3ORXA

Pdk1 mutant bound to allosteric disulfide fragment inhibitor 1f8
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
285
structure length
283
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFCFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQRANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Turning a protein kinase on or off from a single allosteric site via disulfide trapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 283
sequence length 285
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3orxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3orxA01
5JGDA 4UWCA 4TKSA 4ZTMA 1R39A 3ACKA 3ORPA 1HOWA 5LMKA 4AWIA 1PMNA 2ZAZA 3QUPA 2WTVA 3TNHA 4AQCA 4BDKA 4C02A 4C36A 2E9UA 4F70A 4A06A 3OY3A 5HHWA 3OT3A 4ZLZA 5KNJA 1S9JA 4FV2A 5L2TA 3U9NA 4CKRA 2QOFA 5A46A 4JRVA 2GNLA 3C5UA 2VTRA 4BICA 4RX8A 4YJRA 3RWPA 5CSHA 4M14A 5C03A 3ZRKA 4EOIA 4XUFA 4RMZA 2ITOA 1ND4A 3ETAA 4O7VA 4IB0A 3DS6A 2X9EA 4U7ZA 3C4XA 4NYEA 3MDYA 5BYZA 2EB3A 2CMWA 3E62A 4RWJA 4QMQA 3HECA 1H28A 2J51A 2XBAA 5AR2A 1REKA 1GOLA 2HY81 1DM2A 3CE3A 2A27A 4FKGA 4LGDA 2OZAB 2HWPA 2Y4PA 4CYJA 3NNXA 2W5AA 1B39A 4UMRA 5C27A 2IZUA 3NUUA 3RHKA 4KWPA 2BIYA 3QX2A 1OPKA 5CAQA 4IC7A 2O2UA 1H0VA 3P79A 3DJ7A 2P55A 1OL5A 3SKCA 3H9FA 5HLNA 4B8LA 4LV5A 3PDTA 1Y6AA 3BWFA 2JAMA 4IB1A 3UPXA 2BRHA 2W9ZB 3PG1A 3F6XA 4ZZOA 4YTFA 1H1RA 2YERA 3WILA 4DEGA 3JR1A 5GIPE 3OHTA 3NIEA 2X8DA 3RK5A 2IVVA 2VWIA 2QKRA 4USFA 3I1AA 2ITUA 2YM7A 2BRBA 2PVNA 5E9EA 2FSOX 2VTMA 3MBLA 3UPZA 4C3FA 5EOLA 3H0ZA 1OKVA 2JITA 4F1TA 2NP8A 3SVVA 1GZOA 2XCHA 3ALNA 3UMWA 2I0YA 4FKWA 3GOKA 3ZFXA 4AOTA 5HU9A 3TM0A 5KMOA 4YTIA 5JQ8A 1ZYSA 4CYIA 3U6IA 4CFFA 1NXKA 2ZB0A 3WF8A 1MP8A 2BAKA 3RPSA 3LXLA 4GKHA 5M06A 2EXEA 3JY0A 4QQJA 3WZKA 1JKTA 1RDQE 3W10A 3MI9A 4L8MA 4UB7A 4CQEA 3MY5A 1J1BA 2X1NA 2BRNA 3QU0A 2QO7A 3LAUA 5K0KA 4G31A 4IB3A 4NM3A 3VRZA 2GQGA 3GCSA 2HIWA 3PXRA 3EFJA 3VHEA 3ENHA 3LMGA 3ATTA 5IQHA 3KN6A 2PU8A 4RG0A 5LARA 5BUIA 4Q9ZA 3FZOA 3BKBA 1K3AA 3BU3A 3DKFA 3S4QA 2O65A 3BV3A 2IW9A 3ZHPC 3HDNA 3F3UA 3CLYA 4QT1A 4ZZMA 4YZNA 1H1PA 3PY0A 2FSTX 4BWPA 2OJIA 3FEGA 2PE2A 3A4OX 1WFCA 4KB8A 5CU6A 2NRYA 2P4IA 2UZVA 3U55A 4ZEGA 3EQFA 5JKGA 5AM6A 4CG8A 1XH7A 2BAQA 3SQQA 4ZMEA 2OKRA 4MXZA 2QU5A 2WD1A 4UWBA 3IW8A 2I40A 2VAGA 5AUZA 4IW0A 4CSVA 2XNGA 4RVMA 4QTBA 2F2CB 3HUCA 4B4LA 5AADA 4WT6A 2WTIA 5CEPA 1U46A 2Z60A 4BKJA 3R8MA 2LGCA 1UU7A 3E7OA 4RJ4A 2JBOA 2VN9A 3ZZEA 4ZAUA 4FL1A 4KBKA 2R3KA 3DB6A 4QP4A 4YJQA 5AUVA 4BF2A 2C0IA 3PLAE 4FNWA 5DR6A 3M11A 3OWLA 4YHJA 3LCDA 4R8QA 3TJCA 4XEYA 1WVYA 3KXGA 3ORLA 2OF4A 4F1OA 5GJGA 5IQGA 3NRMA 2OFVA 3FLQA 4JBVA 4O86A 3ITZA 2HCKA 3E3BX 4GCJA 5AV0A 3FLSA 3TUDA 4FBXA 4BDHA 4OBQA 3GU7A 4PY1A 4X2GA 4BCIA 3U6JA 3KXHA 1P5EA 4XV2A 4II5A 3R00A 3VW8A 4G2FA 2UZOA 1MRVA 4FSQA 4TYIA 4BCFA 2QOQA 2YLEA 4Q5EA 4L7FA 5AIRA 3DJ6A 4IX5A 3IW5A 5JQ5A 4DA5A 1FVRA 5C4KA 3LFQA 3VBVA 5FM3A 1KE6A 2JDOA 5IDPA 2XKFA 5KUPA 1WBSA 3E5AA 4O0RA 3R73A 2QC6A 3A7GA 4L46A 2IN6A 5AR5A 4BHZA 4JT3A 1PYXA 4IVBA 3BWJA 2IZTA 3LCSA 3SOAA 4BCMA 3ATSA 3PXYA 3PXFA 2ITVA 2X7OA 1H08A 5K5XA 4U3YA 1ZYJA 2ZV8A 3A4PA 2JDRA 3NW5A 4O0YA 5FTOA 4D4VA 2OJJA 1CM8A 4J7BA 2YFXA 4YLJA 4XV9A 4QTDA 2GNFA 2QOHA 4Q2AA 3ZFYA 1ZOHA 1Q8TA 1PHKA 2JFMA 4GV1A 3OXZA 4PP9A 4QYEA 4AFJA 5LVMA 4D58A 4JQ8A 3CXWA 2BCJA 4WO5A 5EDPA 2X2MA 3NUXA 1UKIA 2R3IA 5CVFA 5DEWA 4DEIA 2UZBA 4TYHA 5JK3A 4IEBA 3M42A 2YDJA 4FSNA 2F49A 1T45A 3TV4A 4KS7A 1ZZ2A 4RIXA 5A6NA 4HNIA 5JN2A 3EQIA 3QD0A 3UBDA 4BTFA 4DN5A 3AG9A 4CZTA 4I5CA 1V0PA 2ZMDA 3D7TB 3BHUA 2C6EA 3M2WA 3PIXA 4BZOA 4FTAA 5HKMA 4S32A 3VJOA 4RWKA 5DGZA 3FJQE 5M4UA 4AUAA 3AC3A 2SRCA 2ZV2A 3DXNA 1MQBA 3M1SA 2Z2WA 4DH3A 2ZDUA 4HNFA 3L8VA 2ETRA 3L9NA 4UWYA 5E8UA 3RM7A 3RNYA 3Q60A 2V7OA 2XK7A 3F5UA 5DHJA 3VUKA 3UNZA 3CTJA 2YCRA 5J8IA 1CKPA 3PZHA 3ZOSA 2J9MA 3QZHA 4RVKA 4Y72A 4ALWA 3QD4A 4EOPA 2BRMA 1RW8A 5HTBA 4ZTNA 3EKNA 4DE4A 4PMTA 1IA8A 4E73A 5EI6A 2XK3A 3JYAA 2BMCA 1SVEA 4FKJA 4TYHB 1OIUA 2YZAA 4O0VA 5CU2A 4CTCA 1Q3DA 4MEDA 5CEOA 1BI8A 1CSNA 1SMHA 4EHZA 3GOPA 4QNAA 3CJGA 2WU6A 4C57A 2YM6A 2CNQA 3KVWA 4TWNA 2CN5A 4E7WA 4JAIA 3HMNA 4UX9A 4O2ZA 2X6EA 3W2RA 3MIAA 5LWMA 4O83A 3C13A 4FK3A 4MKCA 2VTNA 4PL4A 2XMYA 4RJ3A 2Y4IC 4ACCA 5TT7A 3GQLA 4B0GA 4MXXA 4R5YA 4MH7A 1QPJA 1PF8A 4KRDA 4BBMA 4F9BA 3C0GA 3GC9A 3NGAA 4ZIMA 2CKOA 3H10A 4B6LA 3QZFA 1DS5A 3OC1A 3W55A 4NEUA 4EK6A 5KMLA 1PMUA 4O38A 4DTBA 4N6ZA 2WTDA 4QMMA 4J52A 4AT5A 5GZ9A 2R4BA 4IAFA 1PY5A 3IW6A 4XHKB 3UP7A 2XM8A 1OIYA 4YC8A 5CYIA 5AR7A 4DLJA 2PUNA 1XR1A 5JFVA 3UOHA 2CNUA 2XF0A 2ITQA 3H3CA 3LLTA 4H3BA 4M3QA 4ZS0A 1ZMVA 3WF9A 3MH2A 2X4ZA 1IASA 4G6NA 5B0XA 3VUTA 5GHVA 4QTEA 5HTCA 2CGVA 2WMVA 2JIVA 3QCYA 3C4ZA 4XS2A 3QA0A 4YPDA 5A4EA 3AC8A 2P0CA 5AUYA 4X2JA 4X6RA 2A0CX 4UY9A 2XNMA 1OUYA 4Y83A 3VULA 3BHVA 3ORKA 4IWPA 4DFLA 4Z7HA 3KA0A 1URWA 3O2MA 3U9CA 3ZO1A 4M68A 3VF9A 3EH9A 3LW0A 5FQDC 3F3WA 2OJGA 3PSDA 4FK6A 3HP2A 1FVTA 2X7GA 3AC5A 4D1ZA 1H0WA 4E26A 3DB8A 4E6AA 5CVGA 1U4DA 3VS0A 4CTBA 5ITAA 4BYJA 2B4SB 3SHEA 3R1NA 2W0JA 5I5ZA 2Y6MA 1TVOA 3UTOA 3BCEA 