4KSQA

Crystal structure of human b-raf bound to a dfg-out inhibitor 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
258
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Discovery of a Selective Kinase Inhibitor (TAK-632) Targeting Pan-RAF Inhibition: Design, Synthesis, and Biological Evaluation of C-7-Substituted 1,3-Benzothiazole Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 258
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ksqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ksqA01
2UW0A 3ERKA 3SC1A 3IW7A 3WF6A 2ZMDA 1YOMA 2FO0A 4CLJA 4UBAA 2BZIB 4QP4A 1ND4A 2Y6OA 2C3JA 3FUPA 5M4FA 3EN7A 3BQRA 4LL5A 5HE3A 4AA4A 4JBQA 3G2FA 2B9JA 2YCSA 5CZIA 3OEFX 3A8XA 1Q8TA 3G9LX 3OROA 5A6NA 5HBJA 3U6HA 3NWWA 2HZ4A 4P2KA 4CKJA 3U4UA 5J9YA 3BHHA 3E8CA 4FG7A 4FV4A 4KRDA 1Q3WA 1HCLA 3RWQA 3R83A 1P4OA 4RFZA 2EB3A 5JQ5A 3ZRLA 2B1PA 3FJQE 4XUFA 2ZV8A 3QZHA 3U87A 4RQVA 4F9CA 5D10A 1M2RA 4ZY4A 5FP5A 4FKSA 4IVCA 3CJFA 3UE4A 4MBLA 1YDTE 3C4ZA 1A48A 4HPUE 2R3KA 4I24A 3NYXA 4BI2A 3MFSA 4A7CA 3BU6A 3SX9A 4QP1A 4C59A 3ACJA 2ACXA 1BL6A 4XHKB 3MPMA 2NRUA 1OZ1A 2JBOA 4ERKA 3IDPA 2VWZA 4QYFA 1Q61A 3HX4A 2C5VA 4HNIA 2XJ2A 4YTHA 4JT3A 3PXQA 4EUUA 4YJNA 2P4IA 4EH4A 4BHNA 2YM6A 4USEA 2XNNA 4MYGA 4Y5QA 3ZO1A 1PXMA 4FMQA 4R1YA 4GG7A 4FTTA 1BUHA 2A2AA 3WZDA 4CSVA 2CKQA 4ITJA 3QTUA 1O6YA 1XHAA 2XM8A 3CC6A 1NVRA 1OB3A 2BKZA 5HCXA 3RK7A 3RNIA 2IWIA 3AC2A 4RIWA 3VC4A 3NPCA 4FZDB 5EQEA 4A4OA 4DGNA 3TV4A 3W33A 4IQ6A 4A9RA 4BDBA 4BZNA 3GCSA 1H24A 4QYEA 4UZHA 3NNUA 2C4GA 4J71A 2HENA 3QQJA 4XLVA 3D5WA 4LQMA 5KMJA 1WCCA 5I9ZA 4K6ZA 3KVWA 5CS6A 4JRVA 5LVNA 4R77A 4ZSEA 3TN8A 3ZUUA 2F2CB 2QQ7A 2VX0A 4G31A 5IA0A 1YXTA 3TUDA 4PRJA 5J9LA 3U8WA 2AC5A 3DBQA 3QUEA 4RMZA 5HU9A 3AC4A 3S00A 4JQ8A 4BCKA 3ORMA 4YO6A 4I4FA 3BYSA 4GH2A 4ENYA 2ZYBA 2CGVA 4XBUA 2FGIA 4RWIA 3Q5ZA 4XOYA 3SXRA 3HYHA 2HZNA 4G6NA 2G2FA 1M2QA 2JD5A 3NW6A 4M84A 