PMIA 4Z7GA 4W4YA 2W0JA 4FKOA 4A4LA 2IN6A 4FKWA 4JXFA 4XH6A 5M09A 3MBLA 4R3RA 5IUIA 2B0QA 3LLAA 4CQGA 5D9HA 2PVNA 3ORTA 3A7GA 1IAHA 5B0XA 2XM8A 3OW4A 2CGXA 4L52A 4RIYB 5BVKA 3KN6A 3K54A 3BBWA 5HICA 5IEYA 3QLFA 4LGDA 2ITXA 3BWJA 3RZFA 5IISA 3VBVA 2JFMA 4BCNA 1ZY4A 4IEBA 2X2MA 5AA8A 3U6JA 5M56A 2VO0A 4BYIA 4MQ2A 4IHPA 4M0YA 4YTIA 3QXOA 4BCJA 2H34A 4DG0E 4GK4A 3H30A 4KSPA 2C6DA 5DG5A 5IZFA 2BDWA 3SOCA 3QCXA 3DU8A 2C4GA 3O51A 4GUEA 3FI8A 1YOJA 3BLHA 5BNJA 3NIEA 3P9JA 1CKPA 2PULA 1GNGA 5EOBA 4LV5A 1UNLA 4WIHA 5FRIA 3TG1A 3ZRLA 5I9YA 5M53A 4M97A 3VUGA 3JS2A 1YHVA 5BQ0A 3LJ0A 4RA5A 3VS7A 5KHWA 4QQ5A 3ID6C 2CHLA 2WTIA 5HOAA 4C4FA 3KRJA 3ULIA 1BLXA 5CENA 4CFUA 5K3YA 5CEOA 3BHUA 1H1RA 4OUCA 4PTCA 1B6CB 4W8DA 4OW8A 3DQXA 2C6LA 1BL7A 4IVAA 3RWQA 3Q52A 3I4BA 5EOLA 2W5HA 4PP9A 4YP8A 3BI6A 5HE2A 3QD2B 4RMZA 5CZHA 2OIBA 1YHSA 3LPBA 3OWJA 1ZAOA 2Y0AA 4YPSA 3I0OA 4JAJA 3SAYA 1R0EA 2JD5A 4ZK5A 3LM5A 3VHKA 4A9UA 5M06A 4ANQA 2F7ZE 4HZRA 4BTMA 5KO1A 4RVLA 4O22A 4LGHA 3TN8A 2R0IA 2XB7A 3IONA 4L46A 4A9RA 3FJQE 4BCGA 5KMKA 4C37A 5CAQA 2YCRA 4NJ3A 5GINE 4FV1A 2XM9A 4QTCA 3U51A 4U3YA 4CMTA 3EQGA 2XKCA 3GGFA 3C1XA 1H24A 4PPCA 4O7TA 3VS0A 2H96A 4UXLA 3MY5A 4XRJA 3FZOA 5IA0A 3WE4A 4XV2A 2PUPA 3E63A 3EQHA 2ZMDA 5AP3A 3UJGA 1GOLA 2A19B 4GFOA 2F2CB 1PKGA 1QL6A 3QRIA 3FHRA 2XMYA 5KZ0A 4EI4A 2QOIA 3GUBA 4OTHA 4H39A 4BWXA 2PUIA 3R00A 1WVYA 3KXZA 3IDBA 4L00A 5CSVA 3ZUTA 2CNUA 3SG8A 5CVHA 2PMOX 3F5XA 4P90A 3BRBA 4BDBA 3GENA 5DFPA 2IG7A 4DT9A 1WBOA 3PXFA 3TCPA 4D9UA 3HA6A 4CQEA 1L8TA 4EOQA 4UWCA 4FIEA 4XX9A 5CSXA 4FTCA 4G2FA 3DFAA 4YLJA 3ZLSA 1G5SA 4F9WA 3UQFA 4GKHA 4XEYA 4FYOA 2OZAA 2GNIA 2WGJA 3MWUA 4JQ8A 1J7UA 3GU7A 5GIOE 3UNZA 4PL4A 5A6NA 4MD9E 1WBNA 2G01A 2NRYA 4M12A 3WZKA 4EL9A 4CFVA 3PJ2A 4HCUA 4I0SA 4XJ0A 5BPYA 2YCQA 4PRJA 1XJDA 2VWWA 4C4JA 3PJ1A 1PW2A 3O8PA 4ZXTA 2HY0A 3IK3A 4NT4A 4OTFA 4V01A 5IQDA 3PUPA 3QTZA 1LR4A 3AC8A 3VRYA 3W2CA 2W17A 3ETAA 4BDDA 5E9EA 4I5PA 1ZYSA 3ATTA 3ZEPA 4A7CA 3LCOA 4IAKA 3VBYA 4GYIA 4QP6A 5E8ZA 1XBAA 4X6RA 5E8YA 4JVGA 4QMNA 2XNNA 5FP5A 5L4QA 1J7LA 4QQCA 5LJJA 4Y8DA 1OL6A 2PL0A 3QCSA 4RGJA 2QOCA 3BCEA 4O7SA 3PJ8A 5AM6A 4PNIA 5CU2A 4CYJA 4FK6A 3GCQA 3II5A 3Q9YA 4AT3A 4WSYA 2JIIA 2R3HA 2DYLA 2DQ7X 4FKQA 1O6LA 3DTCA 1YQJA 2LGCA 2QHNA 5E4HA 5EW8A 5LVLA 1SZMA 2Y6MA 4IVDA 3W1FA 2I40A 2HZNA 2FYSA 4D4YA 3O2MA 3ZM4A 4BCPA 3OD6X 4FOCA 4IX4A 3G2FA 4P2KA 1O6KA 2JAVA 1UU8A 4WBOA 4BIDA 1NVRA 2JDRA 1E1XA 4HGEA 3R8MA 4CG9A 2VTHA 3VBXA 4DGOA 2YWPA 5CQWA 1Q3DA 4I24A 3PTGA 3V51A 1OKYA 2WQMA 3FYKX 1NXKA 4QP3A 3MH0A 1WFCA 4IDTA 1DAWA 4H1JA 4FTOA 1H00A 4YUQA 5AUUA 3AMYA 2GNGA 3KULA 4J8NA 2A27A 4F7LA 4M14A 2UW8A 4YO4A 2J50A 3QD0A 4G17A 4OTWA 5HQ0A 4FOBA 2V7OA 1KE5A 3C4XA 4LM5A 5BVEA 1APME 5LMKA 1Y57A 2BCJA 2W1CA 3TIZA 1ZOEA 4ALVA 3RHKA 3KCKA 3I60A 4DFXE 3EZVA 4XNEA 4E7WA 5I9ZA 3IOKA 3QQHA 3DXPA 5E91A 4L8MA 4YTCA 3Q9ZA 4CD0A 4RX5A 2RIOA 3COKA 4X2KA 3R7GA 1H1PA 3A4OX 3IW8A 3ALNA 4MTAA 4PDPA 3FY2A 3LXPA 5EW3A 4GEOA 3CGFA 2IVUA 4LRKA 5DE2A 5EM8A 2PMLX 4MF0A 4PNKA 5IA2A 2JDOA 3VS4A 3QYZA 4FUYA 4OR5A 4R1VA 2BRHA 4TNDA 3EQFA 5EH0A 3LFAA 4BICA 1VZOA 2P2HA 2VX0A 3R73A 4RLLA 5EHLA 3NDMA 4M15A 4NZWB 3BGZA 1Y91A 5AP6A 2UW9A 4E6QA 3GCVA 3KVXA 4EBVA 