3HLLA 1GY3A 2FSMX 4BIBA 2YCFA 3L9PA 5AA9A 5A6OA 2DUVA 4D2VA 1Q8UA 2J0KA 3EIDA 4JBQA 5E90A 4AA0A 4AW0A 3ENMA 4FA2A 2E9VA 3QCSA 3R9HA 3KB7A 4AW1A 3F82A 4M66A 2Q0NA 4C4HA 5I9WA 4RFYA 4MX9A 3E64A 1DI8A 3PSCA 3TUBA 2PVJA 3NCGA 1JKLA 3CGOA 3PY3A 3NCZA 2NRUA 4W9XA 4ZK5A 4DT9A 2R3JA 4JS8A 4MVFA 4FV6A 3Q9YA 4HPUE 2PVLA 3LFBA 5L8JA 1CTPE 1SVHA 2W4JA 1XJDA 4J8NA 2EXMA 4YLKA 3TV7A 4ANQA 5A54A 5KMKA 5C8NA 2BHHA 3CD8A 2R2PA 3K3IA 3OCBA 4YHTA 5CEQA 3UJGA 4QP8A 4BCKA 4D2RA 3ZEPA 2IVTA 2VO3A 3UE4A 3WI6A 4NCTA 2WZJA 3FXZA 3R0TA 5ETAA 5C26A 5M44A 2ZB1A 3DY7A 1FGKA 2IZRA 3SXSA 1PMVA 5DMZA 1ZOEA 3KMWA 4U0IA 5FBNC 4U9AA 5FRIA 4CGAA 3QLFA 5F95A 2BKKA 3CP9A 1W98A 2R5TA 3FXWA 1CKJA 3BYOA 5ANIA 5CEIA 3QYWA 3GUBA 5FXQA 1H00A 3HMOA 3EFKA 3VW6A 5CASA 1UA2A 4I0RA 2C47A 2R3GA 3N9XA 3FBVA 2GHGA 3QD2B 4H05A 1ATPE 3FMEA 3D83A 3BGQA 4F0GA 1J7UA 3GCPA 2PULA 4CMTA 3ZLSA 1XWSA 3B8RA 4WRGA 4ZMFA 3IDCA 2PMIA 4L6QA 4PPCA 1U5RA 2EUFB 5HIEA 5KMMA 4JG8A 5HNGA 3ZUVA 3QRIA 1BL7A 3HMPA 2BDJA 1GZNA 3T3VA 4DITA 2RF9A 2C1AA 3A8WA 2IPXA 4YJUA 1S9IA 2C0TA 3QQUA 1OI9A 2W9FB 4GK2A 2W5BA 2XIZA 2QODA 5DPVA 3KCFA 5TE0A 1O9UA 2C30A 2XNBA 4U44A 5FLFA 4BCOA 4FIHA 4C4GA 3IONA 3PRIA 2VTSA 3R01A 1BI7A 4RA4A 5LMKC 4HGLA 3EQPA 3MS9A 2X39A 4UZHA 4MNEA 3WE8A 5L2IA 2WOTA 1QCFA 2UVXA 3QALE 4C2VA 4FL2A 4JDIA 4QRCA 2OIBA 2YZLA 3ODYX 3C4EA 4UEUA 5EKNA 1IAJA 1PJKA 3R9RA 1KSWA 3FZ1A 3UVQA 4GS6A 2YM4A 4FG9A 4C37A 5KMNA 4KIKB 4XX9A 4O0WA 2ETMA 2PHKA 3O7LD 4LGHA 3V6SA 4AACA 5E91A 5BYYA 4IX3A 5E1SA 2ITPA 4QTCA 4FV3A 1YHWA 4GRBA 4FIFA 3EOCA 3EMGA 4AOIA 1SNXA 4ANMA 5IQAA 2I0VA 3NUAA 3JVSA 1YXXA 4EI4A 4IVCA 1NA7A 4YR8A 3COKA 3D14A 5BMSA 4D0WA 1WAKA 4FTJA 3GU4A 4C8BA 4U45A 1JNKA 1X8BA 4YNEA 4EQCA 5HVJA 3R8LA 2B54A 2FYSA 2VO7A 4JBPA 5DR9A 4D9TA 5CEKA 1YDRE 4U79A 5DRDA 2YDIA 4XP0A 3WYYA 5FEDA 2XKEA 5CF6A 5K0XA 4QMNA 2VWYA 4HYUA 2XJ1A 3MESA 3PJ1A 3QL8A 4N0SA 1ZZLA 4GUBA 5IF1A 5DNRA 3QHWA 3ZXZA 5GINE 2KTYA 3U8WA 3MA3A 5HESA 4KIQA 5JZNA 5J95A 3W32A 3PWYA 5HE0A 4BR3A 3F9NA 2J0MB 4ZXTA 3VQUA 4LUEA 4WSYA 5HZNA 4XNEA 2G2IA 1IA9A 1YWVA 4ZSGA 2O8YA 2WPAA 3E3PA 5FP5A 4PQNA 5CU4A 3C4WA 4FV9A 2PUIA 3R63A 1XO2B 5FXRA 2VNYA 2UV2A 2CJMA 2IJMA 4M84A 1H4LA 4TWOA 3FUPA 3VRYA 4GYGA 5DI1A 2OJFE 5IUIA 3FY0A 4M69B 3VS6A 5IA1A 4D0XA 1ZOGA 1Y8YA 4I4FA 4DC2A 3I5NA 2BAJA 1KE9A 4EEVA 4DTKA 4D2PA 1KE8A 5E8TA 5JFWA 1WBVA 3SXRA 4AU8A 1YXUA 3VS7A 1UKHA 5ANJA 2W06A 1GJOA 1ZY4A 3ZLXA 2C5OA 1YI6A 4YZBA 3Q32A 2XS0A 1H1WA 1XHAA 3P0MA 3H30A 3OBGA 4FI1A 3NNWA 3R9OA 3SW4A 1SNUA 2EWAA 3P9JA 5TF9A 4K11A 5K4IA 5LXMA 3AGLA 3IK3A 4CLIA 2B52A 4NJ3A 4ZTRA 5DH3A 3H9RA 3W2SA 5AV3A 4F9WA 1W7HA 1LEWA 4S2ZA 1PRYA 4RFZA 4MCVA 4NFNA 3ZFMA 3RAWA 4YSJA 3PA5A 4ZTSA 5I9XA 3F88A 3RAKA 4L00A 4A9SA 1PKGA 2VWBA 1P14A 4NIFB 4TTHB 4X3FB 3NR9A 3R8PA 1MRUA 2B0QA 2WMUA 4IWQA 3FYJX 2C5XA 4USDA 3MSSA 4L68A 4AGCA 4NTSA 3FI2A 3KQ7A 2VWWA 2YJRA 3FHIA 4Q9SA 3I6WA 2WQNA 2W4OA 2F7XE 4IZ7A 3SG8A 4O91A 4AZFA 3JUHA 2JKKA 4IDTA 3TZ9A 4Y8DA 4FEWA 3Q4ZA 2CKPA 4UALA 3R7IA 4H3QA 4K9YA 3Q4UA 3DLSA 5KBQA 3C1XA 3DQXA 2HAKA 4ZS4A 4E93A 2CGUA 3HX4A 4NSTA 5AP7A 5JMSA 3ZO3A 4OR5A 5KO1A 2R9SA 3BPRA 2PUPA 1OITA 2XIYA 2ITYA 5HCXA 1OUKA 3KF4A 3HV6A 2P2IA 5I3OA 3KXNA 5BUJA 1G8AA 5KCVA 3W18A 3UQGA 4LYNA 4FZAB 4S30A 4B8MA 2ITNA 1YXTA 1B38A 5IA0A 1UU8A 3F2AA 3QCXA 4I92A 3UZPA 4D2SA 4F6SA 4LOPA 2HW6A 5IDNA 4M13A 3VS1A 5E8ZA 2QOBA 5CQWA 2X6DA 4M0YA 4FKVA 5GNKA 3WYXA 3TDWA 3MH0A 4GVAA 5M57A 1W82A 3OF0A 3PG3A 2YM5A 5AM7A 3MJ1A 4KKHA 4GT4A 1BMKA 3V5WA 3PA4A 5AJQA 3WIGA 4DEBA 3NEWA 2X7FA 3ZRLA 3RWQA 4MQ1A 4AGDA 2W1FA 4X6QC 3SV0A 4OGRA 5D7VA 4YBKA 5AV2A 3LKMA 2A1AB 3NZ0A 3GI3A 4MQ2A 4DGMA 3I4BA 4PDSA 3WOWA 1M2PA 5DVRA 4CZYB 3PYYA 2VRXA 4TXCA 3QWKA 4C38A 4AZVA 5EDRA 3FY2A 2OZAA 4G9CA 2J7TA 3BYUA 3IW4A 2OXYA 4HVHA 5GZ8A 1RE8A 2W5HA 3E8DA 3ZEWA 2W1IA 4IM2A 3DXPA 3QTQA 3FKNA 4L43A 2X2KA 3MY1A 1TKIA 5EYKA 3VVHA 5AX3A 1GNGA 1ZWSA 4XV1A 3V3VA 5A4QA 2EU9A 3HZTA 4DG0E 5HVYA 2PE1A 5DN3A 2GFSA 4K18A 3CBLA 5KHWA 3OD6X 4ID7A 4HYHA 4RGJA 5EYMA 4BBFA 4BWKA 4I41A 1AQ1A 1OKWA 3R7OA 4ACDA 4EZ3A 3W2CA 3G33A 1MUOA 2H6DA 2CPKE 4EKKA 2C3LA 2QOLA 1ZXEA 3G6GA 3OY1A 4KAOA 1WCCA 3PIYA 4KKEA 1QPDA 2QOKA 2R3FA 3EQRA 3FC1X 3MGYA 2UZLA 4Q5HA 4GVJA 3EN6A 5F1ZA 2E9OA 1CKIA 4WBBB 2FH9A 2EVAA 3E8NA 4AAAA 4KIOA 1GIHA 2YABA 1TQMA 2QOIA 4L42A 2ITXA 3C7QA 2JKQA 5C8MA 1IEPA 4D4SA 4G17A 4D28A 4GH2A 5CNNA 1V1KA 1IAHA 4JL9A 3BEGA 2WMRA 4FSWA 3UO5A 1H07A 1Q3WA 5LMAA 1Q5KA 3SC1A 2QR7A 2A4LA 5CU3A 3IECA 4AOJA 2ERZE 3AD5A 4GFGA 5GJFA 1XH9A 4RPVA 4ANLA 4BYIA 5IZFA 4RIOA 3FKLA 2XEZA 1PW2A 3FV8A 1JSTA 3Q3BA 4U5JA 5DOSA 5JGAA 4OT6A 4QP2A 2PZYA 2P3GX 1KOAA 1Y6BA 1PMEA 4ZSEA 5F20A 2GNGA 4RQVA 4FEVA 2CKEA 4PF4A 2BILB 1NVSA 4NKSA 2UW9A 4WBOA 3L9MA 4MYGA 4YPSA 3GT8A 4MBLA 3PUPA 1TQPA 3EYHA 4O1PA 4RX7A 3BBWA 4OBOA 3MIYA 3PVWA 4QMSA 3EQHA 4RX5A 3EFLA 3D2IA 5DE2A 4ZY5A 3QKLA 4Y46A 4ZLYA 4Y95A 5LWNA 1UU3A 3RJCA 2JC6A 5JRSA 3QTIA 3DK7A 4R1VA 2R3NA 2PVFA 2PVHA 2W99B 4GSBA 4FGBA 2R7BA 4IADA 3RK7A 3TNWA 3RAIA 3KGAA 3KULB 4NZWB 3R7YA 4C2WA 2OFUA 1ZYDA 4GFOA 3RGFA 4FUXA 5BVNA 