3W16A 4AT3A 4CLIA 3PDTA 5G1XA 4WT6A 4WO5A 3KXZA 3W2CA 4FODA 4DT9A 2QONA 3K2LA 4ALWA 2XP2A 3BLRA 5FM3A 1Q8YA 3L8VA 4FK6A 1JPAA 2XKDA 4QQ5A 4WHZA 2ITTA 4AW5A 1OL2A 4WG4A 3W2OA 4O0TA 2UZDA 4KS8A 1S9JA 4M69B 5DLSA 2WQEA 4JBPA 4PY1A 2VTNA 3FKLA 3U9NA 3ZUTA 4KNBA 5CF4A 2F49A 5IA3A 3L9MA 2R3IA 2PTKA 5DMZA 3D9VA 2IZTA 3FAAA 3QA0A 4A4LA 5CI7A 4DGOA 4ZY5A 3HUBA 1H01A 3HMMA 4UWCA 4F6SA 4BCGA 4DEGA 2Z02A 1OM1A 1J7LA 4PP7A 2UZTA 3BHTA 4QQCA 5DYJA 4YZDA 4ID7A 4O7SA 3NLBA 4ITHA 4DAWA 1PJKA 4N4SA 2Y0AA 4RIXB 2PUIA 2W96B 4F6UA 4U3YA 5AV0A 5HLPA 3UVQA 2ZMCA 5EQYA 4NUSA 4UX9A 3PG3A 4O91A 1RJBA 1SVEA 4NCTA 1KUTA 4BIEA 2QLQA 4P7EA 4F9YA 3ZC5A 4WSQA 3O8PA 3DLSA 4GU6A 3SKCA 3QYZA 4CFWA 2J0JA 4CZUA 2VV9A 2PUUA 3NRMA 3W8LA 4D58A 5L6OA 3UNKA 1IAHA 2GQGA 4BDEA 2YM3A 3KL8A 4KAOA 3II5A 3OMVA 4FUXA 5D9HA 2C3KA 2C30A 4IJ9A 4L7FA 1JAMA 4BCMA 1BI7A 4K9YA 5KZ0A 3NUUA 4R5SA 3IW6A 4Y83A 3R7IA 3ZFXA 2O2UA 2W9ZB 3NNXA 2OG8A 3PTGA 3UVPA 3ZXZA 4L68A 4E73A 2R9SA 3ORZA 2JBPA 4C4GA 2X81A 4X6RA 3FDNA 2ITYA 4ZSGA 5HG9A 3FQSA 4IVBA 3L9PA 4NFMA 1Q3DA 3R7VA 3COKA 4FV1A 4XYFA 5DR9A 3IW5A 2R3JA 2FSTX 1UNLA 2JLDA 4GEOA 4PDPA 5FWKK 5KBRA 5C4LA 2YERA 1QL6A 4I22A 3GCQA 4O0XA 4YZNA 3GC8A 4BBEA 3BE2A 3FMHA 3BBWA 3VAPA 3KMMA 5C8NA 4IXPA 2H9VA 5AV2A 4WKQA 3QD3A 5ETIA 2O8YA 2X39A 2J6MA 4G9CA 4J52A 4E5AX 3UO4A 2GNIA 3D94A 4M67A 3ORXA 1PF8A 2OJGA 4FIGA 4CMUA 3WIGA 2Y6MA 3F7WA 5IUGA 3DJ6A 4FZ7A 2VWVA 3QCYA 5BYLA 5FXRA 3EZVA 3TNIA 4R8QA 3H4JA 4WUNA 3RVGA 1GJOA 1GNGA 2VU3A 2JKKA 5DHJA 5CVFA 4GYGA 3WZUA 4DA5A 2CN8A 3F61A 5EM7A 5E8VA 4DE4A 1RE8A 3F6XA 4FGRA 1B6CB 3HAMA 4MTAA 4U42A 2E9VA 5CAOA 1TKIA 4EOIA 4WG5A 4IMYA 2HY81 4RQKA 2UZWE 4IC7A 1DS5A 3QHRA 3R9DA 3QUDA 1R3CA 3KVXA 2O5KA 2Y7JA 4ZTNA 5F94A 3ZEPA 4OTDA 4AGCA 3UDBA 2VTRA 3P0MA 1OL5A 2VNWA 3JY0A 4O1PA 3TTJA 4DEIA 4ACDA 2BRHA 3GOPA 4L3JA 3TJDA 4BIDA 4PMPA 3V5JA 1OIRA 2W05A 1Z9XA 5G6VA 2W9FB 3V6SA 4C38A 5KUPA 