3ORXA

Pdk1 mutant bound to allosteric disulfide fragment inhibitor 1f8
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
285
structure length
283
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFCFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQRANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Turning a protein kinase on or off from a single allosteric site via disulfide trapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 283
sequence length 285
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3orxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3orxA01
2WZJA 2O63A 4H58A 3QD3A 5EHOA 1R78A 2E9NA 3HRCA 2Y4IC 3RM7A 4E73A 3LE6A 3GOPA 3ORLA 4FTOA 3OD6X 4BTKA 3R9HA 3SV0A 2BDJA 3KGAA 3KK8A 2HAKA 4IX5A 3TZ9A 3V5JA 1R0EA 5DR6A 3LFSA 4QNYA 3T3UA 3EMGA 2QC6A 2XK9A 3VUKA 2YDIA 3FMMA 4CZUA 3CSVA 3HMNA 4FTTA 2F7XE 2OK1A 4FKVA 4GT5A 4JXFA 4M97A 3DY7A 4J96A 4BF2A 5IA0A 3ODYX 4QTEA 4R7BA 3Q2JA 3VJNA 5CY3A 3W10A 2QOBA 1P5EA 3BLHA 5T6KA 3ZFYA 4FKQA 3HMOA 4CFMA 5C8MA 2PVHA 2GQRA 3B8RA 5L2WA 3MV5A 4RJ8A 4EWHA 4F63A 3WYXA 1FMOE 2PVRA 3IS5A 4G31A 4A9YA 3R8VA 3MESA 3FYJX 4CFXA 5GHVA 3KU2A 4IAZA 4ITHA 4MKCA 2WOTA 1Q4LA 4G6LA 2CKEA 4WUNA 3UP7A 5KMMA 4O0VA 4TL0A 2JFLA 5HO7A 2HW6A 4FEVA 4F9BA 3F82A 3F2NA 2WTJA 3NW6A 4I0RA 4EJ7A 4IVAA 2OJIA 3ZUUA 5A54A 4BDIA 4D1XA 3Q32A 3N51A 4N57A 2ITWA 1JKSA 3KXHA 5BMSA 2YIQA 4E8AA 3LW0A 3OTVA 4OT5A 4FIFA 3Q9WA 4FNYA 1BI8A 1Y8YA 3P5KA 3QALE 4W8EA 2BUJA 4A9SA 3JUHA 4HW7A 5AM7A 2KULA 4WUAA 2X2LA 5EOLA 1UWHA 5LVNA 5E7RA 3WZDA 3AC4A 2J50A 3ELJA 4IDTA 4IX6A 1PF8A 3G6GA 5L2QA 3TJCA 3TL8A 4RX5A 5CEMA 4ACDA 4TWNA 4O0RA 4TPTA 4DFLA 5AX9A 5C8KA 4YUQA 1Q61A 4MBIA 4UZHA 5E1EA 4BDJA 4L3PA 4V01A 3NW7A 2ONLA 3O17A 4USFA 3RM6A 1KV1A 2WTIA 3FQHA 4FR4A 5CLPA 3R8LA 3K5VA 4YSMA 5GIOE 3QKLA 3KCFA 5HVJA 3S2PA 2PUPA 4FX3A 2RL5A 3MH0A 2I0EA 4ACCA 3ROYA 1IASA 4HVIA 2Z8CA 4S2ZA 3F5PA 4FSUA 3H9RA 2G2FA 2W5AA 1TQIA 2UZTA 5JT2A 2W4KA 1STCE 5ANEA 3D83A 4EH2A 3CPCA 5BVFA 4NWMA 3RHXA 2Z7SA 2C6MA 2UZUE 4R6VA 3QTZA 3QZGA 5HE3A 3KMMA 3LCTA 4XS2A 3HNGA 4XBRA 2B55A 5DEYA 4D55A 3LQ3A 2HZ4A 2QOHA 3EFLA 2XKEA 2BZKB 1URWA 4YJVA 3UYTA 5J9LA 4MXZA 2WMUA 5FTQA 2W17A 5AEPA 4MD7E 4YTCA 2GDOA 1BLXA 2X1NA 2DUVA 4XG7A 3AT2A 1A48A 4K11A 4UBAA 4O6EA 5HG8A 4F7SA 3G33A 2W99B 4D2WA 4B6LA 2W05A 3FDNA 4M66A 3NMUF 2ZM3A 4RJ3A 4IWOA 2QOIA 5E8TA 4WSQA 2YM3A 4ARKA 3PA4A 4FGRA 3PG3A 4GRBA 3P79A 3D9VA 3R2BA 3OS3A 4ITIA 5A14A 4O7NA 1UNLA 3AC2A 4TN6A 4USEA 4DITA 2EXEA 3AXWA 2FVDA 3F3WA 4D2SA 3BU3A 3PY0A 5M44A 2JC6A 5HG5A 2XK4A 3FKOA 4OLIA 3EQBA 4FF8A 3WILA 4D1ZA 4YGAA 3MFUA 4J7BA 5K5XA 4W8DA 3PDTA 3QQLA 3VIDA 4NM5A 3MY5A 3ZRMA 4AU8A 3NVMB 3R04A 4G6NA 1U59A 4H36A 3F5GA 3O8UA 3FZSA 3VJOA 2RFSA 1H24A 4U7ZA 3A4PA 4EK8A 5BQ0A 1R0PA 2Z2WA 5KBQA 4DFYA 4G6OA 2J2IB 2C3JA 4PUZA 3R7EA 4APCA 2VX1A 2UZLA 3UIXA 4CV8A 2WTKB 3Q4ZA 1GIJA 5L6OA 4FV6A 4J8MA 4FMQA 3TDWA 3ORTA 3KVXA 3F9NA 1J7UA 3HKOA 3SVVA 4FTKA 4D28A 1OL2A 4KNBA 2F7ZE 4HVHA 3OEFX 2WQEA 5E1SA 2CKQA 4BDDA 2CKPA 1Q3WA 3OWLA 3DCVA 3MVJA 4FTCA 3UODA 3PPJA 4IWPA 3W8QA 3ZBXA 3SW7A 5BVWA 5CWZA 2R3OA 3ORNA 3KFAA 4EZ3A 4QP3A 1OZ1A 3V8TA 1T45A 3QC9A 2GTMA 4ACMA 1SMHA 2F9GA 2PE2A 3W2QA 5KMLA 4AACA 4B8MA 4EH3A 3NUUA 5AR7A 1K3AA 1P4FA 1UU7A 1WMKA 3F3ZA 4GJ2A 3NZ0A 4RVMA 2BAKA 3PSCA 3QQFA 1M7QA 4O2ZA 4EOSA 1Z5MA 5AP3A 2RSVA 4QPAA 5HORA 4FIHA 5JGDA 5AWMA 3ATTA 2BDFA 4IFGA 4JDKA 2YZLA 3ZLYA 4NM3A 3TKHA 5CNOA 4M0ZA 5AR5A 3DKCA 3TZ7A 4BY9E 5HZNA 4FNWA 1H00A 3QF9A 4UV0A 2GNHA 4GVJA 4I92A 5CNNA 3SXSA 1XKKA 2B53A 5EYDA 4YJRA 2IVUA 4E7WA 5LJJA 2CDZA 5AIRA 4GL9A 1PKGA 3DT1A 4F9AA 2O3PA 1G8AA 2WQMA 5EI8A 5FBNC 3AC3A 4E5AX 2IVSA 2XNMA 5EQYA 5F9EA 1ZOHA 3SDJA 2WMQA 3PFQA 3PSDA 3ZFXA 3R83A 3UC3A 3DK6A 4LYNA 5AADA 5AUZA 2YHVA 4U97A 3C4EA 4NCTC 4XJ0A 5TR6A 3R7GA 4IM2A 3CY2A 4C57A 4WOVA 5KE0A 5CEKA 4OTHA 4EYJA 2GSFA 4YTHA 3S1HA 4JIAA 4W4WA 5TO8A 2OFVA 2VTOA 4C38A 4WO5A 3HYHA 3RZBA 3VS2A 5A46A 3IPHA 2R3NA 4F4PA 1IR3A 2Z60A 3PZEA 2B0QA 2BRGA 4C3FA 3GC0A 3MPTA 4GV1A 4UWCA 4FKSA 4IBMA 2J5FA 2QLQA 2VTHA 5H2UA 4QOXA 5I9XA 2DS1A 5M4IA 2WGJA 2ZV9A 3GCSA 4CG9A 3IK3A 3QUPA 5CEPA 2OU7A 4R8QA 4IM3A 2WNTA 3O8TA 4BGGA 3NR9A 2AC3A 3UVPA 2ZDUA 1REKA 5KUPA 3QKKA 1Q3DA 1FGIA 4UALA 4I20A 4WHZA 3W16A 2W1HA 4GK3A 4K1BA 5AAEA 4FG9A 4FV5A 4MNFA 3AT3A 4ZJVA 2Q83A 1JSTA 3CD8A 4OBPA 5JZNA 5AP0A 4PRJA 4B99A 3VC4A 2BAQA 3KMWA 3UOHA 2WMBA 2YJRA 4JG6A 4O0YA 1NVQA 1OM1A 4YP8A 4BWPA 5J79A 3NNXA 2BCJA 2OXXA 3PY3A 5CTPA 5A6NA 3O71A 5IQHA 3CLYA 4NSTA 3W18A 4PP7A 3LFBA 5CT7A 4Y72A 2OIQA 2ERKA 2Y6MA 4EKKA 5L2IA 2X4FA 4IAAA 4HOKA 5BVEA 4L3LA 3SG9A 3MWUA 3QA0A 4ZSEA 4FL2A 4U42A 4LMUA 1OECA 3LXKA 4BHZA 2C6TA 2V5QA 3DGKA 4FKPA 4ZMEA 4C4GA 3T9IA 4IC8A 5FM3A 4QMVA 3C4XA 3MN3A 2CNQA 3TUBA 4Y83A 3VS1A 4ZTMA 3CGFA 1YI6A 3QZIA 2F7EE 2IJMA 4RWJA 4WA9A 1OI9A 5CVHA 5DN3A 4DGMA 2B1PA 1OL6A 3U4WA 4EOOA 2W5HA 2YCRA 3CIKA 1Q8YA 3UOJA 2GPHA 3ACJA 3R22A 4K18A 1OL1A 5GINE 4RVTA 4A9RA 3VW6A 1J7IA 3OXTA 4O1OA 2HWOA 4UXQA 1OKZA 5HCYA 4F08A 3NPCA 3DLSA 5CX9A 3ALOA 3ZC5A 4TYJA 2ITUA 2WU7A 3AGMA 