4KSQA

Crystal structure of human b-raf bound to a dfg-out inhibitor 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
258
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Discovery of a Selective Kinase Inhibitor (TAK-632) Targeting Pan-RAF Inhibition: Design, Synthesis, and Biological Evaluation of C-7-Substituted 1,3-Benzothiazole Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 258
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ksqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ksqA01
3GC7A 5A6OA 4QMOA 4TNDA 4CT2A 1R1WA 5BQ0A 2ZDTA 3Q6UA 2VO7A 4O0UA 1ZARA 4I6QA 4IDVA 4ANNA 5J87A 1OUKA 3IW7A 2E9VA 3OTVA 4CCUA 4FSWA 4GJ3A 1RJBA 4CKRA 2VTJA 3NUXA 3EKKA 2YWPA 2ITTA 3BI6A 1KWPA 3JUHA 3QD2B 3FKLA 4C0TA 4CFUA 2R3MA 3FI4A 1Y6AA 5FEQA 2CMWA 4ZSJA 1CMKE 4WG3A 2WQNA 2ZB1A 2ZVAA 5M4FA 5BUEA 2W1HA 5IZFA 3GQIA 4NW5A 4JLCA 4LGGA 2OF4A 3R01A 3LMHA 3U9NA 4XBRA 2CNUA 2GU8A 4GYIA 1W84A 3TUDA 3JXWA 3VHEA 3KVWA 2OXDA 1KE8A 3EL8A 4GUEA 4OTFA 3AT4A 2OZOA 2VNWA 4YLLA 1V0OA 4O21A 5J7BA 5EKNA 3PIZA 4N6YA 1SNUA 2YCSA 3FUPA 3GCVA 4PF4A 4ZLZA 4XG8A 3WF6A 3UQFA 2QLQA 4BWXA 3WF8A 1OI9A 1I44A 4RG0A 2O8YA 4FL2A 4FZAB 1LR4A 3FYKX 1U54A 2R3OA 4KKGA 3QGYA 4AF3A 4PTCA 4WNMA 2R3FA 4FICA 3DXPA 5CAVA 5L6OA 2OH0E 3HMIA 4U0IA 2GS2A 4ZIMA 3QXOA 4BI0A 4Z3VA 5IUHA 4U45A 3SKCA 2NO3A 2HW6A 3LM0A 5DEYA 3G9NA 4X0MA 3V5WA 3W2PA 2UVXA 4JBQA 4C4GA 4DBNA 4F9BA 4K8AA 3NVKI 3GU7A 4R5SA 4QP2A 4AQCA 5AR2A 5KKRC 3PPKA 2YCRA 4U79A 3FMKA 3TNQB 2ETKA 2VTPA 2X1NA 3NYVA 3E87A 3IW6A 2JEDA 4Z16A 3D4QA 1HCLA 1JSUA 3OD6X 1ATPE 2QOBA 3L8PA 3QALE 4I24A 4MNEB 5BVEA 4D2RA 5M4UA 4FL3A 4RJ8A 4DH5A 4DGMA 5JZJA 3DKFA 2YHVA 3HDMA 4BTJA 5ANIA 3Q5ZA 3WF7A 2ESMA 3W33A 4QRCA 5FTGA 3W16A 4EK8A 3I4BA 5F1ZA 4AW2A 5LARA 4YPDA 3SLSA 3QWJA 3VIDA 2A19B 1XH9A 1M7QA 3O0GA 3MH3A 1OB3A 5B0XA 3M2WA 3QTQA 3RINA 4HCUA 4FV0A 3PDTA 3OUNB 4FKUA 2R7IA 3SD0A 4FV4A 1B6CB 4LG4A 3SDJA 4D4YA 4UXLA 4O6EA 4RVLA 3R1QA 2CSNA 2BIYA 2WGJA 3OC1A 4HYSA 5AJQA 2QONA 4IX6A 4YZ9A 2C30A 5C1QB 2XNPA 1G8SA 4BVUA 4BY9E 3EN9A 3MWUA 3OW3A 3RWPA 1YI6A 1Z5MA 2C6KA 2WIHA 4HGSA 3TV6A 4ENXA 3TKHA 3RKBA 4TWCA 3BYSA 3K2LA 4FK3A 4MXOA 2OO8X 2HWPA 5JN2A 3B8QA 4YSMA 4BGGA 4IJPA 3QHWA 4E93A 2XYNA 3O51A 3L9MA 3VUTA 3ZEWA 3R6XA 5DR2A 4AN2A 3V6RA 1PXJA 2C68A 2NP8A 3WIGA 4DFYA 1JKSA 4XV2A 3CPCA 4EOKA 4RX5A 4QMSA 2JIUA 4FG7A 4R1YA 5EI2A 4CYIA 2I40A 2YJRA 4EK3A 3F5PA 2YCQA 3ROYA 4BBMA 4YMJA 5L8LA 2GCDA 2QO9A 3O8UA 3BLRA 3F69A 3Q3BA 3ZCLA 3TI1A 2XIXA 1H01A 3RK5A 4I5PA 4DC2A 4ZSGA 1OL7A 4G3CA 3GUBA 2JAMA 3GCQA 1Z57A 5C26A 5AUUA 4YZBA 4RIOA 4E8AA 3FZRA 2QODA 2XIZA 3C4CA 5M08A 4E7WA 3HUCA 4DH8A 3I6UA 2WMUA 1BUHA 2XH5A 3D15A 3MFSA 3BGPA 4O2PA 3BYVA 5L2QA 3LQ5A 4I5CA 4X2NA 4MKCA 5TOZA 1H28A 3WYXA 1M14A 5T3QA 5AR3A 4IZ7A 4EBWA 2W1ZA 4DA5A 2WXVA 1OPJA 3OY1A 4FSQA 1OM1A 1IA8A 4L3LA 4BGHA 4I4EA 2PUIA 3DGKA 2ZYBA 4IMYA 2PZIA 3K5VA 3FLWA 4YO6A 3QQGA 4AZVA 1CDKA 3COMA 1PRYA 3CE3A 4FV3A 5LVOA 2NRUA 4L3JA 4Y95A 1IA9A 2WTWA 3MIAA 4BKJA 1YDRE 3KXHA 3CY2A 4ACGA 4QMLA 1PKDA 2WU7A 4HVHA 4I93A 5I4NA 2YAKA 4A9UA 3D14A 3R04A 4H3BA 3R9NA 2R3JA 3BIZA 4U8ZA 2FSLX 4MYGA 3MY5A 2P4IA 2VRXA 3MFUA 1XJDA 4P5QA 3GU6A 1OITA 2UW6A 3FI2A 2B53A 2PVJA 2WQEA 4GFOA 5CEOA 2GNIA 3G90X 3G51A 4BCIA 2WMSA 4MHAA 5E8SA 1IR3A 5DT3A 2WMXA 1W0XC 2IW9A 2JDVA 5HLNA 1QMZA 4F99A 4ANBA 3A7JA 5DR9A 1K2PA 4FV1A 3Q4TA 4IFGA 4N0SA 2X39A 4ACMA 3DKCA 3I1AA 4QMMA 4BTKA 5CT7A 4GUBA 4CRSA 4E5AX 4F0FA 4QMQA 5FDPA 1ERKA 3DT1A 3LKMA 4Q5EA 5A4TA 4HNFA 3V3VA 4ZZNA 5AMNA 4U42A 3NW7A 5IQGA 4ACCA 3PTGA 4Y72A 4FKVA 3KRXA 4M66A 5M06A 4GT5A 3LXLA 3Q60A 4BYJA 4DEDA 4L45A 2C69A 5H3QA 3ZSGA 4RC4A 2UZDA 4RIYB 3GGFA 4AGUA 1NT2A 1PYEA 3BU3A 5IDPA 1DS5A 3UMWA 2PZRA 3KKVA 4HZRA 5E1EA 4ASEA 1QPCA 3BHUA 5KX8A 2XKEA 3E8EA 5FDXA 4IM0A 5K4JA 3A7FA 3ORPA 2QU5A 1YHSA 1TVOA 1ZMVA 2AUHA 4ENYA 3R9RA 1ZRZA 3HV5A 3EN7A 3NPCA 4LUEA 2KULA 4FGRA 1OPKA 1R0EA 3SRVB 4GW8A 5HBJA 1GJOA 4DFZE 5ETFA 4DAWA 3UO5A 3F2RA 4I92A 4FYOA 4EH4A 3IDCA 2C5YA 3IOKA 5H8GA 3CR0A 3VUGA 4FKSA 4L67A 3MY1A 4PP9A 4EKKA 2IZTA 4C4IA 5TT7A 4DTKA 3NNVA 2CNQA 4OTHA 3R7UA 4IANA 4NIFA 4JQEA 5HCZA 3W8LA 4QP9A 2FUMA 3LFQA 2VU3A 2GS6A 4IVDA 4IC8A 4WKQA 3HYHA 2LAVA 4P5ZA 2DYLA 3AG9A 3DY7A 4QO9A 4ZP5A 4TNBA 2FSOX 5H2UA 4FV8A 4OTQA 2OJFE 5FBOA 3VAPA 3VBVA 5I9WA 1XHAA 3TV7A 3QQFA 1MRVA 4NKSA 4ANMA 3TEIA 3DB6A 1YI3A 3K54A 4I0SA 4ZSLA 3DBCA 1Q8UA 3BBTB 4AGCA 4OGRA 3QKKA 4JBVA 4TRLA 1OL5A 5JFWA 4ZY5A 3U51A 5E90A 5CSVA 2JIIA 3IW5A 3RBWA 2YABA 4FT0A 5AR5A 2C6EA 3QU0A 3R02A 4RIXA 1QL6A 2B55A 3SW4A 3WZJA 5JQ8A 2XKFA 5J1WA 3DXQA 3OUKA 5I0BA 1WBSA 5FTOA 5F20A 3UC4A 1E1XA 3QYWA 3D2IA 4KWPA 3WZKA 4ZEGA 4KA3A 3LCOA 4WG5A 1NW1A 4BN1A 5LVPA 2XK4A 5JH6A 2CLQA 2UZEA 4C35A 1KE9A 4J1RA 2YIXA 2YM3A 4RA5A 2UZUE 4A06A 4YZNA 1PXNA 2VGOA 3HUBA 3Q32A 5CU0A 3OY3A 3R8ZA 3MVHA 2WMQA 4V04A 2ITWA 3CJFA 4A4LA 3H9OA 3LFDA 5DYJA 3EQGA 4ZY4A 4IVBA 2W0JA 4UYNA 4BICA 4WA9A 4E73A 1WZYA 3L9PA 4IAFA 3KRJA 2VWBA 4KIPA 3AC4A 4DGGA 4MCVA 3DV3A 5LJJA 3OW4A 1YXVA 4GKIA 3TTJA 4Q9SA 4FGBA 3HNGA 5KBQA 1R39A 4D4RA 4X3FC 