3MH0A 3IOKA 3TL8A 4HGTA 2ZDUA 4FL3A 5HX8A 5KBQA 5L8KA 5KHWA 5GINE 2YA9A 3N9XA 2X2MA 3CTQA 4BWKA 2Y4IC 3F5GA 4O38A 5FTQA 5CF6A 1OBGA 3PJ3A 2OGVA 5M44A 1UKIA 2YJSA 3VWAA 4OBOA 3MY5A 3DJ5A 3KQ7A 5HE0A 5T3QA 3NDMA 5EYKA 4O27B 1M14A 3VF8A 4AU8A 3UNZA 4H1MA 2V7AA 5AIKA 3CR0A 5EDQA 5AA9A 2PSQA 2GS7A 3I5ZA 5I3RA 3EQRA 4PTGA 5HIBA 4CRLA 4BKJA 4FTRA 3R8PA 5HLNA 5IQGA 3LM5A 2ESMA 4QP3A 4MX9A 1ZOEA 5FBOA 4U80A 4U79A 4IWPA 3EQGA 2ZV7A 3EQDA 1JLUE 4G2FA 3VUTA 2JDVA 3MFUA 4L53A 4YC8A 4IIRA 4YUQA 2QCSA 5JGAA 3FQEA 2OLCA 5CXHA 2ITQA 2YM4A 3FZPA 3TWJA 3QX2A 2PYWA 3GT8A 5BVFA 5FUTA 3K3JA 2OF4A 3L9LA 3PVWA 4Z55A 3A62A 3KKVA 4EOSA 2HELA 1WFCA 4QMNA 2C1AA 3OBJA 5K4IA 4EHZA 1VYZA 4FKVA 4HVGA 1OPJA 2R7BA 3FWQA 3MPTA 2RFSA 3E8NA 4X7QA 5B2KA 1LPUA 2ETRA 5L6WL 5HO7A 3NGAA 3QRKA 2NP8A 2P0CA 1GIIA 3IGOA 4AFEA 4BTKA 4FVQA 2IG7A 4I6QA 4UMTA 3E62A 4C61A 4DG2E 2ONLC 2BIKB 1YQJA 4LOPA 4G5PA 3MW1A 4ZMEA 2ZDTA 3DK6A 2F7ZE 2P55A 1FOTA 3NYVA 4CFVA 5M4UA 4D5KA 1QCFA 3V8WA 4FSQA 3QGYA 4I5CA 3R8ZA 3F88A 2VO7A 3PP1A 1TQIA 4AA0A 5IU2A 4TZRA 5AUUA 4GKHA 2XZSA 4F9AA 5ANEA 1U5QA 2BFYA 5CWZA 3UNJA 2GQSA 3G33A 5ACBC 4BHZA 3PY1A 2DYLA 4CFFA 4KBAA 3V04A 3D2IA 4D0WA 4XV3A 4XRLA 3G0FA 3F69A 3CQWA 3V5QA 2YEXA 3EFKA 3F2RA 1ATPE 4DT8A 4BKYA 4GKIA 1WVXA 2YAAA 4CXAA 5CEPA 3JVRA 2PMOX 3BGQA 1CSNA 4FVRA 3UBDA 5J1WA 3NUYA 2XKCA 1QPCA 1LP4A 2GMXA 4RT7A 1Q24A 2UVXA 4U7ZA 5LVOA 4GJ3A 1Q99A 1PHKA 4JX7A 4XX9A 3TIZA 1ZARA 2JDRA 5A54A 1ZMWA 5IDPA 4BZDA 1U54A 1H4LA 2G9XA 2VWBA 5M53A 2GPHA 4PNIA 4O7TA 2BHHA 2ITVA 3VIDA 2BZJA 4AOTA 3JYAA 4LMNA 1UV5A 4E6CA 3VBTA 4UEUA 5KMIA 3BRBA 3DBCA 4BYIA 3BYUA 3VS5A 2BVAA 4QP2A 2IVTA 2JAMA 3CQUA 4BDGA 3HLLA 5CQWA 3C4FA 3Q53A 4PL3A 1BKXA 4TRLA 3SDJA 3EKNA 5M51A 3NS9A 5E90A 1AQ1A 2OXYA 4DTBA 5HU3A 2WIPA 2WGJA 3MH3A 3PYYA 2WQMA 3MTLA 4FZAB 4LG4A 1Q62A 4FYOA 2I0EA 5T6KA 2IVVA 3JXWA 3UOJA 3DQXA 1ZOHA 1ZYLA 4RC3A 1J1CA 4FKQA 3EN9A 3WZEA 1XWSA 