2UUEA 4FNZA 3COKA 4IANA 4OR5A 3R1QA 4E4MA 4AQCA 4FKWA 3TKUA 1TQMA 4XV3A 3DXPA 1NT2A 1SNXA 5C8NA 3UP2A 5BYZA 3OW3A 4Y5QA 4GIHA 4JDIA 4DTBA 5LCKA 5G6VA 5KMKA 3ZM9A 4MF0A 5T68A 4ERWA 2R0UA 2JKOA 3TT0A 4CT1A 4EH5A 3RBWA 3MFSA 1ZZ2A 4P7EA 3MIYA 3ZXZA 3Q9ZA 3LCDA 4J52A 4QT1A 4RC3A 1HOWA 1XO2B 4RIYB 4E6AA 2JBPA 3HV5A 2R3MA 3NNUA 3TV6A 2UW5A 4L67A 2XJ1A 5IZFA 3FXWA 5DVRA 4F64A 4TNBA 5HCXA 5HHWA 4RJ7A 4BICA 5BYLA 2H34A 3CKWA 3MA6A 2F2CB 3ZSGA 2DQ7X 1XBBA 3ORMA 3QQKA 1U4DA 3RAWA 4IVCA 4BGHA 3IDPA 4CCBA 4F7NA 4KWPA 2PU8A 3TKIA 3DBEA 3QQGA 3ULZA 2I1MA 4WRGA 1E9HA 5M53A 3LCOA 4RX9A 1Q8ZA 2W1CA 4UB7A 4XLVA 1VR2A 2FSMX 4L01A 3H10A 4EHVA 3LFQA 1Y8GA 2EXMA 3VO3A 4LV8A 4QP4A 5AUTA 3QX2A 4MXCA 2C47A 3DTWA 4EHZA 3EZRA 4NZWB 1UA2A 2QD9A 2WMTA 2RG5A 4HYUA 3RI1A 3TDVA 3TACA 3TM0A 3SKCA 3FMHA 4TXCA 5CSVA 4FUYA 5HNIX 4F1MA 2BFXA 5IG1A 4L3JA 2Y4IB 2OWBA 4O21A 4CZTA 3R30A 4CKRA 4RGJA 2XKDA 3TZ8A 3CKXA 4QYYA 3MGYA 2WFYA 3Q5ZA 3Q6UA 4DEBA 3R7VA 4ZTSA 2V0DA 1LP4A 4IVBA 5I3OA 2BILB 1PXOA 3TV7A 5K0XA 3PG1A 1QPDA 4GYGA 2PMLX 3QTSA 3PWDA 3BGQA 3IW4A 3JVRA 4QQ5A 4RLLA 3UNKA 5AV3A 1GOLA 2YACA 5JMSA 4LL0A 2XIKA 2VGPA 5A4LA 4AGUA 4XH6A 2RF9A 1YDSE 1VYZA 1FVVA 4LOQA 3UG1A 4MBJA 4C0TA 4F6UA 2VD5A 2WIHA 2BRHA 4JQEA 3P78A 3ORPA 5KNJA 4X2JA 4F6WA 4GUEA 1CTPE 1PMEA 2FO0A 3EJ1A 3MH3A 3AMBA 3KF4A 4YPDA 5HIEA 2C5YA 3P7CA 5JFWA 2C6EA 4MXAA 2G01A 3C4ZA 1L3RE 4FSWA 4O27B 3TI1A 1PXJA 3SLSA 2X6DA 4WG5A 4QMSA 3C4CA 5HG9A 2SRCA 1MRUA 1A9UA 4TTHB 4AZFA 4FEWA 1U54B 2IPXA 4BCFA 3LXPA 3P4KA 4HZRA 1WZYA 1P14A 3F66A 4K33A 3BRBA 3DJ6A 3PRFA 1PYEA 4L00A 4KIOA 4ASZA 4QTAA 2OSCA 4D4RA 3GC9A 4G17A 4WBBB 2PSQA 4S30A 5G1XA 1FMKA 3T8OA 4TYHB 3A4OX 4YLJA 4CRSA 4C4IA 3FXZA 3VQUA 4Y46A 5AM6A 2PVFA 1Y91A 2VTPA 4ZTNA 3QBNA 5ANGA 1GAGA 3EQFA 2EB2A 3UPXA 2IZTA 3JY9A 4HNIA 5JFXA 1YOLA 2R5TA 4L43A 4EK5A 2WMSA 4NIFB 4CLJA 4WNKA 1K2PA 1P4OA 3R7YA 4BCPA 5IDNA 2YM5A 5LQFA 2VO3A 3O7LB 3C0IA 4RQKA 3G6HA 4ZZOA 3ENHA 2XH5A 4UXLA 4RWLA 2VWIA 1NA7A 2C69A 4G5JA 3W2SA 2ITVA 5EOBA 4WNMA 2IO6A 3CP9A 4L53A 3R73A 5CVGA 4E6CA 4IDVA 3SX9A 1U5QA 1XQZA 5HGIA 3EN7A 4GJ3A 4BZDA 5LMBA 3UMWA 1OIUA 4HPUE 1Y6AA 5CANA 2CKOA 4IH8A 2JDOA 4XEYA 3LLAA 3GP0A 2PHKA 4FEQA 3IG7A 3MVHA 2QKWB 4L42A 4NFMA 1Q8TA 3LQ5A 4FL1A 4FK6A 4F0GA 4N6YA 3QQJA 3NNWA 4XG3A 2WMAA 4X6RA 4UMTA 2QR7A 5I5ZA 3KULB 3E7VA 2HELA 4C36A 4F65A 1BL6A 1EH4A 4WKQA 3Q6WA 3LOKA 3PJ3A 5HE0A 4XMOA 1UWJA 3KRRA 4IIRA 1W0XC 2C3KA 4O7LA 4NM7A 3BHVA 4ANMA 4AZTA 2OLCA 4C4HA 4YJPA 3H30A 1T46A 5FTOA 3N4VA 5DA3A 2CGXA 3DJ7A 4I4EA 4LOPA 2PMOX 2UZBA 4G3CA 4XG9A 5AUUA 4IMYA 2CHLA 2EUFB 2PZPA 4WRSA 1H1PA 2OIDA 2ZV7A 2W9ZB 1VEBA 3BYUA 4TT7A 4AGDA 3DS6A 3PVWA 1YQJA 4QMWA 2WMVA 4C7TA 3VBVA 1YKRA 2OJ9A 5AR2A 4GFGA 4O7WA 3G2FA 2WEIA 2XM9A 4RJ5A 5D7VA 1O9UA 1QPCA 4CNHA 4G5PA 4K8AA 3VF8A 5JZJA 3OWJA 2QOCA 2E2BA 2BPMA 4NK9A 1G3NA 5KZ0A 3ROCA 4DCAA 4P4CA 5K9IA 1A06A 3D15A 3B2TA 3FV8A 5CYIA 2J0KA 4TWOA 2VAGA 3Q3BA 2WMXA 1OIYA 2UW9A 3I0QA 4QP7A 3KC3A 2C5NA 2G9XA 1OITA 4DCEA 3GBZA 3MJ1A 4IC7A 3ITZA 1UKHA 4LMNA 2YDKA 2XA4A 1ZYLA 3JS2A 4PMTA 3UO4A 2QU5A 3HA8A 2UZOA 3MY0A 5A4EA 3RAIA 4KUJA 5E8XA 4QTCA 3PIYA 4YO6A 3WZJA 1E1VA 4HCUA 2X7FA 1PMNA 3SAYA 3S00A 3K5UA 4UN0C 4DHFA 4JQ8A 4UZDA 3UTOA 4N0SA 5IKWA 4CRLA 2JLDA 2VTRA 2OXYA 1W84A 4D0WA 1BX6A 4U0IA 2FYSA 1PXKA 2O64A 4J53A 4TYIA 4ZS0A 5A4CA 3UE4A 4DAWA 1NW1A 1PXIA 2H8HA 3I6UA 1Q62A 1MP8A 2UZVA 4HGTA 3PA3A 1B39A 5EYCA 1J1BA 3MPAA 3WF5A 3R2YA 2GQGA 4K9YA 3WIGA 1NY3A 4I5CA 4OW8A 5ETCA 4DTAA 4YBKA 2P33A 2R3FA 3LMGA 4OTRA 3VS5A 3GCPA 4FV1A 2E9UA 4JBVA 3U9NA 4ZLZA 3C13A 4EQUA 4QQTA 3OXZA 4EL9A 1GZ8A 5EHLA 3QQHA 4IAFA 5BMMA 1S9IA 3I6WA 1M52A 1J91A 2H6DA 4G3EA 4NW5A 4WG4A 4FKTA 4XG4A 2CNVA 4R5SA 5AP5A 5CASA 2GS7A 1WVXA 4ZZNA 5JK3A 2B4SB 4E4LA 4YZNA 1V1KA 3DAEA 4A4OA 1XH6A 3FJQE 4OTIA 2X2KA 3NUPA 4CKJA 3AT4A 2YCQA 4GYIA 5KX8A 4D9UA 4C3PA 5I3RA 3WF8A 4MD8E 2WHBA 1X8BA 3DPKA 1KE9A 3ET7A 4MQ2A 2VTNA 1IG1A 2YEXA 2R64A 4X2FA 4EUTA 2I40A 4AG8A 4AP7A 5FG8A 5LMKA 4MH7A 1IA9A 1YOJA 3CC6A 4CFVA 3PP1A 3F3VA 4FV7A 2VX0A 3U6IA 1UVRA 5LARA 4OAVB 3FL4A 4YSJA 1GJOA 1OPKA 1ZYCA 3DB6A 4TW9A 1OL5A 3EN5A 5FM2A 5CZIA 3SXFA 5HVKA 1UU8A 4JBPA 5JEBA 5IDPA 5CEIA 2ONLC 4ASEA 4ZAUA 2Y8OA 1M2QA 2OKRA 1NVRA 4L68A 1CM8A 4FSNA 4RA4A 3TEIA 2ZMCA 3W2CA 2LGCA 2FA2A 2QURA 4AE9A 2OJFE 4O81A 4JRNA 4IQ6A 3FL5A 1H26A 3WE8A 4FK3A 2IVTA 4HNFA 4A07A 3BV3A 3GU4A 5LVLA 4FTNA 4UY9A 4RC2A 4C62A 2GHGA 4TKSA 4AW1A 3FYKX 1OUKA 2BIKB 2OW3A 2XEYA 4AOIA 5ETAA 2CCIA 4O91A 4AS0A 3PXFA 3F88A 2LAVA 1XHAA 3GI3A 2IW8A 4G2FA 2XP2A 2Z7LA 3DFCB 2I0HA 4RC4A 1M2PA 3H9FA 3FMNA 5HBEA 3DTCA 2ZB1A 3U8WA 2XNBA 3KK9A 3BZ3A 4ANSA 2XYNA 2GNLA 2QR8A 3T9TA 3LCSA 3NWWA 3QC4A 5IH6A 4QMQA 2BDWA 5CU6A 2P2IA 3HMIA 1J1CA 2C1BA 2UZDA 4IE9A 1OKVA 4ANOA 5CF5A 1UU3A 1Q97A 3BU6A 1MRVA 5BNJA 4BCMA 1BL7A 5FEDA 5DYJA 2R3PA 5HI2A 1MQ4A 2XYUA 4RVKA 3CTHA 5ANIA 5IQBA 3M42A 5HX6A 3P1AA 3TUDA 4F7LA 1OMWA 2GNFA 2EXCX 5CQWA 4AOJA 4MBLA 4CLIA 4DH8A 2WQOA 3WE4A 1CKJA 3QLFA 2BMCA 5EDPA 3AOXA 2OO8X 2P3GX 3F3TA 2XK8A 5LVMA 4F70A 2C0IA 2C0OA 3RMFA 3VUHA 5K3YA 