3HRBA 2NP8A 4CZTA 2JEDA 4FICA 3THBA 3FMKA 3L9PA 3VS3A 4DFYA 1NA7A 3WIKA 1R78A 3H0ZA 3N9XA 4JDKA 2SRCA 2FSLX 2QR8A 3LM0A 5LOHA 3HV6A 3I1AA 4QYFA 3PJCA 3KXMA 4U80A 4C58A 4CFMA 5K5NA 1YXTA 2O2UA 2VWIA 1F3MC 3HVCA 3WIGA 5K5XA 4GJ2A 4KNBA 3H0YA 4GG7A 4QP4A 5DIAA 4I5HA 5DEYA 3RKBA 1H01A 4NFNA 3DK3A 4FSTA 2QQ7A 3DBDA 1ZMVA 3NAXA 2VWVA 3BU3A 3M2WA 5FQDC 4F70A 2CGVA 4FVRA 3F82A 5E8WA 3REPA 3TNWA 3NVMB 2GFSA 2ZB0A 3F7WA 2HY81 2GPHA 3C0HA 2W05A 2GMXA 3F5PA 4ANNA 4KAOA 3TKHA 3UZTA 4FZ6A 1W8CA 5TE0A 2UV2A 4YTFA 5M4UA 2RL5A 4HVSA 3HECA 4JQEA 4C62A 3FPQA 3DY7A 3C9WA 5CEPA 2UVYA 4AW5A 4EHGA 4C35A 2VTJA 5EW9A 3UOHA 2XBAA 3E8CA 4QMPA 4FTAA 5DN3A 3F5UA 2BALA 3WI6A 3F5GA 5C9CA 2BZIB 4JG8A 4U79A 4KWPA 4WRGA 4BY9E 4TYHA 4R3CA 3GCUA 3SC1A 4O7LA 3ATSA 4EZ7A 5JK3A 4E5WA 2QI8A 3KL8A 4IAYA 3MSSA 1W83A 4J7BA 3IGOA 4ORKA 4J71A 3NUPA 3LVPA 3ZMMA 4II5A 3R9RA 4V05A 2G2FA 3AQVA 2PUUA 3LQ8A 2Q0NA 4LRMA 5HE3A 1ZYLA 2J0LA 3MA6A 4FG8A 4DHFA 5JH6A 4C33A 3VC4A 2QLQA 3EN5A 3PE2A 1PYXA 2BAKA 3R02A 1KV2A 2JKOA 5EI2A 4RZWA 3LJ2A 1TQMA 4BR3A 5GHVA 3HA8A 1Q8TA 3MVLA 1I44A 3FSFA 2DS1A 1ZOHA 2EWAA 2UW7A 1IAJA 4AACA 4PPAA 2E9UA 4RVTA 3NX8A 4X6QC 1UNHA 3D9VA 3NRMA 3R9NA 3RNIA 5JGAA 1OUYA 5JKGA 5EQEA 5GJDA 5BVWA 3A4PA 4J53A 3EOCA 3V5QA 3TZMA 1PYEA 3UYTA 4ALUA 5H8GA 4G6OA 3QZGA 2I0VA 4TKSA 5HG5A 4BC6A 4FSMA 2V22A 4WOVA 4WA9A 1PY5A 2BAQA 4CKRA 2VN9A 3Q5IA 4FIFA 4WUAA 4D5KA 4O86A 4YURA 2QC6A 4LG4A 4MNEA 3TNHA 3TV6A 3QTIA 3A61A 4D1SA 4F7SA 3AG9A 4EEVA 3NVKI 4CRLA 4I94A 2OJIA 3A7JA 1OIQA 5AA9A 2OI4X 4AZEA 2QONA 3Q96A 3FBVA 2UW4A 3ANRA 3H9RA 3QD3A 4QMSA 4R5SA 5L6PA 4K11A 5LCKA 2R64A 4CRSA 4DGGA 4CKJA 3PIXA 4FZ7A 2IW9A 3RJCA 5KE0A 1MP8A 3FV8A 4MYGA 3DLZA 3L9LA 3V5LA 5LMKC 3OBGA 5JRSA 4C4HA 3IOPA 4FKSA 4GUBA 4R1YA 4M67A 3R8VA 4ACDA 2YCSA 2PVHA 5AP2A 4FSNA 5AP5A 3UMWA 4F63A 4CCBA 1XBBA 1I09A 3R1SA 4FIIA 3MGYA 4UV0A 4S33A 3UP7A 1Q4LA 2YLEA 3DK6A 5CLPA 2XZSA 3D5WA 3T3VA 4JNWA 4NH1A 4CCUA 5F20A 4L3JA 1Q61A 1RE8A 2HW7A 4LMUA 2CCIA 4YJNA 4F0FA 3FEGA 3MY1A 2X1NA 4RJ3A 3LFFA 4QMUA 3WZUA 4PL3A 3ACKA 4BYJA 5GJFA 2PZPA 3W10A 3RI1A 1Y8GA 3TI1A 2RKUA 2HXLA 1Q24A 2C5XA 4ZJJA 4O84A 4JRVA 3HDNA 1JKKA 4EOPA 2I7QA 4C0TA 4K0YA 4EH3A 1M14A 5EYMA 2BDJA 1U5RA 3EQCA 5HTBA 4BRXA 2PUNA 2IWIA 4F0IA 2FB8A 4WHZA 4WRSA 3V01A 5CQUA 4RJ8A 4AN2A 1FOTA 2O0UA 4ZMFA 4I20A 3PA3A 5DOSA 3HV5A 5ANDA 3ZSGA 1Y6AA 4EQMA 5CU0A 1T46A 3HP2A 4W8EA 2R3PA 4HYUA 3WOWA 3R9DA 2Z60A 3PVWA 4FSYA 3ZLYA 4R78A 3I79A 3VJNA 4NYEA 5HTCA 3PLSA 4PDSA 5I9WA 3QU0A 2WTKC 2QOKA 3PZEA 3RCJA 2HZ4A 1PRYA 2UVZA 4J97A 3B2TA 3UVQA 4E6CA 1YDRE 3W2SA 1UA2A 3DBQA 4XG9A 3TTIA 4F6SA 4XG8A 1BUHA 2PVFA 2P3GX 2C3JA 3MFRA 4MEDA 4UYAA 5TT7A 3RK9A 3ZBXA 3NYXA 4KKGA 3S0OA 4B8MA 4F08A 2GDOA 3GQIA 3QALE 5JN2A 3LCKA 1AQ1A 3GC9A 4YJPA 3R8LA 3C51A 4NM3A 1VR2A 4XLVA 2WMVA 4ANLA 4GMYA 2HK5A 2X6DA 3DNEA 3R83A 3DDQA 5AR7A 5AUXA 4QP7A 5EYKA 5J79A 1M2QA 4ZSLA 2RF9A 1CM8A 2QU5A 1OPJA 3KY2A 3FQSA 3MFTA 3RVGA 2OXXA 2WU7A 2EUFB 3NNUA 4HYIA 4XV3A 3UYSA 4ENYA 2GCDA 4YU2A 2IJMA 3UO4A 5D7VA 4I92A 4CMUA 4FV9A 3VIDA 4AZSA 2LAVA 3QBNA 4O0XA 5HNBA 1REJA 5I5ZA 2NNWB 3LQ3A 3R71A 3R28A 4G3CA 3AD4A 3VBTA 3Q5ZA 2V62A 3AD6A 4X3FA 4QMOA 4RFZA 2HCKA 3CC6A 4KABA 4RJ4A 4FKUA 4BKYA 