3QX4A 4BRXA 4FKOA 2AUHA 1ZAOA 4S33A 3UMXA 4J1RA 3ROCA 3IGOA 3FMDA 3NX8A 3JXWA 5HEZA 4OTRA 4L44A 3UQFA 2OG8A 3DBQA 4QQCA 1OL6A 3S1HA 2QG7A 5DLSA 4F63A 2B9FA 3JPVA 1YDTE 4HGSA 4RIWA 2BRGA 4Z3VA 5HBJA 4AP7A 1OPLA 4JXFA 4PPBA 4USEA 1YW2A 3O51A 3G2FA 3LFCA 3LJ0A 3QKKA 4C4EA 5LJJA 5A4LA 4JNWA 4A9UA 4ITHA 4K6ZA 3FZTA 1UNHA 3LOKA 3ZH8A 3LFDA 5E1EA 3TWJA 1ZYCA 3RP9A 2VUWA 3EFWA 4E4MA 2GS7A 1KWPA 5CAOA 4FOBA 3OEFX 5AR8A 4QTAA 3EYGA 4JX7A 4F08A 3O7LB 5BX0A 4V05A 4I6BA 5EDQA 4WHZA 3TUCA 3TIYA 4GW8A 5DIAA 5ANOA 5ETCA 5LVLA 2VV9A 3FZPA 5DT0A 2J0LA 4FKLA 3I6UA 4R7IA 4V04A 4YZDA 4BCPA 1UNGA 3FSKA 3NPCA 4L3LA 1CDKA 4L3PA 3SAYA 2Z7LA 1V0OA 3IS5A 2HOGA 5HBEA 4RIWB 3MVHA 3UZRA 3G9NA 1H25A 3PVGA 2OIDA 3CIKA 2WQBA 2O64A 5CAVA 1Y91A 1Q99A 3E63A 5K9IA 4YU2A 3E8CA 4ERKA 4EH3A 2VTHA 3EHAA 4O7LA 2R3HA 2B9HA 4C4JA 3KCKA 4I4EA 4LL5A 4RJ5A 5L4QA 1E1VA 4PTGA 4OBPA 4TL0A 3CD3A 3N51A 4LRMA 3A60A 3ROYA 2B9JA 3G0EA 5BPYA 3Q52A 4U81A 2PK9A 4YLLA 3OZ6A 3AMAA 4CMUA 2UZNA 4FEQA 3PXQA 2BR1A 3ZDUA 3Q4TA 4JG7A 1P4FA 5AIKA 4A07A 3LMHA 3ZBXA 4AXAA 4BWXA 1J3HA 4GU9A 1BL6A 3NW7A 4NCTC 5AP3A 3JVRA 2ACXA 4ZJIA 3SXFA 3D7TA 3MFUA 3O96A 3AMBA 3LXKA 1PXJA 3PPKA 3QTZA 3PFQA 4HYIA 4O84A 2XNOA 4W4XA 5H2UA 3UOLA 2ERKA 2YISA 3GB2A 3AXWA 3QC9A 4I21A 4G3CA 2G15A 3EJ1A 4JLCA 2YAKA 3PE2A 4GU6A 2I0EA 5C8KA 2GNIA 2RGPA 4AG8A 3E88A 4FSRA 4KSQA 3D5XA 3NUPA 5HD4A 4HOKA 1U5QA 3IQ7A 4YNOA 2VTJA 3UVRA 4D5HA 3IGGA 3OCSA 3R8ZA 5ETIA 3U54A 3R28A 3LMIA 5AMNA 4JG6A 4FVRA 3MTLA 4LOQA 3DV3A 4AZSA 4CLJA 4EL9A 1L3RE 4UMQA 2FSLX 3ELJA 3KRJA 5AAGA 4KUJA 3OCGA 2A19B 4PWNA 3SRVA 3UOKA 2UZUE 3DDQA 4PMMA 3CY3A 3AC2A 4FV7A 2YIXA 4BI0A 5L6OA 3C5IA 4QPAA 2HZNA 5IQBA 4ZSLA 3NVMB 4O7ZA 4F7NA 2GFCA 3PJ8A 4PMPA 3LVPA 5IH6A 2IVSA 5DA3A 3IKAA 3E93A 1FVVA 5IISA 4S31A 3GQIA 5AP0A 1XKKA 4RLLA 3NYNA 3NYOA 4B99A 4EH5A 4R1YA 2OJ9A 2VTIA 5CAPA 3Q53A 4A4OA 3ET7A 3EKKA 4RFMA 4FNZA 1PXLA 5HICA 5IUGA 1Q97A 2Y7JA 2DYLA 2WOUA 3QQGA 4FTUA 2RFNA 3NDMA 2GQRA 4DEDA 3KK8A 4I22A 4RQKA 3UIBA 3ZUUA 2JLDA 3LZBA 4JDHA 3AC4A 4IM3A 1M7QA 4CZUA 3RPOA 1OB3A 2ZV9A 5CT0A 4OTGA 2XNEA 4O0XA 4Y73A 4O1OA 3IOPA 2E9PA 2WQMA 2IWIA 1R1WA 1VEBA 4QNYA 4I1ZA 3PXZA 4PX6A 4IDVA 1SYKA 3PZEA 2XJ2A 3ZLWA 5G1XA 2UZTA 3OEZA 4J97A 4WNMA 3SRVB 3R9NA 4YC3A 5HG8A 2WB8A 3NYXA 4FZ7A 3OP5A 5HI2A 3UC4A 4DFXE 4I24A 4CFXA 2YIWA 4Z55A 5DWRA 3OS3A 3H9OA 1OBDA 3QZGA 3V01A 4A7CA 4G5JA 2Y6OA 5HE3A 2C6OA 4ZY6A 4FKTA 3CJFA 4KABA 3MVLA 1Q62A 3F5GA 3NWWA 4I0SA 3G6HA 1RJBA 4YHFA 2HZIA 4IAIA 2WQEA 1H1QA 5CVHA 2Z7SA 3QRKA 2R0UA 3VUGA 3LJ1A 2CCHA 4JOAA 4N70A 4X2KA 3R9DA 2R0IA 2QOCA 4TZRA 4A4LA 4F7SA 5BVOA 2FB8A 5BQ0A 2OWBA 1YHVA 5E4HA 1W8CA 4EBVA 4DCAA 1UVRA 1J91A 3QFVA 3IW7A 1ERKA 2QCSA 4FR4A 3EWHA 3G51A 4IAAA 4UBAA 4O27B 2JKOA 3A62A 3WZJA 2WMBA 3KMUA 4DH1A 4AFEA 3EL7A 3FLZA 4H3PA 4LI5A 3OTUA 3VIDA 2CLQA 3L8XA 4QP9A 4M7IA 5CZIA 4EK8A 2WNTA 4P5ZA 3OWJA 4KD1A 4RT7A 2HXQA 5DG5A 1LPUA 3TZMA 4WUNA 3F61A 3KF7A 4X3FC 1OL2A 1YXVA 4TY1A 3UG2A 4L3JA 4DAWA 4DEHA 2BZIB 3D9VA 4PDPA 3CEKA 3S95A 4LV8A 2W1EA 1Q24A 4YMJA 3WZEA 1FQ1B 3KXMA 2E9NA 3W8QA 4EJNA 5FGKA 4U8ZA 2WIHA 4EOJA 5AP6A 2VX3A 2WMTA 4KIPA 4K8AA 5H8EA 4FX3A 4GJ2A 2CGWA 4JDKA 4HJOA 3FWQA 4R3RA 4WG3A 4YJVA 3THBA 3ZCLA 3ZM4A 3U6HA 3LM0A 1A06A 3KREA 4ZY4A 1XH5A 2JIUA 4FTTA 4QP3A 2B53A 4EK5A 2J90A 3NVKI 1OM1A 5IQDA 4FYNA 5BVKA 3R22A 4FC0A 4O82A 5D12A 4E20A 2XYNA 3NIZA 4CVAA 4R5SA 3H0YA 3I5ZA 3NS9A 5FD2A 5M4IA 1M14A 3NNUA 1JWHA 3KXXA 3AD4A 4C33A 3F2NA 4FEXA 5FP6A 1PXKA 4EHVA 3NYVA 4Z16A 4FZ6A 3SA0A 4E5AX 1M7NA 3LCTA 4QMTA 2X4FA 4HVDA 3N4VA 2R3MA 4P7EA 4ANBA 5J9LA 1AD5A 1XH4A 3FPQA 4QMVA 3FPMA 5J5TA 2W96B 3OROA 4FSUA 2XK8A 4YO6A 4IZYA 4ZZNA 1YWNA 2CDZA 4AA5A 4ZJJA 3QWJA 3DAEA 2ZM4A 4PL3A 2XNPA 1OPJA 4UMTA 4C7TA 4DINA 3LQ8A 2HZ4A 4FV0A 3ZSHA 4BGGA 4IJ9A 3K2LA 4L67A 4DG2E 3BEAA 3FMJA 3Q96A 4YP8A 4AF3A 1QPCA 3W2QA 2VTOA 3LCOA 3W33A 2BFXA 3DAKA 2WEVA 1IRKA 2WTCA 3DAJA 5HG7A 4CCUA 2WKMA 1NVRA 4J71A 4DF3A 5IQCA 2QD9A 3NUSA 4WNKA 4GT5A 1YHSA 3ZS5A 1KV2A 3OWPA 3I0QA 5DBXA 4MD9E 5IA3A 3COIA 4NFMA 3ORIA 2B7AA 3D0EA 4LM5A 5IU2A 2BROA 3QC4A 3FI3A 3FHRA 3NUNA 3PWDA 5HQ0A 4FEUA 3GU5A 4DYMA 4F9CA 3R8UA 4FE2A 2UZDA 1K2PA 2GS6A 3UO4A 3F7ZA 4GG5A 3MH1A 5TOZA 3PA3A 5JFSA 4IE9A 5B2LA 4QQ5A 3ERKA 4XLIA 5LCKA 4BIEA 4IZ5A 4Z7GA 3T9IA 1GIIA 1ZARA 4KIKA 4XV3A 2JIIA 3D94A 3HV5A 4RLKA 3REPA 4BHNA 5J7BA 5M55A 3BQCA 4NW5A 5EW9A 4A9RA 1UNLA 3IDPA 1FBNA 4AX8A 3MYGA 3ULIA 3CQWA 3WBLA 2UW3A 4K1BA 3WF6A 2W1DA 2XBJA 3E92A 4H1JA 4X21A 4E3CA 3NMUF 4PL5A 4EH4A 2GPHA 3RM6A 1GIJA 1LR4A 2JFLA 2XK4A 4XP2A 4ORKA 3Q9XA 2YWVA 2Z02A 3R2BA 1FMKA 4YZ9A 4MTAA 3QRUA 4BN1A 1MQ4A 1STCE 5CI7A 3CQEA 4BDCA 5IEYA 3LXPA 1HCKA 3ORZA 3ZONA 3OFMA 1WBTA 2R7IA 5HORA 3QGYA 5KBRA 3BYVA 5GJDA 2WGJA 5ANKA 1FINA 4QMLA 4QYGA 4IX4A 4FKUA 4DGGA 3ZU7A 4AA4A 3B8QA 4R3CA 3DDPA 4K2RA 4BZDA 4F7JA 3UQCA 3UC3A 5E8XA 4CG9A 3COHA 5H8BA 1G3NA 2C3IB 4FODA 5LQFA 3DNEA 2R3OA 4U80A 5CU0A 4H1MA 3S0OA 5FTGA 1JKKA 3EB0A 4NWMA 4WD5A 2GS2A 4GG7A 4KBCA 4G5PA 2YHVA 3G90X 3FZSA 4ASZA 4EKLA 4M15A 1ZRZA 1XH6A 3R7GA 3KXZA 3KRWA 3TZ7A 5EHOA 