2R3QA 3Q6WA 4LUEA 4OBPA 4PQNA 3GEQA 1Y91A 4RFMA 5J9ZA 5DWRA 3R04A 3IDCA 3LJ1A 3Q2MA 5IKWA 3VW6A 3IQ7A 2QOBA 2G01A 4YC6A 3R63A 4Q9ZA 5LMKA 4BRXA 2QO9A 3BE9A 3HRBA 1J7IA 5IQAA 3RHXA 3F2NA 3W2RA 4RLLA 1L3RE 1FMKA 1E9HA 2QC6A 1YHWA 2WTIA 1UNHA 2GDOA 5DR2A 3HUCA 3AMYA 3GFEA 2RG6A 1PY5A 3QZFA 3E63A 3PA5A 1H1SA 3QAME 5CU0A 2WIHA 5J5SA 4R3CA 2C6DA 4ACCA 4U8ZA 5J79A 3M2WA 3VUHA 5E8SA 5KMNA 4ORKA 3VHEA 4GFMA 3R7EA 4AQCA 3E5AA 4FSUA 3C4WA 2W4JA 3R0TA 4DLJA 4AS0A 1V0OA 3I1AA 3BWJA 3W2PA 3ZZEA 3FY2A 3QXOA 5AX3A 5K5XA 2B0QA 3D83A 2XMYA 4C2WA 4EONA 3OF0A 1W84A 3ENMA 3ZDIA 5DIAA 2XIRA 4QMYA 2BMCA 3GFWA 1VEBA 4QMZA 5BMMA 1A06A 4OW8A 1KE7A 4RLKA 3LQ8A 3EN5A 4CQGA 2YM8A 4DLIA 4YO4A 5L6PA 1SNUA 3TJCA 4X2JA 3C0HA 4NJDA 3IKAA 4EH3A 4IWQA 4CGAA 2HZIA 4IAFA 2C5NA 5BYYA 4CFNA 3EKKA 3NUXA 5BQ0A 5J7HA 5AP0A 4G3FA 1UVRA 2PZRA 3ZSGA 3AMAA 2WU6A 2YCFA 1GOLA 2J9MA 4X6QC 4CV9A 2J0IA 2R5TA 2VWIA 3VUMA 3E64A 4IH8A 4M68A 4A06A 4IACA 2ITPA 1XH9A 2UW5A 2RIOA 5L3AA 3G51A 4IM0A 3AG9A 4D9TA 5M4CA 4J95A 3BQCA 4BZOA 4OLIA 2J5FA 2J51A 3PJ8A 3QTZA 4ASXA 3QLGA 4FSMA 2G15A 4AGWA 3H10A 4FTKA 2J4ZA 4O0YA 3ZUVA 1R0EA 3ALOA 4RFYA 1O9UA 4Q5HA 4M14A 3O0GA 3I60A 3MIAA 1MUOA 2JKQA 4JDIA 2Y4IB 4QYHA 5GHVA 1XO2B 3H0ZA 4FEXA 5M09A 4BI0A 4KABA 5CAUA 3R1NA 3LKMA 2WEVA 3DU8A 3ZDUA 1XJDA 4QMVA 5J7BA 3PA4A 4LGHA 3HRFA 4EK5A 5I3OA 4PWNA 4HYSA 3NYOA 4QP6A 3CSVA 1XH5A 4Z7HA 4AWIA 3DFAA 4YJTA 4KD1A 3OY1A 3QQHA 4PMSA 3T3UA 4R1VA 4R7HA 4HVIA 3AGLA 2BDWA 2CCIA 2BRBA 2HZ0A 3BHUA 3RZFA 3T9TA 2B52A 2BTRA 4D2PA 2PMIA 2C1BA 4RPVA 4MBIA 5IH5A 4QYGA 2PVKA 2YWPA 3LCKA 3FSFA 4C58A 3JPVA 1DM2A 3MN3A 3D5VA 2PE2A 1UU7A 2XYNA 5LVPA 3F5UA 4KKEA 2B4SB 3VQHA 3LCDA 3ZH8A 4XV2A 3QQGA 3DBFA 2VZ6A 5JEBA 2V22A 3H30A 2YABA 5CLPA 3TUBA 4JDHA 1CDKA 1PMVA 5CVHA 2A27A 1JKSA 3LMHA 2WMBA 1WBNA 5HNIX 5E7RA 3RK9A 4EQMA 1WBOA 3U55A 5AUVA 4HZRA 4L7SA 4QP9A 4C3RA 2OO8X 3PPKA 3QC4A 3E93A 4ZOGA 3CXWA 