2XCHA 2XJ1A 1M7QA 3Q4UA 4LOOA 4GW8A 4QYGA 5CT0A 3TZ9A 5AP7A 3T9TA 4FT5A 3ZHPC 4ZAUA 4BDHA 4GIHA 4O0VA 3NEWA 5EI8A 3E5AA 4FGRA 2PYWA 3ZFYA 4EH4A 1NVSA 4CTCA 2ETMA 3KRXA 3EQDA 4EK3A 3UZRA 2QO9A 3SRVB 4NJDA 5KKRB 3PSCA 4JDHA 3RINA 4I5CA 2RG5A 3LLTA 2XYNA 5FEDA 4FZFB 4BCKA 3ZM9A 4PY1A 3Q6WA 3G0FA 1PMUA 4FTUA 5JFSA 4ZEGA 3LZBA 4KIPA 3FMMA 5FTOA 3R7VA 2F9GA 1M7NA 4RQKA 3SVVA 2XK4A 5T3QA 2F7XE 1W98A 4Y73A 3EN7A 3EFWA 1ZMWA 4FTMA 3SQQA 4BCFA 2WMRA 1CKIA 3BLRA 3AGMA 4E6DA 2CPKE 5BX0A 2UZTA 3DQWA 1QPCA 1ZMUA 3OP5A 3LW0A 4PPBA 3NSZA 2XF0A 4R8QA 3PG1A 3BBTB 3GT8A 4JX7A 5BMMA 3HMNA 4UMUA 4U5JA 3QA8A 1OBDA 1FVTA 3QC9A 3G5DA 3F3TA 1OIRA 2GNFA 3RPOA 1OM1A 4GV1A 2W1IA 2X81A 1IA8A 5ICPA 4LQMA 3D5XA 4DFBA 2RFNA 5EDPA 5EM5A 4YHTA 4HW7A 2GS7A 2CKPA 4OT6A 4U7ZA 4FTQA 3VQHA 2QKWB 5FD2A 4R7BA 3UIXA 5BUJA 3G0EA 4EOKA 4LL5A 5JSMA 1U54A 2R2PA 3NUYA 3ORXA 4GK2A 5D7AA 1WBPA 2EB2A 4QT1A 3R7IA 4Q5HA 3LMHA 1KE8A 1XO2B 5CT7A 5GZ9A 3WBLA 3MN3A 2UW0A 3QCQA 4LV8A 4EZ5A 1WZYA 2GHGA 3GC8A 4F1MA 4D1ZA 3ZXZA 4FKVA 3TNPC 3UIMA 3FXZA 3WF5A 2P33A 4CG8A 5I3RA 5A9UA 2J9MA 4D5HA 4Q9ZA 4M84A 5HG8A 3VS1A 3AC4A 3DCVA 1Q97A 2XCKA 4FV3A 4YBJA 4DTKA 3IS5A 4D58A 4P5QA 3H4JA 3PXYA 3UODA 5LXMA 4QNAA 3QKMA 4NU1A 4F65A 4IM0A 3E93A 4NIFA 4UWBA 4BDKA 4DAWA 3G33A 5G1XA 5JT2A 3E3BX 2C0IA 2ZDTA 3PP0A 3IECA 3D14A 3FLYA 3ZRMA 3D2IA 2EXMA 2NO3A 4I23A 5ANJA 5F1ZA 3W2OA 5ETIA 4UEUA 4K18A 4O2ZA 4KUJA 4PMSA 2I6LA 3EQIA 4FV8A 4XHKB 1LPUA 1KWPA 3BPRA 4IFGA 3VW8A 4DH7A 4P5ZA 2OH0E 5A3XA 5KZIA 3QWJA 2P55A 2W9FB 1H27A 2FSMX 4F9YA 3KEXA 3RM6A 3UC4A 4C61A 4O21A 3LFQA 4F0GA 5M51A 4N70A 3ZOSA 4AE9A 1WMKA 1EH4A 4XG2A 2OIQA 5IEXA 4HCTA 4QP2A 2YWVA 4HOKA 3I5NA 4APPA 3E62A 2PSQA 4F64A 2W9ZB 3UOKA 3FE3A 2QOBA 2BZKB 2R3GA 2ETRA 3BKBA 3CQUA 5EM7A 1J91A 5DT0A 3G15A 3ITZA 3O50A 3FLQA 3FUPA 3PRFA 3QTQA 4X3FC 1M17A 3PY1A 3QF9A 1G8AA 1P14A 1ZXEA 3EB0A 5HBEA 5J8IA 3ORMA 4L43A 4S2ZA 3GC0A 4RVKA 2J0IA 1IA9A 3OEZA 4AWIA 5IDNA 5B2KA 3P4KA 4ZY6A 4U45A 4O96A 2C1BA 4ANOA 2G9XA 2F57A 2GS2A 3RPYA 3VNTA 1A48A 3UIBA 4E4LA 3NUXA 1YXSA 4IBMA 2E9NA 4O0UA 1UVRA 1OKVA 4FC0A 1YOMA 4NW6A 5IDPA 2OICA 4S34A 3PPJA 3ORLA 1OIUA 2W1HA 4JBVA 4GT5A 3RAIA 3MY0A 4YZMA 4I6QA 5E8TA 1PMEA 3RBWA 2WMQA 2FVDA 2UZDA 4TL0A 4XYFA 3CQWA 2B9HA 4C4GA 3OWLA 4NL0A 4IIRA 2X4ZA 3QRTA 1S9JA 3A99A 4TN6A 5FP6A 4ERWA 4ZSAA 4C3PA 4EOIA 4B7TA 1OKWA 5L6OA 3MW1A 4I6HA 4OTIA 4IMYA 4CFXA 3LXNA 2B9FA 1K2PA 1TQIA 2Z8CA 5KBRA 2W4JA 3DJ5A 3RK7A 3JY9A 3FMEA 1ZYJA 3UTOA 2JLDA 2PVMA 3QGWA 1JVPP 3OTUA 2A0CX 1BI7A 4YZ9A 2UZEA 4FSUA 3D15A 4CEGA 3WARA 5M4FA 2J90A 4RZVA 5AR2A 4FL3A 2PVKA 2X8DA 4JQ7A 4NEUA 4BVUA 3VRZA 2B54A 2J0KA 4IAZA 1M2RA 3HL7A 5AUZA 4MD8E 3D94A 5FG8A 3RPSA 5LQFA 3BYVA 4EC8A 5L2TA 2B9IA 2C69A 2Z2WA 3A60A 3EKKA 3OZ6A 3PY0A 2B1PA 2YA9A 2P4IA 4LOPA 4D4RA 5HNIX 5HU9A 3AD5A 3C4WA 2UZNA 4JBPA 3WF8A 3NNXA 2WHBA 1RDQE 3BHTA 3E7VA 2XUUA 1JSVA 5B7VA 2ITTA 2WAJA 4FV6A 2XK8A 3MH1A 3TV7A 5EFQA 2JITA 3S95A 4Z9LA 2W1EA 5ANEA 3W2RA 4ANSA 4UALA 4AZWA 1ZZLA 4TWCA 3TV4A 5ITAA 4I4EA 2YISA 5KMNA 3E8NA 3LFDA 4FTLA 5CI6A 5IF1A 3P78A 5M08A 2QOHA 4KIKB 1OITA 5C4KA 4BIBA 1OVEA 4QP1A 2W4KA 2UUEA 5TO8A 5J9YA 4C8BA 1XHAA 3OWPA 4U9AA 2XK7A 5GNKA 3DJ6A 2G1TA 2O63A 1U46A 2XNGA 