5M08A 5H8GA 2PMNX 3BQRA 3T9TA 4R78A 3PP1A 4X2NA 3VBQA 1T46A 2FA2A 2PZRA 3O8UA 5EI2A 1FGIA 1VJYA 3WIKA 5CALA 3QHRA 2W1GA 3GC7A 3IO7A 3RALA 3SLSA 3I60A 4G9RA 3II5A 3ZXTA 4GUEA 3UG1A 3SDJA 2BTSA 1SVGA 2F9GA 3DA6A 4M69A 4O0UA 3ZMMA 3FE3A 4NJDA 2BZKB 4ASDA 3DBDA 4D5KA 1JQHA 5L8KA 1WBWA 3EZVA 5J7HA 3UNKA 4QMYA 4QP1A 5CZHA 4MXCA 5E8SA 4ASEA 5HNIX 3F66A 4LOOA 3V5PA 3MN3A 5J79A 3SW7A 4F65A 4XRLA 2BTRA 5ANGA 1H27A 3CGFA 1WVWA 5IEVA 2UVZA 3GU8A 4FG7A 3C0HA 3RMFA 3HKOA 3KC3A 3GC0A 3A99A 5CF4A 4XH6A 4IJPA 2PYWA 3L8SA 3R1QA 5EG3A 2JDSA 4FT3A 4L45A 2ZOQA 2OGVA 4AS0A 3VS4A 3C0IA 1JBPE 1QMZA 5HD7A 5IQEA 2B9IA 3LFEA 3OMVA 3ZDIA 2XYUA 3DBEA 4C4IA 4OTDA 4RSSA 1W83A 3BZ3A 2F4JA 3VJNA 3EQBA 5D9HA 1W0XC 4U42A 5HU3A 4NIFA 4JDJA 4X3FA 4XG3A 4EOQA 4AN9A 3WZUA 3DT1A 2R3PA 5J5SA 4EHEA 3MFRA 3VQHA 5AV4A 5FXSA 4U3ZA 3S3IA 4ALUA 2QR8A 3ORXA 4LL0A 4OTWA 3RINA 2RFEA 4WRSA 4IC8A 3C51A 4LMUA 3QD3A 3HRBA 4A9TA 4F64A 2OXDA 2RL5A 4BCHA 4N6YA 4QMXA 2O5KA 5I9UA 4ENXA 5K4JA 5IKWA 1WBNA 3MPMA 5L2QA 4MBIA 1FOTA 4OUCA 5HLWA 4ACMA 3TKUA 3TL8A 3GU6A 4C59A 4EBWA 4K33A 5JT2A 1WMKA 4TRLA 2PMLX 5CWZA 4FF8A 4EOKA 5B2KA 2Y4IB 4MBJA 5CAUA 3QQFA 2XK9A 1F5QA 4XOZA 3FAAA 2XCKA 3AT3A 5CXZA 3GVUA 4R6VA 3BIZA 4XG6A 3NAYA 4HCVA 5KKRB 3UOJA 2ZV7A 1JAMA 5E92A 3OUNB 3DTWA 2GNHA 1JSUA 4NH1A 4TW9A 4BIDA 4YURA 5CENA 2YJSA 4O21A 3P23A 4OTFA 3CQUA 3MPAA 4WOVA 4CQGA 2BHEA 3IPHA 4QMOA 5DRBA 4UYNA 3DBCA 3KFAA 5CLPA 3VO3A 3TIZA 1B6CB 4ZTHA 4KA3A 4IB5A 2QVSE 2XUUA 4ZOGA 5FBOA 4DBXA 1Q4LA 2BKZA 1U54B 2VWUA 3ZSGA 2GCDA 2BPMA 2YAAA 4RC3A 4RZVA 4CD0A 2FUMA 3ZC5A 4C62A 5F9EA 2J0JA 4BGHA 4C0TA 5BNJA 5JFXA 4BCJA 4O6LA 3BHHA 3RHXA 3RVGA 4I20A 4P5QA 1KOBA 5D11A 4BKZA 3NSZA 3EZRA 3GP0A 4IWOA 2C69A 2WAJA 4IH8A 4O7RA 3QAME 1JPAA 2OU7A 2HW7A 3R1YA 2E2BA 2GMXA 2BFYA 1YDSE 2VX0A 3TKIA 1ZY5A 2XZSA 3PPJA 4XMOA 4GK4A 3PIZA 2GSFA 2WMAA 2VTLA 1NW1A 3AMYA 4APCA 4JRNA 3G15A 3F3ZA 3QYZA 2ITZA 4RIYB 2R3RA 5LVPA 5DT3A 1URCA 3DQWA 3RZFA 3WF5A 3O23A 3ANRA 3U51A 4EK4A 2JDVA 3FLYA 4F6UA 4DFZE 3RZBA 4KINA 5CSXA 3VUDA 4XP3A 3CY2A 3DLZA 1YKRA 4HVGA 5I9ZA 4KS8A 3A7HA 3OT8A 4CEGA 1OL7A 2BDWA 3DFAA 4LRKA 2XIKA 3QRJA 4FV8A 2V62A 3UIUA 3UNJA 4OAUC 5J9YA 4BTKA 1O6KA 2VTQA 3ALOA 3FMMA 1JSVA 3EN7A 3A7IA 3ZUTA 4ANNA 4TYJA 5EQPA 4QYYA 4EH2A 4GIHA 5EM5A 4BBEA 2WTKB 2WTJA 4I6FA 4JQ7A 5F4NA 4EZ5A 5CNOA 2VTTA 1DAWA 2P2HA 5FWKK 4D1XA 2VGOA 5HE1A 2VD5A 5K3YA 1FMOE 2CNVA 1SM2A 5C01A 2W1HA 3DU8A 3ZTXA 2RSVA 4YJNA 4DGLC 2PMOX 4J99A 5LOHA 2H9VA 4PMSA 5HX8A 5E7RA 5HNBA 3OVVA 1KE7A 2VO6A 2PZIA 2B55A 2IVUA 2JBPA 1H1SA 3BE9A 3K3JA 4KSPA 4MXOA 5J87A 3UP2A 3UVPA 3QTWA 3MB6A 4G16A 4J53A 3CKWA 3BU6A 3BYMA 3HA6A 5T68A 4EH8A 3ORTA 5A9UA 4O7SA 4LG4A 1Q8WA 1JOWB 3SX9A 5DEYA 4WKQA 4ANSA 3T3UA 4F6WA 2RG5A 2WHBA 5EW8A 5TO8A 2XRUA 4ACGA 4R3PA 3UIMA 1ZLTA 5IA4A 4V0GB 5BVFA 3VBXA 1PXOA 4FKQA 3KU2A 4Y5QA 2YIQA 4UMUA 1R0EA 2R64A 4L7SA 2QLUA 2CLXA 4IQ6A 5CY3A 1VR2A 3TN8A 1LUFA 3OW3A 4QO9A 4AE9A 4E4NA 4DEAA 4PUZA 3QQJA 4JAJA 4WSQA 4MF1A 4EH7A 4DFUA 3G0FA 4FNXA 2QNJA 5KHXA 2WMWA 3E87A 4DH8A 3ID6C 1BLXA 4W9WA 4BTMA 3RNIA 2IG7A 4NM7A 3OBJA 4C4FA 4MF0A 3PJ2A 4CXAA 5AP1A 4J96A 2NO3A 2ONLA 3ACJA 1GAGA 2HZ0A 4TT7A 3V51A 5JSMA 5I9VA 4AZTA 3U4UA 3RPYA 4EOOA 4HZSA 1DI9A 1O6YA 2YIYA 2Q83A 2QKWB 4IZAA 5H9BA 3KULA 2V0DA 4CFVA 4AW5A 4CT1A 4C3PA 3A2CA 4LFIA 4WNPA 4QMZA 4OTQA 2XA4A 3N4UA 4H58A 2OZOA 4FIEA 1E1XA 5AUTA 4M67A 2XNNA 4R7BA 3HA8A 4CRSA 3DFCB 3D15A 3S00A 3HV7A 4WA9A 5M4CA 4E5WA 2BZHB 5D1JA 4BDEA 1XQZA 4IVAA 3SOCA 3LFNA 3PJ3A 4P4CA 4GFMA 2GHMA 5IPJA 3PVBA 4OW8A 2J50A 1YWRA 4MAOA 2VO0A 4FT0A 2W4KA 4WG5A 4B7TA 2WQOA 3U4WA 2QQ7A 4HYSA 3W1FA 2ZM1A 3COMA 5JH6A 4OAVB 4HCTA 1J1CA 3PRFA 5CX9A 1J7LA 2QO9A 4AGUA 2FO0A 3BLQA 3F69A 3L9LA 5K5NA 2GU8A 2C6DA 4ZLOA 3PXKA 5FEQA 5A4CA 4NUSA 4RVTA 4EONA 4D1SA 3IDBA 2J5EA 3MTFA 3MFSA 3MH3A 4I5HA 4OTPA 3RI1A 4HZRA 3OOGA 2NNWB 5AFVA 3KKVA 1BUHA 2J2IB 4QYHA 4BTJA 3FLWA 5L2SA 3ZRMA 4FTRA 1H01A 3FI4A 3F2RA 5IQIA 1Q8ZA 3B2WA 3R71A 2YCQA 4FV5A 5AP5A 5E8YA 5DR2A 3V8SA 5I3RA 2UW4A 3WARA 4FTKA 3QTSA 2XM9A 3B2TA 5ACBC 3W8LA 1ZYLA 2X2LA 1OL1A 5CANA 2O63A 1TQIA 4MD7E 4L53A 4F0IA 3MW1A 3TEIA 4C61A 3CTQA 4LUDA 4W4WA 3LIJA 3V6RA 3TTJA 3BGZA 3Q2MA 2XIRA 3UYTA 3GC8A 3LFSA 5FM2A 2OW3A 2YEXA 4AT4A 3BE2A 4XLVA 2F7EE 4BDBA 2H96A 3VC4A 4DH5A 3R04A 2W1ZA 2AYPA 4PP7A 5A3XA 1Y8GA 3R1SA 2PE0A 2ZM3A 4FSYA 3R8VA 2X8IA 3A61A 2RG6A 5HO7A 4XOYA 5LVNA 2HWOA 2DQ7X 2XJ0A 1Z9XA 4K0YA 2Y8OA 1Y57A 2UW5A 3Q04A 3ANQA 3BLHA 4FTLA 4RRVA 4JQEA 3VWAA 3ZBFA 2C3JA 3LCKA 4BDAA 2AC5A 4EH6A 4ENYA 2H8HA 3D2KA 2YCSA 2WU7A 4DEEA 1Z5MA 2RFDA 3AGMA 4G6OA 3RCDA 1WBOA 2Y0AA 4IHPA 3AQVA 4UV0A 4OTIA 4YO4A 1KUTA 4JX3A 3A8XA 4D4RA 3ULZA 2GNJA 4Z9LA 4W4YA 2G1TA 4AT3A 4FGRA 3C9WA 3LE6A 4GK3A 2OH4A 3ZZWA 5HX6A 3HMIA 4EC8A 1UWHA 3BELA 3R83A 2WELA 3PTGA 1JKSA 1DAYA 1RQQA 2XIXA 3FL4A 3W2OA 3CS9A 1OIRA 2CCIA 1GZ8A 1KV1A 3BLRA 3QLGA 3QF9A 2XK6A 4XBRA 3QXOA 4HW7A 3LJ2A 4QMPA 4IANA 1AGWA 2NPQA 3QUDA 5G6VA 2IO6A 4GEOA 2O0UA 3R21A 2UZWE 3JY9A 5L6PA 2ZYBA 3P7BA 1ZMWA 4NU1A 3FL5A 3W2PA 3BBTB 3ORMA 2XRWA 4MK0A 3BRBA 4MHAA 4RWIA 