3PVGA 3ETAA 4A4XA 4MD9E 4Z7HA 3EB0A 2BTRA 4H3QA 4HZSA 2YZAA 3E88A 5DG5A 3ZLWA 4S31A 4AA5A 4C4JA 5CSPA 4F1TA 2QOLA 2RFDA 2REIA 2QG5A 4DYMA 4P5ZA 4CT2A 5DH3A 2BZIB 3BHYA 2GFSA 2PYWA 4FOCA 4K77A 3G9NA 3D94A 4EBVA 3CQUA 4QP1A 2IW6A 3BBWA 3DLZA 3RNYA 2OJGA 3ATSA 3AMYA 4KD1A 3R00A 3ZUVA 2CCHA 4BTFA 2W06A 3ZO1A 5TE0A 4UYNA 3WZEA 4M84A 3ZDIA 1FINA 3BEAA 3E8EA 4KIQA 1M7NA 5TKDA 1PRYA 2NNWB 4KB8A 4KA3A 3BHUA 4RIYA 4O1PA 5KZIA 3HRBA 3MFTA 1ZAOA 2HWPA 2YABA 1SVHA 4NW6A 5B2LA 5IQFA 4EQMA 2XNNA 4IB0A 4BL1A 1BKXA 1LPUA 2F57A 3MVLA 3RGFA 3THBA 4GCJA 5FLFA 4PTCA 2BHEA 4M12A 1M2RA 1V0BA 1YWNA 4MTAA 2XRWA 3LZBA 3DXQA 4IWDA 3DV3A 4HGEA 4XG6A 2OH4A 4NKSA 3COHA 4YJTA 3M2WA 3GQIA 2W1IA 3N9XA 3NGAA 4I1ZA 3ORZA 4I5MA 2OGVA 2XJ0A 4RIOA 3D4QA 4BDCA 4I41A 2XIRA 4AE6A 4RA5A 3DAJA 1NXKA 3EOCA 4D0XA 4H3PA 4YPSA 5CXZA 3V5PA 3F7WA 3E63A 4LRJA 4CVAA 2RKUA 1YXUA 2PVMA 2PE1A 3VS4A 2CJMA 5F95A 1FVRA 1UV5A 3GGFA 2W4JA 4J97A 4MVFA 4X2GA 3E64A 4BDAA 3PXRA 1OKWA 4ZP5A 4RLKA 1P2AA 1JBPE 1PKDA 3FWQA 3ZSHA 2Y6OA 1JVPP 4QTDA 5HG7A 4AXAA 3FKNA 1DAYA 3M11A 4I93A 4NUSA 4ID7A 4MEDA 5CU0A 2OF2A 2XRUA 4U5JA 3C4WA 1JAMA 4RT7A 2VNYA 3DBFA 3LVPA 4FV8A 5KBRA 4ZS4A 4G3FA 2XCKA 2UW7A 1YRPA 4FT7A 4E4XA 3RK7A 4G9CA 2X8EA 3GT8A 3QD4A 4M67A 5KMOA 3D2KA 4XRLA 1UU9A 5FBOA 2F4JA 4C02A 5CAQA 5HTBA 3VBYA 4A4LA 2GHLA 3QXPA 2UVZA 4J98A 3G15A 2OF4A 3VBWA 4N70A 2XMYA 3TIYA 4CQEA 2O0UA 1ZMUA 4BCIA 5EM8A 3EQGA 3LQ8A 2IZUA 4GKIA 4H1MA 1ZYDA 4IAYA 3REPA 5DMZA 3BYVA 3QFVA 3QHWA 1O6YA 4GU9A 1U54A 5L2SA 1OBGA 5CU2A 5A6OA 1L8TA 4TWCA 4AW5A 5J5TA 4I5HA 4FTRA 3EH9A 4A9UA 2GU8A 3N4UA 5I9UA 3QKMA 4DEGA 3PIZA 4CG8A 5HOAA 2V22A 5T3QA 4GFMA 4K2RA 1XJDA 4KBAA 1KOBA 3WF7A 2ZB0A 1Q5KA 1WBSA 4TYHA 3D0EA 2I7QA 2UW6A 4HGSA 2ITTA 4PY1A 4QTBA 4DEEA 4R7IA 3DDQA 3NNVA 4D4VA 4U9AA 5EI6A 2C3IB 3IDCA 4EQCA 3RVGA 2XS0A 4NIFA 5DT3A 4PPAA 3ERKA 3EN6A 3U51A 4R77A 1H1SA 3KEXA 3RP9A 4DFUA 3DBCA 4U80A 2RFNA 3JVSA 1G8SA 3HP5A 3PE2A 4L6QA 3UC4A 5LVPA 4ZTHA 2IG7A 2PMNX 5E91A 4GEOA 2VTLA 3TUCA 3CS9A 4XP0A 5EDQA 4ZMFA 2R3HA 3QWKA 5M07A 4DGLC 4AW2A 4L44A 3LAUA 2I6LA 2CLXA 4FKLA 1Q24A 2C6DA 3UQGA 5AAGA 4NYEA 3FBVA 3SD0A 3WZUA 3NS9A 4RSSA 4BFMA 3MVMA 3W32A 3BIZA 3FY2A 4BCGA 4EUUA 3W2PA 3H4JA 3VRZA 4O6LA 2JAMA 3HV3A 4KBKA 1ZRZA 3H3CA 3HGKA 4L45A 5D11A 3LFEA 3IONA 3Q53A 2R4BA 3NAXA 4X2KA 4LRMA 1UNHA 4I22A 4BCOA 3F3UA 2PVKA 2A19B 4KSPA 3MFRA 2ITZA 4DLJA 4BTJA 4XCUA 3DZQA 4PDSA 4BI2A 2VTTA 5IEVA 2QG7A 3P9JA 4O7SA 4RJ4A 3BLQA 2HENA 4D2TA 5AR3A 3RALA 4DH7A 3I0OA 4IB5A 3QRJA 1W7HA 2R0IA 3I5NA 2JIIA 4X6QC 5IA5A 4KIKA 5E4HA 3TNHA 5HCZA 3AMAA 5BX0A 2EWAA 4I94A 3I4BA 3PJ1A 4DFZE 2WMWA 2FUMA 4J99A 2PZ5A 5CAPA 1S9JA 1U46A 2C6OA 2UW3A 4JBQA 4JAJA 3Q4TA 1WBNA 1AQ1A 3KCKA 5I9ZA 1YI4A 4EOQA 5LXMA 5D41A 3PXKA 3IDBA 2P0CA 5E8ZA 5IH4A 3MA3A 1QPEA 4ENYA 1WBWA 3KXXA 4XYFA 3PJ2A 2G2IA 4FGBA 1DAWA 2C5XA 5I4NA 1W8CA 4FKIA 2VTJA 4BDBA 1OPLA 2NRYA 3NYXA 4Q5EA 4M0YA 4TYGA 3VW8A 4OTWA 4JJRA 5HD7A 1BYGA 2P2HA 3DFAA 3FMLA 3KXGA 5HO8A 1DM2A 3C51A 2YIYA 1H4LA 3ZZWA 4EYMA 4ZLYA 1TKIA 1LR4A 3NUNA 5CZHA 1IRKA 2ZOQA 1BI7A 4KS8A 5CF8A 4RMZA 2XIYA 4QYFA 5HEZA 5D10A 3TNIA 1R3CA 3WF9A 4ANQA 5AP2A 3GVUA 2BALA 2P55A 1YI3A 4OUCA 5EM6A 3EIDA 4AN9A 1RW8A 4GG7A 3KN6A 1KOAA 2A27A 3DNEA 4IAIA 3IECA 4JG8A 5AP4A 3EZVA 2UZWE 3IGGA 4K0YA 2JBOA 4YC3A 4U40A 5J5SA 1PMUA 2OG8A 4AZWA 3PA5A 4IM0A 3G0EA 3LM0A 3DKOA 3R8ZA 4Q9ZA 1BMKA 1YVJA 3PTGA 5EYMA 4YTIA 3U55A 2B54A 3CQEA 4FTUA 3IW8A 2J51A 5JH6A 4NH1A 3E62A 3ZUTA 4XP2A 5JRSA 2HY81 4BYJA 2C6IA 1NVSA 2JKQA 3BYOA 2WTWA 2W1EA 3OFMA 1ZOEA 3D5XA 4U6RA 1YHSA 4BCJA 2E9VA 3GCVA 2C4GA 3CD3A 4QMLA 2V7AA 4QMPA 4RWIA 4M69B 3ZZEA 5J87A 4YTFA 5FUTA 3OUNB 1MQBA 4IB1A 5DRDA 2JD5A 3UO6A 4FZAB 2WB8A 1H1RA 4YHJA 3IW5A 3SQQA 5M06A 4RZWA 3V5LA 3ZTXA 4PMPA 3NIZA 2WU6A 3E3BX 4PMMA 2WTVA 4D4YA 3ZXTA 3RPRA 3V8WA 3W2RA 1RDQE 4X7QA 4DEAA 2PZIA 3GUBA 4ENXA 3CPBA 3HZTA 4FSZA 2PUIA 4JVGA 5GIPE 4RIWB 3MH2A 4RIXA 3OY3A 4BCQA 3LFDA 4ERKA 4ZSJA 4I24A 4S32A 5FWKK 4JRVA 2BTSA 5D1JA 1SVEA 4UMQA 2VWXA 5HIDA 3VVHA 2QO7A 1KUTA 4GVAA 2IWIA 3KXMA 3R02A 4FKJA 3WBLA 1JLUE 5CEQA 4C8BA 3HX4A 3MY1A 4TZRA 3E93A 5I0BA 5I9WA 4IVDA 4NU1A 3UYSA 3IQ7A 2GMXA 4IZ7A 2BHHA 4EORA 3QWJA 4BYIA 4ZY4A 4JX3A 3CJFA 3ZONA 3A7FA 4IZAA 4M15A 4NJ3A 2VWUA 3KREA 3KVWA 2XM8A 4JOAA 1F3MC 3ORXA 5EG3A 4IEBA 5BVKA 4C2WA 4QD6A 4W4XA 3F7ZA 1DI8A 4CMTA 1Q8WA 3SW4A 4AWIA 1GY3A 3G0FA 2HZNA 3OHTA 5AA8A 3BX5A 2YM4A 4FT0A 5DGZA 3I81A 3QD2B 3GFEA 4B7TA 2BRNA 2DYLA 4BC6A 4ORKA 4HGLA 2YIWA 4AN2A 4UEUA 3FI2A 2X9EA 3E7OA 2VTAA 3ZS5A 3K54A 3D2IA 1XBCA 4Y95A 3W1FA 1FVTA 2X7OA 3BGZA 3A8WA 3UG2A 3T3VA 4B9DA 2J6MA 3FHRA 1KV2A 4QPMA 3QTIA 3QCQA 4UX9A 3KKVA 4HCTA 3WF6A 4I5PA 4BBMA 4FKUA 2E9OA 4ACHA 3VUIA 2VTMA 3P7AA 2XNEA 3UJGA 3FMDA 3OBGA 3SOAA 4B0GA 4D1SA 4YMJA 5EQPA 4PTEA 3PWYA 4X2NA 5E8YA 3P0MA 4IW0A 5KKRC 5IA4A 2OI4X 3EQDA 4RRVA 4JDHA 3VWAA 2QQ7A 3FC1X 3MB7A 5F4NA 3KN5A 1J7LA 5F1ZA 4C34A 5E92A 3TJDA 5EHYA 2VO7A 2OICA 3E92A 4BRXA 1PYXA 2R9SA 4KRCA 5A4TA 2XVDA 4ZTLA 2BAJA 1WBTA 4QMZA 4ONAA 5LCJA 4HCVA 5F94A 4IACA 3D5UA 2HW7A 1OVEA 3V6SA 