5F20A 1MQBA 4L46A 4DFLA 4CZTA 5E4HA 4ZEGA 4MXXA 4I94A 1CM8A 2YDJA 3HZTA 5H3QA 2C0TA 2W1DA 2VWXA 3VS3A 1IA8A 3DTCA 1U46A 2BDFA 3MH2A 4I21A 4YP8A 4ZZNA 4EK8A 3ENHA 3FKNA 3VUIA 5AV1A 4RX8A 4O86A 5CQUA 4E6QA 2YITA 4U97A 3UGCA 4YJSA 4I93A 2YIQA 4Q9SA 5AMNA 3Q5IA 2ZM4A 3QYWA 3EHAA 3LVPA 4MXOA 3DTWA 3N4UA 5DR6A 4O96A 3RAHA 4ASDA 2VN9A 2ITXA 3I79A 3B2TA 4KKGA 1L8TA 1IASA 5CSWA 2WB8A 2UZNA 4QQJA 2XRUA 3CTJA 4E6DA 4ONAA 3C4EA 3MFTA 4D5HA 4FEUA 3G6HA 3ZMMA 1XH8A 2HAKA 2YJRA 3PSDA 4AFJA 4EOMA 2XBJA 3VN9A 2RKUA 2JIUA 2ZB1A 3OVVA 4M15A 4GCJA 2OXDA 2BUJA 2F9GA 5FDXA 2B55A 1MRUA 1XH7A 5FP6A 4CCBA 4V0GB 5TT7A 4I41A 3HA6A 3S1HA 4EOPA 1H26A 1MRVA 3BYVA 4YPSA 2JFLA 3IO7A 3HV4A 4IX3A 5A4LA 4MXCA 5JRSA 2XNGA 4NM3A 1IR3A 1K3AA 1X8BA 4PMTA 3VUGA 5GIPE 2JFMA 4AP7A 1BMKA 2E9PA 2WTWA 2I7QA 1YWNA 3VJOA 1DAWA 3F5PA 3P78A 3ORKA 3C5UA 4MNEB 3SXSA 1NVSA 2GNLA 4R5YA 3ZONA 3KFAA 2OIDA 2XKFA 2X6EA 4DEEA 4A9TA 3SG8A 5DVRA 3WBLA 4B99A 4OT5A 4OTQA 2CGUA 4GT5A 2XIYA 3MVJA 4QTAA 4FT9A 4OTFA 4EQUA 2C0OA 3FPMA 3TACA 1H00A 1QPDA 2WMSA 4XG3A 3WF8A 3MSSA 2PVYA 5CTPA 5FQDC 3BELA 3KRJA 3OXZA 2A19B 4RVTA 3S3IA 2QG7A 1T46A 2R3FA 3QRJA 4OT6A 3V8SA 2RSVA 2GCDA 3RCDA 4AW0A 4O82A 2PVJA 3QTWA 2I40A 2IW6A 3MWUA 3NEWA 3HMPA 2YIRA 2GSFA 1Y57A 2JEDA 3OWJA 5FRIA 4O6EA 3KMWA 4S34A 2XNMA 4KB8A 4HGSA 4U0IA 2VTJA 3SVVA 2QD9A 2WZJA 4NIFB 2UW8A 4QPAA 3ZBFA 4H05A 4TKSA 4YSJA 4NU1A 4RJ4A 4CYJA 4G5JA 4RX7A 5JFWA 1MQ4A 1YI6A 2WMVA 3BGPA 3GUBA 1UNGA 3QKMA 5HNGA 4FV3A 3IONA 4MK0A 3R9OA 1LEWA 5DEYA 3RPVA 4YBJA 3QD0A 4BB4A 4PDOA 2UZOA 4XP2A 4DEHA 5IEXA 3ORIA 2HXQA 4JLCA 3FXZA 5IA4A 3I6UA 5C4KA 4FIIA 5A46A 5M07A 2P2IA 3P1AA 1KE8A 3EQHA 3ROYA 4ZIMA 4RSSA 1XH4A 3ALNA 4OR5A 4UXQA 3W2QA 4ZJVA 4RWJA 3CPCA 5CEOA 1SNXA 1O6LA 4HOKA 4EHVA 3OT8A 1JSUA 2WMWA 4FG8A 3SLSA 2IO6A 3TTIA 3DQWA 4QPSA 4YMJA 4V0GA 1Q8ZA 3QCQA 1UU8A 4IC8A 5K3YA 3V01A 5M06A 3O8UA 3FV8A 1PXNA 2C6IA 2EU9A 2OJJA 