3IGOA 3RK9A 4RJ3A 4Y5HA 5AP3A 1OGUA 4UWCA 3U6HA 5HHWA 4ZS0A 4JVGA 1PXOA 4F6UA 1DI9A 4A07A 2CKOA 4FSNA 3DLSA 3S00A 2RSVA 4MQ1A 3UYSA 3ALOA 3SXFA 3DK3A 2ITQA 5EHYA 3UMXA 5B2MA 5EHLA 5JT2A 4P4CA 2BDJA 2BHHA 1IEPA 4C4EA 2J0MB 4E1ZA 1WVYA 3OOGA 5DE2A 5F94A 2PVHA 5L2SA 1XWSA 3R22A 3OBGA 3MSSA 4IWQA 5AR4A 4BTFA 5ICPA 2Y6MA 3CQWA 4L00A 3EQPA 3V04A 3KXZA 4N6ZA 3AD6A 4EEVA 4FTRA 4U9AA 3ETAA 4XYFA 4ZTNA 1P4OA 1OECA 2X2LA 2R3NA 3GCSA 3VO3A 4BBEA 5A9UA 5AV4A 4EOJA 1IASA 2GHLA 5DOSA 4NZWB 4FTAA 2OJGA 1PMVA 4PNKA 5C03A 5FGKA 3Q2MA 3DBQA 2IWIA 4CT1A 3NW5A 4DITA 1UNGA 4GFGA 3PP0A 2UW9A 4OBOA 5L2WA 2XK8A 4MWIA 2XK7A 3BPRA 5JGAA 2C5VA 3LMGA 3FKOA 3ULZA 4UALA 5EHOA 3E64A 4FBXA 5I9VA 1ZXEA 2UZVA 3DU8A 3QL8A 4LGHA 5AV0A 3BEAA 3KXGA 2BZIB 5HICA 5C8MA 3UBDA 4FTUA 4Z7GA 5B7VA 3QTIA 2EB2A 2V22A 4RX7A 3LE6A 5AA8A 3MW1A 1CTPE 4CG8A 1XBAA 3LFSA 3OWPA 3SQQA 1Q4LA 1JQHA 3BHVA 4D5KA 4UMUA 4FSRA 5AUZA 4K9YA 5ACBC 2OLCA 3GOPA 5L8JA 4BCMA 4ZTMA 3UOJA 5HGIA 5KBRA 3HAVA 1M2QA 2BDFA 5D11A 4O7YA 2ERKA 1MP8A 1R78A 1OPLA 2VD5A 3RMFA 3UP2A 5BPYA 4YP8A 1REKA 1V1KA 4KIKB 4BFMA 3K3IA 1W83A 3NCGA 2R3HA 3C4XA 5L2IA 3VUHA 3U55A 4EK6A 2J5FA 3SXSA 5AR7A 2XVDA 2WU6A 1OIRA 1Y8YA 4G1WA 1I09A 4QQJA 4K18A 4RLLA 4BCNA 5IMXA 5AFVA 2NRYA 4XG9A 2JDTA 3P79A 4GS6A 5GJGA 2YM5A 3I79A 4BI1A 3CLYA 3NYXA 3KA0A 4ZAUA 4BDBA 2R3RA 3E5AA 3IW8A 3Q6WA 4M68A 2VTRA 3ZUVA 2X9FA 4RVKA 3Q4ZA 3CBLA 3F9NA 4MTAA 3IONA 5ETIA 5ETAA 1H1SA 4TWPA 4U80A 4XMOA 4FTJA 2ZOQA 4PNIA 4A7CA 4IFCA 4APCA 4ZSEA 4UV0A 1WFCA 5JGDA 5HO6A 4C37A 4I6HA 5EM7A 2OXXA 4F7LA 3PA3A 5BVOA 2OKRA 4AFJA 4PL5A 4V0GA 3SA0A 4BKYA 2O5KA 3VW8A 2QO2A 5I3OA 4LV5A 4O0YA 4UXQA 2HIWA 1YQJA 1ZZLA 3NAXA 5KMLA 4EOOA 2ZDUA 2VX3A 3FZ1A 3NZ0A 2Q83A 2JBPA 4K2RA 2ACXA 4NH1A 4RVTA 4ZLOA 3VVHA 2YDJA 3R2YA 3RALA 3AC2A 3RHKA 3FMNA 3VBXA 5DN3A 4YTIA 2R3QA 4X2KA 2C0OA 3QXPA 4KSPA 4H1JA 4FEVA 1AGWA 3NNWA 4YJPA 1CKJA 2WB8A 4L68A 4NEUA 2C3KA 1FVRA 5ANDA 3PY1A 3AC1A 4X21A 1KUTA 3OMVA 5FQDC 1JPAA 3DXNA 3F66A 1YOMA 3CIKA 3U87A 3LFCA 3SG8A 4V05A 3KGAA 2F7XE 2Z02A 3MVMA 4G17A 4ANSA 4HGEA 5EW3A 3ZBFA 5GZ8A 3P5KA 3ORIA 3QZIA 5CY3A 5DFPA 4PV0A 3LJ2A 4BHZA 3QQLA 4FOCA 3LCKA 5E8UA 4CFVA 4J96A 5EDQA 3UIUA 1UKHA 3IGGA 3FPQA 4E6CA 5HOAA 3GT8A 4GT3A 3ROCA 3O2MA 2OIDA 4YHJA 5LMKC 1YXSA 3PP1A 3FZSA 4BCPA 3BHYA 1PXLA 3NUNA 3TKIA 5CAPA 3QRIA 5K5XA 2WMVA 5E91A 5AV1A 4XCUA 4F70A 4C59A 3QRKA 4J8NA 1H24A 4FIHA 3QA8A 4FTTA 2QOQA 4RZWA 4ZTLA 2X6DA 5BX0A 3DJ6A 5AWMA 3LXNA 4L44A 3FZPA 1JLUE 4FF8A 3TJCA 5AP0A 5EI6A 4O1PA 3NYNA 1PW2A 2OIQA 3BU5A 3LFEA 2F2CB 4UMRA 3TNIA 2J0KA 3PJ8A 4FEWA 4AACA 4EZ3A 3IDBA 5KMOA 4NM7A 2UW7A 3DJ5A 4NWMA 2WMAA 4EC8A 4O81A 2EUFB 1BI7A 2GHMA 2H6DA 4CMOA 4E4LA 2WTKC 4J71A 5AUXA 3LJ1A 2QOFA 5LVNA 3FMEA 5E8VA 3I0QA 3MPTA 3NS9A 4FNZA 2JKKA 4L53A 3V5LA 4TKSA 4ERKA 3BE9A 4C3FA 5E9EA 4D2PA 5E8WA 3WF9A 2ITUA 1JKLA 3MH1A 4JRNA 2JBOA 3QTRA 3B2TA 4JRVA 2XBAA 3PVWA 4DG3E 1ZAOA 3NGAA 3FXWA 5JK3A 1Q8WA 1YXXA 4WRGA 3RAKA 4CLJA 3LW0A 3MB6A 2YEXA 4IAKA 3EN4A 1URWA 3E7OA 4XV1A 3AC3A 3OVVA 3PPZA 3K3JA 4YC8A 5KO1A 4G3FA 3E8NA 3H0ZA 2CGUA 3QRJA 4H3PA 4L42A 4RIWB 4UN0C 4QTDA 4IAIA 2HXLA 3O7LD 5HBEA 3TUCA 3KREA 4S31A 4S33A 3G5DA 4FODA 1APME 3KL8A 4RWIA 3UNJA 2UZTA 4HOKA 2UZOA 3OOMA 5M09A 4FSTA 5FTQA 4RLKA 2XJ1A 4Q2AA 4U41A 5EQPA 4FVPA 2WD1A 4WD5A 2VV9A 5JZNA 4F4PA 3LFBA 3TCPA 4QQ5A 4M0ZA 1IRKA 3UNZA 3T8OA 4FMQA 4IHPA 3R7IA 2QG7A 4RA4A 1ZWSA 2VAGA 3PSBA 3ZO2A 1PF8A 4JBPA 4ITHA 2BMCA 2Y6OA 1YWNA 4NT4A 5CU3A 3VS2A 3HV4A 1VYZA 3DBDA 2C1BA 4IZAA 2CKEA 2I0YA 2GHGA 2HWOA 4MXCA 5CS6A 4TT7A 2X9EA 5HD7A 5BYZA 4EQCA 2VX0A 4IW0A 4MD7E 2GTMA 3EQIA 4DTBA 3V01A 5LXMA 4LFIA 1QPJA 3FXXA 5H9BA 4JOAA 4A9TA 3ZDUA 2QG5A 3E92A 4ZK5A 3TV4A 2XBJA 3IG7A 4M14A 2Y0AA 2OGVA 3RPRA 5K5NA 2ZMCA 4BDDA 2PVMA 4EOLA 3RPVA 4J52A 4J7BA 4EHEA 2F9GA 3KCKA 4U44A 4FV6A 1FMKA 3CKWA 2G15A 4YJSA 3UC3A 4XG2A 2VWWA 5IQAA 2W1GA 4AT3A 2YZAA 3CD3A 3HX4A 4CKIA 1Q8ZA 2B0QA 4IC7A 1WVXA 2H96A 3GC8A 4XLIA 2IG7A 4L8MA 1QPDA 5BUIA 1XH6A 4DEBA 1FGKA 3EQDA 4GVJA 4MD8E 5A14A 3MI9A 5DVRA 3KMWA 3DK7A 3HRFA 3JVSA 5HI2A 2CCHA 4P7EA 3PSDA 4C58A 5B2LA 4FKLA 2QKRA 4EH3A 4YJQA 4WRSA 3ZH8A 1H4LA 4MVFA 1PXMA 1JKTA 5HE1A 3W55A 4USFA 4G9CA 3PXRA 4ZZOA 4L6QA 2WTJA 4FTMA 1UU9A 4HCVA 2GMXA 1S9JA 4QPMA 5DIAA 3BRBA 4UZHA 2UW8A 3C4EA 2GTNA 4NTSA 4RJ6A 3F2AA 3REPA 1F5QA 2PVYA 4MWHA 5EOBA 3LQ8A 1H27A 4JJRA 4C57A 3BU6A 2UVYA 4RBLA 3UO6A 4BDFA 5K3YA 3ZU7A 5IQCA 2W05A 3P08A 4I41A 4YHTA 4I4FA 4O27B 1BYGA 2PZ5A 3Q4CA 1GZOA 4OTWA 5I9UA 4LI5A 2XP2A 2YA9A 4NYEA 4IADA 1Q3WA 3LIJA 1UV5A 3BHHA 3HMNA 3QWKA 4O1OA 1OKYA 1YWRA 5JSMA 1WAKA 4OTIA 4NM0A 4PRJA 2R0IA 3GU8A 4IB3A 5HEZA 2IW6A 4CTBA 3RAWA 4G6LA 3ATSA 2SRCA 1H26A 2KTYA 2E9PA 3LLTA 4PMSA 4PMTA 3ZDIA 5CI6A 4U81A 2H9VA 3OEFX 4IM2A 3OHTA 3D7TA 3IO7A 3MH2A 3D5UA 4GG5A 4K11A 4WO5A 4QD6A 4NJ3A 4FSYA 2G9XA 3EN6A 3GCUA 3QZHA 4HVSA 4BL1A 4E6AA 4IZYA 4O0VA 4GIIA 2X6EA 2Z7LA 1Q99A 4I5MA 4PTGA 4BCGA 4DHFA 3KN6A 1DAYA 3MV5A 5AA9A 5EYKA 1P4FA 3CPBA 3ZMMA 2W06A 4HVGA 1H07A 4X6RA 3BHTA 3KULB 4EKLA 4W4YA 3EMGA 2VWYA 2P55A 2CGWA 2XMYA 3KK9A 