5DE2A 4H1JA 3PUPA 5HLWA 5FXRA 2XK3A 4WT6A 4XNEA 5FXSA 5CF6A 2IVVA 2R3RA 1OL7A 2Y7JA 5HTCA 3C5IA 3IOKA 2QNJA 3MDYA 2GHMA 4FSQA 4EC9A 3NVKI 2B52A 3M1SA 5C01A 3LXNA 3Q96A 3EQCA 3COMA 4E26A 3Q04A 2CSNA 5ACKA 4TYEA 4MX9A 2JDSA 3V6RA 4HYIA 4PDOA 1R39A 4BKZA 1H0VA 2IZRA 4GKHA 2PK9A 4BIBA 2WQBA 3D5WA 3H0ZA 4WNPA 3HMMA 4KABA 5J9ZA 5KKRB 4DEIA 4DTKA 2O2UA 3UBDA 2PWLA 4C61A 5IF1A 5HIBA 3PY1A 5CXHA 2B9JA 3FZOA 4AUAA 4J95A 3EN9A 3ZO4A 3DXNA 4RVLA 3V5TA 3R9NA 4FE2A 1H25A 2CN8A 4YC8A 4FV3A 3DOGA 3A7IA 4YURA 4BWKA 3KMUA 3JY0A 3SGCA 3DBDA 5BYYA 3FMKA 5ACBC 2ZV2A 1H08A 4KBCA 1JKTA 3Q5IA 4RJ6A 4C59A 1IAHA 4MK0A 4C37A 3CE3A 3OWKA 4JAIA 4FVQA 2JFMA 2XK7A 2BROA 2WD1A 5CI7A 5IA2A 3CGOA 1XH7A 3PZHA 1LEZA 3MYGA 2ZM1A 4MCVA 1W98A 2X4ZA 3AQVA 4V0GB 1JOWB 5D12A 5M55A 4X3FC 5DNRA 4ZY6A 2GNJA 5DT4A 4DH3A 5CQUA 4O0SA 3SHEA 2RIOA 3DJ5A 4RZVA 5M09A 5EK7A 5IMXA 4XRJA 3R28A 1XH4A 2YWPA 1ZLTA 4II5A 2RG6A 2G15A 2BZJA 3R7IA 2A0CX 3AGLA 3HECA 2VU3A 2BKZA 3IOPA 3L8VA 3QRUA 3BHHA 3FQEA 1U5RA 5HU9A 1PMVA 5IUHA 2BKKA 3R63A 3C7QA 3P08A 2VWBA 2Z7QA 3V5WA 5TF9A 3C0GA 4FL3A 5EW9A 5E8UA 2WXVA 3RAKA 1OPJA 2PVYA 4OBQA 3ZEPA 3G9LX 3EKKA 4LQMA 1SYKA 5B2KA 5IQCA 3FLWA 2QONA 3NIEA 5BVOA 3OC1A 3DK7A 3QRKA 2XIZA 3KRXA 3EQPA 4MWIA 4BN1A 4DLIA 3CJGA 4WG3A 5AV2A 4AT5A 5JRQA 3EQRA 4NKAA 5LMKC 4E6QA 3F2RA 4D9TA 2W96B 4ZK5A 5CAOA 3KRWA 3LJ1A 1JPAA 2UW0A 1RQQA 1CKIA 4BWXA 4E93A 3HAMA 3EFKA 2X8IA 3ZSIA 4BB4A 5AA9A 4PPCA 2ZYBA 3BWFA 5LWNA 5LOHA 4JDJA 1CDKA 3CBLA 3QTWA 2HZ0A 3JYAA 2X2MA 2B9HA 4O2PA 3FPQA 2QHMA 3A8XA 4BDKA 3BYSA 2YJSA 4JX7A 3KL8A 1YW2A 2PZRA 3Q52A 3BHTA 3FLQA 4QMYA 5JSMA 3UQCA 1ZOGA 4ALVA 5C03A 4NM0A 1FQ1B 4A06A 3MTFA 4UMUA 4OGRA 4FV9A 5H8BA 3PJCA 3RINA 2YM6A 2R3IA 4CYIA 4DGGA 4LI5A 3IKAA 3DKGA 3NUAA 1H28A 1KWPA 1FPUA 2VO6A 2X8DA 3KXZA 5HNGA 5HO6A 4U3YA 4FBXA 3ZMMA 3DZOA 4FA2A 3R9RA 4QMNA 3KRLA 3FLSA 3EL8A 4GSBA 2WTCA 4H39A 5FQDC 3QYZA 5J1WA 1W82A 3A99A 3QCXA 5ANJA 2X0GA 4CV9A 2C30A 4BI0A 2GQSA 4F9YA 2HOGA 3Q2MA 4TRLA 3BLRA 3QGYA 2R3JA 5LVOA 3O23A 4MXOA 4IJPA 1Z9XA 2C6KA 5M4UA 4JS8A 1ZMWA 4XBUA 3L8SA 3KA0A 4ASDA 5FDPA 3SRVB 5IISA 5D9HA 3VULA 4GU6A 4O96A 5AV4A 3V01A 4EONA 5KHWA 2ACXA 4MXYA 5FGKA 2CMWA 4EH7A 2C5OA 3OCTA 3ZH8A 4AF3A 2J9MA 3TTIA 2QOKA 2PMIA 3C9WA 3OMVA 2R7IA 3AC1A 3GCUA 5EFQA 1WCCA 3IO7A 3HVCA 4FSRA 1KE5A 3ZFMA 2Z7RA 4BCNA 4DA5A 5DWRA 4QPSA 4DINA 4YJNA 2OZAB 4M68A 3K3JA 1CSNA 2HYYA 2QHNA 3ENMA 1FGKA 3UIMA 4XOYA 4DEDA 4NFNA 2AC5A 3BE9A 1LEWA 3NCZA 4Q9SA 1V0PA 1JWHA 4PDPA 3UNJA 1BUHA 3WYYA 3UO5A 2O8YA 4CD0A 2X81A 3UGCA 3EFWA 3UOKA 4FNXA 4FTAA 4CTCA 4FTQA 4I6BA 4ZY5A 4CFUA 4Z7GA 4N6ZA 3HRFA 5HU3A 3ALNA 3EWHA 5DFPA 1URCA 3UMXA 4L46A 5HQ0A 5JGBA 4AW0A 5C4LA 1ZXEA 3RWPA 4KKEA 2F49A 2OJJA 3BKBA 4X21A 2PULA 4QYEA 3COIA 3BPRA 5CU3A 4AZVA 2XNPA 4F0FA 5CEOA 3EN4A 4FIIA 3VN9A 5L8LA 3NYOA 2PUNA 4D2VA 5AUXA 2CGUA 4PL4A 1OB3A 1WBPA 3K3IA 5L8JA 4ZSGA 5HBJA 4AFEA 4BCHA 5DLSA 2O65A 3VHEA 2OBJA 2I0YA 3P23A 2W5BA 4DT8A 4G3GA 2XZSA 4OTQA 2HCKA 2BZHB 3A2CA 4FSTA 2R3GA 4NTSA 4I0SA 3TXOA 4AA4A 2B9FA 3LJ2A 4ZXTA 5KMJA 5K5NA 2QLUA 5EW3A 5GJFA 4ANBA 5E8SA 4OBOA 2WELA 2QOQA 4XG2A 3VHKA 3R71A 4HVGA 4PNIA 2J0IA 3GNIB 3BU5A 2OFUA 4NT4A 4Z16A 3K2LA 4KIPA 2CGWA 3OCSA 3VAPA 3O7LD 1IEPA 5IU2A 4CMUA 4MWHA 1Z57A 5AR4A 4D5HA 2ESMA 2YM7A 3FC2A 2YERA 4BCKA 4DFBA 3D14A 4EOMA 2X7GA 5IQGA 3OZ6A 4EBWA 1Q8UA 3F6XA 2YAAA 3ZM4A 1UKIA 3D5VA 2W1ZA 4M69A 3TN8A 4O7TA 3MB6A 3DQWA 3ANRA 4O7YA 4XUFA 3GU8A 4D2PA 4MF1A 4ZOGA 2XUUA 5CAUA 5M56A 4D58A 2NRUA 2C3LA 4HPTE 3LM5A 3UOLA 4TNDA 2OH0E 2X6EA 4FIGA 3B2WA 4RQVA 5H3QA 4BTMA 1WVYA 4E20A 1SZMA 4C2VA 4LGDA 3LMHA 1YDRE 4NJDA 4RG0A 4RIWA 3BELA 3O50A 2C0TA 3G90X 4FT9A 5H9BA 3A61A 2YN8A 1XH8A 5GJGA 3PXZA 4EZ7A 1Y6BA 5IEYA 1PHKA 2OIBA 4FG8A 4I3ZA 3CEKA 1ZY5A 5FD2A 4XLIA 4YJOA 4ZJIA 1GZNA 3U54A 4D2RA 2UVXA 3O2MA 3RCJA 3R01A 4U41A 4MYGA 5CS6A 5GZ9A 2J0MB 4M13A 5ICPA 3HLLA 5IUGA 4ALWA 3JPVA 3LFFA 2QODA 3A7GA 3QX4A 4FT5A 4GW8A 5DHJA 3E87A 4QYGA 2C5VA 4J71A 3C50A 2VN9A 2B7AA 3E5AA 4GK2A 3ZO2A 5BUIA 5L8KA 5M57A 3OWPA 2BRBA 4FV4A 5AX3A 2GNGA 3DA6A 5HTIA 4L52A 1H27A 1YHVA 3QCYA 5E8VA 4FT3A 5K0KA 4BVUA 3OG7A 2NPQA 4GT3A 3AD5A 3MSSA 2BVAA 2WIPA 4I0TA 4LRKA 2B9IA 4RFZA 5L2TA 2VRXA 2CLQA 1UNGA 5AAFA 2XJ2A 3HUBA 3HAVA 2O5KA 3FPMA 4WD5A 3NUYA 3V04A 4YLLA 3Q9YA 5CALA 3PIXA 4C33A 1H1QA 4CFWA 3DNDA 5AIKA 1O6LA 3MH1A 3R1NA 4XV9A 3OT8A 3WIKA 2HXQA 1ND4A 3R1YA 4FC0A 4EK6A 4LUDA 5HVYA 2XIXA 1I09A 2JITA 5LWMA 4YZBA 4FZDB 5C9CA 1OBDA 5J7HA 3F69A 3F5XA 1PY5A 5EM5A 1RE8A 4RX8A 5M4FA 3VBXA 4QP9A 2VUWA 3BBTB 3DKFA 4YHFA 3BEGA 3POOA 3RAHA 2PUUA 3CXWA 3CR0A 5JN2A 4CXAA 1JQHA 5DPVA 2HXLA 3HL7A 5DR2A 5KMIA 4R3PA 4FTJA 3TCPA 1QPJA 2VTQA 3HDNA 5BUEA 2AUHA 3PXQA 3U9CA 1YXSA 2PTKA 4OTPA 3FLYA 5DT0A 4HYHA 3FZRA 2UW4A 3L1SA 2V7OA 3QLGA 3L9MA 3VBQA 4DBXA 2EVAA 2VZ6A 4E3CA 2YLEA 3LFAA 4W4YA 2BR1A 3R7UA 4M14A 4ALUA 2QO9A 4CGAA 4PQNA 3D7ZA 5B0XA 1KE6A 2A4LA 3ZLXA 3PYYA 2JIVA 4FEUA 3EL7A 3RHKA 3E8NA 3SC1A 4CMOA 3ORIA 4PF4A 5M51A 4JR7A 4BR3A 4GS6A 3UDBA 5FXQA 4YLKA 2UZNA 3LLTA 3VF9A 1YXTA 2UZEA 3QZHA 3RNIA 1GZOA 3Q4CA 