3NNVA 5J95A 2KTYA 4AZTA 4NL0A 2QOHA 4I5PA 3IGGA 4ZTSA 3TV6A 3G15A 4ANNA 3KRLA 3TT0A 4FTJA 4FTIA 4U40A 5EW8A 1WAKA 5ETAA 3ORPA 1EH4A 3DAJA 3KEXA 5CI6A 3AXWA 3TKIA 1UU3A 4O0RA 4E93A 4MNEA 5J8IA 4O21A 5JFVA 3LLAA 4AW2A 4AZVA 4RWKA 4C4JA 3PWYA 3UVRA 3D5XA 4TWPA 2WTCA 5TO8A 3UIXA 5K0XA 4FV2A 5BVDA 3OEZA 4Z9LA 5HX6A 3HAVA 4XMOA 3NUAA 1KOAA 2C6TA 2XNPA 3GCUA 3ITZA 5HHWA 3TDWA 4IAKA 3A8WA 4FV8A 3QC9A 4C35A 4EZ7A 4OTWA 3TIYA 4CQEA 3RM6A 2B54A 3HMOA 2YLEA 4MKCA 3FKOA 2BILB 4FSTA 4TL0A 4AXAA 2R3LA 2E2BA 3UMXA 2LGCA 4GW8A 5EHOA 5A6OA 3ODZX 3SV0A 5CEMA 4Y72A 3F3VA 4JNWA 1OKVA 4ANQA 2PE0A 5L2QA 4C33A 4JBOA 4QP8A 3GQLA 2C3IB 3Q52A 5CENA 2VTOA 1A9UA 3CEKA 1DI9A 2BCJA 2IN6A 5HG8A 4IAZA 4NIFA 4ZJIA 4EKKA 4DFYA 3E3BX 5L8JA 2W1CA 2XF0A 3NW5A 1XR1A 4JAJA 3VNTA 3R22A 1CKPA 4I92A 5L4QA 3G0EA 3KXNA 4ITIA 2CCHA 3BLQA 3BCEA 3MGYA 5AV4A 3RP9A 2B7AA 5HBEA 2CN5A 3UO5A 2WFYA 4IANA 4M0ZA 1YXVA 3F3ZA 4XG4A 1ZYJA 4M12A 3V5TA 1FVRA 3DBEA 3AOXA 1U59A 3BYMA 2UW4A 4EUTA 5IQDA 2OF2A 3NAYA 5A3XA 2HXLA 5D41A 3LZBA 3A7GA 3PG1A 4EH6A 4UMQA 2Z8CA 3U54A 4L43A 4N6ZA 3RI1A 4RA4A 4MXAA 3OFMA 3DS6A 3ORTA 3AD4A 2QR8A 4YZMA 5HNBA 3EL7A 1OUKA 3WF7A 4EWHA 4S30A 2R3MA 3UP2A 4ACMA 2X7GA 4CKRA 2OFUA 2IPXA 4UWBA 5AIRA 5IQCA 3ZU7A 2OZAB 1H27A 4JS8A 1OPKA 1BX6A 5J1VA 3GC9A 2G1TA 2ETKA 4HZSA 4WRGA 3TKHA 3QGWA 4DCAA 5KKRB 4G16A 4PF4A 3Q9XA 5CSXA 3DXNA 2WAJA 3WILA 5BNJA 2W1FA 3AMBA 5DEWA 4PTCA 5KHXA 3GU7A 5IQFA 4UYAA 5IZFA 1IRKA 2GS2A 2ZM3A 1XH6A 5IA2A 1RW8A 5CALA 4FOBA 2YIYA 5KNJA 2C5YA 3MI9A 3VO3A 1JBPE 4FNXA 2OICA 4DTAA 2B9IA 1XQZA 2XNBA 3CIKA 3CQEA 2QOLA 3I0OA 4EH2A 4IZAA 4F08A 2FSLX 4FZFB 4G6LA 3AD5A 1SYKA 2OIBA 5E1SA 1H08A 3WF5A 3NYNA 2ITOA 5LWMA 2WQNA 3FC2A 5LQFA 4EK4A 1SZMA 3AC1A 1IA9A 3OY3A 5H8GA 4N0SA 3FQHA 5KO1A 2W06A 3EFLA 4G1WA 2VGOA 2QOKA 4O7NA 1H1PA 4FK3A 5FXQA 4KIQA 3LFNA 5D11A 5IUHA 5I9VA 2C6MA 4ZY6A 3ZM4A 4EYMA 4HGLA 4L9IA 3LQ3A 3S0OA 5FTOA 