4MD9E 2OH4A 1FINA 5L4QA 3Q2JA 3FY2A 4A4XA 4X2JA 4G5JA 5CANA 2QLUA 3P23A 2Q0NA 4FV5A 3RNYA 4JDKA 4MK0A 4NK9A 4XP3A 4LM5A 3VS7A 4AP7A 3RAIA 5AEPA 1OUYA 5AP4A 3EH9A 4YU2A 3LMIA 2Y8OA 4H58A 4OLIA 4D1ZA 1J7LA 3QC4A 2JLDA 2OWBA 2XNOA 2XNNA 3DLZA 3ZUUA 4I94A 3FHRA 4L01A 1AQ1A 3VNTA 5L6PA 5HCXA 1YDSE 3BX5A 4KIOA 4JS8A 4R3CA 4BDHA 4ZTQA 4D1XA 2G2FA 4AZFA 2EXMA 3NIEA 2HZ4A 5E4HA 4UWYA 4ZTHA 4BR3A 1GIHA 4E4MA 1CM8A 3R1YA 1MUOA 3Q9XA 4CYJA 3ORZA 2F57A 4I21A 4S32A 4APPA 5IEVA 4UEUA 4BYIA 5LQFA 3OWLA 4JDJA 4GV1A 4D2SA 1R0PA 1KSWA 2J5EA 3AD4A 4XJ0A 3NUAA 3L9LA 5IU2A 1S9IA 4MXAA 3V6SA 3D7ZA 3ZO1A 2R3KA 5HIDA 4BKZA 4DYMA 2ETMA 2F7ZE 4DINA 4OTGA 5AADA 4OBQA 4R78A 3ZFMA 2ZM3A 5HTCA 3QTUA 4IWPA 4KSQA 3CTQA 2BZKB 3FI3A 4GH2A 4GVAA 3U6JA 3VF9A 3WZUA 3F2NA 4BDJA 4F9AA 4IJ9A 3UG2A 3DNDA 3T3VA 2I1MA 5BYYA 5C4KA 4XH6A 3AD5A 3Q04A 4G34A 1YXUA 4MH7A 4ZY6A 3RJCA 4PPAA 1U54B 3C0GA 4W9XA 4WNPA 1JOWB 5HESA 3ZO3A 4E3CA 3HP2A 4JXFA 3R00A 4O86A 2R3PA 3VQHA 3BKBA 3IKAA 2W5HA 2WMTA 3FMJA 3OROA 3ULIA 2NPQA 5I9YA 5K4IA 4L46A 5FEDA 3U54A 4R5YA 4FG8A 5J95A 4KINA 4M97A 4YURA 2BZHB 1W82A 2EVAA 2WQBA 1YHVA 4BIBA 4KBAA 4R7HA 2W1IA 4GU9A 4EH6A 1MQBA 2C6IA 1PXPA 2XM8A 3CXWA 3PIXA 4LOQA 3WYYA 2XIRA 5DNRA 2ZV7A 3ITZA 4C38A 5TR6A 2B9FA 4RT7A 4FKQA 3EQRA 3GU4A 3GP0A 4ARKA 2G01A 2UW3A 3BWFA 1M52A 2IZRA 4Q9ZA 2WHBA 5KMJA 2PE2A 5M4IA 4B7TA 1JSTA 3BBWA 5CXHA 3WZDA 4BGQA 3CGOA 4LGDA 4M12A 3CTJA 3OZ6A 2BR1A 3VS6A 1JBPE 3KU2A 1LEZA 4QP7A 2C3JA 2YIRA 3CKXA 3ZEPA 4CZTA 4FV9A 3RPSA 3PIYA 4XUFA 1QCFA 1H0VA 3CP9A 3A8XA 4YBKA 3BGZA 5HCYA 4CFWA 5GIPE 4NFNA 3NIZA 3MPMA 1RQQA 3PWYA 2UZWE 1FQ1B 3CCNA 1RDQE 4H05A 2OK1A 3PRIA 4AZWA 3R7GA 4EH8A 4X7QA 4NUSA 2J7TA 3RAHA 5HE2A 3ZZWA 4DFNA 1F0QA 5M56A 2I7QA 2X7OA 4WUAA 3RM7A 1A06A 1X8BA 2XCHA 4DLJA 5ANOA 2CN5A 2CJMA 4HGTA 4CFFA 3R7EA 4RFYA 4YBJA 2YM6A 4ASDA 4E26A 2BAJA 4AW5A 4EHGA 3LM5A 3GENA 3F5XA 4OBPA 3OCSA 4IZ5A 3BYOA 3UQGA 4OAVB 1QPEA 3ORMA 2WMRA 2I0HA 5EYMA 4DEGA 3PJ2A 4TZRA 3GVUA 3AXWA 3BGQA 4KBCA 1KE5A 5IDNA 3B2WA 1U4DA 2B7AA 3W18A 2XM9A 3WIKA 1U59A 3DTWA 5AR8A 5F4NA 1Y6BA 2VTNA 3P4KA 3GCPA 3UZRA 4RFMA 4WNOA 4IVAA 3RTPA 4C33A 2UVZA 4UMTA 2FVDA 3R30A 3BLQA 3GC0A 2GSFA 5HG8A 2BDWA 3ENMA 3R0TA 4HYUA 3ZYAA 4OTPA 4E5WA 4FT3A 5JRQA 3PSCA 5IA2A 4FEQA 4O7LA 3ENHA 4MBLA 4RPVA 3TWJA 3FZOA 4FK6A 5FWKK 2C6OA 1UWJA 1RW8A 4QTBA 3DDPA 3F3TA 4KS8A 1A48A 4QT1A 2HAKA 1UWHA 4O0SA 1BI8A 2XUUA 2BALA 4AA5A 2PHKA 2R0UA 2XJ2A 3U8WA 3VBQA 4GJ2A 2XNBA 3KF7A 4J97A 3VN9A 3ZFXA 1ZYLA 2VTQA 2IZUA 3VUMA 4FVQA 4R3PA 4F1TA 5J1VA 1GOLA 1H25A 3R1NA 4NCTC 4RWLA 1ZMUA 5C27A 4AUAA 1KV1A 3KMUA 4IVCA 4RMZA 2XNGA 2AC5A 2P3GX 3CJGA 3OXZA 5DG5A 4D55A 3GC9A 1NXKA 5CF6A 3G9LX 4EOSA 3QD3A 3DCVA 1J3HA 3IQ7A 3LPBA 3E8DA 4PPBA 3RHXA 3UO4A 2WELA 5J8IA 3MESA 3ZRMA 3E63A 5CLPA 3EQCA 4M69A 4NW6A 3R8PA 4BBFA 2C5XA 3R8LA 4NTTA 1LP4A 2XNEA 4EOIA 4DBXA 5I9XA 2QD9A 3ZBXA 3RCDA 3ZXTA 4TYGA 4EORA 3SVVA 5FBNC 3RCJA 5CSWA 2OG8A 3NUPA 3F5GA 4M13A 5M55A 3TZMA 1OKWA 4HVDA 4MXYA 3QTXA 5IQEA 3HMOA 4EONA 2RFNA 4RX8A 4RZVA 5IH6A 4QMPA 4FZFB 4U40A 1WBNA 4CVAA 4D4SA 2CPKE 3L9NA 3FYJX 2CLXA 3VUDA 2FB8A 3UDBA 3WE8A 3SOAA 4CMTA 2DQ7X 5CYIA 3BQCA 2QOLA 2V62A 4QP8A 4XRJA 4AA0A 3R63A 1IG1A 5E1SA 2Y4PA 3UOLA 2YISA 2PE1A 3VBYA 3C5UA 3G0FA 5DPVA 3QF9A 2P2IA 3ZTXA 2GS7A 4LRJA 3CQUA 5GNKA 2RIOA 2PL0A 3JY9A 1OKVA 2EU9A 3P86A 4JDIA 3ZHPC 4AX8A 5CASA 5HO7A 4O82A 4WT6A 3TIYA 3FC1X 3MTLA 1STCE 4EJ7A 4D5HA 3L1SA 2XZSA 3KY2A 2PVKA 3AT2A 2IVSA 3W1FA 4FTOA 4W9WA 5IQFA 4FTQA 4Y85A 3SOCA 3ZRKA 3HA6A 4EBVA 3TTIA 4PP7A 2C4GA 4NIFB 1JNKA 3ERKA 2C1AA 5IISA 4KABA 3R8VA 4DN5A 2J9MA 1SVEA 2VWIA 3KEXA 4FOBA 1PMUA 1GIJA 4NM5A 3PLAE 4PQNA 5BVFA 4JNWA 4WSQA 1KE7A 2O65A 5HBHA 4RWKA 2PULA 5D1JA 4WG4A 4I22A 3D5VA 1YI4A 2HZ0A 4F08A 3FLYA 3DTCA 3PA5A 5LWMA 3O8TA 5CSPA 3OEZA 1XBBA 2YM8A 5AUYA 3RM6A 4BDGA 4UB7A 5FP6A 4NFMA 3F7WA 4YC3A 2WFYA 1WBTA 2XK6A 3EJ1A 4QMTA 4EUTA 2CDZA 3G33A 3ZLSA 3PWDA 4ITJA 2JFMA 3H9RA 3LFAA 3UODA 4E4NA 3P7AA 2BAKA 3TKUA 3QX2A 5A3XA 1TKIA 2O0UA 1F3MC 2X7GA 4RIXB 4QTAA 5LWNA 1UNLA 3UIBA 4GCJA 4C4FA 3MN3A 2GFSA 3BE2A 4QNYA 1NY3A 2EB3A 4EOQA 4RQKA 3V8TA 3KRLA 4IB1A 1ZYJA 3V8SA 5D41A 4KAOA 4EI4A 4I23A 3GBZA 1K9AA 1NVRA 2J0LA 3WZEA 3ZM4A 1BMKA 1VZOA 3C1XA 3CY3A 3E62A 3KVXA 4C62A 4IX5A 2C5OA 2VTHA 5CWZA 4LV8A 3QYZA 3FC2A 3OBJA 4YPSA 2WPAA 3UP7A 4EYJA 2GQSA 3EOCA 4R7IA 3RNIA 2EXCX 3TL8A 4ALUA 2OBJA 3P7CA 4GEOA 4JG6A 4AXAA 1IAHA 5LMAA 4DCAA 4Z7HA 4YJTA 2QVSE 2UUEA 2VTSA 3DNEA 4HGLA 1GZKA 4B9DA 1SMHA 3I5ZA 3QQHA 5D7VA 3PA4A 3W8QA 4J53A 3LCSA 4O22A 3AMAA 4CEGA 4GT4A 4K1BA 5AAGA 2X2MA 3R9DA 4R7BA 3F82A 4MXXA 4HYIA 4YR8A 5C8KA 1GY3A 4DTAA 3EFKA 4N70A 3HVCA 4USDA 2P2HA 3TZ7A 3BELA 3CC6A 3D0EA 3PXYA 3QLGA 3DFAA 4RX9A 4YNEA 4O0RA 4OUCA 1NVSA 1KE6A 2Z7RA 1ZYDA 2ONLC 3KQ7A 3OWJA 4CZUA 5CI7A 2LGCA 4AOIA 2W96B 1M2RA 5LOHA 2QOKA 1WBOA 1ZMWA 2J50A 3QCYA 4JT3A 5EK7A 5JKGA 5M53A 1FPUA 4LL0A 3NVMB 3UPXA 2IJMA 3Q52A 2ZM4A 3JYAA 3OTUA 5E8YA 1ZOHA 4DEHA 4YC6A 3PJ3A 1YRPA 2CCIA 2RL5A 3G15A 1OIUA 2QR8A 4LL5A 2C5NA 3VS1A 2YIYA 4ZJIA 2OZAA 3B8RA 4IH8A 4CFXA 2W4OA 