4P7EA 3SXSA 5A4EA 3KMUA 2WTDA 4KSQA 4UZDA 4YJOA 3VJOA 4IVBA 4IX3A 2CKQA 3GCPA 5IQIA 3HV3A 3ZLWA 4PX6A 3I5ZA 3D5UA 3UPXA 5DT3A 4CFNA 1OUKA 4BKJA 5C03A 3ENHA 3OOGA 2XKDA 2RSVA 2JGZA 2X9FA 3FL5A 4BL1A 3EWHA 4O0SA 1GIJA 1MQ4A 2FGIA 2ZV9A 4O1PA 3VULA 4YZCA 3MDYA 4R3PA 4F1TA 5HE0A 1ZWSA 4AT5A 5DWRA 4RIXB 3TXOA 5HVYA 3OXZA 4F7NA 2W96B 4N6YA 4X0MA 5L8JA 5IH4A 2VO3A 2AUHA 1Q8WA 2ZV7A 4FMQA 3LFCA 3TWJA 4FNZA 3ERKA 4L6QA 3ZUVA 3BE2A 3HLLA 1QCFA 3P08A 4DGLC 1FBNA 3TIYA 2VX3A 1YI4A 3ZDIA 4F7JA 5AAEA 3NUAA 2X7GA 3NLBA 3HRCA 5IQCA 1WAKA 4K9YA 4J1RA 3DAJA 4F9BA 4TY1A 1SYKA 4QMQA 2OXDA 1GAGA 4A4OA 1J1BA 3GBZA 3H9OA 1MQBA 2RG6A 1OL5A 3OROA 4IJPA 4FZDB 2H6DA 3V6RA 4FIGA 4C38A 3RAWA 4RVMA 5IA5A 2UZWE 3DTWA 2WQNA 4EOOA 1WBWA 3FMDA 3MH2A 1T45A 5TKDA 4FV4A 4HGLA 3DKGA 3RP9A 2BPMA 2Z7LA 2EXCX 4OTQA 4RC3A 1H4LA 2O65A 3U4WA 1VJYA 4AGDA 1RW8A 4U41A 3AMAA 5AV4A 4QQTA 2VO7A 4BDEA 2HWPA 2WTVA 2GS6A 5HU3A 4R7HA 3N4TA 3CKXA 2XIZA 3GFEA 1XH6A 3R22A 4FVPA 4WUNA 3RWPA 4CLIA 4CYIA 4QTDA 3KXNA 3AGLA 3C5IA 1R3CA 4FEVA 2IVVA 3OBJA 4AS0A 3Q9XA 1GZNA 3QFVA 4E5AX 3ZBFA 3PWYA 1GZ8A 5JQ8A 4B9DA 3N4VA 4QYEA 3EMGA 5AM7A 5J87A 3WILA 4ZY5A 2IVTA 2FSTX 2Z7SA 3VO3A 4IC8A 4E1ZA 4DBXA 3SXRA 5EDRA 4QYYA 1QPEA 5L6WL 5K4IA 2HW6A 3PA4A 3QTXA 4DG2E 2C0TA 3AXWA 3QUEA 1NY3A 3Q2JA 5FDPA 2OIDA 3DKCA 5C01A 4CV8A 5ANKA 3DAKA 4NWMA 1U5QA 4QTAA 2ZB1A 4DE4A 3HGKA 4XBRA 5CU6A 3VF9A 2GQGA 2CNVA 5JQ5A 4BDFA 3P7AA 5AX9A 4JDIA 4I22A 4JIKA 2QOQA 4HZSA 4CMOA 5BYYA 5DI1A 5DRDA 3WF6A 3MPMA 1JAMA 2H8HA 1RQQA 1OECA 2XEZA 2WMBA 3QUPA 4FKTA 3B8RA 5HKMA 5A14A 3A2CA 4BZDA 4YLKA 4A9TA 2ZM4A 3ZFXA 3KF7A 4MAOA 4GVJA 2XA4A 4MXYA 5HEZA 2VNWA 3R2BA 3PXZA 4QRCA 3A62A 4ASZA 2ITOA 4R7IA 1TVOA 3R7EA 2YERA 2BIKB 3F3VA 3PSBA 4LI5A 3DBFA 1XKKA 5CI7A 5J7HA 2VTOA 2YZLA 3L9NA 4QMYA 4RPVA 4ANMA 4ZZNA 3VBQA 3E8DA 3R1YA 4ACCA 3OCTA 3OS3A 2P0CA 2UZOA 3HNGA 3NCGA 4NUSA 3VUHA 5IA3A 4FNWA 4S31A 2W1FA 1MRUA 2XRWA 2HELA 3KF4A 3MPAA 3BZ3A 3R30A 4MWIA 5DR9A 4G9RA 4AN9A 1UWHA 2ESMA 1FINA 2BRGA 3NYNA 3V5TA 3TUCA 4AZVA 2X4FA 2W5AA 5ANOA 3F61A 3T9IA 1OL7A 2R5TA 2BFYA 4E8AA 4FF8A 5EK7A 4D1XA 4EK8A 2ETKA 2GQSA 3A7FA 2C3IB 1ATPE 1CKJA 4TWPA 5BUIA 4MQ1A 3G6HA 4AW1A 2X39A 1FMOE 5J1WA 4UBAA 4EUUA 3O0GA 4C57A 1M52A 3U54A 2XS0A 4N6ZA 4EJ7A 4MXCA 4RIWA 4YPDA 4F99A 2VGOA 5K0XA 3WF9A 3F2AA 4FE2A 5AR4A 2W1GA 2XBJA 4FSWA
chains in the Genus database with same CATH superfamily
2JFLA 5EHOA 5EI6A 4EOLA 2VX1A 3Q6UA 5HHWA 4E4NA 3BLAA 3UG2A 1PXNA 3GU6A 3CGOA 5CXHA 1NT2A 3DA6A 3PIZA 4FKJA 3MB6A 3FMNA 2XKFA 2J51A 2QG7A 4DYMA 3BHHA 1WVWA 4QPAA 1BKXA 2BRNA 3GFWA 3GP0A 4X2JA 4K6ZA 3RGFA 2ERKA 3VF8A 3A7HA 4CT1A 3QHRA 4IC7A 5HI2A 5L8LA 4ACMA 3UQCA 5HLNA 3BU5A 1OGUA 2B55A 2A4LA 4BCQA 4XV1A 4OAVB 3LIJA 3E92A 3F69A 2PY3A 3O23A 4FT7A 5ETCA 4QMZA 5J5TA 4I6FA 3EL8A 3TM0A 4MKCA 3FQEA 4I1ZA 3COIA 5E8XA 3TUBA 2VTTA 2YHVA 4AOJA 3PUFC 2R3RA 3C0IA 3L9MA 4C36A 2BRBA 2VTSA 5HX8A 3MFSA 5I9VA 3UG1A 3O96A 2AC3A 2OH4A 4H3BA 4C4EA 3Q4TA 3TNQB 3HMIA 3ZFMA 5CVGA 4E4XA 3AKKA 1STCE 3OXTA 2WELA 3BIZA 3KGAA 4HNIA 4J99A 3DNDA 5GZAA 4IZYA 2XK3A 3FSKA 5ETFA 3UVRA 5E8VA 3GI3A 3FZSA 2OLCA 3LE6A 4L42A 1Z57A 4DITA 4PMMA 3DB6A 5HIBA 3CD8A 1DI9A 4JDJA 4QQJA 2JC6A 3R04A 4L7SA 3UNKA 