1SZMA 3HNGA 2X8EA 4OT5A 3MVMA 4XCUA 3MPTA 3QZIA 5BVEA 3P7AA 4C34A 4I94A 1O6LA 2PTKA 4RJ6A 4JBOA 4BZNA 4OLIA 5BMMA 2C5YA 3DK6A 4ITJA 2XB7A 3AOXA 3H4JA 3V5QA 4W8EA 3AT4A 2AC3A 4NKAA 2WXVA 5HVKA 2C0OA 2WMXA 5IH4A 5C4LA 2F7ZE 3PPZA 3S2PA 1PKDA 3FLNC 3VF8A 5EHLA 2QONA 3Q4CA 4FT5A 4UXLA 3FMKA 3OXIA 3P4KA 2ITWA 4DCEA 3E8EA 5ICPA 2JAVA 3Q5IA 2BVAA 3EQCA 3F5XA 4IWDA 4L52A 5AUWA 4XG4A 4PTCA 3GBZA 4X3JA 3FMLA 3NAXA 4PRJA 3V04A 2OIQA 3GFWA 3VS5A 3ZO2A 5J1VA 4FSZA 4NW6A 3TNIA 4QYFA 4BDJA 4RJ7A 5HLPA 4B9DA 4IFGA 5ANEA 1REJA 2C3KA 3AT2A 3HAVA 3TACA 3Q6WA 4N4SA 5M51A 3HRFA 4HCUA 4YGAA 1XBAA 4XRJA 3CC6A 4FKRA 4I6HA 2PSQA 2YDKA 3BHYA 3O71A 4FT9A 3OOMA 3HEGA 2X9FA 4F4PA 4AW2A 5CF8A 5J9ZA 3DOGA 4MNFA 4MWIA 3OG7A 2WO6A 3DZQA 3TG1A 1WZYA 2OO8X 4A9YA 5FEEA 5AUXA 4NT4A 1YXSA 2JD5A 1A9UA 3A7FA 5CTPA 4D4YA 2QURA 2UVYA 5DYJA 3MB7A 4CFWA 3POOA 5EYCA 4U41A 3OW4A 3VN9A 2YLFA 5TR6A 2QU6A 3UDBA 3FQSA 5I4NA 5DFPA 1PXMA 4J8MA 3K54A 3QQLA 4MXYA 3P78A 4BI1A 4YTHA 3BYSA 4K77A 4R7HA 3WZDA 4GIIA 4WUAA 4PNKA 3SG9A 2XVDA 1E9HA 4P2KA 2YACA 5EHYA 3MVJA 3D5VA 3QKMA 4FTIA 4D2WA 2VTAA 4PDOA 1WVXA 3FC2A 2GTMA 5LCJA 4FUYA 4HPTE 2BZJA 3TNPC 3QCQA 1M17A 4UXQA 3TV6A 4UYAA 4G34A 1HCLA 2Z8CA 4BFMA 3RTPA 2F57A 1BX6A 3HP5A 1Q41A 5AUUA 3ZO4A 4H39A 4KBAA 1YRPA 4X0MA 5FTQA 4HGTA 4JIKA 3R7VA 5KMJA 2I7QA 4LGGA 3TNQB 2FGIA 2QOOA 3QBNA 4C35A 4O7YA 4QMWA 3RK9A 2OBJA 3DNDA 2Q0BA 4RIXB 1R78A 3BU5A 3P08A 2GDOA 4F99A 1YI3A 2OH0E 3D7ZA 5EM8A 4AE6A 2RIOA 4RJ8A 5M56A 4O7NA 4YJPA 1APME 1I09A 3DTCA 4NM0A 2YM3A 4YJSA 5HIBA 3VUIA 4O22A 3CR0A 3OUKA 5CSVA 3KVXA 1NT2A 4BC6A 4FKPA 1KE5A 5EH0A 4W8DA 4MXAA 4C3RA 5L6WL 3MY0A 2UW7A 4I93A 5KZIA 4C58A 2PVMA 2C1BA 4QMUA 4ZJVA 5FG8A 3Q2JA 4TYEA 3F3VA 3ZM9A 3LQ5A 2WFYA 2V55A 5KKRC 4XG8A 4GYIA 1R3CA 4U43A 2G2HA 2PZPA 4WIHA 4X2FA 2P33A 4JI9A 5CXHA 3Q9WA 4EOLA 3MA6A 4RX9A 1H24A 3R02A 3CTHA 5C1QB 4LQMA 1YOLA 4TNDA 3K5VA 5ETFA 2CSNA 5IMXA 3WF7A 3QGWA 4YC6A 5I9YA 5AWMA 3FYKX 3P1AA 5M53A 3TTIA 4UZDA 4XG2A 3GENA 5BYLA 2PL0A 3HL7A 2VZ6A 4MWHA 4ONAA 3NNVA 4DFBA 1QPEA 5AA8A 2QHMA 4YZMA 3R2YA 5JRQA 5BVWA 1I44A 4FIGA 3O8TA 5EFQA 1XBCA 2A2AA 2QO2A 3Q6UA 5EM6A 2Z7QA 4ZTQA 5AR4A 2DWBA 1OECA 2C6MA 3FQEA 5KZ0A 4E4LA 5KE0A 5AP4A 5L8LA 4EYMA 1IR3A 3O0GA 1P4OA 2GHLA 4EC9A 4NL0A 2WMQA 5LVOA 3DZOA 4TNBA 2YIRA 3HV3A 4GL9A 4U97A 5TKDA 2UW8A 5E8WA 2DS1A 4GT3A 4DT8A 1UU9A 3L1SA 3GCQA 2WIPA 1YI4A 2LAVA 4IAKA 4YJOA 5HTIA 1NVQA 1QL6A 3DCVA 3FZRA 4FIJA 4I3ZA 5A14A 4QPMA 3D5UA 3F3TA 4QD6A 4CV8A 1H8FA 4U40A 5J1WA 1K9AA 2VTPA 4QPSA 3R30A 2OK1A 2OI4X 4BB4A 3LPBA 4FV4A 3P7CA 2V22A 3KK9A 1ZMUA 4F0FA 3DKOA 4Y85A 1L8TA 2G9XA 2BDFA 3HV4A 4ZP5A 2EXCX 3EN5A 3Q5ZA 3VBWA 4DFNA 4FVPA 4KKGA 4NK9A 2YA9A 3FI8A 1OMWA 3VAPA 4EQUA 5HIDA 3GXLA 4APPA 3LQ3A 4N57A 5T6KA 3LM5A 4PDYA 3OCTA 1U59A 3NW6A 2WTKC 2ZMCA 4D9UA 2OSCA 3P86A 4AZEA 3UO6A 3DK3A 2CKQA 5EQEA 4F9AA 2XP2A 5GZAA 5IEXA 3CPBA 3KRLA 4O7TA 3HGKA 3SD0A 2W1CA 3DBFA 3AD6A 4F09A 2YN8A 3C4CA 2FVDA 2Y9QA 3VNTA 2VWZA 5HBHA 4I0TA 1G5SA 4PV0A 1BYGA 2YWPA 5KX8A 4D2TA 2C68A 4CFNA 3SGCA 2JDTA 1NY3A 1UWJA 3VHKA 5C9CA 4CKJA 4EWQA 1UV5A 2XH5A 2J0IA 3R6XA 1MRYA 3C50A 4FSTA 4EWHA 4IAYA 4RVLA 3KMMA 3G9LX 4TWPA 3V8WA 4F1MA 1F0QA 3V5JA 2J5FA 2C5NA 3BX5A 3BGPA 3HUBA 4O96A 5GIOE 4Y5HA 4CRLA 3N4TA 2PWLA 3EL8A 5AV1A 3OXTA 3IOKA 1OBGA 3KEXA 5D41A 4FG8A 3VBYA 3I0OA 4H36A 4AN3A 4L01A 3E7VA 4X7QA 5ANDA 1W84A 3F5PA 3QA8A 4FICA 4BCNA 3PY1A 5AEPA 5EQYA 1PXIA 2W17A 3LFFA 3QQKA 5EM7A 5HO8A 3UODA 2ZJWA 3GCUA 4QP7A 4O7WA 2J6MA 2XKCA 3ZSIA 5IQFA 3VS3A 2Z7RA 4FIIA 4EZ7A 4TYGA 2X81A 3CKXA 3HDMA 2ZDTA 1M52A 4FTNA 3LXNA 4E6DA 3O50A 4PTEA 3IG7A 1IG1A 2HK5A 2PVRA 4HGEA 2W05A 2C5VA 4JJRA 5HG5A 4FL3A 2G2FA 1OVEA 2YM8A 5CSPA 4NM5A 3PVUA 3CPCA 4FZFB 5E8VA 5F94A 4FSMA 2OLCA 3TXOA 3C4FA 4EUUA 1JLUE 3MFTA 2XEYA 3JS2A 4FKSA 1Q8YA 2KULA 3TDVA 2WTWA 2PVYA 3LFAA 2HY0A 4EOMA 2R3LA 5HG9A 2QHNA 4G3GA 3ZC6A 2OF2A 5AP2A 2JGZA 3PSBA 2PZ5A 2PY3A 4QOXA 4XG7A 4DBNA 3P5KA 4FVQA 4AZWA 4FTCA 4BVUA 1F3MC 2ONLC 1Q61A 3G5DA 4RWLA 1XH8A 5JZJA 1OGUA 2ETKA 2ESMA 3POZA 5IH5A 4GKIA 4HVSA 4W4VA 3DKGA 4LMNA 3LHJA 5KMIA 4M12A 4YBJA 4XYFA 3EQDA 4O0SA 2WEIA 5B7VA 4FTQA 4FNYA 4ITIA 2IW6A 2PUUA 3DKCA 3U87A 4FV1A 5L2WA 5FUTA 4XJ0A 3TT0A 5A4TA 2HYYA 5JGBA 3FSFA 3CCNA 3L8PA 3FDNA 4DGNA 3GCVA 2OICA 4NTTA 2O3PA 5EI8A 5AAEA 1VYWA 2H34A 4E6QA 5EOBA 3R7UA 4EQMA 2VGPA 4BDGA 4CMOA 1EH4A 3EQGA 5HCYA 4CCBA 3NLBA 5FDXA 4EK3A 4BCQA 4FMQA 4U6RA 4KRCA 3OTVA 3VUMA 1PYEA 4YTCA 5B2MA 2UZEA 3T8OA 3KRRA 4MNEB 4TWCA 4IIRA 4ANOA 4O81A 3BHTA 4FZDB 3LLAA 4RBLA 4LRJA 3PLSA 4IAZA 4D55A 2VX1A 4E6CA 5L3AA 4IM0A 4WG4A 2QG5A 3TKHA 3V5LA 3I81A 3GGFA 4G3DA 3RAHA 2J4ZA 1R0PA 3VUHA 3GEQA 4JVGA 4M0ZA 4FTOA 3PJCA 5AX9A 3MWUA 3QXPA 3DPKA 2BALA 3PE1A 3BI6A 3TZ8A 5D7AA 4DH7A 3QTUA 1GZKA 1JVPP 5ACKA 2C6KA 2C6TA 3GNIB 1FPUA 3Q9ZA 3HRCA 2GTNA 4YZCA 2W7XA 5M4FA 4BKYA 1VYZA 4EH9A 1V0BA 1U54A 3MJ2A 4FOCA 4RA5A 5AR3A 4IXPA 2QLQA 2CN8A 3TCPA 4FKIA 2B1PA 2G01A 3K5UA 2PPQA 5JEBA 5CS6A 4EYJA 4DFYA 3FMNA 5IA2A 5IG1A 2C6LA 4RC2A 4CT2A 4A4XA 3O17A 2I1MA 4BDFA 2RFSA 3D4QA 4TPTA 4IVDA 3RCJA 