3U4UA 2VWYA 4FV0A 2OZOA 2C68A 4L7FA 4E1ZA 2JEDA 3ID6C 4CKIA 3V51A 4C4EA 2YA9A 4DN5A 5C26A 2JDRA 2WO6A 4NL0A 3VRYA 2PE0A 5CSXA 4FICA 3QQUA 5FDXA 5HE1A 3UZPA 3QAME 3ZC6A 4EOLA 5IPJA 1I44A 3NAYA 5DR9A 4Z3VA 3VBTA 1PW2A 3O96A 5EKNA 3BYMA 3ORKA 3R1SA 3HEGA 3NW5A 4CFNA 1AD5A 5AUVA 2ZVAA 3GC8A 5AV1A 3FKLA 4A7CA 5EKOA 4ASXA 4G9RA 4K6ZA 3PPZA 2CPKE 3QXOA 5AP1A 5E90A 2KTYA 3PPKA 4OT6A 5GNKA 4U79A 4V05A 5IUIA 2IW9A 2ITQA 4RBLA 4W4VA 2EB3A 2W9FB 3HDMA 4V0GA 3SOCA 5J7BA 5ANOA 3TZMA 4PL5A 3V3VA 4FODA 3ZDUA 4UWYA 2PL0A 4XP3A 4FTLA 3UVRA 4X3JA 3VS0A 4EH6A 5IQIA 3ZCLA 1VYWA 1ZARA 3LIJA 2ETMA 2XBJA 2YITA 3F5UA 4RWKA 3KULA 4L7SA 3NEWA 4X0MA 4HVSA 3EQHA 5D7AA 2J0LA 4EHGA 3FSKA 1QL6A 3R8PA 3MS9A 4E5WA 5GZAA 3TG1A 4GG5A 5J1VA 3EYGA 4MNEB 4X3FB 4R7HA 5IH5A 2XCHA 2QKRA 3IW7A 2FGIA 2QVSE 3UZRA 4BKYA 2J5EA 2VX3A 2YM8A 4HJOA 4M7IA 5KHXA 4RFMA 3GQLA 5EDRA 4DC2A 3FMEA 1H1WA 4FSYA 2DWBA 5L4QA 2YIRA 2R3KA 4FV2A 1F5QA 2JGZA 4GH2A 1QCFA 4MQ1A 4U8ZA 3TIZA 4D4SA 1JKLA 4LM5A 2W1GA 4O0WA 4G16A 3I79A 4XOZA 3TNQB 5AR8A 4XG8A 1H0WA 3O8PA 4OTFA 3LMIA 3WZKA 2GFCA 2XKCA 3QTUA 3RK5A 4I6FA 5FP6A 3QL8A 4YZCA 3EQIA 4OAUC 4FZ6A 2W1DA 3FI8A 3L9NA 5L6PA 2ITXA 4O83A 3FSFA 5DRBA 2WQNA 1YXXA 1MUOA 3ANQA 4EHEA 3DB8A 3FY0A 1ZYJA 5HNBA 4F09A 2PVJA 1KE7A 3QRIA 3R7OA 4EC8A 4O22A 3L9PA 4EOJA 3FLNC 4EOPA 1SNUA 2Q0NA 4F7JA 4G3DA 4JLCA 2JAVA 1HCLA 3OOGA 4L9IA 1H8FA 3RCDA 4Y5HA 3OUKA 3DK3A 4QO9A 3PP0A 3NCGA 4BHNA 4JQ7A 4TY1A 4EEVA 2BRMA 3PJ8A 5BPYA 2JKKA 5FEEA 4AOTA 1TVOA 3VUGA 3VS6A 3R6XA 3D7TB 3FXXA 3SG8A 5M08A 4FVPA 3W55A 3FZ1A 5CAVA 4ANLA 3OROA 3HP2A 4R1YA 2PVNA 2W4OA 4TWPA 4JT3A 5K4JA 3KXNA 4I21A 3EHAA 5JQ5A 1JKKA 2GNIA 2ETRA 1JNKA 3PVBA 4A9TA 5HLPA 5IA1A 3FZPA 5HBHA 3LCKA 4AA0A 2V62A 2VTIA 4UYAA 4MAOA 3PLAE 1YWVA 3RPOA 3FAAA 5CENA 4FTMA 4UMRA 2QO2A 1OGUA 3FLZA 2ERZE 3U6JA 3SRVA 3II5A 3QUEA 3Q60A 4E5BA 1WBOA 4J1RA 5KCVA 4PWNA 3PE1A 3QHRA 4QP2A 1OIQA 4XV1A 5AP6A 4C3RA 5KO1A 2CN5A 3DU8A 3H9OA 4DT9A 1VJYA 5ANKA 1Y57A 1GIIA 4CQGA 5GZ8A 1YHWA 4V04A 3W8LA 4APPA 4CFFA 4DFNA 3C4FA 5B2MA 3QTQA 3GU6A 4AZEA 4IHPA 3QGWA 4FSMA 5F20A 5L6WL 4MXXA 1ZY4A 2OZAA 4G1WA 3EYHA 3LJ0A 5EI2A 3TTJA 2YWVA 1E1XA 3A60A 3GXLA 4LL5A 2R2PA 4Y8DA 2J4ZA 4RX7A 1JSUA 4F99A 4EI4A 2AYPA 2V55A 2W7XA 4XV2A 2XNOA 4BDHA 3FZTA 2BIYA 3KB7A 3LHJA 4C58A 4D5KA 4KKHA 5J9YA 4NCTA 3E3PA 3RWQA 3FI3A 1ZMVA 4JBOA 5TT7A 4DH5A 2PY3A 4BDFA 5BUJA 4ZEGA 3LPBA 4LGGA 4EOKA 1B38A 4O0TA 4QMMA 1B6CB 1ZWSA 2ZAZA 4WNOA 3GCQA 2YDJA 4PTGA 3R9DA 5BVDA 4WSYA 4ZIMA 1APME 2QOFA 2R7BA 3DAKA 2VWWA 4DG0E 2VTSA 2QU6A 3LKMA 4W9WA 4OTDA 3IW6A 3A7HA 3ACKA 3WARA 5EM7A 4FKGA 2VNWA 4PDYA 5HICA 5AFVA 4AN3A 3GU5A 1TQPA 3A7JA 4O38A 3EFJA 4ACGA 4CYJA 4EH9A 3HA6A 3AD6A 3QCSA 4I6HA 4KSQA 1F0QA 2XB7A 3AD4A 4LV5A 1Q41A 4YZMA 3IGOA 3L8PA 3E8DA 3R9OA 3I7BA 4JL9A 3QZFA 3ZHPC 4WIHA 4YJSA 4LUEA 5DEWA 4JR3A 4QMTA 3R8UA 4H05A 3VNTA 4UWBA 4PV0A 4M8TA 1R1WA 4G34A 3UVQA 3HV4A 5DBXA 1DI9A 4IZ5A 4I6QA 3GFWA 4DEHA 3KQ7A 1HCKA 2Y9QA 4AZSA 4GFOA 3FI4A 4JI9A 4C4FA 4MHAA 1FOTA 2H96A 3NUXA 4O0XA 4S34A 4AFJA 2VWZA 3VS7A 1GNGA 2PVLA 3KF7A 2W0JA 4Q2AA 4QMOA 3TNPC 4U3ZA 2YFXA 1G5SA 4AGCA 3RPVA 4IX4A 4DFXE 4U44A 3FQSA 4IFCA 5HD4A 5FTGA 4LGHA 2R3QA 5CT0A 2YCSA 4UMPA 5BVNA 3NLBA 2JKMA 3U87A 1J3HA 5CSHA 3GOKA 1OUYA 4Z55A 5ETIA 3NDMA 4PNKA 1AGWA 2GS2A 3ZRKA 5LMAA 3DBQA 3FHIA 4Y73A 3VS3A 2R3LA 5HE2A 3OBJA 3L8XA 3QA8A 4JG7A 4BDGA 4DG2E 4DGNA 3NX8A 4QMXA 2H9VA 4DE4A 5H8EA 5FEQA 5HX8A 3BCEA 3NUSA 1PXPA 5ANDA 3ZBFA 5I9VA 2FB8A 2ITOA 4YU2A 1DS5A 2CGVA 4O7RA 4YO4A 4EKLA 4WBOA 2GS6A 3MI9A 3R21A 2WTKC 2ZM4A 3QD0A 5AV0A 1Q99A 4R78A 3V5QA 4Q5HA 1YXVA 5IEXA 2IN6A 3QU0A 4IX3A 4HVDA 2Y0AA 3GC7A 3RPYA 4DF3A 3ZYAA 4ZJJA 4LOOA 2VGOA 2C1AA 4U81A 4YZDA 3EKNA 4O84A 1M14A 2VWVA 3NYVA 4S33A 3MIAA 4YHTA 4CSVA 3PVUA 2XNGA 2XKFA 3Q9XA 3QUDA 5CSWA 5HESA 1KSWA 3OY1A 3ZEWA 1V0OA 4Z9LA 4DGOA 1CKPA 3HMPA 4GMYA 3VUTA 3OEZA 1XBAA 4CCUA 5B7VA 4IB3A 5CU4A 2WAJA 4BDEA 3RPSA 3P7BA 4YZ9A 5EYKA 4PL3A 4YNEA 1H01A 4KRDA 5IA3A 1RJBA 3ZRLA 3OW4A 2X9FA 2QI8A 3ULIA 2Z02A 4O7ZA 4YJUA 4C35A 5CI6A 3NSZA 3WI6A 4QNAA 4B8LA 4IXPA 3S95A 4FYOA 1WBVA 2PZYA 3ZU7A 4DH1A 3C0HA 2JDVA 3FUPA 3I7CA 4ZTQA 2WKMA 5GJDA 4ZSLA 5AJQA 4E4NA 5DOSA 4FI1A 5E8WA 5HKMA 3F2AA 4ZZMA 4PPBA 3V8SA 3DDPA 3I60A 3S0OA 3HV7A 5ETFA 2J90A 3NRMA 4DBNA 5DIAA 4CTBA 2ZV8A 3HUCA 5M4CA 5EH0A 2XF0A 1ZYSA 1WAKA 4YBJA 4YR8A 2QOOA 3CQWA 3BV2A 4QQCA 4EH4A 1PXNA 5JFVA 4FZFB 3FE3A 4Y85A 4E6DA 5AUYA 3RKBA 3G51A 1ZZLA 3CY3A 4CEGA 3OCBA 2ITYA 2YLFA 3O0GA 4YNOA 1ATPE 2WTDA 5KMNA 1XH9A 4XX9A 2VO0A 3BQRA 3PSBA 4KINA 3GENA 4BGQA 2A2AA 5FRIA 4FUXA 2XBAA 3KRJA 5H8GA 3MBLA 5A3XA 2IZSA 4AGWA 1XR1A 5J8IA 4EZ5A 5JGAA 3MJ2A 4GT4A 1YOMA 3F61A 3VUDA 3B8QA 4W9XA 5IQAA 1CMKE 3QTRA 3VUMA 4EWQA 4IADA 3AC8A 3BGPA 4BZNA 3G5DA 4GUBA 4EOIA 1GZKA 2XK6A 2WPAA 4ANNA 4EK3A 2ITNA 3JR1A 4AT3A 4KKGA 4KIKB 4U43A 4BBEA 1PJKA 2Q0BA 3I1AA 3U6HA 4IAKA 3TV4A 4O86A 4QMUA 5K4IA 2P4IA 4EH8A 4NTTA 2G1TA 4FKOA 4P5QA 3OCGA 3PXYA 2F2UA 5AUWA 2WEVA 5A4QA 1H07A 1PXMA 2UVYA 3OT3A 4L8MA 3ODZX 4U45A 3OF0A 2BFYA 5C4KA 1GIHA 3RJCA 2HZIA 4QYHA 4AT4A 