2Z02A 4JL9A 5CSHA 4EH5A 1YW2A 3OY1A 1W2DA 1JKLA 1GZOA 2WMTA 1W82A 4I3ZA 5FM2A 4BTJA 3O71A 4EYMA 4ZY4A 2IVSA 3MB7A 2BUJA 2BHHA 3VS5A 3R0TA 5A46A 4WD5A 4FKLA 1PXLA 4RC2A 4EUTA 4RA4A 2VWYA 3LFNA 3NS9A 4BTKA 2IF8A 2YM6A 4C3RA 4C59A 3RPRA 4BB4A 3CXWA 2R0UA 2GFCA 5HO6A 3FZPA 3ZO2A 4L3LA 4RSSA 4MXZA 4TPTA 5IH5A 4IACA 4X3JA 4YC3A 1DS5A 4U8ZA 5JFVA 3QHWA 3QTWA 4IWPA 2ZM3A 4ZTLA 4FTJA 4Q2AA 5HG7A 4JR3A 4XRLA 1XH7A 4AXDA 1SVGA 2PVLA 1XMLA 5L2WA 2I0EA 5E1EA 2XNOA 2X7FA 4NK9A 3ZUUA 4C34A 4F4PA 1Q41A 4MXOA 2R7IA 5CY3A 1UU3A 2YN8A 2YZAA 4G3FA 5HZNA 4ZMEA 2YIRA 4IFCA 5DR2A 4DA5A 2ITNA 3G90X 4MBJA 3QWKA 4F9AA 3ZDUA 5LWMA 1W0XC 2VWZA 2IW6A 1Q3WA 4WG5A 5HGIA 1ZY5A 1GY3A 4Z7HA 4GRBA 5A4LA 3BYSA 5I4NA 4EK6A 4MXXA 2VUWA 4E6AA 5LVPA 4AGCA 3HAVA 3ULZA 2E9OA 3TACA 2FSOX 3OG7A 4H3PA 4I93A 3QQJA 4Q9SA 1NW1A 3VONA 5LMAA 2WTKB 4YZBA 4H1MA 5H2UA 4G3DA 3QXPA 1Z9XA 4EH9A 3SDJA 2BKKA 3MVMA 3C5UA 4EHEA 4MCVA 4JAIA 3ORIA 5EYDA 4EC9A 5CWZA 4RX9A 2I0YA 2ITYA 3JUHA 5AX3A 1K3AA 5DRBA 3UVPA 5JEBA 4LDTA 5CYIA 3F3WA 4O2PA 2VTRA 4EYJA 4O7YA 5AIKA 3FYJX 1H25A 1GJOA 4GU9A 4TYHB 4QPMA 4HGTA 5IMEA 5TR6A 2UW6A 4EOSA 1OPLA 5K0KA 3GU8A 3L8XA 5DYJA 2CCHA 4OTRA 2X0GA 2WD1A 2I1MA 4XV9A 3GB2A 4KINA 2OSCA 3OUNB 3ZH8A 4MXAA 4TTHB 4CKIA 2YFXA 3ZSHA 5K4JA 4G34A 3AMBA 3UDBA 3ORPA 2KTYA 3IW5A 5DA3A 2HOGA 2Q83A 4FODA 4I6LA 4UZHA 4YNEA 4WG4A 1JWHA 1ZZ2A 2WB8A 4FG9A 5CF4A 1ERKA 4BWKA 4R77A 4O7VA 5C8MA 1JKSA 5T6KA 2JIUA 3QUDA 3RAKA 3CJGA 4YC6A 2BTSA 4TZRA 3MA3A 4EOMA 3F2NA 2YABA 4V0GB 4YJSA 4NSTA 5IPJA 4G6NA 5JZJA 5HESA 2YDIA 2W1ZA 2C1AA 2BHEA 2R3QA 3DB8A 3EHAA 4L44A 4O27B 2QHMA 4RWLA 4USDA 5AUYA 3U8WA 5KHXA 2X7OA 4GG5A 5E8UA 2VTQA 1UU7A 4PUZA 3C0GA 4BGGA 4JT3A 2C6IA 4MNEB 4BBMA 5HE1A 5AR3A 1A9UA 4CNHA 4LUDA 1DI8A 1MRVA 3NIZA 3TZ7A 2OFVA 3OEFX 3W2PA 5FXRA 2YITA 3HP5A 5TOZA 4EQUA 3SGCA 4CFWA 2B52A 4MH7A 4Q5EA 3P7CA 3R8PA 1FMKA 5H3QA 3HKOA 4O38A 4DEHA 4DHZA 2QODA 1E9HA 4FR4A 4GYGA 4PTEA 4AUAA 4BI2A 2CLXA 4C2WA 1L3RE 5ACKA 4UMPA 3O5AA 3O8TA 4O7NA 2Y6OA 2YM4A 4RWIA 4UXQA 2XP2A 4M69B 3D7TB 5IA4A 1BYGA 3OT3A 1PXJA 3QZHA 3GCSA 5CX9A 5H9BA 3QLGA 4FK3A 3MTFA 5CAVA 5IQBA 3FLSA 2VU3A 3FHIA 4ZTRA 3Q60A 4DEEA 3HV7A 2J4ZA 2R3IA 2WO6A 5J5SA 4ALWA 3CKWA 3HAMA 1J1CA 3LQ5A 5T68A 5CSWA 2OBJA 2PZYA 3DPKA 3FAAA 1ZYCA 3IGGA 2J0MB 5DHJA 4E3CA 3POZA 5HVKA 5AUTA 5IUHA 4CT2A 3FKOA 4G1WA 3NUUA 3NZ0A 4FEQA 4IB3A 3BWFA 4BN1A 4ZIMA 1CTPE 2WQOA 2XIXA 3CBLA 1BL6A 3NNVA 4RFMA 4PF4A 4PDYA 4AZFA 4G16A 4RQVA 4YJTA 3N51A 1ZLTA 3RALA 4ZSEA 1H26A 4BZOA 2WZJA 4DEGA 4BHNA 1OMWA 2XNEA 3R21A 4U97A 4D2VA 3CQEA 3JVSA 4DLIA 3TMOA 3P23A 3TYKA 4B0GA 2XIKA 3AT3A 4JLCA 2XK9A 3UZPA 3BELA 4Z55A 5L3AA 3U9CA 2YM8A 2QKRA 3SV0A 3UOJA 1HCLA 4KBCA 3PRIA 3UE4A 3LCTA 5JRQA 1Q99A 4HPTE 4E93A 3IW4A 4KIOA 4AGWA 3U6HA 3FMJA 4EOJA 2OF2A 2YDJA 3ORZA 3HYHA 3WZDA 5A4TA 2JDTA 2QVSE 3IDPA 4RBLA 1H1SA 4TYJA 5KMJA 4H36A 5HO7A 4FVQA 4AW2A 1SVEA 4S32A 3UGCA 4OAUC 5EKOA 3MTLA 4WBBB 2FO0A 4IZ5A 2E9VA 3NPCA 3R9OA 1KV1A 3NW7A 4HCVA 3TZ8A 1KOAA 3NW6A 4AE6A 4Z3VA 2J5EA 4AA5A 3GVUA 2A1AB 4IDVA 3MJ1A 5TF9A 3CP9A 4ZTMA 2IZSA 3ZEWA 3ZRKA 1XWSA 2C5YA 4LL0A 3KREA 2PVJA 3Q4CA 2WOUA 3CPBA 2Y9QA 3DOGA 4BCMA 4F1OA 2CJMA 3ELJA 1ZOGA 4R6VA 4ZSGA 3S2PA 5JFWA 4LMNA 