2GNHA 3FLSA 2E9OA 4U6RA 4R7IA 4R7BA 4IX4A 1CTPE 4DF3A 4FV5A 3ZHPC 4FZ6A 4DN5A 4FSRA 4EOQA 1YWVA 2X9FA 3PXKA 5HORA 1OIQA 5ANKA 5LCJA 3PLSA 1M52A 3OWPA 3Q9WA 5CX9A 3TXOA 1H1WA 4TYEA 4L6QA 4BCQA 4GS6A 3ETAA 1XBAA 4WNMA 2FUMA 2R0UA 3KK9A 5AAGA 5AFVA 2WOTA 5F95A 3MDYA 4M69A 4RX9A 5JN2A 4ZTQA 3EOCA 5JMSA 3MS9A 3PRIA 4L42A 3D7TB 5ANIA 2H96A 4AA5A 2XK4A 5AUXA 1UA2A 2YZLA 4ZTMA 1FINA 4LL0A 4YBKA 1GZOA 2BTSA 2X7FA 3GCVA 4RJ3A 1JKKA 5JGBA 3F3WA 4DG0E 2OZAA 3SXFA 2R64A 3ATTA 1RDQE 1G3NA 3CY2A 3PJ2A 4K77A 3BKBA 2OH4A 3GC7A 4MNFA 3CBLA 3R9RA 4RIXA 4EK3A 3BGZA 3AC3A 5AP6A 3FMEA 4GT4A 4ALUA 5CU3A 2GS6A 3OW4A 4ZSLA 3E3PA 2WXVA 4W8DA 4QMLA 3OBGA 2OKRA 2WTDA 4TW9A 2C5OA 5BUIA 2NO3A 3SW7A 3R8MA 4YZBA 3FLNC 2KULA 4FGBA 1YXUA 4P5QA 2GHMA 2UZLA 5EM6A 5CF5A 3R1SA 3UYSA 1TVOA 3A4OX 5EHLA 4A9SA 3ZC6A 4YR8A 2SRCA 3HP5A 3KMUA 4HCTA 4FIEA 5E91A 2UVZA 5HG5A 4RVKA 2VRXA 4LOOA 1QMZA 4RC4A 1SMHA 3P23A 3C4CA 4M3QA 4RZVA 2JGZA 3OOMA 5DNRA 5E8WA 3ZFYA 1P14A 4AE9A 3E8DA 2WMRA 5CAQA 4ZS4A 4HYIA 4ENXA 2B53A 5AUTA 3M1SA 3F3UA 5DPVA 1J1BA 1RQQA 3A7HA 4YLLA 4FT0A 3F66A 3ZLXA 2W1IA 2BFXA 2XB7A 1W98A 4YLJA 4FV9A 3PY3A 2OIQA 2JDSA 2A4LA 4UN0C 4YU2A 3R28A 3DPKA 4FTAA 4C3FA 3CTHA 4YJRA 3UC4A 5HBHA 3Q4CA 4D4RA 4QTDA 2NNWB 1Y8GA 3U9CA 5IH6A 2CNUA 4C0TA 5FDPA 2Z7LA 4AGDA 4JVGA 2VTTA 3QD4A 5JSMA 5LXMA 4YHFA 3QFVA 3RM7A 3WIKA 3VQUA 3E92A 4AAAA 2QHNA 4ZSJA 4GG5A 2O65A 3ZRMA 5A4TA 3IECA 4AZWA 3D2KA 3OS3A 4PPBA 4X2GA 4IB3A 2NRYA 3OTVA 3D7TA 5BUEA 3R01A 4O0WA 4F0GA 3HECA 5F4NA 3E7VA 3GU8A 5ANGA 2Q0NA 4E6AA 4MD8E 2RGPA 4QT1A 2VTQA 2YIXA 3QHWA 5AUZA 4I0RA 1B39A 1W83A 4DFBA 4EEVA 1OBDA 3UZTA 4IZ5A 2WNTA 4RRVA 2AYPA 3QD2B 4KIKB 4L3LA 4WIHA 5EM5A 2CJMA 4J8MA 4FNZA 4J53A 4E26A 4LGDA 4ZLZA 2BRMA 3O50A 3TNQB 2R3PA 3CLYA 2FH9A 4MQ2A 4UALA 4OUCA 5AR8A 5ETCA 4BGHA 4XBRA 4KA3A 3QKLA 1ZWSA 3O23A 3DGKA 4Y85A 4M97A 5AAEA 4FV7A 4YNOA 3Q60A 3NUPA 4ZSAA 1NW1A 5IUIA 3A7FA 3LFAA 