4EJNA 4FIEA 3BI6A 4FOBA 2GCDA 3MPMA 1LUFA 4O7VA 4IZYA 4I23A 1WFCA 2C6LA 2JDTA 2UW8A 4AAAA 3E8CA 4BZOA 2YAKA 4IWQA 4PP9A 3TNWA 2W1FA 2WOUA 4QQJA 3L9LA 4KAOA 3W2OA 1ERKA 2ZJWA 3PRIA 4CZYB 2FSTX 3GB2A 3ZOSA 4J8NA 2G2HA 5EW8A 2GTNA 2I0VA 3H0YA 3MW1A 4EK4A 4OTGA 4NEUA 1MRYA 2ZDTA 3FMJA 2HK5A 4LFIA 4ITJA 5ITAA 3OVVA 3PLSA 3QTXA 3BQCA 3UNZA 4O82A 3OXIA 4FKRA 3UQFA 2CNUA 4FVRA 5J95A 3RZFA 1XH5A 3NYNA 4F9CA 2VV9A 4QP6A 2X39A 5HLNA 2J7TA 3SXRA 1O6KA 4F1OA 3CTQA 5I9YA 5IQEA 3OP5A 4N4SA 3MTLA 5C1QB 4GIIA 1W83A 2HY0A 4GK4A 2EU9A 2J0JA 3QRTA 4YC6A 3S4QA 2E9PA 3N4TA 5E9EA 4MNEA 4X3FA 5CF4A 3LXLA 4BKJA 2FSLX 2YISA 4FIJA 1XWSA 4B4LA 1PXLA 2ETKA 2Y4PA 3R0TA 4ZTRA 4XHKB 4FYNA 2NO3A 4RFYA 3LFNA 3P86A 2PPQA 4PX6A 4DG3E 4ZLOA 3KY2A 3LFCA 4BIDA 3UIBA 2UV2A 2XEZA 4R3CA 3ZO3A 2QCSA 1OIRA 5AP7A 4JIKA 4FEXA 4F6SA 2A1AB 5L3AA 5EQEA 3OOMA 5AMNA 3WOWA 5DI1A 2OXDA 3UIUA 4FZ7A 3CCNA 5JQ8A 3GEQA 1QMZA 1IAJA 3A62A 3BWJA 3JXWA 5JFSA 1SM2A 4USDA 4O0UA 3DQXA 4IJ9A 1YWRA 3POZA 4R3RA 3QYWA 4QRCA 2ITPA 4P90A 3AC5A 1VZOA 1YDTE 4RIXB 2RGPA 2JIUA 3RTPA 5C27A 5TOZA 4P2KA 4YJQA 2ZMDA 3O51A 3UPZA 1IA8A 1OKYA 2RFEA 3HV6A 4H3BA 4F9WA 2FH9A 4BIEA 5JKGA 3SA0A 5FP5A 3S3IA 3C5UA 4PMSA 4FG7A 2YIXA 1KE8A 3OTUA 4F0IA 5A9UA 1REJA 3VQHA 3CTJA 2NP8A 1FBNA 4I4FA 1K9AA 4M3QA 1JSVA 3W33A 4QP8A 3ZLSA 1SVGA 3UZTA 4RPVA 4HYSA 4R5YA 5CVFA 5IMEA 3TWJA 2YCFA 2HIWA 3RK9A 4ZSAA 3Q4UA 4FTIA 4JNWA 3FEGA 3D7TA 4BBFA 5IQDA 3R8MA 4KS7A 4AX8A 1M17A 3BE2A 4LG4A 1WVWA 3C1XA 2FSOX 3GU7A 4BI1A 3AG9A 3I5ZA 4R1VA 2WMRA
chains in the Genus database with same CATH superfamily
2WZJA 2O63A 4H58A 3QD3A 5EHOA 1R78A 2E9NA 3HRCA 2Y4IC 3RM7A 4E73A 3LE6A 3GOPA 3ORLA 4FTOA 3OD6X 4BTKA 3R9HA 3SV0A 2BDJA 3KGAA 3KK8A 2HAKA 4IX5A 3TZ9A 3V5JA 1R0EA 5DR6A 3LFSA 4QNYA 3T3UA 3EMGA 2QC6A 2XK9A 3VUKA 2YDIA 3FMMA 4CZUA 3CSVA 3HMNA 4FTTA 2F7XE 2OK1A 4FKVA 4GT5A 4JXFA 4M97A 3DY7A 4J96A 4BF2A 5IA0A 3ODYX 4QTEA 4R7BA 3Q2JA 3VJNA 5CY3A 3W10A 2QOBA 1P5EA 3BLHA 5T6KA 3ZFYA 4FKQA 3HMOA 4CFMA 5C8MA 2IF8A 2PVHA 4O4CA 3B8RA 5L2WA 3MV5A 2GQRA 4RJ8A 4EWHA 4F63A 3WYXA 1FMOE 2PVRA 3IS5A 4G31A 4A9YA 3R8VA 3MESA 3FYJX 4CFXA 5GHVA 3KU2A 4IAZA 4ITHA 4MKCA 2WOTA 1Q4LA 4G6LA 2CKEA 4WUNA 3UP7A 5KMMA 4O0VA 4TL0A 2JFLA 5HO7A 2HW6A 4FEVA 4F9BA 3F82A 3F2NA 2WTJA 3NW6A 4I0RA 4EJ7A 4IVAA 2OJIA 3ZUUA 5A54A 4BDIA 4D1XA 3Q32A 3N51A 4N57A 2ITWA 1JKSA 3KXHA 5BMSA 2YIQA 4E8AA 3LW0A 3OTVA 4OT5A 4FIFA 3Q9WA 4FNYA 1BI8A 1Y8YA 3P5KA 3QALE 4W8EA 2BUJA 4A9SA 3JUHA 4HW7A 5AM7A 2KULA 4WUAA 2X2LA 5EOLA 1UWHA 5LVNA 5E7RA 3WZDA 3AC4A 2J50A 3ELJA 4IDTA 4IX6A 1PF8A 3G6GA 5L2QA 3TJCA 3TL8A 4RX5A 5CEMA 4ACDA 4TWNA 4O0RA 4TPTA 1TZDA 5AX9A 4DFLA 5C8KA 4YUQA 1Q61A 4MBIA 4UZHA 5E1EA 4BDJA 4L3PA 4V01A 3NW7A 2ONLA 3O17A 4USFA 3RM6A 1KV1A 2WTIA 3FQHA 4FR4A 5CLPA 3R8LA 3K5VA 4YSMA 5GIOE 3QKLA 3KCFA 5HVJA 3S2PA 2PUPA 4FX3A 2RL5A 3MH0A 2I0EA 4ACCA 3ROYA 1IASA 4HVIA 2Z8CA 4S2ZA 3F5PA 4FSUA 3H9RA 2G2FA 2W5AA 1TQIA 2UZTA 5JT2A 2W4KA 1STCE 5ANEA 3D83A 4EH2A 3CPCA 5BVFA 4NWMA 3RHXA 2Z7SA 2C6MA 2UZUE 4R6VA 3QTZA 3QZGA 5HE3A 3KMMA 3LCTA 4XS2A 3HNGA 4XBRA 2B55A 5DEYA 4D55A 3LQ3A 2HZ4A 2QOHA 3EFLA 2XKEA 2BZKB 1URWA 4YJVA 3UYTA 5J9LA 4MXZA 2WMUA 5FTQA 2W17A 5AEPA 4MD7E 4YTCA 2GDOA 1BLXA 2X1NA 2DUVA 4XG7A 3AT2A 1A48A 4K11A 4UBAA 4O6EA 5HG8A 4F7SA 3G33A 2W99B 4D2WA 3W0QA 4B6LA 2W05A 3FDNA 4M66A 3NMUF 2ZM3A 4RJ3A 4IWOA 2QOIA 5E8TA 4WSQA 2YM3A 4ARKA 3PA4A 4FGRA 3PG3A 4GRBA 3P79A 3D9VA 3R2BA 3OS3A 4ITIA 5A14A 4O7NA 1UNLA 3AC2A 4TN6A 4USEA 4DITA 2EXEA 3AXWA 2FVDA 3F3WA 4D2SA 3BU3A 3PY0A 5M44A 3BL7A 2JC6A 5HG5A 2XK4A 3FKOA 4OLIA 3EQBA 4FF8A 3WILA 4D1ZA 4YGAA 3MFUA 4J7BA 5K5XA 4W8DA 3PDTA 3QQLA 3VIDA 4NM5A 3MY5A 3ZRMA 4AU8A 3NVMB 3R04A 4AQKA 4G6NA 1U59A 4H36A 3F5GA 3O8UA 3FZSA 3VJOA 2RFSA 1H24A 4U7ZA 3A4PA 4EK8A 5BQ0A 1R0PA 2Z2WA 5KBQA 4DFYA 4G6OA 2J2IB 2C3JA 4PUZA 3R7EA 4APCA 2VX1A 2UZLA 3UIXA 4QEBA 4CV8A 2WTKB 3Q4ZA 1GIJA 5L6OA 4FV6A 4J8MA 4FMQA 3TDWA 3ORTA 3KVXA 3F9NA 1J7UA 3HKOA 3SVVA 3O5AA 4FTKA 4D28A 1OL2A 4KNBA 2F7ZE 4HVHA 3OEFX 2WQEA 5E1SA 2CKQA 3TYKA 4DHIB 4BDDA 2CKPA 1Q3WA 3OWLA 3DCVA 3MVJA 4FTCA 3UODA 3PPJA 4IWPA 3W8QA 3ZBXA 3SW7A 5BVWA 5CWZA 2R3OA 3ORNA 3KFAA 4EZ3A 4QP3A 1OZ1A 3V8TA 1T45A 3QC9A 2GTMA 4ACMA 1SMHA 2F9GA 2PE2A 3W2QA 5KMLA 4AACA 4B8MA 4QDEA 4EH3A 3NUUA 5AR7A 1K3AA 1P4FA 1UU7A 1WMKA 3F3ZA 4GJ2A 3NZ0A 4RVMA 2BAKA 3PSCA 3QQFA 1M7QA 4O2ZA 4EOSA 1Z5MA 5AP3A 2RSVA 4QPAA 5HORA 4FIHA 5JGDA 5AWMA 3ATTA 2BDFA 4IFGA 4JDKA 2YZLA 3ZLYA 4NM3A 3TKHA 5CNOA 4M0ZA 5AR5A 3DKCA 3TZ7A 4BY9E 5HZNA 4FNWA 1H00A 3QF9A 4UV0A 2GNHA 4GVJA 4I92A 5CNNA 3SXSA 1XKKA 2B53A 5EYDA 4YJRA 2IVUA 4E7WA 5LJJA 2CDZA 5AIRA 4GL9A 1PKGA 3DT1A 4F9AA 2O3PA 1G8AA 2WQMA 5EI8A 5FBNC 3AC3A 4E5AX 2IVSA 2XNMA 5EQYA 5F9EA 1ZOHA 3SDJA 2WMQA 3PFQA 3PSDA 3ZFXA 3R83A 3UC3A 2XALA 3DK6A 4LYNA 5AADA 5AUZA 2YHVA 4U97A 3C4EA 4NCTC 4XJ0A 5TR6A 3R7GA 4IM2A 3CY2A 4C57A 4WOVA 5KE0A 5CEKA 4OTHA 4EYJA 2GSFA 4YTHA 3S1HA 4JIAA 4W4WA 5TO8A 2OFVA 2VTOA 4C38A 4WO5A 3HYHA 3RZBA 3VS2A 5A46A 3IPHA 2R3NA 4F4PA 1IR3A 2Z60A 3PZEA 2B0QA 2BRGA 4C3FA 3GC0A 