4C02A 3PPZA 4M68A 2VTPA 4I4FA 4YO6A 1JSTA 2ZM1A 3DS6A 3UO5A 3CTJA 2JKQA 2R9SA 3BLQA 3GNIB 1BMKA 4XG6A 3SX9A 5EG3A 2EU9A 1W2CA 3UPZA 2VAGA 4X2GA 1VYWA 2WEIA 3OTVA 5AV1A 3D4QA 3RTPA 3G9NA 2CNQA 3EFLA 4Y5QA 1YVJA 4X3FB 2J5FA 4IX6A 4EHZA 3AT2A 4ZOGA 5IQGA 3K5VA 5IQAA 4O91A 3FKLA 2YIWA 5HO8A 2XEYA 4GCJA 3HUBA 4AA0A 4CFFA 4JBQA 2GNHA 1Q62A 1P2AA 3QQUA 4RJ7A 1PXPA 3R8ZA 4I0TA 5KKRC 5J9LA 5A6OA 5B2MA 3EFJA 3OY3A 3TDVA 1UV5A 4GKIA 5C4LA 3S3IA 3AT4A 3ZO4A 3EZRA 5KNJA 2YIXA 3L8PA 5FUTA 3WZEA 4BDIA 4JI9A 4BDAA 4ZTSA 4IWDA 2B4SB 4G3GA 5KX8A 5ANIA 3EIDA 3W2QA 3MV5A 4FSRA 4HVIA 2OWBA 3ORNA 3PVUA 4CXAA 3CTHA 4ZSJA 1YKRA 5LVMA 2WOTA 3OVVA 2ITQA 4XP3A 3R01A 3ODYX 4XCUA 2VWXA 1Q8UA 5J95A 4MVFA 3S1HA 1SNXA 3BE9A 3VUTA 4H05A 4BTFA 3K5UA 1V0PA 3NWWA 4JG7A 4NCTA 4RIYA 4E5BA 1OBGA 2YM3A 1CMKE 4AF3A 2XRUA 2XANA 3FDNA 2C6MA 3RAHA 2A2AA 4O7ZA 4IANA 4U3ZA 4L9IA 1RJBA 4UMQA 3ZTXA 2GTNA 5EYCA 5BVOA 2X2LA 4W9WA 2C30A 3GXLA 3LOKA 4O0WA 4OBOA 2IPXA 2W06A 1PF8A 5GJGA 3LKMA 1QMZA 2C6EA 3SW4A 4MX9A 3V3VA 4A9SA 1O6YA 5BYLA 2OJFE 1V1KA 2HENA 1FPUA 1JQHA 1XH5A 3K3IA 4C3FA 3C50A 3BEGA 1H0WA 4TRLA 4AQCA 3PVGA 2UW5A 3D2KA 4ITJA 3FI4A 4AOTA 3LFEA 4V04A 2C47A 4RJ5A 5LARA 3DXQA 5FTGA 4CSVA 5FBNC 3LHJA 3C13A 1Q5KA 4NW5A 4IAFA 3LFBA 3I7BA 1IASA 2JKKA 4KIKA 5CVFA 1K9AA 3R7UA 5EKNA 4EWQA 1REKA 4QPSA 5IKWA 4D9TA 4QMWA 4DFUA 2HZ0A 3W16A 3NYVA 5AV2A 2HWOA 4FNYA 3W18A 2W1DA 3NUSA 3KIOC 4IWQA 3WE8A 4EH8A 4FI1A 4JBOA 4U40A 5HVJA 2DUVA 3EQPA 4MBLA 5AP4A 2PVRA 2PZ5A 3B2WA 3FXWA 5BUEA 4O83A 3SG9A 4QP9A 5FEQA 5ETAA 4I21A 4D4SA 3E88A 2YEXA 3C7QA 3FLNC 3R7YA 3RCDA 3KRWA 4HNFA 4UWYA 2F49A 4O4EA 1PJKA 2WMUA 3BYOA 3QQFA 3FI3A 1KSWA 4N0SA 5F9EA 2IZRA 1FVRA 4PMTA 4BGHA 1G8KA 3U87A 4NIFB 1W84A 3WZJA 2F2UA 4ARKA 2WMWA 5FEEA 3ZYAA 4RIXA 1WVXA 4NKAA 5I9UA 5DLSA 3QRUA 3RNYA 4OBQA 3RZBA 1BX6A 3V8TA 3DT1A 5I9XA 3GEQA 3DKFA 4DHIB 2WEVA 2J7TA 3BGPA 1OI9A 1SM2A 2OGVA 2WPAA 2Y4IC 4L53A 1U59A 2X8EA 2C3KA 4X7QA 1V0BA 3KXGA 4YHFA 5J7BA 1M2PA 4OTGA 4JRNA 3CE3A 4CTBA 5BYZA 2YJRA 4WNOA 3GOKA 4HYSA 3UP2A 4A06A 3KK9A 3ZLXA 4HPUE 2WQBA 2WTJA 2YM5A 3CEKA 3EN4A 5EQYA 2XVDA 1JSUA 1UKIA 4FG7A 1G8SA 2YAKA 5CASA 2GTMA 3A8WA 4G5JA 4M66A 1ND4A 5LCJA 2RFEA 2WMSA 4DG3E 3VAPA 5A54A 4FL2A 1Y8YA 4QMTA 4X2NA 4CV9A 4YJQA 3QTUA 4DFNA 2J6MA 3JYAA 3D5VA 3KXXA 3AC3A 3ROYA 1DM2A 2OZOA 4AT4A 5AP1A 4X21A 4PQNA 3QL8A 2WQEA 3CLYA 5BVDA 3PIYA 4PWNA 2NRUA 4DCAA 3ZONA 4YJVA 3BV3A 4U81A 3ZO1A 4QTBA 1PHKA 1WBVA 1R0PA 2W4OA 5L2SA 4J98A 5HTIA 4FUXA 3OUKA 4E26A 3QZFA 5CAOA 3PLAE 3MJ2A 5CEIA 1URWA 4OTDA 2WMAA 4FYNA 1PMVA 4FA2A 4BCHA 4FTNA 2WTWA 3PP1A 3UNJA 2W5BA 4APCA 5M4IA 1PXIA 1YXVA 2ZDUA 4AFEA 3R7OA 1XH8A 5CS6A 5L8KA 4XP0A 2PK9A 1AD5A 4Y85A 1JKTA 3FZ1A 4JIAA 2OW3A 1YDTE 4JG6A 4UB7A 3UDTA 1KE9A 2OK1A 4FIHA 4TYEA 5AADA 2WMXA 3DV3A 3A7IA 3OW3A 4NCTC 2IZTA 2QO2A 3PPKA 4FV7A 4EKKA 4USEA 1VLRA 3BV2A 4AP7A 4YZDA 3V8SA 4O6EA 1UU9A 3KKVA 2PMNX 4KD1A 5CXZA 2CN5A 2ZJWA 3HZTA 4WG3A 3JR1A 3TDWA 3W55A 1FGIA 2HXQA 2QCSA 2WIHA 3FL4A 5HBHA 2BMCA 3NAYA 4QMLA 4XG4A 3ZSIA 4UN0C 3BX5A 5DBXA 2J0JA 4ASDA 4D2TA 1OL2A 2QOLA 4Y46A 4Y83A 2BZHB 2IO6A 3OF0A 3OHTA 5AAGA 1P4FA 3MVHA 4AN3A 4CVAA 3HV4A 5CALA 3P86A 5HCZA 1CDKA 5IQEA 5KCVA 4ZP5A 5AR8A 5CF8A 