5HIBA 4FV7A 4AGWA 3UPZA 4FG9A 5K9IA 4IXPA 4PUZA 3THBA 2BRHA 4IQ6A 4HYHA 4FL1A 4K0YA 4S30A 3AOXA 4QPAA 4C36A 3PVGA 5L8KA 5DA3A 2HZIA 2BZJA 3DBFA 2C0TA 2WOTA 5CQUA 2QOIA 4ZJJA 2CKPA 3I0OA 3F3ZA 2QHNA 4QMUA 4XLVA 3BEGA 2W4KA 3FMLA 5EYDA 4RWJA 3POZA 4DH7A 3LCTA 3DZOA 5D7AA 4I1ZA 4C4HA 4EUUA 2BFYA 3SV0A 3ORLA 3R9OA 4U3YA 1NVQA 3DAEA 4NJDA 1G3NA 3DK6A 4FIEA 4YJUA 4FEUA 5HNGA 2OFUA 2JD5A 3II5A 3QQKA 4BB4A 1JWHA 1B38A 1ZYSA 2E2BA 4FNWA 4C02A 3KB7A 2OIBA 1KOBA 4OT6A 1YOLA 4PWNA 1J7IA 2OJIA 4BF2A 3MVJA 3R9HA 4J99A 3LQ3A 5JMSA 3WILA 5M57A 2UZLA 1A9UA 4YSJA 3PJ1A 4IB5A 2GDOA 2C0IA 5CVFA 3T9IA 3FE3A 2PVNA 3KRRA 4QP3A 3O96A 3HZTA 5I3RA 3QTZA 4LOPA 3UIXA 5HE0A 3ZO4A 4CSVA 5IA3A 4UMQA 1XH4A 4O83A 4LMUA 4R1VA 1HOWA 4BCQA 2DUVA 4AW0A 4FKIA 2RG6A 5CAUA 3ZM9A 4EHVA 4WBBB 4FUYA 4W4VA 3L8SA 4BZOA 4DG0E 2BPMA 3FZTA 5C8NA 2HCKA 3Q4UA 5J9YA 3DAJA 3QRUA 4X3FA 5FP5A 4QYFA 3QX4A 2VTMA 3EQFA 1B39A 4ERWA 4QMXA 4C4JA 4J98A 4GK4A 3HV7A 4HVIA 2UW0A 3DB8A 4ZSAA 4AAAA 5IF1A 1PHKA 2BKZA 4RFZA 4F0GA 1XO2B 1M7NA 3EWHA 3O50A 3QQJA 4QPSA 2YACA 5LVLA 4R3RA 3JVRA 5FXSA 2W9FB 3OCBA 4E6QA 4F7JA 4FYNA 4WNKA 3G6GA 5FXRA 5A4CA 3IDPA 4XG7A 5AAFA 4AWIA 2EWAA 4AZSA 4V0GB 1RE8A 4ASZA 3ZSHA 2HW7A 5LVMA 3KK8A 5IQIA 2JKOA 2OU7A 3EB0A 3MB7A 2IPXA 4BCFA 4TYHA 3TN8A 4AOJA 2PMLX 1UVRA 3LAUA 2QU6A 3R1SA 4QP4A 3KXXA 3VULA 4MXZA 4G16A 4F7SA 3C9WA 4L9IA 4M67A 4CKJA 3DKGA 3PVUA 4BCOA 2E9OA 3MA3A 4NU1A 2CN8A 4KB8A 3AGLA 4HW7A 2Z7SA 3QUPA 3VBWA 1PXKA 4PY1A 5KMNA 4FNYA 1O6LA 4I6BA 5HG9A 3ORKA 5TKDA 2XJ0A 4D28A 3FAAA 2R7BA 3PFQA 5BNJA 2V7OA 4XNEA 4FVRA 4AG8A 2ERZE 4ZZMA 2A2AA 4KRCA 4L7FA 2RGPA 3LJ0A 3HRBA 3ZFYA 4D1SA 3DQWA 4F63A 2OJ9A 1PKGA 4MQ2A 4QOXA 4D2TA 5KHWA 3PLSA 1SYKA 3BZ3A 2QCSA 2YIWA 4ANQA 2H8HA 2QR7A 4EK5A 3PRFA 3TNWA 2PVFA 3MFTA 4F09A 2R4BA 3HDNA 2IZSA 5DI1A 4FT5A 3R21A 4FKTA 5GJFA 5HTBA 4DF3A 5HVYA 3VBTA 4BWPA 2QNJA 4N4SA 1WVWA 2YDIA 1H1RA 3R73A 4D0XA 4JR7A 4D4VA 2YM7A 2WOUA 4AA4A 4NL0A 4F1OA 2PSQA 5HNBA 3W2QA 2IVTA 3NUYA 5DT0A 5AP5A 3UZTA 2XK3A 2IN6A 3RI1A 3I7CA 4O7ZA 1YXTA 2PY3A 4LRMA 3U9CA 1H1PA 4ASXA 1FGIA 1L3RE 4PMMA 3GQLA 5JQ5A 5KUPA 4U43A 4I20A 2WQMA 4O7RA 3LVPA 3RZBA 3UGCA 3FMMA 4HCTA 5IA1A 1J91A 2W1FA 5BVDA 3F3VA 3O17A 5TO8A 1O6YA 3MH0A 1V0BA 1FBNA 2ITPA 2YLFA 3O71A 3ZZEA 5AIKA 4RRVA 3MVLA 1G5SA 4NM3A 3DA6A 4RSSA 2Z7QA 3EN5A 3TXOA 3V5JA 3VRZA 1UA2A 1YHWA 3OFMA 4QQTA 1FVTA 3QZGA 4F7NA 5HLWA 5D12A 4JX3A 3DOGA 2X2KA 4OAUC 4Y8DA 5DBXA 3EYGA 4EZ5A 4B99A 5ITAA 2UZNA 3FWQA 4II5A 5BYLA 2I6LA 2XF0A 4FT9A 5C01A 3W10A 1DM2A 2BRNA 1MRYA 4JX7A 4CLIA 1YVJA 2BAQA 3V5TA 4PMPA 3C0IA 1P2AA 4DEEA 5HTIA 1VR2A 3E93A 5AAEA 3L8XA 3S0OA 1H1QA 4IDTA 3QCXA 4BCHA 5GIOE 3IECA 3FPMA 1ZLTA 3ANRA 5G6VA 4KS7A 5BMMA 3OP5A 1Q41A 3ZONA 3U6IA 2BUJA 4ZTSA 4BIDA 4RC3A 4MBJA 3RWQA 2E9UA 2XS0A 3ODYX 3NRMA 5AUWA 3VF8A 3W2CA 4MNEA 2Y4IB 3F3WA 3DQXA 4CRLA 2GNJA 4ZJVA 3UJGA 3HL7A 5AP6A 1SZMA 4IX4A 1OMWA 2XCKA 3PG3A 4M7IA 3ET7A 5HLPA 3W2RA 4QP1A 2R2PA 1WBPA 5LMKA 4DFXE 5LCKA 4P2KA 1REJA 4E6DA 2IVUA 2XEYA 3NUUA 2WAJA 3KRWA 3A7HA 4JR3A 4X6QC 1H1WA 5A4EA 2FYSA 2QI8A 3NAYA 4FZ6A 3ORXA 4GK2A 1UU8A 2DS1A 4DEIA 1SVHA 3MIYA 3G0EA 3M42A 4HJOA 4A9SA 4USEA 3FI8A 4G3GA 4CNHA 3GXLA 1L8TA 3F3UA 2V55A 2W17A 4TYEA 3VUKA 5DR6A 3E7VA 4QYYA 4BIEA 3NMUF 3NX8A 2BRGA 4RJ4A 4EH2A 2B1PA 2OSCA 4P90A 3KXMA 4IACA 4J95A 2CHLA 4TWOA 4GYGA 2P0CA 3JS2A 4AZTA 2A27A 3QCQA 3UYTA 4AU8A 3TT0A 4YJRA 5DRBA 5AUTA 1LEWA 3D5XA 4EOMA 5CALA 3I60A 5IQHA 1H00A 4DT9A 5CVHA 2C6TA 2WTVA 2YJSA 4D9TA 4H39A 3COIA 1XH7A 2VWUA 1UU7A 2B9HA 3IK3A 3HRCA 4FSUA 4TYJA 4QNAA 2J90A 3DS6A 3AGMA 4FNXA 2BTRA 3PXQA 1ZY4A 1OKZA 4U6RA 2R5TA 4IEBA 4TY1A 4WOVA 1BL6A 4FZ7A 2V7AA 5CEIA 4ALVA 4JG7A 3FQHA 5IMEA 4FIFA 1EH4A 3G6HA 5FG8A 1MRUA 1VEBA 1H8FA 4AOTA 2J0JA 4I3ZA 5E8TA 4UY9A 1PMNA 4M3QA 5KMIA 3FEGA 2FH9A 5CENA 4IBMA 4CGAA 2W1EA 2W5AA 1OBGA 3BV2A 2GFCA 4I6FA 2XNMA 5AP2A 5IA4A 2F7EE 2BFXA 3FQEA 3SG9A 2W4JA 4EK4A 4O84A 2JKMA 1BLXA 4ZS4A 3PXFA 4YJNA 5IEYA 5IH5A 3CGFA 4XV9A 4G9RA 5HG5A 5JFSA 4DGNA 4PDOA 3Q96A 3I7BA 3IS5A 2VO3A 3NLBA 4GG7A 4Y46A 4UBAA 2XKCA 3PZEA 3GFWA 3W2OA 4BRXA 3ZRLA 2JIVA 4YZMA 2B9JA 5KMMA 1TQIA 4ACDA 4QMZA 2QQ7A 3OF0A 3ZC6A 1XBCA 3RZFA 3VRYA 3M11A 4FC0A 5HE3A 1OL2A 5FM3A 3MJ2A 3FLNC 4XS2A 3IW4A 3WOWA 4H36A 3H4JA 4ZMFA 3ZSIA 5FUTA 2OICA 2YIQA 4FX3A 4ZMEA 2YERA 3K5UA 3M1SA 1OIQA 5DRDA 2CNVA 2VNYA 4L52A 4FKJA 2C3LA 2PZPA 4EJNA 3PUPA 4KIQA 3R2BA 1WBVA 1GAGA 3FY0A 5EG3A 3S4QA 1W8CA 3UVPA 2YN8A 3LLAA 5C4LA 4ITIA 2JFLA 4F6WA 2X7FA 3KFAA 3D7TB 2PMNX 5T68A 3HECA 3HGKA 4U97A 2WNTA 5ANKA 3KMMA 1Q61A 4TPTA 2GNGA 3EZRA 1BX6A 2RF9A 2WZJA 2VGPA 5FXQA 5DMZA 2PPQA 3AMBA 3DZQA 2HENA 3MDYA 2JDSA 3PYYA 2RFDA 3QUEA 4JQ8A 2WTKB 4TTHB 5BVWA 2X0GA 3O8PA 3E3BX 4FR4A 1FOTA 2X4FA 3FXZA 4EQUA 5HNIX 3Q9YA 3MY0A 4DEAA 4HPTE 5BUJA 4D58A 5I9ZA 4CV9A 4QP6A 3LFNA 4IB0A 3NSZA 4RIYA 5ANJA 2VO0A 1J1BA 3CS9A 3P0MA 4R6VA 3U4WA 2VUWA 2OJJA 3MYGA 3DAKA 3PY3A 2JDOA 3BV3A 4FTKA 4JIAA 2VTOA 1GNGA 3NDMA 4R8QA 5CZHA 2Z8CA 4GFMA 4J8MA 4QYEA 3FDNA 1KOAA 2BRBA 3RPOA 3SAYA 2I0EA 3GB2A 3LCDA 3SRVA 3W32A 2A4LA 3I6WA 