3MPTA 4GV1A 4UWCA 4FKSA 4IBMA 2J5FA 2QLQA 2VTHA 5H2UA 4QOXA 5I9XA 2DS1A 5M4IA 2WGJA 2ZV9A 3GCSA 4CG9A 3IK3A 3QUPA 5CEPA 2OU7A 4R8QA 4IM3A 2WNTA 3O8TA 4BGGA 3NR9A 2AC3A 3UVPA 2ZDUA 1REKA 5KUPA 3QKKA 1Q3DA 1FGIA 4UALA 4I20A 4WHZA 3W16A 2W1HA 4GK3A 4K1BA 5AAEA 4FG9A 4FV5A 4MNFA 3AT3A 4ZJVA 2Q83A 1JSTA 3CD8A 4OBPA 5JZNA 5AP0A 4PRJA 4B99A 3VC4A 2BAQA 3KMWA 3UOHA 2WMBA 2YJRA 4JG6A 4O0YA 1NVQA 1OM1A 4YP8A 4BWPA 5J79A 3NNXA 2BCJA 2OXXA 3PY3A 5CTPA 5A6NA 3O71A 3W0RA 5IQHA 3CLYA 4NSTA 3W18A 4PP7A 3LFBA 5CT7A 4Y72A 2OIQA 2ERKA 2Y6MA 4EKKA 5L2IA 2X4FA 4IAAA 4HOKA 5BVEA 4L3LA 3SG9A 3MWUA 3QA0A 4ZSEA 5BV3A 4FL2A 4U42A 4LMUA 1OECA 3LXKA 4BHZA 2C6TA 2V5QA 3DGKA 4FKPA 4ZMEA 4C4GA 3T9IA 4IC8A 5FM3A 4QMVA 3C4XA 3MN3A 2CNQA 3TUBA 4Y83A 3VS1A 4ZTMA 3CGFA 1YI6A 3QZIA 2F7EE 2IJMA 4RWJA 4WA9A 1OI9A 5CVHA 5DN3A 4DGMA 2B1PA 1OL6A 3U4WA 4EOOA 2W5HA 2YCRA 3CIKA 1Q8YA 3UOJA 2GPHA 3ACJA 3R22A 4K18A 1OL1A 5GINE 4RVTA 4A9RA 3VW6A 1J7IA 3OXTA 4O1OA 2HWOA 4UXQA 1OKZA 5HCYA 4F08A 3NPCA 3DLSA 5CX9A 3ALOA 3ZC5A 4TYJA 2ITUA 2WU7A 3AGMA 2UUEA 4FNZA 3COKA 4IANA 4OR5A 3R1QA 4E4MA 4AQCA 4FKWA 3TKUA 1TQMA 4XV3A 3DXPA 1NT2A 1SNXA 5C8NA 3UP2A 5BYZA 3OW3A 4Y5QA 4GIHA 4JDIA 4DTBA 5LCKA 5G6VA 5KMKA 3ZM9A 4MF0A 5T68A 4ERWA 2R0UA 2JKOA 3TT0A 4CT1A 4EH5A 2XAMA 3RBWA 3MFSA 1ZZ2A 4P7EA 3MIYA 2X0PA 3Q9ZA 3ZXZA 3LCDA 4J52A 4QT1A 4RC3A 1HOWA 1XO2B 4RIYB 4E6AA 2JBPA 3HV5A 2R3MA 3NNUA 3TV6A 2UW5A 3VONA 4L67A 2XJ1A 5IZFA 3FXWA 5DVRA 4F64A 4TNBA 5HCXA 5HHWA 4RJ7A 4BICA 5BYLA 2H34A 3CKWA 3MA6A 2F2CB 3ZSGA 2DQ7X 1XBBA 3ORMA 3QQKA 1U4DA 3RAWA 4IVCA 4BGHA 3IDPA 4CCBA 4F7NA 4KWPA 1XMLA 2PU8A 3TKIA 3DBEA 3QQGA 3ULZA 2I1MA 4WRGA 1E9HA 5M53A 3LCOA 4RX9A 1Q8ZA 2W1CA 4UB7A 4XLVA 1VR2A 2FSMX 4L01A 3H10A 4EHVA 3LFQA 1Y8GA 2EXMA 3VO3A 4LV8A 4QP4A 5AUTA 3QX2A 4MXCA 2C47A 3DTWA 4EHZA 3EZRA 4NZWB 1UA2A 2QD9A 2WMTA 2RG5A 4HYUA 3RI1A 3TDVA 3TACA 3TM0A 3SKCA 3FMHA 4TXCA 5CSVA 4FUYA 5HNIX 4F1MA 2BFXA 5IG1A 4L3JA 2Y4IB 2OWBA 4O21A 4CZTA 3R30A 4CKRA 4RGJA 2XKDA 3TZ8A 3CKXA 4QYYA 3MGYA 2WFYA 3Q5ZA 3Q6UA 4DEBA 1G8JA 3R7VA 4ZTSA 2V0DA 1LP4A 4IVBA 5I3OA 2BILB 1PXOA 3TV7A 5K0XA 3PG1A 1QPDA 4GYGA 2PMLX 3QTSA 3PWDA 3BGQA 3IW4A 3JVRA 4QQ5A 4RLLA 3UNKA 5AV3A 1GOLA 2YACA 5JMSA 4LL0A 2XIKA 2VGPA 5A4LA 4AGUA 4XH6A 2RF9A 1YDSE 1VYZA 1FVVA 4LOQA 3UG1A 4MBJA 4C0TA 4F6UA 2VD5A 2WIHA 2BRHA 4JQEA 2NYAA 3P78A 3ORPA 5KNJA 4X2JA 4F6WA 4GUEA 1CTPE 1PMEA 2FO0A 3EJ1A 3MH3A 3AMBA 3KF4A 4YPDA 5HIEA 2C5YA 3P7CA 5JFWA 2C6EA 4MXAA 2G01A 3C4ZA 1L3RE 4FSWA 4O27B 3TI1A 1PXJA 3SLSA 2X6DA 4WG5A 4QMSA 3C4CA 5HG9A 2SRCA 1MRUA 1A9UA 4TTHB 4AZFA 4FEWA 1U54B 2IPXA 4BCFA 3LXPA 3P4KA 4HZRA 1WZYA 1P14A 3F66A 4K33A 3BRBA 3DJ6A 3PRFA 1PYEA 4L00A 4KIOA 4ASZA 4QTAA 2OSCA 4D4RA 3GC9A 4G17A 4WBBB 2PSQA 4S30A 5G1XA 1FMKA 3T8OA 4TYHB 3A4OX 4YLJA 4CRSA 4C4IA 3FXZA 3VQUA 4Y46A 5AM6A 2PVFA 1Y91A 2VTPA 4ZTNA 3QBNA 5ANGA 1GAGA 3EQFA 2EB2A 3UPXA 2IZTA 3JY9A 4HNIA 5JFXA 1YOLA 2R5TA 4L43A 4EK5A 2WMSA 4NIFB 4CLJA 4WNKA 1K2PA 1P4OA 3R7YA 4BCPA 5IDNA 2YM5A 5LQFA 2VO3A 3O7LB 2XAOA 3C0IA 4RQKA 3G6HA 4ZZOA 3ENHA 2XH5A 4UXLA 4RWLA 2VWIA 1NA7A 2C69A 4G5JA 3W2SA 2ITVA 5EOBA 4WNMA 2IO6A 3CP9A 4L53A 3R73A 5CVGA 4E6CA 4IDVA 3SX9A 1U5QA 1XQZA 5HGIA 4AXEA 3EN7A 4GJ3A 4BZDA 5LMBA 3UMWA 1OIUA 4HPUE 1Y6AA 5CANA 2CKOA 4IH8A 2JDOA 4XEYA 3LLAA 3GP0A 2PHKA 4FEQA 3IG7A 3MVHA 2QKWB 4L42A 4NFMA 1Q8TA 3LQ5A 4FL1A 4FK6A 4F0GA 4N6YA 3QQJA 3NNWA 4XG3A 2WMAA 4X6RA 4UMTA 2QR7A 5I5ZA 3KULB 3E7VA 2HELA 4C36A 4F65A 1BL6A 1EH4A 4O4EA 3Q6WA 4WKQA 3LOKA 3PJ3A 5HE0A 4XMOA 1UWJA 2X0QA 3KRRA 4IIRA 1W0XC 2C3KA 4O7LA 4NM7A 3BHVA 4ANMA 4AZTA 2OLCA 4C4HA 4YJPA 3H30A 1T46A 5FTOA 3N4VA 5DA3A 2CGXA 3DJ7A 4I4EA 4LOPA 2PMOX 2UZBA 4G3CA 4XG9A 5AUUA 4IMYA 2CHLA 2EUFB 2PZPA 4WRSA 1H1PA 2OIDA 2ZV7A 2W9ZB 1VEBA 3BYUA 4TT7A 4AGDA 3DS6A 3PVWA 1YQJA 4QMWA 2WMVA 4C7TA 3VBVA 1YKRA 2OJ9A 5AR2A 4GFGA 4O7WA 3G2FA 2WEIA 2XM9A 4RJ5A 5D7VA 1O9UA 1QPCA 4CNHA 3W0MA 4G5PA 4K8AA 3VF8A 5JZJA 3OWJA 2QOCA 2E2BA 2BPMA 4NK9A 1G3NA 5KZ0A 3ROCA 4DCAA 4P4CA 5K9IA 1A06A 3D15A 3B2TA 3FV8A 5CYIA 2J0KA 4TWOA 2VAGA 3Q3BA 2WMXA 1OIYA 2UW9A 3I0QA 4QP7A 3KC3A 2C5NA 2G9XA 1OITA 4DCEA 3GBZA 3MJ1A 4IC7A 3ITZA 1UKHA 4LMNA 2YDKA 2XA4A 1ZYLA 3JS2A 4PMTA 3UO4A 2QU5A 3HA8A 2UZOA 3MY0A 5A4EA 3PFYA 3RAIA 4KUJA 5E8XA 4QTCA 3PIYA 4YO6A 3WZJA 1E1VA 4HCUA 2X7FA 1PMNA 3SAYA 3S00A 3K5UA 4UN0C 4DHFA 4JQ8A 4UZDA 3UTOA 4N0SA 5IKWA 4CRLA 2JLDA 2VTRA 2OXYA 1W84A 4D0WA 1BX6A 4U0IA 2FYSA 1PXKA 2O64A 4J53A 4TYIA 4ZS0A 5A4CA 3UE4A 4DAWA 1NW1A 1PXIA 2H8HA 3I6UA 1Q62A 1MP8A 2UZVA 4HGTA 3PA3A 1B39A 5EYCA 1J1BA 3MPAA 3WF5A 3R2YA 2GQGA 4K9YA 3WIGA 1NY3A 4I5CA 4OW8A 5ETCA 4DTAA 4YBKA 2P33A 2R3FA 3LMGA 4OTRA 3VS5A 3GCPA 4FV1A 2E9UA 4JBVA 3U9NA 4ZLZA 3C13A 4EQUA 4QQTA 3W0SA 3OXZA 4EL9A 1GZ8A 5EHLA 3QQHA 4IAFA 5BMMA 1S9IA 3I6WA 1M52A 1J91A 2H6DA 4G3EA 4NW5A 4WG4A 4FKTA 4XG4A 2CNVA 4R5SA 5AP5A 5CASA 2GS7A 1WVXA 4ZZNA 5JK3A 2B4SB 4E4LA 4YZNA 1V1KA 3DAEA 4A4OA 1XH6A 3FJQE 4OTIA 2X2KA 3NUPA 4CKJA 3AT4A 2YCQA 4GYIA 5KX8A 4D9UA 4C3PA 5I3RA 3WF8A 4MD8E 2WHBA 1X8BA 3DPKA 1KE9A 3ET7A 4MQ2A 2VTNA 