4EORA 4E5BA 2VU3A 2CHLA 1LEZA 1M2QA 4J95A 1OZ1A 2VWXA 3UZTA 5H3QA 4R77A 3AC1A 3KL8A 4EJ7A 1OKZA 4UN0C 3RBWA 3EN9A 4I23A 5IMEA 4G3FA 4DG3E 3ZYAA 4ACHA 4V01A 4RIYA 4BL1A 4JIAA 2HENA 4IFCA 2I6LA 3R7EA 4MD8E 2ZVAA 3GFEA 1VZOA 3EN4A 3FQHA 3A7JA 3HMMA 4PPAA 3RPVA 2V5QA 2JEDA 4ZSJA 3ODZX 1A48A 5CT7A 2PVKA 1PXNA 3KY2A 4YJTA 5M07A 3F7WA 2OXXA 2C6IA 4CKIA 2WMSA 2F2UA 4IX6A 5EK7A 5HE2A 3TI1A 4DGOA 4F7LA 5LMBA 4XBUA 5CEMA 3KRXA 4GMYA 3CSVA 4E4XA 4BCGA 2HELA 3RPRA 3DXQA 3ZLYA 4AN2A 4PNIA 2V7AA 2QI8A 5DT4A 3FKOA 4G1WA 1H26A 3I7CA 3NUYA 2GQSA 4M97A 1OIQA 5T3QA 3HVCA 1YQJA 2C4GA 4TN6A 5IA5A 3V5TA 4M8TA 1P2AA 4RZWA 4EOSA 5I0BA 3UGCA 4EUTA 4E1ZA 1G8SA 4BY9E 5EYDA 4L9IA 3D5WA 3QTXA 4I6QA 4ZSAA 4WNOA 3MV5A 5HO6A 4O2PA 4CV9A 1LP4A 1Z57A 4ASXA 4IMYA 3UIXA 1XBBA 3HAMA 5IUHA 1BKXA 4QQTA 5HGIA 3W16A 2BIKB 3RKBA 4BDDA 2VNWA 3BV2A 1PXPA 4O0TA 3PP0A 4BI2A 4V0GA 1YVJA 5BUEA 4P90A 2EB2A 3VBTA 4UMPA 4XG9A 5FDPA 3WE4A 2HXLA 4JR3A 4CFMA 2IZSA 4AGWA 2RKUA 3FMHA 3TJDA 4BDIA 3OWKA 4YUQA 2BUJA 3HYHA 4YSMA 5CI6A 4RC4A 2IW8A 4FTMA 5EKOA 4OTHA 4ZTLA 5M09A 1YOJA 4ERWA 3KN5A 3QRTA 4IBMA 5CQUA 4F9YA 2JKMA 2R3QA 4IACA 5AAFA 3VS2A 1OKYA 2CGXA 2XKDA 1M2RA 4GJ3A 1J7IA 4J98A 5BVDA 4G6LA 3V8TA 3I7BA 4I5MA 2UW6A 2VWVA 4QP6A 3UYSA 1YOMA 2ITTA 2YITA 4FT7A 5CSWA 4BGQA 2X0GA 4I5PA 5HCZA 5D10A 3DJ5A 4CFUA 4EHGA 1WBPA 3DGKA 2UUEA 5CF5A 4ALVA 5EW3A 4E8AA 1CMKE 4G3EA 4JR7A 4O6EA 4ARKA 4DLIA 3I79A 4S34A 2UW0A 4HVIA 4DTAA 3QUEA 3QTRA 2REIA 3QQHA 4KNBA 5HOAA 4CNHA 4FYOA 3FXXA 4DHFA 2I0HA 3O8PA 3ORNA
chains in the Genus database with same CATH superfamily
5JGDA 4UWCA 4TKSA 4ZTMA 1R39A 3ACKA 3ORPA 1HOWA 5LMKA 4AWIA 1PMNA 2ZAZA 3QUPA 2WTVA 3TNHA 4AQCA 4BDKA 4C02A 4C36A 2E9UA 4F70A 4A06A 3OY3A 5HHWA 3OT3A 4ZLZA 5KNJA 1S9JA 4FV2A 5L2TA 3U9NA 4CKRA 2QOFA 5A46A 4JRVA 2GNLA 3C5UA 2VTRA 4BICA 4RX8A 4YJRA 3RWPA 5CSHA 4M14A 5C03A 3ZRKA 4EOIA 4XUFA 4RMZA 2ITOA 1ND4A 3ETAA 4O7VA 4IB0A 3DS6A 2X9EA 4U7ZA 3C4XA 4NYEA 3MDYA 5BYZA 2EB3A 2CMWA 3E62A 4RWJA 4QMQA 3HECA 1H28A 2J51A 2XBAA 5AR2A 1REKA 1GOLA 2HY81 1DM2A 3CE3A 2A27A 4FKGA 4LGDA 2OZAB 2HWPA 2Y4PA 4CYJA 3NNXA 2W5AA 1B39A 4UMRA 5C27A 2IZUA 3NUUA 3RHKA 4KWPA 2BIYA 3QX2A 1OPKA 5CAQA 4IC7A 2O2UA 1H0VA 3P79A 3DJ7A 2P55A 1OL5A 3SKCA 3H9FA 5HLNA 4B8LA 4LV5A 3PDTA 1Y6AA 3BWFA 2JAMA 4IB1A 3UPXA 2BRHA 2W9ZB 3PG1A 3F6XA 4ZZOA 4YTFA 1H1RA 2YERA 3WILA 4DEGA 3JR1A 5GIPE 3OHTA 3NIEA 2X8DA 3RK5A 2IVVA 2VWIA 2QKRA 4USFA 3I1AA 2ITUA 2YM7A 2BRBA 2PVNA 5E9EA 2FSOX 2VTMA 3MBLA 3UPZA 4C3FA 5EOLA 3H0ZA 1OKVA 2JITA 4F1TA 2NP8A 3SVVA 1GZOA 2XCHA 3ALNA 3UMWA 2I0YA 4FKWA 3GOKA 3ZFXA 4AOTA 5HU9A 3TM0A 5KMOA 4YTIA 5JQ8A 1ZYSA 4CYIA 3U6IA 4CFFA 1NXKA 2ZB0A 3WF8A 1MP8A 2BAKA 3RPSA 3LXLA 4GKHA 5M06A 2EXEA 3JY0A 3AKLA 4QQJA 3WZKA 1JKTA 1RDQE 3W10A 3MI9A 4L8MA 4UB7A 4CQEA 3MY5A 1J1BA 2X1NA 2BRNA 3QU0A 2QO7A 3LAUA 5K0KA 4G31A 4IB3A 4NM3A 3VRZA 2GQGA 3GCSA 2HIWA 3PXRA 3EFJA 3VHEA 3ENHA 3LMGA 3ATTA 5IQHA 3KN6A 2PU8A 4RG0A 5LARA 5BUIA 4Q9ZA 3FZOA 3BKBA 1K3AA 3BU3A 3DKFA 3S4QA 2O65A 3BV3A 2IW9A 3ZHPC 3HDNA 3F3UA 3CLYA 4QT1A 4ZZMA 4YZNA 1H1PA 3PY0A 2FSTX 4BWPA 2OJIA 3NFFB 3FEGA 2XARA 2PE2A 3A4OX 1WFCA 4KB8A 5CU6A 2NRYA 2P4IA 2UZVA 3U55A 4ZEGA 3EQFA 5JKGA 5AM6A 4CG8A 1XH7A 2BAQA 3SQQA 4ZMEA 2OKRA 4MXZA 2QU5A 2WD1A 4UWBA 3IW8A 2I40A 2VAGA 5AUZA 4IW0A 4CSVA 2XNGA 4RVMA 4QTBA 2F2CB 3HUCA 4B4LA 5AADA 4WT6A 2WTIA 5CEPA 1U46A 2Z60A 4BKJA 3R8MA 2LGCA 4DHZA 1UU7A 3E7OA 4RJ4A 2JBOA 2VN9A 3ZZEA 4ZAUA 4FL1A 4KBKA 2R3KA 3DB6A 4QP4A 4YJQA 5AUVA 4BF2A 2C0IA 3PLAE 4FNWA 5DR6A 3M11A 3OWLA 4YHJA 3LCDA 4R8QA 3TJCA 4XEYA 1WVYA 3KXGA 3ORLA 2OF4A 4F1OA 5GJGA 5IQGA 3NRMA 2OFVA 3FLQA 4JBVA 4O86A 3ITZA 2HCKA 3E3BX 4GCJA 5AV0A 3FLSA 3TUDA 4FBXA 4BDHA 4OBQA 3GU7A 4PY1A 4X2GA 4BCIA 3U6JA 3KXHA 1P5EA 4XV2A 4II5A 3R00A 3VW8A 4G2FA 2UZOA 1MRVA 4FSQA 4TYIA 4BCFA 2QOQA 2YLEA 4Q5EA 4L7FA 5AIRA 3DJ6A 4IX5A 3IW5A 5JQ5A 4DA5A 1FVRA 5C4KA 3LFQA 3VBVA 5FM3A 1KE6A 2JDOA 5IDPA 2XKFA 5KUPA 1WBSA 3E5AA 4O0RA 3R73A 2QC6A 3A7GA 4L46A 2IN6A 5AR5A 4BHZA 4JT3A 1PYXA 4IVBA 3BWJA 2IZTA 3LCSA 3SOAA 4BCMA 3ATSA 3PXYA 3PXFA 2ITVA 2X7OA 1H08A 5K5XA 4U3YA 1ZYJA 2ZV8A 3A4PA 2JDRA 3NW5A 4O0YA 5FTOA 4D4VA 2OJJA 1CM8A 4J7BA 2YFXA 4YLJA 4XV9A 4QTDA 2GNFA 2QOHA 4Q2AA 3ZFYA 1ZOHA 1Q8TA 1PHKA 2JFMA 4GV1A 3OXZA 4PP9A 4QYEA 4AFJA 5LVMA 4D58A 4JQ8A 3CXWA 2BCJA 4WO5A 5EDPA 2X2MA 3NUXA 1UKIA 2R3IA 5CVFA 5DEWA 4DEIA 2UZBA 4TYHA 5JK3A 4IEBA 3M42A 2YDJA 4FSNA 2F49A 1T45A 3TV4A 4AXDA 4KS7A 1ZZ2A 4RIXA 5A6NA 4HNIA 5JN2A 3EQIA 3QD0A 3UBDA 4BTFA 4DN5A 3AG9A 4CZTA 4I5CA 1V0PA 2ZMDA 3D7TB 3BHUA 2C6EA 3M2WA 3PIXA 4BZOA 4FTAA 5HKMA 4S32A 3VJOA 4RWKA 5DGZA 3FJQE 5M4UA 4AUAA 3AC3A 2SRCA 2ZV2A 3DXNA 1MQBA 3M1SA 2Z2WA 4DH3A 2ZDUA 4HNFA 3L8VA 2ETRA 3L9NA 4UWYA 5E8UA 3RM7A 3RNYA 3Q60A 2V7OA 2XK7A 3F5UA 5DHJA 3VUKA 3UNZA 3CTJA 2YCRA 5J8IA 1CKPA 3PZHA 3ZOSA 2J9MA 3QZHA 4RVKA 4Y72A 4ALWA 3QD4A 4EOPA 2BRMA 1RW8A 5HTBA 4ZTNA 3EKNA 4DE4A 4PMTA 1IA8A 4E73A 5EI6A 2XK3A 3JYAA 2BMCA 1SVEA 4FKJA 4TYHB 1OIUA 2YZAA 4O0VA 5CU2A 4CTCA 1Q3DA 4MEDA 5CEOA 1BI8A 1CSNA 1SMHA 4EHZA 3GOPA 4QNAA 