3QBNA 3QZFA 4JG8A 4D9UA 4XBUA 2BROA 2HELA 4A4OA 2BTSA 3N51A 2J0IA 1OVEA 1TQPA 3BWJA 3S2PA 4B4LA 4JQ7A 5DGZA 1PYXA 1J7UA 3HAMA 4DH1A 3TNHA 3FSFA 3VC4A 4YLJA 4RQVA 4Z55A 3N4VA 2C6LA 2ITVA 4BDCA 3HMMA 4FZDB 2VZ6A 4QQCA 4F1MA 2WTIA 4WUNA 1O9UA 3LXKA 3FL4A 1UNHA 1CKPA 2VWZA 2WTCA 3D9VA 4YTHA 5GZ9A 3FMDA 4YJVA 4B8MA 4M84A 4F9CA 4UMPA 2NNWB 4EOPA 2VTAA 4N57A 1ZOGA 3S1HA 5F9EA 2R64A 3NW6A 4LYNA 2J6MA 4G3EA 2ITNA 3VS0A 2HYYA 4IWDA 4U7ZA 3TUBA 3ORNA 3E88A 4FTLA 4MNFA 3PXZA 5CU2A 2Z2WA 4E5BA 4X2FA 2DWBA 1CSNA 3AMYA 4KD1A 5FD2A 4O38A 5HO8A 4YZCA 3UG1A 4DLIA 4BDEA 1Q62A 3OXTA 4RC2A 4TN6A 4ANOA 3FV8A 4G2FA 3IPHA 4BDIA 5M51A 2HOGA 4KRDA 4ONAA 3MBLA 5IQDA 3UZPA 4PL3A 4FKOA 1WCCA 4KNBA 4MBIA 4LUDA 2WEVA 4YZDA 5ANEA 4E20A 5HVKA 3TZ8A 2W1DA 3SX9A 2IW8A 3FHIA 4BTMA 2HK5A 4C2VA 3H0YA 4AE9A 1VJYA 1WMKA 3KN5A 3LXPA 5A4QA 3QKLA 3ZLYA 3P9JA 1UU3A 1JKKA 3OT8A 1BKXA 4DCEA 3NUSA 1ZZ2A 3H10A 4ID7A 2ZMDA 5A6NA 5M4CA 3MJ1A 4H1MA 4OT5A 3O7LB 4XG4A 4PX6A 5ANGA 5HD4A 3DKOA 1H0WA 1SM2A 4K77A 4C34A 4YO4A 5BVNA 3MA6A 4MX9A 1Y8GA 3UQCA 4EWQA 2YITA 2CKQA 3W2SA 5CAQA 3C50A 3HV3A 5JRSA 4YTFA 2JDRA 3T9TA 1IAJA 2UW4A 2C47A 3BLHA 1PY5A 4DFUA 2A0CX 3H9FA 1K3AA 4OW8A 4UYAA 5BVKA 5KMKA 2QHMA 4FIJA 3MTFA 3HA8A 4O6LA 3DBEA 5BMSA 2GQRA 3R7VA 1GIIA 2XRWA 4NSTA 3UE4A 4B8LA 4FEXA 5T6KA 5AP7A 5K0KA 1O6KA 4IM3A 5HIEA 5JGBA 2IO6A 4C2WA 4EHZA 5HU3A 4M15A 5C9CA 3QAME 3VW6A 3U4UA 4AGDA 2VWXA 4GU6A 2YAAA 2BKKA 3DPKA 4XRLA 4B6LA 3MPAA 1ND4A 2ZV8A 3H30A 4FA2A 2XA4A 5CTPA 3V51A 2REIA 3EZVA 2QC6A 1WBWA 3LZBA 4HNIA 5EM6A 5CF8A 4K6ZA 2FSMX 1ZYCA 4IAYA 1R3CA 4GL9A 3A99A 2WTDA 3SXRA 1SVGA 5CT0A 4XHKB 3VS4A 4FI1A 3MS9A 5CU6A 4FKPA 5EH0A 5KHXA 3UNKA 5K0XA 5FM2A 5A46A 5EM8A 5CNOA 3BCEA 3CQEA 4JI9A 4U5JA 5CSHA 3AT3A 2XEZA 1P5EA 4O7SA 2BVAA 4G31A 3F61A 1OL1A 4W4WA 4AS0A 2V0DA 4B0GA 2PTKA 2AYPA 2BIKB 2YWVA 4FIIA 3F5UA 2YZLA 4D2VA 2PVLA 2J2IB 4XX9A 5CQWA 4UWBA 5EYCA 3FLZA 5IUGA 2G2HA 2VTTA 1E9HA 4EWHA 4I0RA 4GIHA 4PL4A 4CG9A 3QQUA 4E4XA 1Q3DA 1U5RA 2W1CA 2Y9QA 2YCFA 4F9YA 3ZS5A 1XH8A 4O7NA 1U5QA 4O7VA 3HV6A 3ANQA 2WQOA 5GZAA 3NEWA 2WEIA 5AM7A 5KKRB 4FT7A 4ACHA 2YM4A 3QTSA 3VS3A 3RPYA 4QMNA 3RK7A 2X8DA 3CD8A 3PXKA 4M0YA 4W4XA 3D83A 4KIKA 4LRKA 4GMYA 3TZ9A 4YLKA 4FSZA 4AW1A 4CMUA 4DT8A 5KE0A 4CZYB 2W7XA 4Z9LA 5LCJA 2IVVA 3ID6C 5E7RA 5HG7A 2A1AB 2HY81 3ORTA 2OXYA 3CSVA 5HX8A 5L6WL 1Q8TA 4A9RA 2JITA 3E8CA 4F6SA 1M2PA 3WI6A 4Y73A 4JDHA 2ZM1A 2ITZA 3C0HA 3UIMA 5TF9A 1T45A 4XOYA 2HZNA 4NKAA 2BCJA 5EDRA 2BILB 5CAOA 3KXNA 4DG2E 3KF4A 1YWVA 3I81A 4HPUE 3PVBA 3OWKA 3A8WA 4RGJA 4ZOGA 2PU8A 3VJOA 3SHEA 4F64A 1Y57A 2UW5A 3PPJA 4M69B 3COKA 1FMOE 5CEPA 4X3JA 1DI8A 5CNNA 2PUNA 2QOCA 2AC3A 3KCFA 5JFXA 1OL6A 4AN3A 4F9WA 4MF0A 4V01A 4CQEA 3QA0A 5CEQA 3VJNA 2VWVA 3EQHA 5IKWA 1MQ4A 2JC6A 3A7GA 4DGLC 3S3IA 3A60A 1LPUA 5J9ZA 4KKEA 1M17A 4FUXA 2XIYA 2XK9A 2F2UA 2W9ZB 4UX9A 4C7TA 3Q9ZA 3P1AA 4C61A 3PZHA 5H8BA 1P14A 2OF2A 2CGXA 3FMHA 3I5NA 2FO0A 2BHEA 4AFEA 2HY0A 3A62A 4AE6A 5I5ZA 2I0VA 4GRBA 5EW8A 4I5HA 2W5BA 3WF5A 2R3IA 4GK3A 3C5IA 3JR1A 1Q8YA 3VHKA 2GQGA 4EH7A 4GKHA 3QUDA 5DWRA 3JPVA 3FQSA 4FIGA 5G1XA 2Y4IC 3VS5A 4XG6A 2OW3A 3C13A 2B4SB 3QC9A 3VWAA 2UV2A 2RG5A 3OCTA 4F65A 2C6MA 1KV2A 5H8EA 1J1CA 4PDPA 4WHZA 5HORA 2W99B 4DFLA 5M07A 3OCGA 4XG3A 3LHJA 3NWWA 3CTHA 1YOJA 2F49A 4EZ7A 3SGCA 3ODZX 3ZLWA 3D5WA 5DLSA 1XH5A 4DGOA 4XV3A 4O7WA 3A61A 3Q5IA 4JL9A 1PMEA 4O96A 5IUIA 3ZC5A 5EDPA 3AC8A 2RFSA 3QLFA 4LOOA 4W8DA 5DEWA 3PE1A 1JAMA 2RFEA 2PE0A 2GNLA 5L2TA 4FTIA 2YFXA 3F6XA 4KKHA 3TDWA 1HCKA 4KUJA 3ZOSA 2XKDA 5AV3A 4EH5A 3NCZA 5CEMA 4RJ5A 4TYIA 4AT4A 4NCTA 2BRMA 2C6DA 3BQRA 3EKNA 4FKGA 2X81A 1Q97A 2Z60A 3P78A 5HKMA 2JKQA 2PMIA 3C4WA 3TIZA 3V5QA 3F88A 4QYGA 3QHRA 2G2IA 1E1VA 3HP5A 3DDQA 4L3PA 5CVGA 4YUQA 1JVPP 3LFFA 1JSVA 5A54A 2QURA 5FEEA 3ZUTA 2QOOA 4JAIA 3FJQE 2J4ZA 4PDYA 3R71A 5FRIA 2XIKA 3R8MA 5AV2A 2ZAZA 5CEKA 5DHJA 4QMVA 3WARA 4U3ZA 5CX9A 4G5PA 5JEBA 3ALNA 4XP0A 4AN9A 1AD5A 1XKKA 4IWOA 4D2WA 3GOKA 4QTEA 2X8IA 3GI3A 3LOKA 5CSXA 5E8XA 3RP9A 4D0WA 3FLQA 4OTRA 5EW9A 5KZ0A 4BCJA 3HMPA 1Q24A 3SW7A 5J9LA 5AX9A 4PTEA 1XR1A 4WBOA 4Y5QA 5AUVA 3QRTA 3TG1A 4BWKA 1Q5KA 3ACJA 4IAZA 5FLFA 3KC3A 3R8UA 4EC9A 2JAVA 4JBOA 5ETCA 2OI4X 4ZXTA 2CGVA 3UOKA 4FE2A 4RIWA 4WSYA 3C51A 4QMWA 3A4OX 3TACA 1FVVA 4S34A 3QD0A 3QD4A 3R7OA 3POOA 5AIRA 5IG1A 3TDVA 3HKOA 2PVRA 2QKWB 3MFRA 4FKWA 4EH9A 3BYUA 4FTNA 3NR9A 4A9YA 3V5PA 4YTCA 3E3PA 1U46A 3ZXZA 3IOPA 3EIDA 3FBVA 4MF1A 4OR5A 5L3AA 3NYOA 4CV8A 5B2KA 5HQ0A 4BHNA 4YHFA 4I0TA 4O0WA 4O0TA 3HEGA 2PYWA 4QMYA 2WMWA 2J51A 3C7QA 4BDKA 3COHA 4O2ZA 2ITYA 5HX6A 2PK9A 2YDKA 2PUPA 4OTDA 4EYMA 5EQEA 4ZTRA 1YW2A 4CFMA 2RKUA 4Q5HA 4XOZA 5CXZA 3PE2A 2EXEA 3D94A 4WIHA 1G8AA 1GZNA 4JAJA 1TQMA 4EQMA 2R3LA 3UOHA 1GZ8A 3JY0A 4HZSA 4CTCA 3GEQA 5DT4A 4CFNA 4F0IA 2G1TA 2XYUA 2VTIA 4FSMA 4L43A 3EFWA 3PY0A 4XP2A 3S95A 4LQMA 3NNUA 4FV2A 3T3UA 5GINE 3WE4A 2FSTX 1CKIA 4X2GA 2O2UA 4IAAA 2JGZA 2QO7A 2WKMA 2R3GA 1PXIA 2OZAB 4IIRA 3EFJA 4CCBA 4W8EA 1ZY5A 1VYWA 4JIKA 3N4TA 4AZEA 4IE9A 3OT3A 5EQYA 4RJ7A 3ZLXA 3A2CA 5E8ZA 3QFVA 4MAOA 2ITXA 4C3PA 