1IG1A 2YEXA 2R64A 4X2FA 4EUTA 2I40A 4AG8A 4AP7A 5FG8A 5LMKA 4MH7A 1IA9A 1YOJA 3CC6A 4CFVA 3PP1A 3F3VA 4FV7A 2VX0A 3U6IA 1UVRA 5LARA 4OAVB 3FL4A 4YSJA 1GJOA 1OPKA 1ZYCA 3DB6A 4TW9A 1OL5A 3EN5A 5FM2A 5CZIA 3SXFA 5HVKA 1UU8A 4JBPA 5JEBA 5IDPA 4DDGA 5CEIA 2ONLC 4ASEA 4ZAUA 2Y8OA 1M2QA 2OKRA 1NVRA 4L68A 1CM8A 4FSNA 4RA4A 3TEIA 2ZMCA 3W2CA 2LGCA 2FA2A 2QURA 4AE9A 2OJFE 4O81A 4JRNA 4IQ6A 3FL5A 1H26A 3WE8A 4FK3A 2IVTA 4HNFA 4A07A 3BV3A 3GU4A 5LVLA 4FTNA 4UY9A 4RC2A 4C62A 2GHGA 4TKSA 4AW1A 4BJJA 3FYKX 1OUKA 2BIKB 2OW3A 2XEYA 4AOIA 5ETAA 2CCIA 4O91A 4AS0A 3PXFA 3F88A 2LAVA 1XHAA 3GI3A 2IW8A 4G2FA 2XP2A 2Z7LA 3DFCB 2I0HA 4RC4A 1M2PA 3H9FA 3FMNA 5HBEA 3DTCA 2ZB1A 3U8WA 2XNBA 3KK9A 3BZ3A 4ANSA 2XYNA 2GNLA 2QR8A 3T9TA 3LCSA 3NWWA 3QC4A 5IH6A 4QMQA 2BDWA 5CU6A 2P2IA 3HMIA 1J1CA 2C1BA 2UZDA 4IE9A 1OKVA 4ANOA 5CF5A 1UU3A 1Q97A 3BU6A 1MRVA 5BNJA 4BCMA 1BL7A 5FEDA 5DYJA 2R3PA 5HI2A 1MQ4A 2XYUA 4RVKA 3CTHA 5ANIA 2AEGA 2XANA 5IQBA 3M42A 5HX6A 3P1AA 3TUDA 4F7LA 1OMWA 2GNFA 2EXCX 5CQWA 4AOJA 4MBLA 4CLIA 4DH8A 2WQOA 3WE4A 1CKJA 3QLFA 2BMCA 5EDPA 3AOXA 2OO8X 2P3GX 3F3TA 2XK8A 5LVMA 4F70A 2C0IA 2C0OA 3RMFA 4AAYA 3VUHA 5K3YA 3PVGA 3ETAA 4A4XA 4MD9E 4Z7HA 3EB0A 2BTRA 4H3QA 4HZSA 2YZAA 3E88A 5DG5A 3ZLWA 4S31A 4AA5A 4C4JA 5CSPA 4F1TA 2QOLA 2RFDA 2REIA 2QG5A 4DYMA 4P5ZA 4CT2A 5DH3A 2BZIB 3BHYA 2GFSA 2PYWA 4FOCA 4K77A 3G9NA 3D94A 4EBVA 3CQUA 4QP1A 2IW6A 3BBWA 3DLZA 3RNYA 2OJGA 3ATSA 3AMYA 4KD1A 3R00A 3UDZA 3ZUVA 2CCHA 4BTFA 2W06A 3ZO1A 5TE0A 4UYNA 3WZEA 4M84A 3ZDIA 1FINA 3BEAA 3E8EA 4KIQA 1M7NA 5TKDA 1PRYA 2NNWB 4KB8A 4KA3A 3BHUA 4RIYA 4O1PA 5KZIA 3HRBA 3MFTA 1ZAOA 2HWPA 2YABA 1SVHA 4NW6A 5B2LA 5IQFA 4EQMA 2XNNA 4IB0A 4BL1A 1BKXA 1LPUA 2F57A 2IEWA 3MVLA 3RGFA 3THBA 4GCJA 5FLFA 4PTCA 2BHEA 4M12A 1M2RA 1V0BA 1YWNA 4MTAA 2XRWA 3LZBA 3DXQA 4IWDA 3DV3A 4HGEA 4XG6A 2OH4A 4NKSA 3COHA 4YJTA 3M2WA 3GQIA 2W1IA 3N9XA 3NGAA 4I1ZA 3ORZA 4I5MA 2OGVA 2XJ0A 4RIOA 3D4QA 4BDCA 4I41A 2XIRA 4AE6A 4RA5A 2ZFYA 3DAJA 1NXKA 3EOCA 4D0XA 4H3PA 4YPSA 5CXZA 4FJVA 3V5PA 3F7WA 3E63A 4LRJA 4CVAA 2RKUA 1YXUA 2PVMA 2PE1A 3VS4A 2CJMA 5F95A 1FVRA 1UV5A 3GGFA 4MUQA 2W4JA 4J97A 4MVFA 4X2GA 3E64A 4BDAA 3PXRA 1OKWA 4ZP5A 4RLKA 1P2AA 1JBPE 1PKDA 3FWQA 3ZSHA 2Y6OA 1JVPP 4QTDA 5HG7A 4AXAA 3FKNA 1DAYA 3M11A 4I93A 4NUSA 4ID7A 4MEDA 5CU0A 2OF2A 2XRUA 4U5JA 3C4WA 1JAMA 4RT7A 2VNYA 3DBFA 3LVPA 4FV8A 5KBRA 4ZS4A 4G3FA 2XCKA 2UW7A 1YRPA 4FT7A 4E4XA 3RK7A 4G9CA 2X8EA 3GT8A 3QD4A 4M67A 5KMOA 3D2KA 4XRLA 1UU9A 5FBOA 2F4JA 4C02A 5CAQA 5HTBA 3VBYA 4A4LA 2GHLA 3QXPA 2UVZA 4J98A 3G15A 2OF4A 3VBWA 4N70A 2XMYA 3TIYA 4CQEA 1W2FA 2O0UA 1ZMUA 4BCIA 5EM8A 3EQGA 3LQ8A 2IZUA 4GKIA 4H1MA 1ZYDA 4IAYA 3REPA 5DMZA 3BYVA 3QFVA 3QHWA 1O6YA 4GU9A 1U54A 5L2SA 1OBGA 5CU2A 5A6OA 1L8TA 4TWCA 4AW5A 5J5TA 4I5HA 4FTRA 3EH9A 4A9UA 2GU8A 3N4UA 5I9UA 3QKMA 4DEGA 3PIZA 4CG8A 5HOAA 2V22A 5T3QA 4GFMA 4K2RA 1XJDA 4KBAA 1KOBA 3WF7A 2ZB0A 1Q5KA 1WBSA 4TYHA 3D0EA 2I7QA 2UW6A 4HGSA 2ITTA 4PY1A 4QTBA 4DEEA 4R7IA 3DDQA 3NNVA 4D4VA 4U9AA 5EI6A 2C3IB 3IDCA 4EQCA 3RVGA 2XS0A 4NIFA 5DT3A 4PPAA 3ERKA 3EN6A 3U51A 4R77A 1H1SA 3KEXA 3RP9A 4DFUA 3DBCA 4U80A 2RFNA 3JVSA 1G8SA 3HP5A 3PE2A 4L6QA 3UC4A 5LVPA 4ZTHA 2IG7A 2PMNX 5E91A 4GEOA 2VTLA 3TUCA 3CS9A 4XP0A 5EDQA 4ZMFA 2R3HA 3QWKA 5M07A 4DGLC 4AW2A 4L44A 3LAUA 2I6LA 2CLXA 4FKLA 1Q24A 2C6DA 3UQGA 5AAGA 4NYEA 3FBVA 3SD0A 3WZUA 3NS9A 4RSSA 4BFMA 3P5JC 3MVMA 3W32A 3BIZA 3FY2A 4BCGA 4EUUA 3W2PA 3H4JA 3VRZA 4O6LA 2JAMA 3HV3A 4KBKA 1ZRZA 3H3CA 3HGKA 4L45A 5D11A 3LFEA 3IONA 3Q53A 2R4BA 3NAXA 4X2KA 4LRMA 1UNHA 4I22A 4BCOA 3F3UA 2PVKA 2A19B 4KSPA 3MFRA 2ITZA 4DLJA 4BTJA 4XCUA 3DZQA 4PDSA 4BI2A 2VTTA 5IEVA 2QG7A 3P9JA 4O7SA 4RJ4A 3BLQA 2HENA 4D2TA 5AR3A 3RALA 4DH7A 3I0OA 4IB5A 3QRJA 1W7HA 2R0IA 3I5NA 2JIIA 4X6QC 5IA5A 4KIKA 5E4HA 3TNHA 5HCZA 2XARA 3AMAA 5BX0A 2EWAA 4I94A 3I4BA 3PJ1A 4DFZE 2WMWA 2FUMA 4J99A 2PZ5A 5CAPA 1S9JA 1U46A 2C6OA 2UW3A 4JBQA 4JAJA 3Q4TA 1WBNA 1AQ1A 3KCKA 5I9ZA 1YI4A 4EOQA 5LXMA 5D41A 3PXKA 3IDBA 2P0CA 5E8ZA 5IH4A 3MA3A 1QPEA 4ENYA 1WBWA 3KXXA 4XYFA 3PJ2A 2G2IA 4FGBA 1DAWA 2C5XA 5I4NA 1W8CA 4FKIA 2VTJA 4BDBA 1OPLA 2NRYA 3NYXA 4Q5EA 4M0YA 4TYGA 3VW8A 4OTWA 4JJRA 5HD7A 1BYGA 2P2HA 3DFAA 3FMLA 3KXGA 5HO8A 1DM2A 3C51A 2YIYA 3W0NA 1H4LA 3ZZWA 4EYMA 4ZLYA 1TKIA 1LR4A 3NUNA 5CZHA 1IRKA 2ZOQA 1BI7A 4KS8A 5CF8A 4RMZA 2XIYA 4QYFA 5HEZA 5D10A 3TNIA 1R3CA 3WF9A 4ANQA 5AP2A 3GVUA 4LV7A 2BALA 2P55A 1YI3A 4OUCA 5EM6A 3EIDA 4AN9A 1RW8A 4GG7A 3KN6A 1KOAA 3BL9A 2A27A 3DNEA 4IAIA 3IECA 4JG8A 5AP4A 3EZVA 2UZWE 3IGGA 4K0YA 2JBOA 4YC3A 4U40A 5J5SA 1PMUA 2OG8A 4AZWA 3PA5A 4IM0A 3G0EA 3LM0A 3DKOA 3R8ZA 4Q9ZA 1BMKA 1YVJA 3PTGA 5EYMA 4YTIA 3U55A 2B54A 3CQEA 4FTUA 3IW8A 2J51A 5JH6A 4NH1A 3E62A 3ZUTA 4XP2A 5JRSA 2HY81 4BYJA 2C6IA 1NVSA 2JKQA 3BYOA 2WTWA 2W1EA 3OFMA 1ZOEA 3D5XA 4U6RA 1YHSA 4BCJA 2E9VA 3GCVA 2C4GA 3CD3A 4QMLA 2V7AA 4QMPA 4RWIA 4M69B 3ZZEA 5J87A 4YTFA 5FUTA 3OUNB 1MQBA 4IB1A 5DRDA 2JD5A 3UO6A 4FZAB 2WB8A 1H1RA 4YHJA 3IW5A 3SQQA 3W0PA 5M06A 4RZWA 3V5LA 3ZTXA 4PMPA 3NIZA 2WU6A 3E3BX 4PMMA 2WTVA 4D4YA 3ZXTA 3RPRA