3CJGA 2WU6A 4C57A 2YM6A 2CNQA 3KVWA 4TWNA 2CN5A 4E7WA 4JAIA 3HMNA 4UX9A 1VLRA 4O2ZA 2X6EA 3W2RA 3MIAA 5LWMA 4O83A 3C13A 4FK3A 4MKCA 2VTNA 4PL4A 2XMYA 4RJ3A 2Y4IC 4ACCA 5TT7A 3GQLA 4B0GA 4MXXA 4R5YA 4MH7A 1QPJA 1PF8A 4KRDA 4BBMA 4F9BA 3C0GA 3GC9A 3NGAA 4ZIMA 2CKOA 3H10A 4B6LA 3QZFA 1DS5A 3OC1A 3W55A 4NEUA 4EK6A 5KMLA 1PMUA 4O38A 4DTBA 4N6ZA 2WTDA 4QMMA 4J52A 4AT5A 5GZ9A 2R4BA 4IAFA 1PY5A 3IW6A 4XHKB 3UP7A 2XM8A 1OIYA 4YC8A 5CYIA 5AR7A 4DLJA 2PUNA 1XR1A 5JFVA 3UOHA 4AQKA 2CNUA 2XF0A 2ITQA 3H3CA 3LLTA 4H3BA 4M3QA 4ZS0A 1ZMVA 3WF9A 3MH2A 2X4ZA 1IASA 4G6NA 5B0XA 3VUTA 5GHVA 4QTEA 5HTCA 2CGVA 2WMVA 2JIVA 3QCYA 3C4ZA 4XS2A 3QA0A 4YPDA 5A4EA 3AC8A 2P0CA 5AUYA 4X2JA 4X6RA 2A0CX 4UY9A 2XNMA 1OUYA 4QEBA 4Y83A 3VULA 3BHVA 3ORKA 4IWPA 4DFLA 4Z7HA 3KA0A 1URWA 3O2MA 3U9CA 3ZO1A 4M68A 3VF9A 3EH9A 3LW0A 5FQDC 3F3WA 2OJGA 3PSDA 4FK6A 3HP2A 1FVTA 2X7GA 3AC5A 4D1ZA 1H0WA 4E26A 3DB8A 4E6AA 5CVGA 1U4DA 3VS0A 4CTBA 5ITAA 4BYJA 2B4SB 3SHEA 3R1NA 2W0JA 5I5ZA 2Y6MA 1TVOA 3UTOA 3BCEA 3HLLA 1GY3A 2FSMX 4BIBA 2YCFA 3L9PA 5AA9A 5A6OA 2DUVA 4D2VA 1Q8UA 2J0KA 3EIDA 4JBQA 5E90A 4AA0A 4AW0A 3ENMA 4FA2A 2E9VA 3QCSA 3R9HA 3KB7A 4AW1A 3F82A 4M66A 2Q0NA 4C4HA 5I9WA 4RFYA 4MX9A 3E64A 1DI8A 3PSCA 3TUBA 2PVJA 3NCGA 1JKLA 3CGOA 3PY3A 3NCZA 2NRUA 4W9XA 4ZK5A 4DT9A 2R3JA 4JS8A 4MVFA 4I6LA 4FV6A 3Q9YA 4HPUE 2PVLA 3LFBA 5L8JA 1CTPE 1SVHA 2W4JA 1XJDA 4J8NA 2EXMA 4YLKA 3TV7A 4ANQA 5A54A 5KMKA 5C8NA 2BHHA 3CD8A 2R2PA 3K3IA 3OCBA 4YHTA 5CEQA 3UJGA 4QP8A 4BCKA 4D2RA 3ZEPA 2IVTA 2VO3A 3UE4A 3WI6A 4NCTA 2WZJA 3FXZA 3R0TA 5ETAA 5C26A 5M44A 2ZB1A 3DY7A 1FGKA 2IZRA 3SXSA 1PMVA 5DMZA 1ZOEA 3KMWA 4U0IA 5FBNC 4U9AA 5FRIA 4CGAA 3QLFA 5F95A 2BKKA 3CP9A 1W98A 4O4BB 1W2CA 2R5TA 3FXWA 1CKJA 3BYOA 5ANIA 5CEIA 3QYWA 3GUBA 5FXQA 1H00A 3HMOA 3EFKA 3VW6A 5CASA 1UA2A 4I0RA 2C47A 2R3GA 3N9XA 3FBVA 2GHGA 3QD2B 4H05A 1ATPE 3FMEA 3D83A 3BGQA 4F0GA 1J7UA 3GCPA 2PULA 4CMTA 3ZLSA 1XWSA 3B8RA 4WRGA 4ZMFA 3IDCA 2PMIA 4L6QA 4PPCA 1U5RA 2EUFB 5HIEA 5KMMA 4JG8A 5HNGA 3ZUVA 3QRIA 1BL7A 3HMPA 2BDJA 1GZNA 3T3VA 4DITA 2RF9A 2C1AA 3A8WA 2IPXA 4YJUA 1S9IA 2C0TA 3QQUA 1OI9A 2W9FB 4GK2A 2W5BA 2XIZA 2QODA 5DPVA 3KCFA 5TE0A 1O9UA 2C30A 2XNBA 4U44A 5FLFA 4BCOA 4FIHA 4C4GA 3IONA 3PRIA 2VTSA 3R01A 1BI7A 4RA4A 5LMKC 4HGLA 3EQPA 3MS9A 2X39A 3TYKA 4UZHA 4MNEA 3WE8A 5L2IA 2WOTA 1QCFA 2UVXA 3QALE 4C2VA 4FL2A 4JDIA 4QRCA 2OIBA 2YZLA 3ODYX 3C4EA 4UEUA 5EKNA 1IAJA 1PJKA 3R9RA 1KSWA 3FZ1A 3UVQA 4GS6A 2YM4A 4FG9A 4C37A 5KMNA 4KIKB 4XX9A 4O0WA 2ETMA 2PHKA 3O7LD 4LGHA 3V6SA 4AACA 5E91A 5BYYA 4IX3A 5E1SA 2ITPA 4QTCA 4FV3A 1YHWA 4GRBA 4FIFA 3EOCA 3UDSA 3EMGA 4AOIA 1SNXA 4ANMA 5IQAA 2I0VA 3NUAA 3JVSA 1YXXA 4EI4A 4IVCA 1NA7A 4YR8A 3COKA 3D14A 5BMSA 4D0WA 1WAKA 4FTJA 3GU4A 4C8BA 4U45A 1JNKA 1X8BA 4YNEA 4EQCA 5HVJA 3R8LA 2B54A 5BV3A 2FYSA 2VO7A 4JBPA 5DR9A 3BLAA 4D9TA 5CEKA 1YDRE 4U79A 5DRDA 2YDIA 4XP0A 3WYYA 5FEDA 2XKEA 5CF6A 5K0XA 4QMNA 2VWYA 4HYUA 2XJ1A 3MESA 3PJ1A 3QL8A 4N0SA 1ZZLA 4GUBA 5IF1A 5DNRA 3QHWA 3ZXZA 5GINE 2KTYA 3U8WA 3MA3A 5HESA 4KIQA 5JZNA 5J95A 3W32A 3PWYA 5HE0A 4BR3A 3F9NA 2J0MB 4ZXTA 3VQUA 4LUEA 4WSYA 5HZNA 4XNEA 2G2IA 1IA9A 1YWVA 4ZSGA 2O8YA 2WPAA 3E3PA 5FP5A 4PQNA 5CU4A 3C4WA 4FV9A 2PUIA 3R63A 1XO2B 5FXRA 2VNYA 2UV2A 2CJMA 2IJMA 4M84A 1H4LA 4TWOA 3FUPA 3VRYA 4GYGA 5DI1A 2OJFE 5IUIA 3FY0A 4M69B 3VS6A 5IA1A 4D0XA 1ZOGA 1Y8YA 4I4FA 4DC2A 3I5NA 2BAJA 1KE9A 4EEVA 4DTKA 4D2PA 1KE8A 5E8TA 5JFWA 1WBVA 3SXRA 4AU8A 1YXUA 3VS7A 1UKHA 5ANJA 2W06A 1GJOA 1ZY4A 3ZLXA 2C5OA 1YI6A 4YZBA 3Q32A 2XS0A 1H1WA 1XHAA 3P0MA 3H30A 3OBGA 4O4EA 4FI1A 3NNWA 3R9OA 3SW4A 1SNUA 2EWAA 3P9JA 5TF9A 4K11A 5K4IA 4O4DA 5LXMA 3AGLA 3IK3A 4CLIA 2B52A 4NJ3A 4ZTRA 5DH3A 3H9RA 3W2SA 5AV3A 4F9WA 1W7HA 1LEWA 4S2ZA 1PRYA 4RFZA 4MCVA 4NFNA 3ZFMA 3RAWA 4YSJA 3PA5A 4ZTSA 5I9XA 3F88A 3RAKA 4L00A 4A9SA 1PKGA 2VWBA 1P14A 4NIFB 4TTHB 4X3FB 3NR9A 3R8PA 1MRUA 2B0QA 2WMUA 4IWQA 3FYJX 2C5XA 4USDA 3MSSA 4L68A 4AGCA 4NTSA 3FI2A 3KQ7A 2VWWA 2YJRA 3FHIA 4Q9SA 3I6WA 2WQNA 2W4OA 2F7XE 4IZ7A 3SG8A 4O91A 4AZFA 3JUHA 2JKKA 4IDTA 3TZ9A 4Y8DA 4FEWA 3Q4ZA 2CKPA 4UALA 3R7IA 4H3QA 4K9YA 3Q4UA 3DLSA 5KBQA 3C1XA 3DQXA 2HAKA 4ZS4A 4E93A 2CGUA 3HX4A 4NSTA 5AP7A 5JMSA 3ZO3A 4OR5A 5KO1A 2R9SA 1W2FA 3BPRA 2PUPA 1OITA 2XIYA 2ITYA 5HCXA 1OUKA 3KF4A 3HV6A 2P2IA 5I3OA 3KXNA 5BUJA 1G8AA 5KCVA 3W18A 3UQGA 4LYNA 4FZAB 4S30A 4B8MA 2ITNA 1YXTA 1B38A 5IA0A 1UU8A 3F2AA 3QCXA 4I92A 3UZPA 4D2SA 4F6SA 4LOPA 2HW6A 5IDNA 4M13A 4AAYA 3VS1A 5E8ZA 2QOBA 5CQWA 2X6DA 4M0YA 4FKVA 5GNKA 3WYXA 3TDWA 3MH0A 4GVAA 5M57A 1W82A 3OF0A 3PG3A 2YM5A 5AM7A 3MJ1A 4KKHA 4GT4A 1BMKA 3V5WA 3PA4A 5AJQA 3WIGA 4DEBA 3NEWA 2X7FA 3ZRLA 3RWQA 4MQ1A 4AGDA 2W1FA 4X6QC 3SV0A 4OGRA 5D7VA 4YBKA 5AV2A 3LKMA 2A1AB 3NZ0A 3GI3A 4MQ2A 4DGMA 3I4BA 4PDSA 3WOWA 1M2PA 5DVRA 4CZYB 3PYYA 2VRXA 4TXCA 3QWKA 4C38A 4AZVA 5EDRA 3FY2A 2OZAA 4G9CA 2J7TA 3BYUA 3IW4A 2OXYA 4HVHA 5GZ8A 1RE8A 2W5HA 3E8DA 3ZEWA 2W1IA 4IM2A 3DXPA 3QTQA 3FKNA 4L43A 2X2KA 3MY1A 1TKIA 5EYKA 3VVHA 5AX3A 1GNGA 1ZWSA 4XV1A 3V3VA 5A4QA 2EU9A 3HZTA 4DG0E 5HVYA 2PE1A 5DN3A 2GFSA 4K18A 3CBLA 