3HLLA 3PJCA 4ALWA 4ORKA 3ACKA 4O7TA 4G6NA 2HXQA 4YJOA 2GPHA 1NA7A 3NNXA 2E9NA 4FTCA 1OIYA 5A4LA 1Y91A 3O23A 1PJKA 3Q9WA 3EL7A 4DH3A 4C3RA 2WO6A 2O3PA 4KBKA 3A7IA 2FA2A 5EOLA 5KNJA 3V8WA 3FSKA 4DE4A 1OBDA 2ETRA 2F4JA 5IA5A 2X4ZA 5J5TA 5DH3A 4C8BA 2VTLA 4BZDA 5D10A 5HVJA 3OS3A 3GNIB 2WMBA 5J5SA 2XRUA 3SC1A 5D9HA 4QTCA 3OG7A 3GFEA 3QTWA 5IEXA 5EM5A 4BDAA 5IA0A 1YKRA 1H08A 3MGYA 5EKOA 3F7ZA 1ZOEA 3FKNA 3DJ7A 2H34A 5AX3A 4IX3A 5J7HA 5EI8A 1URCA 3QKMA 1BL7A 2Q0BA 2VX1A 2B52A 3R83A 2GNFA 4O0XA 3ATTA 1W7HA 5AM6A 4PPCA 1T46A 3D2KA 3H3CA 3FL5A 4YGAA 3TM0A 5GJDA 5E92A 4LMNA 3EFLA 5J79A 4X3FB 4K33A 4XEYA 3EYHA 5GHVA 2Y7JA 4S2ZA 4QYHA 3QGWA 3OXIA 2O64A 2ONLA 3ELJA 3TNPC 1LUFA 2VN9A 4RVMA 5CF4A 4FKRA 3CEKA 3UTOA 4M8TA 3QCSA 4O91A 1SNXA 3G2FA 2V5QA 1W98A 3Q53A 4L7SA 5AP1A 3R7YA 2WIPA 2ZV2A 5LMBA 5M44A 3L8VA 5ACKA 5CZIA 2B9IA 5IH4A 4PDSA 4MEDA 5KCVA 4Y83A 1UKIA 5IQBA 4TWNA 1V0PA 5EFQA 2C3IB 1YDTE 2P33A 2PUUA 2PZYA 2ZV9A 5HU9A 3P7BA 4GSBA 3RVGA 4YNOA 4AT5A 4ZLYA 4EL9A 4ANLA 2OFVA 4TYHB 2ZB0A 2ZJWA 3PG1A 3AC5A 5TE0A 4BCKA 2GNHA 4BC6A 2PWLA 3UVQA 4CQGA 3BYMA 2PMOX 2O63A 4H3QA 4TW9A 4G3DA 4CD0A 3FLSA 3EQBA 3KULA 3EHAA 5F95A 1XQZA 1DAWA 2XB7A 2R9SA 2UZBA 3N9XA 3UVRA 4TL0A 4BZNA 5IPJA 2YLEA 2FGIA 3N4UA 1OZ1A 3WBLA 3R28A 3C4FA 3VQUA 5CF5A 4R77A 2QOHA 3TJDA 1Z9XA 2ITOA 4BI2A 4UZDA 3C4ZA 2B54A 5CU4A 2VO6A 3RGFA 3AQVA 3A4PA 3DFCB 3VUIA 2X8EA 4CXAA 5HZNA 4DFBA 4TXCA 5JFVA 3GU5A 4G6OA 5KZIA
chains in the Genus database with same CATH superfamily
3GC7A 5A6OA 4QMOA 4TNDA 4CT2A 1R1WA 5BQ0A 2ZDTA 3Q6UA 2VO7A 4O0UA 1ZARA 4I6QA 4IDVA 4ANNA 5J87A 1OUKA 3IW7A 2E9VA 3OTVA 4CCUA 4FSWA 4GJ3A 1RJBA 4CKRA 2VTJA 3NUXA 3EKKA 2YWPA 2ITTA 3BI6A 1KWPA 3JUHA 3QD2B 3FKLA 4C0TA 4CFUA 2R3MA 3FI4A 1Y6AA 5FEQA 2CMWA 4ZSJA 1CMKE 4WG3A 2WQNA 2ZB1A 2ZVAA 5M4FA 5BUEA 2W1HA 5IZFA 3GQIA 4NW5A 4JLCA 4LGGA 2OF4A 3R01A 3LMHA 3U9NA 4XBRA 2CNUA 2GU8A 4GYIA 1W84A 3TUDA 3JXWA 3VHEA 3KVWA 2OXDA 1KE8A 3EL8A 4GUEA 3UDZA 3PFYA 4OTFA 3AT4A 2OZOA 2VNWA 4YLLA 1V0OA 4O21A 5J7BA 5EKNA 3PIZA 4N6YA 1SNUA 2YCSA 3FUPA 3GCVA 4PF4A 4ZLZA 4XG8A 3WF6A 3UQFA 2QLQA 4BWXA 3WF8A 1OI9A 1I44A 4RG0A 2O8YA 4FL2A 4FZAB 1LR4A 3FYKX 1U54A 2R3OA 4KKGA 3QGYA 4AF3A 4PTCA 4WNMA 2R3FA 4FICA 3DXPA 5CAVA 5L6OA 2OH0E 3BL9A 3HMIA 4U0IA 2GS2A 4ZIMA 3QXOA 4BI0A 4Z3VA 5IUHA 4U45A 3SKCA 2NO3A 2HW6A 3LM0A 5DEYA 3G9NA 4X0MA 3V5WA 3W2PA 2UVXA 4JBQA 4C4GA 4DBNA 4F9BA 4K8AA 3NVKI 3GU7A 4R5SA 4QP2A 4AQCA 5AR2A 5KKRC 3PPKA 2YCRA 4U79A 3FMKA 3TNQB 2ETKA 2VTPA 2X1NA 3NYVA 3E87A 3IW6A 2JEDA 4Z16A 3D4QA 1HCLA 1JSUA 3OD6X 1ATPE 2QOBA 3L8PA 3QALE 4I24A 4MNEB 5BVEA 4D2RA 5M4UA 4FL3A 4RJ8A 4DH5A 4DGMA 5JZJA 3DKFA 2YHVA 3HDMA 4BTJA 5ANIA 3Q5ZA 3WF7A 2ESMA 3W33A 4QRCA 5FTGA 3W16A 4EK8A 3I4BA 5F1ZA 4AW2A 5LARA 4YPDA 3SLSA 3QWJA 3VIDA 2A19B 1XH9A 1M7QA 3O0GA 3MH3A 1OB3A 5B0XA 3M2WA 3QTQA 3RINA 4HCUA 4FV0A 3PDTA 3OUNB 4FKUA 2R7IA 3SD0A 4FV4A 1B6CB 4LG4A 3SDJA 4D4YA 4UXLA 4O6EA 4RVLA 3R1QA 2CSNA 2BIYA 2WGJA 3OC1A 4HYSA 5AJQA 2QONA 4IX6A 4YZ9A 2C30A 5C1QB 2XNPA 1G8SA 4BVUA 4BY9E 3EN9A 3MWUA 3OW3A 3RWPA 1YI6A 1Z5MA 2C6KA 2WIHA 4HGSA 3TV6A 4ENXA 3TKHA 3RKBA 4TWCA 3BYSA 3K2LA 4FK3A 4MXOA 2OO8X 2HWPA 2XARA 5JN2A 3B8QA 4YSMA 4BGGA 4IJPA 3QHWA 4E93A 2XYNA 3O51A 3L9MA 3VUTA 3ZEWA 3R6XA 5DR2A 4AN2A 2XAMA 3V6RA 1PXJA 2C68A 2NP8A 3WIGA 4DFYA 1JKSA 4XV2A 3CPCA 4EOKA 4RX5A 4QMSA 2JIUA 4FG7A 4R1YA 5EI2A 4CYIA 2I40A 2YJRA 4EK3A 3F5PA 2YCQA 3ROYA 4BBMA 4YMJA 5L8LA 2GCDA 2QO9A 3O8UA 3BLRA 3F69A 3Q3BA 3ZCLA 3TI1A 2XIXA 4BJJB 1H01A 3RK5A 4I5PA 4DC2A 4ZSGA 1OL7A 4G3CA 3GUBA 2JAMA 3GCQA 1Z57A 5C26A 5AUUA 4YZBA 4RIOA 4E8AA 3FZRA 2QODA 2XIZA 3C4CA 5M08A 4E7WA 3HUCA 4DH8A 3I6UA 2WMUA 1BUHA 2XH5A 3D15A 3MFSA 3BGPA 4O2PA 3BYVA 5L2QA 3LQ5A 4I5CA 4X2NA 4MKCA 5TOZA 1H28A 3WYXA 1M14A 5T3QA 5AR3A 4IZ7A 4EBWA 2W1ZA 4DA5A 2WXVA 1OPJA 3OY1A 4FSQA 1OM1A 1IA8A 4L3LA 4BGHA 4I4EA 2PUIA 3DGKA 2ZYBA 4IMYA 2PZIA 3K5VA 3FLWA 4YO6A 3QQGA 4AZVA 1CDKA 3COMA 1PRYA 3CE3A 4FV3A 5LVOA 2NRUA 4L3JA 4Y95A 1IA9A 2WTWA 3MIAA 4BKJA 1YDRE 3KXHA 3CY2A 4ACGA 4QMLA 1PKDA 2WU7A 4HVHA 4I93A 5I4NA 2YAKA 4A9UA 3D14A 3R04A 4H3BA 3R9NA 2R3JA 3BIZA 4U8ZA 2FSLX 4MYGA 3MY5A 2P4IA 2VRXA 3MFUA 1XJDA 4P5QA 3GU6A 1OITA 2UW6A 3FI2A 2B53A 2PVJA 2WQEA 4GFOA 5CEOA 2GNIA 3G90X 3G51A 4BCIA 2WMSA 4MHAA 5E8SA 1IR3A 5DT3A 2WMXA 1W0XC 2IW9A 2JDVA 5HLNA 1QMZA 4F99A 4ANBA 3A7JA 5DR9A 1K2PA 4FV1A 3Q4TA 4IFGA 4N0SA 2X39A 4ACMA 3DKCA 3I1AA 4QMMA 4BTKA 5CT7A 4GUBA 4CRSA 4E5AX 4F0FA 4QMQA 5FDPA 1ERKA 3DT1A 3LKMA 4Q5EA 5A4TA 4HNFA 3V3VA 4ZZNA 5AMNA 4U42A 3NW7A 5IQGA 4ACCA 3PTGA 4Y72A 4FKVA 3KRXA 4M66A 5M06A 4GT5A 3LXLA 3Q60A 4BYJA 4DEDA 4L45A 2C69A 5H3QA 3ZSGA 3UG1A 4RC4A 2UZDA 4RIYB 3GGFA 4AGUA 1NT2A 1PYEA 3BU3A 5IDPA 1DS5A 3UMWA 2PZRA 3KKVA 4HZRA 5E1EA 4ASEA 1QPCA 3BHUA 5KX8A 2XKEA 3E8EA 5FDXA 4IM0A 5K4JA 3W0QA 3A7FA 3ORPA 2QU5A 1YHSA 1TVOA 1ZMVA 2AUHA 4ENYA 3R9RA 1ZRZA 3HV5A 3EN7A 3NPCA 4LUEA 2KULA 4FGRA 1OPKA 3W0RA 1R0EA 3SRVB 4GW8A 5HBJA 1GJOA 4DFZE 5ETFA 4DAWA 3UO5A 3F2RA 4I92A 4FYOA 4EH4A 3IDCA 2C5YA 3IOKA 5H8GA 4AAYA 3CR0A 3VUGA 4FKSA 