5IA1A 4ZS4A 1JPAA 4G3EA 5LMBA 5LWNA 4BCOA 5FTQA 2C5NA 4XLIA 1HOWA 4KB8A 4DFZE 1ZARA 2FH9A 4ZJIA 3BEAA 3ANQA 3FC1X 3GOPA 4H3QA 3WYXA 4DLJA 1IR3A 3P5KA 3QD4A 1YRPA 3I81A 1GIHA 2X0QA 2FA2A 1OL1A 4DCEA 1LP4A 3HMOA 4GJ3A 4IB0A 4QNYA 2PHKA 4BBEA 4QYHA 5HG9A 3HRFA 3ROCA 2VTLA 4UYNA 4DDIA 2JKMA 4IH8A 2V0DA 4K8AA 3IO7A 4DN5A 3NGAA 3LMIA 4FSQA 5KUPA 4ZTHA 5FBOA 4I5MA 5K9IA 4QEBA 2GU8A 4P4CA 1YXXA 3COHA 4DFLA 4EZ3A 2ITUA 3ZO3A 5C8NA 1P4OA 2X8IA 4MBIA 5DPVA 4XG7A 5HD7A 1H07A 4ITHA 3FC2A 5CAPA 2AC5A 2XK6A 4HVDA 3FMHA 5KMLA 2V5QA 4AG8A 3BYMA 3IW7A 3V5PA 4B99A 2JDSA 3EN6A 4X2FA 3POOA 4M3QA 5FDXA 1PXOA 2BFXA 2OFUA 4FGBA 4U6RA 3R9HA 4WKQA 4EHVA 3E7OA 1H1WA 1YHWA 1IG1A 4FV5A 4GIIA 5JMSA 1OB3A 1OZ1A 5IQFA 4QD6A 2X0OA 4DGNA 3ALOA 4ERKA 5IUGA 2HZIA 2GNLA 1KOBA 3ZC6A 4WO5A 2VTMA 4WSQA 4O82A 2AYPA 5CAUA 5L2IA 2R3LA 1NVQA 2PE0A 3NR9A 5CEQA 5EQPA 1SMHA 5AR5A 5IEVA 3S4QA 1URCA 4U44A 1W7HA 2VZ6A 2G15A 3PDTA 3QTRA 2X9EA 4FT9A 4IXPA 2WU6A 4BKZA 3FKNA 4UMTA 1YI6A 3EQRA 1XH9A 3BQRA 2ZOQA 3DLSA 4ID7A 4YSJA 4IAIA 4EK5A 2OZAB 2UZBA 4MF1A 4PMPA 1JLUE 2V55A 2ZYBA 2VO6A 2XJ0A 3L8SA 4W4XA 3EN9A 2VD5A 3FI2A 4NM7A 4W9XA 2BIYA 4DH5A 2C6OA 4GH2A 2YIYA 4CZUA 2R3KA 4C4IA 3R6XA 2XIRA 4MK0A 3K3JA 5AP0A 3F7ZA 3V6SA 5KMMA 4NTTA 2V7AA 3ZU7A 4OTPA 2BVAA 3TTJA 1P5EA 2HYYA 3KXHA 4ZTQA 3KVWA 4JMQA 1BI8A 1B39A 2XNPA 2JBPA 3QCYA 4BI1A 2G2IA 2R3FA 4I41A 3VUMA 2XJ2A 4EKLA 3KN5A 2VWUA 2WTCA 4FV2A 2VWBA 3EYGA 3F3UA 3OC1A 5H8BA 5DT4A 2AEGA 4FEWA 3KA0A 5D10A 3TJCA 3HDMA 3KMWA 3Q4ZA 3I6UA 3Q3BA 2VNYA 4FSZA 2ZAZA 3VUIA 2QNJA 4H58A 3SKCA 5HIEA 2YCFA 2JBOA 1DAYA 4RX7A 2ZV8A 4K77A 4O7RA 3UBDA 3C4EA 3VW6A 4BZNA 5HIDA 4Y95A 2XYUA 3V04A 2ZVAA 1KE7A 3SW7A 4ITIA 4YSMA 4ZTNA 2C0OA 5AV0A 4CLJA 4EWHA 5HLPA 4D0WA 4Y72A 3LXKA 3R1QA 4AGUA 4YGAA 4M7IA 2AQXA 3P0MA 3UIUA 2BILB 4G31A 4OLIA 5HBJA 4O6LA 1YWVA 3VQUA 4DH3A 2O5KA 3MYGA 5HORA 3MIAA 3MESA 4DF3A 1S9IA 2R3OA 3BYUA 3DDPA 4D55A 4QDEA 5M44A 2Z7QA 4FL1A 3L1SA 5LVOA 5CU4A 2R4BA 1IEPA 2BR1A 4K1BA 3SHEA 4D4VA 4F9CA 3KU2A 3P1AA 4O4BB 3M42A 1YXUA 3KULB 5DNRA 3P79A 4K33A 2R3NA 5E8SA 5IH6A 4IZAA 1GZKA 3VUDA 2QG5A 4BDGA 2NPQA 5DGZA 2ITVA 2X6EA 3EFKA 3ZZEA 3ZC5A 4XMOA 4FBXA 5DR6A 2J2IB 3MPTA 3QTSA 4J96A 2CMWA 4WNPA 3NMUF 5CEKA 3MIYA 3P7BA 1SVHA 3QRJA 4W4WA 4HYHA 3R1NA 1MRYA 4YJUA 3D7ZA 1LUFA 3LAUA 4HGSA 3BL9A 4IAAA 5FXQA 3OOMA 4S30A 2UVXA 1X8BA 2H9VA 4FKIA 2QOOA 3CCNA 3OCBA 4KRCA 4LFIA 4OT5A 4RIOA 4Z16A 3V5WA 5CF6A 3OMVA 4O0YA 5DVRA 4XP2A 3GQLA 3R2YA 1OPKA 4O0RA 2ONLA 3CTQA 3R63A 4FX3A 1XH4A 1YOLA 4M8TA 4RWKA 4EBWA 3ZCLA 3ACJA 3M11A 3IQ7A 2OG8A 4D2SA 3Q2MA 3PYYA 5CSPA 1J7IA 5CTPA 2CLQA 2OKRA 3FPMA 1A06A 2R3JA 3F6XA 2XIYA 4FTRA 4RIWB 4BGQA 2PPQA 4A4XA 5L2QA 4JS8A 4FV0A 4M0ZA 5DMZA 2R7BA 5F94A 2REIA 2ITPA 2F7EE 2UW3A 3DXNA 2QURA 5E90A 4RRVA 4UX9A 4YMJA 3PE1A 2VGPA 5E7RA 4JJRA 4AXEA 2VTIA 4AQKA 3NYOA 4KA3A 4D28A 3PVBA 3G51A 5D1JA 2C5VA 4BCIA 4L3PA 4V0GA 5CZIA 1WBTA 4OBPA 4ACHA 2Z7RA 5G6VA 2BTRA 4F6WA 1PKDA 4LOQA 4FNXA 4KS7A 4AZTA 2C5OA 4FKRA 2PWLA 4WT6A 3COMA 3OCGA 5E1SA 5GIPE 5DEWA 3CPCA 4YBKA 3VS6A 2BRMA 5FXSA 3D83A 4KIQA 4OGRA 2W99B 4NTSA 2IEWA 2VTNA 3QA0A 3C4ZA 4AU8A 4TWOA 4XG3A 2OJGA 3D0EA 3E8EA 2DWBA 3BHYA 3LCDA 3DK7A 3I7CA 3W8QA 4DT8A 2PU8A 