5KHWA 3OD6X 4ID7A 4HYHA 4RGJA 5EYMA 4BBFA 4BWKA 4I41A 1AQ1A 1OKWA 3R7OA 4ACDA 4EZ3A 3W2CA 3G33A 4DHIB 1MUOA 2H6DA 2CPKE 4EKKA 2C3LA 2QOLA 1ZXEA 3G6GA 3OY1A 4KAOA 1WCCA 3PIYA 4KKEA 1QPDA 2QOKA 2R3FA 3EQRA 3FC1X 3MGYA 2UZLA 4Q5HA 2AEGA 4GVJA 3EN6A 5F1ZA 2E9OA 1CKIA 4WBBB 2FH9A 2EVAA 3E8NA 4AAAA 4KIOA 1GIHA 2YABA 1TQMA 2QOIA 4L42A 2ITXA 3C7QA 2JKQA 5C8MA 1IEPA 4D4SA 4G17A 4D28A 4GH2A 5CNNA 4AXEA 1V1KA 1IAHA 4JL9A 3BEGA 2WMRA 4FSWA 3UO5A 1H07A 1Q3WA 5LMAA 1Q5KA 3SC1A 2QR7A 2A4LA 5CU3A 3IECA 4AOJA 2ERZE 3AD5A 4GFGA 5GJFA 1XH9A 4RPVA 4ANLA 4BYIA 5IZFA 4RIOA 3FKLA 2XEZA 1PW2A 3FV8A 1JSTA 3Q3BA 4U5JA 5DOSA 5JGAA 4OT6A 4QP2A 2PZYA 2P3GX 1KOAA 1Y6BA 1PMEA 4ZSEA 5F20A 2GNGA 4RQVA 4FEVA 2CKEA 4PF4A 2BILB 1NVSA 4NKSA 2UW9A 4WBOA 3L9MA 4MYGA 4YPSA 3GT8A 4MBLA 3PUPA 1TQPA 3EYHA 4O1PA 4RX7A 3BBWA 4OBOA 3MIYA 3PVWA 4QMSA 3EQHA 4RX5A 3EFLA 3D2IA 5DE2A 4ZY5A 3QKLA 4Y46A 4ZLYA 4Y95A 5LWNA 1UU3A 3RJCA 2JC6A 5JRSA 3QTIA 3DK7A 4R1VA 2R3NA 2PVFA 2PVHA 2W99B 4GSBA 4FGBA 2R7BA 4IADA 3RK7A 3TNWA 3RAIA 3KGAA 3KULB 4NZWB 3R7YA 4C2WA 2OFUA 1ZYDA 4GFOA 3RGFA 4FUXA 5BVNA 3QX4A 4BRXA 4FKOA 1G8KA 2AUHA 1ZAOA 4S33A 3UMXA 4LV7A 4J1RA 3ROCA 3IGOA 3FMDA 3NX8A 3JXWA 5HEZA 4OTRA 4L44A 3UQFA 2OG8A 3DBQA 4QQCA 1OL6A 3S1HA 2QG7A 5DLSA 3KIOC 4F63A 2B9FA 3JPVA 1YDTE 4HGSA 4RIWA 2BRGA 4Z3VA 5HBJA 4AP7A 1OPLA 4JXFA 4PPBA 4USEA 1YW2A 3O51A 3G2FA 3LFCA 3LJ0A 3QKKA 4C4EA 5LJJA 5A4LA 4JNWA 4A9UA 4ITHA 4K6ZA 3FZTA 1UNHA 3LOKA 3ZH8A 3LFDA 5E1EA 3TWJA 1ZYCA 3RP9A 2VUWA 3EFWA 4E4MA 2GS7A 1KWPA 5CAOA 4FOBA 3OEFX 5AR8A 4QTAA 3EYGA 4JX7A 4F08A 3O7LB 5BX0A 4V05A 4I6BA 5EDQA 4WHZA 3TUCA 3TIYA 4GW8A 5DIAA 5ANOA 5ETCA 5LVLA 2VV9A 3FZPA 5DT0A 2J0LA 4FKLA 3I6UA 4R7IA 4V04A 4YZDA 4BCPA 1UNGA 3FSKA 3NPCA 4L3LA 1CDKA 4L3PA 3SAYA 2Z7LA 1V0OA 3IS5A 2HOGA 5HBEA 2X0PA 4RIWB 3MVHA 3UZRA 3G9NA 1H25A 3PVGA 2OIDA 3CIKA 2WQBA 2O64A 5CAVA 1Y91A 1Q99A 3E63A 5K9IA 4YU2A 3E8CA 4ERKA 4EH3A 2VTHA 3EHAA 4O7LA 2R3HA 2B9HA 4C4JA 3KCKA 4I4EA 4LL5A 4JMQA 4RJ5A 5L4QA 1E1VA 4PTGA 4OBPA 4TL0A 3CD3A 3N51A 4LRMA 3A60A 3ROYA 2B9JA 3G0EA 5BPYA 3Q52A 4U81A 2PK9A 4YLLA 3OZ6A 3AMAA 4CMUA 2UZNA 4FEQA 3PXQA 2BR1A 3ZDUA 3Q4TA 4JG7A 1P4FA 5AIKA 4A07A 3LMHA 3ZBXA 4AXAA 4BWXA 1J3HA 4GU9A 1BL6A 3NW7A 4NCTC 5AP3A 3JVRA 2ACXA 4ZJIA 3SXFA 3D7TA 3MFUA 3O96A 3AMBA 3LXKA 1PXJA 3PPKA 3QTZA 3PFQA 4HYIA 4O84A 2XNOA 4W4XA 5H2UA 3UOLA 2ERKA 2YISA 3GB2A 3AXWA 3QC9A 4I21A 4G3CA 2G15A 3EJ1A 4JLCA 2YAKA 3PE2A 4GU6A 2I0EA 5C8KA 2GNIA 2RGPA 4AG8A 3E88A 4FSRA 4KSQA 3D5XA 3NUPA 5HD4A 4HOKA 1U5QA 3IQ7A 4YNOA 2VTJA 3UVRA 4D5HA 3IGGA 3OCSA 3R8ZA 5ETIA 3U54A 3R28A 3LMIA 5AMNA 4JG6A 4FVRA 1TFFA 3MTLA 4LOQA 3DV3A 4AZSA 4CLJA 4EL9A 1L3RE 4UMQA 2FSLX 3ELJA 3KRJA 5AAGA 4KUJA 3OCGA 2A19B 4PWNA 3SRVA 3UOKA 2UZUE 3DDQA 4PMMA 3CY3A 3AC2A 4FV7A 2YIXA 4BI0A 5L6OA 3C5IA 4QPAA 2HZNA 5IQBA 4ZSLA 3NVMB 4O7ZA 4F7NA 2GFCA 3PJ8A 4PMPA 3LVPA 5IH6A 2IVSA 5DA3A 3IKAA 3E93A 1FVVA 1TZDA 4S31A 5IISA 3GQIA 5AP0A 1XKKA 4RLLA 3NYNA 3NYOA 4B99A 4EH5A 4R1YA 2OJ9A 2VTIA 5CAPA 3Q53A 4A4OA 3ET7A 3EKKA 4RFMA 4FNZA 1PXLA 5HICA 5IUGA 1Q97A 2Y7JA 2DYLA 2WOUA 3QQGA 4FTUA 3O5AA 2RFNA 3NDMA 2GQRA 4DEDA 3KK8A 4I22A 4RQKA 3UIBA 3ZUUA 2JLDA 3LZBA 4JDHA 3AC4A 4IM3A 1M7QA 4CZUA 3RPOA 1OB3A 2ZV9A 5CT0A 4OTGA 2XNEA 4O0XA 4Y73A 4O1OA 3IOPA 4O4FA 2E9PA 2WQMA 2IWIA 1R1WA 1VEBA 4QNYA 4I1ZA 3PXZA 4PX6A 4IDVA 1SYKA 3PZEA 2XJ2A 3ZLWA 5G1XA 2UZTA 3OEZA 4J97A 4WNMA 3SRVB 3R9NA 4YC3A 5HG8A 2WB8A 3NYXA 4FZ7A 3OP5A 5HI2A 3UC4A 4DFXE 4I24A 4CFXA 2YIWA 4Z55A 5DWRA 3OS3A 3H9OA 1OBDA 3QZGA 3V01A 4A7CA 4G5JA 2Y6OA 5HE3A 2C6OA 4ZY6A 4FKTA 3CJFA 4KABA 3MVLA 1Q62A 3F5GA 3NWWA 4I0SA 3G6HA 1RJBA 4YHFA 2HZIA 4IAIA 2WQEA 1H1QA 5CVHA 2Z7SA 3QRKA 2R0UA 3VUGA 3LJ1A 2CCHA 4JOAA 4N70A 4X2KA 3R9DA 2R0IA 2QOCA 4TZRA 4A4LA 4F7SA 5BVOA 2FB8A 5BQ0A 2OWBA 1YHVA 5E4HA 1W8CA 4EBVA 4DCAA 1UVRA 1J91A 3QFVA 3IW7A 1ERKA 2QCSA 4FR4A 3EWHA 3G51A 4IAAA 4UBAA 4O27B 2JKOA 3A62A 3WZJA 2WMBA 3KMUA 4DH1A 4AFEA 3EL7A 3FLZA 4H3PA 4LI5A 3OTUA 3VIDA 2CLQA 3L8XA 4QP9A 3BL7A 4M7IA 5CZIA 4EK8A 2WNTA 4QDEA 4P5ZA 3OWJA 4KD1A 4RT7A 2HXQA 5DG5A 1LPUA 3TZMA 4WUNA 3F61A 3KF7A 4X3FC 1OL2A 1YXVA 4TY1A 3UG2A 4L3JA 4DAWA 4DEHA 2BZIB 3D9VA 4PDPA 3CEKA 3S95A 4LV8A 2W1EA 1Q24A 4YMJA 3WZEA 1FQ1B 3KXMA 2E9NA 3W8QA 4EJNA 5FGKA 4U8ZA 2WIHA 4EOJA 5AP6A 2VX3A 2WMTA 4KIPA 4K8AA 5H8EA 4FX3A 4GJ2A 2CGWA 4JDKA 4HJOA 3FWQA 4R3RA 4WG3A 4YJVA 3THBA 3ZCLA 3ZM4A 3U6HA 3LM0A 1A06A 3KREA 4ZY4A 1XH5A 4QDVA 2JIUA 4FTTA 4QP3A 2B53A 4EK5A 2J90A 3NVKI 1OM1A 5IQDA 4FYNA 5BVKA 3R22A 4FC0A 4O82A 5D12A 4E20A 2XYNA 3NIZA 4CVAA 4R5SA 3H0YA 3I5ZA 3NS9A 5FD2A 5M4IA 1M14A 3NNUA 1JWHA 3KXXA 3AD4A 4C33A 3F2NA 4FEXA 5FP6A 4LDTA 1PXKA 4EHVA 3NYVA 4Z16A 4FZ6A 3W0OA 3SA0A 4E5AX 1M7NA 3LCTA 4QMTA 2X4FA 4HVDA 3N4VA 2R3MA 4P7EA 4ANBA 5J9LA 1AD5A 1XMLA 1XH4A 3FPQA 4QMVA 3FPMA 5J5TA 2W96B 3OROA 4FSUA 2XK8A 4YO6A 4IZYA 4ZZNA 1YWNA 2CDZA 4AA5A 4ZJJA 3QWJA 3DAEA 2ZM4A 4PL3A 2XNPA 1OPJA 4UMTA 4C7TA 4DINA 3LQ8A 2HZ4A 4FV0A 3ZSHA 4BGGA 4IJ9A 3K2LA 4L67A 4DG2E 3BEAA 3FMJA 3Q96A 4YP8A 4AF3A 1QPCA 3W2QA 2VTOA 3LCOA 3