4L67A 3MY1A 4PP9A 4EKKA 4QDVA 2IZTA 4C4IA 5TT7A 4DTKA 3NNVA 2CNQA 4OTHA 3R7UA 4IANA 4NIFA 4JQEA 5HCZA 3W8LA 4QP9A 2FUMA 3LFQA 2VU3A 2GS6A 4IVDA 4IC8A 4WKQA 3HYHA 2LAVA 4P5ZA 2DYLA 3AG9A 3DY7A 4QO9A 4ZP5A 4TNBA 2FSOX 5H2UA 4FV8A 4OTQA 2OJFE 5FBOA 3VAPA 3VBVA 5I9WA 1XHAA 3TV7A 3QQFA 1MRVA 4NKSA 4ANMA 3TEIA 3DB6A 3W0PA 1YI3A 3K54A 4I0SA 4ZSLA 3DBCA 1Q8UA 3BBTB 4AGCA 4OGRA 3QKKA 4JBVA 4TRLA 1OL5A 5JFWA 4ZY5A 3U51A 5E90A 5CSVA 2JIIA 3IW5A 3RBWA 2YABA 4FT0A 5AR5A 2C6EA 3QU0A 3R02A 4RIXA 1QL6A 2B55A 3SW4A 3WZJA 5JQ8A 2XKFA 5J1WA 3DXQA 3OUKA 5I0BA 1WBSA 5FTOA 5F20A 3UC4A 1E1XA 3QYWA 3D2IA 4KWPA 3WZKA 4ZEGA 4KA3A 3LCOA 4WG5A 1NW1A 4BN1A 5LVPA 2XK4A 5JH6A 2CLQA 2UZEA 4C35A 1KE9A 4J1RA 2YIXA 2YM3A 4RA5A 2UZUE 4A06A 4YZNA 1PXNA 2VGOA 3HUBA 3Q32A 5CU0A 3OY3A 3R8ZA 3MVHA 2WMQA 4V04A 2ITWA 3CJFA 4A4LA 3H9OA 3LFDA 5DYJA 5GINE 3EQGA 4ZY4A 4IVBA 2W0JA 4UYNA 4BICA 4WA9A 4E73A 1WZYA 3L9PA 4IAFA 3KRJA 2VWBA 4KIPA 3AC4A 4DGGA 4MCVA 3DV3A 5LJJA 3OW4A 1YXVA 4GKIA 3TTJA 4Q9SA 4FGBA 3HNGA 5KBQA 1R39A 4D4RA 4X3FC 3IGOA 3RK9A 4RJ3A 4Y5HA 5AP3A 1OGUA 4UWCA 3U6HA 5HHWA 4ZS0A 4JVGA 1PXOA 4F6UA 1DI9A 4A07A 2CKOA 4FSNA 3DLSA 3S00A 2RSVA 4MQ1A 3UYSA 3ALOA 3SXFA 3DK3A 2ITQA 5EHYA 3UMXA 5B2MA 5EHLA 5JT2A 4P4CA 2BDJA 2BHHA 1IEPA 4C4EA 2J0MB 4E1ZA 1WVYA 3OOGA 5DE2A 5F94A 2PVHA 5L2SA 1XWSA 3R22A 3OBGA 3MSSA 4IWQA 5AR4A 4BTFA 5ICPA 2Y6MA 3CQWA 4L00A 3EQPA 3V04A 3KXZA 4N6ZA 3AD6A 4EEVA 4FTRA 4U9AA 3ETAA 4XYFA 4ZTNA 1P4OA 1OECA 2X2LA 2R3NA 3GCSA 3VO3A 4BBEA 5A9UA 5AV4A 4EOJA 1IASA 2GHLA 5DOSA 4NZWB 4FTAA 2OJGA 1PMVA 4PNKA 5C03A 5FGKA 3Q2MA 3DBQA 2IWIA 4CT1A 3NW5A 4DITA 1UNGA 4GFGA 3PP0A 2UW9A 4OBOA 5L2WA 2XK8A 4MWIA 2XK7A 3BPRA 5JGAA 2C5VA 3LMGA 3FKOA 3ULZA 4UALA 5EHOA 3E64A 4FBXA 5I9VA 1ZXEA 2UZVA 3DU8A 3QL8A 2AQXA 4LGHA 3BEAA 3KXGA 2BZIB 5AV0A 5HICA 5C8MA 3UBDA 4FTUA 4Z7GA 5B7VA 3QTIA 2EB2A 2V22A 4RX7A 3LE6A 5AA8A 3MW1A 1CTPE 4CG8A 1XBAA 3LFSA 3OWPA 3SQQA 1Q4LA 1JQHA 3BHVA 4D5KA 4UMUA 4FSRA 5AUZA 4K9YA 5ACBC 2OLCA 3GOPA 5L8JA 4BCMA 4ZTMA 3W0OA 3UOJA 5HGIA 5KBRA 3HAVA 1M2QA 2BDFA 5D11A 4O7YA 4QEBA 2ERKA 1MP8A 1R78A 1OPLA 2VD5A 3RMFA 3UP2A 5BPYA 4YP8A 1REKA 1V1KA 4KIKB 4BFMA 3K3IA 1W83A 3NCGA 2R3HA 3C4XA 5L2IA 3VUHA 3U55A 4EK6A 2J5FA 3SXSA 5AR7A 2XVDA 2WU6A 1OIRA 1Y8YA 4G1WA 1I09A 4QQJA 4K18A 4RLLA 4BCNA 5IMXA 5AFVA 2NRYA 4XG9A 2JDTA 3P79A 4GS6A 5GJGA 2YM5A 3AKLA 3I79A 4BI1A 3CLYA 3NYXA 3KA0A 4ZAUA 4BDBA 2R3RA 3E5AA 3IW8A 3Q6WA 4M68A 2VTRA 3ZUVA 2X9FA 4RVKA 3Q4ZA 3CBLA 3F9NA 4MTAA 3IONA 5ETIA 5ETAA 1H1SA 4TWPA 4U80A 4XMOA 4FTJA 2ZOQA 4PNIA 4A7CA 4IFCA 4APCA 4ZSEA 4UV0A 1WFCA 5JGDA 5HO6A 4C37A 4I6HA 5EM7A 2OXXA 4F7LA 3PA3A 5BVOA 2OKRA 4AFJA 4PL5A 4V0GA 3SA0A 4BKYA 4AXFA 2O5KA 3VW8A 2QO2A 5I3OA 4LV5A 4O0YA 3AKKA 4UXQA 2HIWA 1YQJA 1ZZLA 3NAXA 5KMLA 4EOOA 2ZDUA 2VX3A 3FZ1A 3NZ0A 2Q83A 2JBPA 4K2RA 2ACXA 4NH1A 4RVTA 4ZLOA 3VVHA 2YDJA 3R2YA 3RALA 3AC2A 3RHKA 3FMNA 3VBXA 5DN3A 4YTIA 2R3QA 4X2KA 2C0OA 3QXPA 4KSPA 4H1JA 4FEVA 1AGWA 3NNWA 4YJPA 1CKJA 2X0PA 2WB8A 4L68A 4NEUA 2C3KA 1FVRA 5ANDA 3PY1A 3AC1A 4MUQA 4X21A 1KUTA 3OMVA 5FQDC 1JPAA 3DXNA 3F66A 1YOMA 3CIKA 3U87A 3LFCA 3SG8A 4V05A 3KGAA 2F7XE 2Z02A 3MVMA 4G17A 4ANSA 4HGEA 5EW3A 3ZBFA 5GZ8A 3P5KA 3ORIA 3QZIA 5CY3A 5DFPA 4PV0A 3LJ2A 4BHZA 3QQLA 4FOCA 3LCKA 5E8UA 4CFVA 4J96A 5EDQA 3UIUA 1UKHA 3IGGA 3FPQA 4E6CA 5HOAA 3GT8A 4GT3A 3ROCA 3O2MA 2OIDA 4YHJA 5LMKC 1YXSA 3PP1A 3FZSA 4BCPA 3BHYA 1PXLA 3NUNA 3TKIA 5CAPA 3QRIA 5K5XA 2WMVA 5E91A 5AV1A 2XAOA 4XCUA 4F70A 4C59A 3QRKA 4J8NA 1H24A 4FIHA 3QA8A 4FTTA 2QOQA 4RZWA 4ZTLA 2X6DA 5BX0A 3DJ6A 5AWMA 3LXNA 4L44A 3FZPA 1JLUE 4FF8A 3TJCA 5AP0A 5EI6A 4O1PA 3NYNA 1PW2A 2OIQA 3BU5A 3LFEA 2F2CB 4UMRA 3TNIA 2J0KA 3PJ8A 4FEWA 4AACA 4EZ3A 3IDBA 5KMOA 4NM7A 2UW7A 3DJ5A 4NWMA 2WMAA 4EC8A 4O81A 2EUFB 1BI7A 2GHMA 2H6DA 4CMOA 4E4LA 2WTKC 4J71A 5AUXA 3LJ1A 2QOFA 5LVNA 3FMEA 3W0SA 5E8VA 3I0QA 3MPTA 3NS9A 4FNZA 2JKKA 4L53A 3V5LA 4TKSA 4ERKA 3BE9A 4C3FA 5E9EA 4D2PA 5E8WA 3WF9A 2ITUA 1JKLA 3MH1A 4JRNA 2JBOA 3QTRA 3B2TA 4JRVA 2XBAA 3PVWA 4DG3E 1ZAOA 3NGAA 3FXWA 5JK3A 1Q8WA 1YXXA 4WRGA 3RAKA 4CLJA 3LW0A 3MB6A 2YEXA 4IAKA 3EN4A 1URWA 3E7OA 4XV1A 3AC3A 3OVVA 3PPZA 3K3JA 4YC8A 5KO1A 4G3FA 3E8NA 3H0ZA 2CGUA 3QRJA 4H3PA 4L42A 4RIWB 4UN0C 4DHJA 4QTDA 4IAIA 2HXLA 3O7LD 5HBEA 3TUCA 3KREA 4S31A 4S33A 3G5DA 4FODA 1APME 3KL8A 4RWIA 3UNJA 2UZTA 4HOKA 2UZOA 3OOMA 5M09A 4FSTA 5FTQA 4RLKA 2XJ1A 4Q2AA 4U41A 5EQPA 4FVPA 2WD1A 4WD5A 2VV9A 5JZNA 4F4PA 3LFBA 3TCPA 4QQ5A 4M0ZA 1IRKA 3UNZA 3T8OA 4FMQA 4IHPA 3R7IA 2QG7A 4RA4A 1ZWSA 2VAGA 3PSBA 3ZO2A 1PF8A 4JBPA 4ITHA 2BMCA 2Y6OA 1YWNA 4NT4A 5CU3A 3VS2A 3HV4A 1VYZA 3DBDA 2C1BA 4IZAA 2CKEA 2I0YA 2GHGA 2HWOA 4MXCA 5CS6A 4TT7A 2X9EA 5HD7A 5BYZA 4EQCA 2VX0A 4IW0A 4MD7E 2GTMA 3EQIA 4DTBA 3V01A 5LXMA 4LFIA 1QPJA 3FXXA 5H9BA 4JOAA 4A9TA 3ZDUA 2QG5A 3E92A 4ZK5A 3TV4A 2XBJA 3IG7A 4M14A 2Y0AA 2OGVA 3RPRA 5K5NA 2ZMCA 4BDDA 2PVMA 4O4BB 4EOLA 3RPVA 4J52A 4J7BA 4EHEA 2F9GA 3KCKA 4U44A 4FV6A 1FMKA 3CKWA 2G15A 4YJSA 3UC3A 4XG2A 2VWWA 5IQAA 2W1GA 4AT3A 2YZAA 3CD3A 3HX4A 4CKIA 1Q8ZA 2B0QA 4IC7A 1WVXA 2H96A 