4IZ7A 2QR7A 1PXMA 2Y8OA 3HMPA 4FTIA 1V0OA 4O4CA 2UZVA 3HUCA 3U9NA 3ZXTA 4DDGA 4N57A 4U0IA 4QMXA 5EM6A 4BHZA 4ZLOA 2C6KA 1QPJA 4M69A 3D7TA 4QO9A 4O0TA 4XUFA 4QOXA 3OWKA 1VYZA 4PDOA 5FM3A 4YLLA 3VVHA 3F88A 4L01A 1FVVA 4IB5A 2CDZA 4XS2A 1UKHA 2XNMA 4YNOA 5FLFA 4YR8A 2ZV2A 3H9FA 2BROA 1TZDA 2XKEA 4USFA 5HCXA 4C7TA 5EHYA 2HIWA 3F9NA 4YZNA 4EJNA 4EONA 2QU6A 3Q9WA 1Q8ZA 3VWAA 2CN8A 4I6BA 4FT0A 4ZZMA 1G3NA 2VV9A 3FQHA 2O3PA 1TQPA 2B9JA 2VRXA 3H10A 4ENXA 3FZRA 1UWJA 3SXFA 2P2IA 4GS6A 4J95A 4RJ6A 4AAAA 4Y5HA 1TKIA 1WCCA 3AC5A 3LCSA 5I0BA 3SLSA 3F2RA 3PXRA 3TKUA 2YIQA 3SRVA 2I0HA 3PXQA 3VUKA 5M4CA 3E64A 5D41A 4QMMA 3O7LD 5D11A 4ASEA 1LEZA 4MHAA 4EH7A 2YM7A 4JR7A 5DH3A 3ORKA 5AWMA 4E20A 1JBPE 3FY0A 4W4VA 5ANGA 1GIIA 2PTKA 3LJ1A 2GQRA 4FEXA 3WF7A 5ACBC 2XNBA 4C2VA 5AEPA 1B38A 2E2BA 4RLKA 3QC4A 2R3MA 3Q53A 4IE9A 3PY3A 5HCYA 1CSNA 4FEUA 4BI0A 3DZQA 3EKNA 3TL8A 1LEWA 3W0SA 4QP8A 4ZLYA 3I0QA 4LRJA 3EYHA 5J9ZA 4D0XA 4DGMA 2ERZE 3NW5A 4U42A 2GSFA 4ASXA 3PFQA 2CKOA 3FLWA 3A8XA 2YAAA 1F0QA 2C68A 2G2HA 3RK5A 4AXAA 4O81A 3FWQA 4KS8A 2RFSA 4D2RA 3N4UA 4GVAA 3VS2A 3IG7A 4GFMA 2KULA 1E1VA 4FIJA 2ONLC 2RGPA 4DC2A 4TYIA 4K2RA 4GL9A 3MS9A 2YJSA 2PZRA 3DGKA 3BQCA 4G5PA 5AUVA 3QX2A 4EH6A 2F4JA 4FTKA 5AV3A 3VHEA 3P5JC 2WXVA 4L67A 4QMVA 1OKZA 3UDSA 2PVYA 4PV0A 4A9YA 5M57A 1HCKA 2QOFA 3EJ1A 4BBFA 5C1QB 2BZJA 1H0VA 2EB3A 3O8UA 4IQ6A 1ST0A 2YACA 4DINA 3TT0A 4AXFA 2GNJA 4IVCA 3F3ZA 4F09A 4RWJA 2BKZA 5I3OA 2PE2A 4L45A 3VBWA 5HD4A 5AFVA 4IM3A 5EDQA 5E92A 3OCSA 4YTHA 3UOLA 4EQCA 4RT7A 4DEBA 5BMSA 5CEMA 3SOAA 3W32A 4I0RA 4NKSA 4CZYB 4D2PA 5A4QA 3TUDA 3R8UA 3TKIA 4UMRA 3U6IA 4TWNA 2HAKA 3DFCB 4ACGA 1JOWB 4FKGA 1MUOA 2UZUE 4G6LA 3QKLA 5C26A 2OO8X 2XH5A 1ZYDA 3JPVA 3CIKA 3KRRA 3FXXA 4DEDA 2WNTA 3JY0A 2E9PA 2IW8A 4MWHA 3S00A 4YC8A 2PZIA 2QO7A 3BU6A 3QYWA 4LGGA 3VN9A 4AX8A 3Q04A 5BVNA 2UZLA 4O7WA 3G6GA 5CANA 5M07A 2ZMCA 1QPDA 4QDVA 4AA4A 4AFJA 3CSVA 4YHJA 1Y6BA 2EVAA 3IDCA 3GC7A 3QX4A 3F66A 5M55A 5F95A 5IMXA 4KKHA 3EQBA 3EL7A 4ONAA 3M1SA 4E73A 4BDJA 4DBNA 4TXCA 4FT3A 1IRKA 2CKEA 2PE1A 3QKKA 3JXWA 4TW9A 4KBKA 3RM7A 3OXIA 1OIYA 3TNIA 4GFGA 4WNKA 3ENMA 2WFYA 4IJ9A 4O1OA 1Z5MA 3DBEA 2B7AA 3U4UA 3RMFA 3TJDA 3LFSA 3PJ3A 4IX5A 4BIEA 4DTAA 5CNNA 4CGAA 3JVRA 3DBCA 4A07A 2EXEA 3IPHA 3SA0A 3QZIA 3HX4A 5B2LA 1F5QA 4WNMA 4RG0A 4BF2A 3OFMA 2IZUA 4XOYA 4ZJVA 3W0QA 4QTEA 5AIRA 3NUNA 5C27A 1PMNA 3CY3A 3C4CA 1YI3A 3UO6A 3UMXA 1H1QA 1R39A 4RX8A 3UC3A 3QGYA 3RHXA 3L8VA 4NM5A 4B8LA 2XAOA 4TYGA 1WBSA 4FZAB 3AOXA 3GU4A 4J8MA 2JDVA 3KQ7A 3V5JA 3QQLA 2GHLA 4IB1A 4IM2A 4U43A 5KBQA 2RFDA 5AUWA 5HLWA 4YJRA 2OXYA 4KRDA 3KK8A 3DZOA 3KCFA 5J1VA 4J52A 3FMLA 4ZS0A 3WYYA 3B8QA 4KKEA 4BDCA 4HJOA 3CS9A 3QAME 4KBAA 4FTTA 3BGQA 4R5YA 4RFYA 4ZZOA 3LMGA 3T8OA 3ZZWA 1UNGA 4DH8A 4GK3A 5AMNA 5IG1A 1FQ1B 3HMMA 3KRLA 4LUEA 5H8EA 3SD0A 3QQGA 2YLFA 3MVJA 3K2LA 1H8FA 4GSBA 3DKOA 5FGKA 4ANBA 5IQHA 4BFMA 3CD3A 1KE6A 3DJ7A 5FWKK 2O8YA 1SNUA 2FUMA 4LYNA 2Q0BA 3I6WA 4PL5A 1O9UA 2JAMA 1YDSE 3AC1A 5JGDA 2C3LA 4XBUA 1U4DA 4JOAA 2CSNA 5CF5A 1KUTA 1XR1A 2YDKA 4GT3A 5CU3A 1XQZA 3KFAA 3T3UA 3RPVA 5JFXA 4DEIA 1H28A 2BAJA 3PA5A 3MFUA 3PSDA 2X2KA 3O7LB 3E3PA 4FKPA 5D12A 4BWPA 5KMOA 2C6TA 2Y7JA 4IW0A 3U55A 1FGKA 3V8WA <