3GC8A 4XLIA 2IG7A 4L8MA 1QPDA 5BUIA 1XH6A 4DEBA 1FGKA 3EQDA 4GVJA 4MD8E 5A14A 3MI9A 5DVRA 3KMWA 3DK7A 3HRFA 3JVSA 5HI2A 2CCHA 4P7EA 3PSDA 4C58A 5B2LA 4FKLA 2QKRA 4EH3A 4YJQA 4WRSA 3ZH8A 1H4LA 4MVFA 1PXMA 1JKTA 5HE1A 3W55A 4USFA 4G9CA 3PXRA 4ZZOA 4L6QA 2WTJA 4FTMA 1UU9A 4HCVA 2GMXA 1S9JA 4QPMA 5DIAA 3BRBA 4UZHA 2UW8A 3C4EA 2GTNA 4NTSA 4RJ6A 3F2AA 3REPA 1F5QA 2PVYA 4MWHA 5EOBA 3LQ8A 1H27A 4JJRA 4O4CA 4C57A 3BU6A 2UVYA 4RBLA 3UO6A 4BDFA 5K3YA 3ZU7A 5IQCA 2W05A 3P08A 4I41A 4YHTA 4I4FA 4O27B 1BYGA 2PZ5A 3Q4CA 1GZOA 4OTWA 5I9UA 4LI5A 2XP2A 2YA9A 4NYEA 4IADA 1Q3WA 3LIJA 1UV5A 3BHHA 3HMNA 3QWKA 4O1OA 1OKYA 1YWRA 5JSMA 1WAKA 4OTIA 4NM0A 4PRJA 2R0IA 3GU8A 4IB3A 5HEZA 2IW6A 4CTBA 3RAWA 4G6LA 3ATSA 2SRCA 1H26A 2KTYA 2E9PA 3LLTA 4PMSA 4PMTA 3ZDIA 5CI6A 4U81A 2H9VA 3OEFX 4IM2A 2XANA 3OHTA 1TZDA 3D7TA 3IO7A 3MH2A 3D5UA 4GG5A 4K11A 4WO5A 4QD6A 4NJ3A 4FSYA 2G9XA 3EN6A 3GCUA 3QZHA 4HVSA 4BL1A 4E6AA 4IZYA 4O0VA 3W0NA 4GIIA 2X6EA 2Z7LA 1Q99A 4I5MA 4PTGA 4BCGA 4DHFA 3KN6A 1DAYA 3MV5A 5AA9A 5EYKA 1P4FA 3CPBA 3ZMMA 2W06A 4HVGA 1H07A 4X6RA 3BHTA 3KULB 4EKLA 4W4YA 3EMGA 2VWYA 2P55A 2CGWA 2XMYA 3KK9A 4MD9E 2OH4A 1FINA 5L4QA 3Q2JA 3FY2A 4A4XA 4X2JA 4G5JA 5CANA 2QLUA 3P23A 2Q0NA 4FV5A 3RNYA 4JDKA 4MK0A 4NK9A 4XP3A 4LM5A 3VS7A 4AP7A 3RAIA 5AEPA 1OUYA 5AP4A 3EH9A 4YU2A 3LMIA 2Y8OA 4H58A 4OLIA 4D1ZA 1J7LA 3QC4A 2JLDA 2OWBA 2XNOA 2XNNA 3DLZA 3ZUUA 4I94A 3FHRA 4L01A 1AQ1A 3VNTA 5L6PA 5HCXA 1YDSE 3BX5A 4KIOA 4JS8A 4R3CA 4BDHA 4ZTQA 4D1XA 2G2FA 4AZFA 2EXMA 3NIEA 2HZ4A 1W2CA 5E4HA 4UWYA 4ZTHA 4BR3A 1GIHA 4E4MA 1CM8A 3R1YA 1MUOA 3Q9XA 4CYJA 3ORZA 2F57A 4I21A 4S32A 4APPA 5IEVA 4UEUA 4BYIA 5LQFA 3OWLA 4JDJA 4GV1A 4D2SA 1R0PA 1KSWA 2J5EA 3AD4A 4XJ0A 3NUAA 3L9LA 5IU2A 1S9IA 4MXAA 3V6SA 3D7ZA 3ZO1A 2R3KA 5HIDA 4BKZA 4DYMA 2ETMA 2F7ZE 4DINA 4OTGA 5AADA 4OBQA 4R78A 3ZFMA 2ZM3A 5HTCA 3QTUA 4IWPA 4KSQA 3CTQA 2BZKB 3FI3A 4GH2A 4GVAA 2X0OA 3VF9A 3WZUA 3U6JA 3F2NA 4BDJA 4F9AA 4IJ9A 3UG2A 3DNDA 3T3VA 2I1MA 5BYYA 5C4KA 4XH6A 3AD5A 3Q04A 4G34A 1YXUA 4MH7A 4ZY6A 3RJCA 4PPAA 1U54B 3C0GA 4W9XA 4WNPA 1JOWB 5HESA 3ZO3A 4E3CA 3HP2A 4JXFA 3R00A 4O86A 2R3PA 3VQHA 3BKBA 3IKAA 2W5HA 2WMTA 3FMJA 3OROA 3ULIA 2NPQA 5I9YA 5K4IA 4QDEA 4L46A 5FEDA 3U54A 4R5YA 4FG8A 5J95A 4KINA 4M97A 4YURA 2BZHB 1W82A 2EVAA 2WQBA 1YHVA 4BIBA 1G8KA 4KBAA 3UDSA 4R7HA 2W1IA 4GU9A 4EH6A 1MQBA 2C6IA 1PXPA 2XM8A 3CXWA 3PIXA 4LOQA 3WYYA 4DHZA 2XIRA 5DNRA 2ZV7A 3ITZA 4C38A 5TR6A 2B9FA 4RT7A 4FKQA 3EQRA 3GU4A 3GP0A 4ARKA 2G01A 2UW3A 3BWFA 1M52A 2IZRA 4Q9ZA 2WHBA 5KMJA 2PE2A 5M4IA 4B7TA 1JSTA 3BBWA 5CXHA 3WZDA 4BGQA 3CGOA 4LGDA 4M12A 3CTJA 3OZ6A 2BR1A 3VS6A 1JBPE 3KU2A 1LEZA 4QP7A 2C3JA 2YIRA 3CKXA 3ZEPA 4CZTA 4FV9A 3RPSA 3PIYA 4XUFA 1QCFA 1H0VA 3CP9A 3A8XA 4YBKA 3BGZA 5HCYA 4CFWA 5GIPE 4NFNA 3NIZA 3MPMA 1RQQA 3PWYA 2UZWE 1FQ1B 3CCNA 1RDQE 4H05A 2OK1A 3PRIA 4AZWA 3R7GA 4EH8A 4X7QA 4NUSA 2J7TA 3RAHA 5HE2A 3ZZWA 4DFNA 1F0QA 5M56A 2I7QA 2X7OA 4WUAA 3RM7A 1A06A 1X8BA 2XCHA 4DLJA 5ANOA 2CN5A 2CJMA 4HGTA 4CFFA 3R7EA 4RFYA 4YBJA 2YM6A 4ASDA 4E26A 2BAJA 4AW5A 4EHGA 3LM5A 3GENA 3F5XA 4OBPA 3OCSA 4IZ5A 3BYOA 3UQGA 4OAVB 1QPEA 3ORMA 2WMRA 2I0HA 5EYMA 4DEGA 3PJ2A 4TZRA 3GVUA 3AXWA 3BGQA 4KBCA 1KE5A 5IDNA 3B2WA 1U4DA 2B7AA 3W18A 2XM9A 3WIKA 1U59A 3DTWA 5AR8A 5F4NA 1Y6BA 2VTNA 3P4KA 3GCPA 3UZRA 4RFMA 4WNOA 4IVAA 3RTPA 4C33A 2UVZA 4UMTA 2FVDA 3R30A 3BLQA 3GC0A 2GSFA 5HG8A 2BDWA 3ENMA 3R0TA 4HYUA 3ZYAA 4OTPA 4E5WA 4FT3A 5JRQA 3PSCA 5IA2A 4FEQA 4O7LA 3ENHA 4MBLA 4RPVA 3TWJA 3FZOA 4FK6A 5FWKK 2C6OA 1UWJA 1RW8A 4QTBA 3DDPA 3F3TA 4KS8A 3ML1A 1A48A 4QT1A 2HAKA 1UWHA 4O0SA 1BI8A 2XUUA 2BALA 4AA5A 2PHKA 2R0UA 2XJ2A 3U8WA 3VBQA 4GJ2A 2XNBA 3KF7A 4J97A 3VN9A 3ZFXA 1ZYLA 2VTQA 2IZUA 3VUMA 4FVQA 4R3PA 4F1TA 5J1VA 1GOLA 1H25A 3R1NA 4NCTC 4RWLA 1ZMUA 5C27A 4AUAA 1KV1A 3KMUA 4IVCA 4RMZA 2XNGA 2AC5A 2P3GX 3CJGA 3OXZA 5DG5A 4D55A 3GC9A 1NXKA 5CF6A 3G9LX 4JMQA 4EOSA 3QD3A 3DCVA 1J3HA 3IQ7A 3LPBA 3E8DA 4PPBA 3RHXA 3UO4A 2WELA 5J8IA 3MESA 3ZRMA 3E63A 5CLPA 3EQCA 4M69A 4NW6A 3R8PA 4BBFA 2C5XA 3R8LA 4NTTA 1LP4A 2XNEA 4EOIA 4DBXA 5I9XA 2QD9A 3ZBXA 3RCDA 3ZXTA 4TYGA 4EORA 3SVVA 5FBNC 3RCJA 5CSWA 2OG8A 3NUPA 3F5GA 4M13A 5M55A 3TZMA 1OKWA 4HVDA 4MXYA 3QTXA 5IQEA 3HMOA 4EONA 2RFNA 4RX8A 4RZVA 5IH6A 4QMPA 4FZFB 4U40A 1WBNA 4CVAA 4D4SA 2CPKE 3L9NA 3FYJX 2CLXA 3VUDA 2FB8A 3UDBA 3WE8A 3SOAA 4CMTA 2DQ7X 5CYIA 3BQCA 2QOLA 2V62A 4QP8A 4XRJA 4AA0A 3R63A 1IG1A 5E1SA 2Y4PA 3UOLA 2YISA 2PE1A 3VBYA 3C5UA 3G0FA 5DPVA 3QF9A 2P2IA 3ZTXA 2GS7A 4LRJA 3CQUA 5GNKA 2RIOA 2PL0A 3JY9A 1OKVA 2EU9A 3P86A 4JDIA 3ZHPC 4AX8A 5CASA 5HO7A 4O82A 4WT6A 3TIYA 3FC1X 3MTLA 1STCE 4EJ7A 4D5HA 3L1SA 2XZSA 3KY2A 2PVKA 3AT2A 2IVSA 3W1FA 4FTOA 4W9WA 5IQFA 4FTQA 4Y85A 3SOCA 3ZRKA 3HA6A 4EBVA 3TTIA 4PP7A 2C4GA 4NIFB 1JNKA 3ERKA 2C1AA 5IISA 4KABA 3R8VA 4DN5A 2J9MA 1SVEA 2VWIA 3KEXA 4FOBA 1PMUA 1GIJA 4NM5A 3PLAE 4PQNA 5BVFA 4JNWA 4WSQA 1KE7A 2O65A 5HBHA 4RWKA 2PULA 5D1JA 4WG4A 4I22A 3D5VA 1YI4A 2HZ0A 4F08A 3FLYA 3DTCA 3PA5A 5LWMA 3O8TA 5CSPA 3OEZA 1XBBA 2YM8A 5AUYA 3RM6A 4BDGA 4UB7A 5FP6A 4NFMA 3F7WA 4YC3A