5LCKA 5D1JA 2OJ9A 3P4KA 4IWDA 3HGKA 4UYNA 5L2IA 4PPCA 3JR1A 1I44A 5IA5A 2PY3A 3D4QA 4N6YA 4PTEA 2IZUA 2RG5A 3Q3BA 1KWPA 1M7QA 3GXLA 4GK4A 1PXPA 4IFCA 3FL4A 1ZAOA 3W10A 4F7JA 4I1ZA 3P9JA 4CZYB 3IDBA 3ZO3A 4TYGA 4FUYA 4E4LA 4W8EA 4USFA 3KF4A 2OH0E 4MHAA 4UMRA 3ANRA 4G6OA 4GT3A 3PVGA 4BI1A 4NW6A 3QQUA 3DKGA 3V5WA 4FBXA 5FG8A 3SRVB 4FTCA 4IDVA 4CV8A 4XV9A 3OCTA 3DCVA 5A4EA 1PKGA 5E8UA 3C5IA 4ANLA 4H3PA 4JG7A 3OTUA 3R8LA 2OSCA 1H28A 1YXSA 2ERKA 4F63A 3H9FA 3UG2A 3EQIA 2X8IA 3KXGA 4KUJA 4ZMFA 4V04A 4KINA 3SA0A 3TG1A 5EG3A 4GVJA 4XS2A 3T8OA 4CD0A 4IVAA 5HTCA 4OTGA 2QOIA 2PPQA 3FZ1A 3FZOA 3NIZA 1T45A 1XBCA 5AEPA 3QQFA 3H0YA 4I5MA 1U4DA 5CT7A 2BPMA 3ZTXA 4KBKA 5HQ0A 5FD2A 4MD7E 1WBPA 5KMLA 4LV5A 3DXPA 2UZBA 4FICA 3QCXA 2XIKA 1K2PA 1YXXA 3BPRA 4S2ZA 3ZLYA 4O7RA 4JI9A 2QR7A 4KRCA 4E8AA 5CSPA 4HCUA 4F64A 1YWRA 5AP5A 3KRRA 3FMNA 2BALA 1YW2A 2DQ7X 2HWOA 2VX3A 2W5HA 4KIKA 4FKPA 5GNKA 4C4HA 1NA7A 2VTAA 2EXEA 3U4WA 2O64A 4C4FA 3NVMB 3W55A 2CKEA 3MVMA 2FA2A 5LVLA 4L3PA 2VX1A 4UZDA 3A61A 1OMWA 3VULA 3GVUA 3POZA 5EOLA 4CEGA 2Z7RA 4X3JA 1G8AA 4QO9A 5JZNA 1OPLA 1VJYA 5GZAA 3HVCA 3UIBA 1R78A 3L8PA 4FSYA 4EHEA 1ZYCA 2JC6A 1FQ1B 2XK3A 3VBWA 5GJGA 4YHTA 1K9AA 4XG6A 1MP8A 2ETMA 2IW9A 4E5BA 5C1QB 4QMUA 2IVSA 1Z5MA 5IPJA 2CPKE 2QO7A 5IH4A 2PHKA 4NM5A 2A0CX 3FEGA 3UMWA 3D14A 3NCZA 5AV3A 5KCVA 3THBA 1STCE 4ZTRA 5FM2A 4D4YA 4TYIA 3SRVA 2ITZA 3VW8A 3LFEA 2B9HA 1VZOA 3VRYA 4YJVA 2WMXA 2Z7SA 4FTOA 4LI5A 4YNEA 4BDAA 1DI8A 2QKRA 5LARA 3AT2A 2DWBA 3QUPA 3P79A 4BWPA 3FMKA 3EFJA 3ATSA 3DZQA 2I1MA 1OI9A 5TR6A 2QLUA 3UOKA 3P7CA 3AT4A 1QPJA 4JAIA 4IM2A 4K1BA 1YHSA 4LRKA 4U9AA 3ZEWA 4EC9A 5EYCA 4RWLA 3VRZA 4BBFA 4DFNA 3BBTB 3A99A 3HP2A 3DA6A 1TQPA 2H6DA 3ANQA 3KF7A 3PPZA 5DT4A 4CG8A 4WG3A 2I6LA 4O0VA 3TZMA 4DTKA 3RWPA 4U41A 4I4EA 5JGDA 3O51A 3QWKA 3MB6A 2HW6A 2QOQA 2VO3A 4K2RA 5BPYA 3GNIB 4TWCA 4MF1A 5GZ9A 3PWDA 4BCHA 2F7EE 4EWQA 4XNEA 3UQFA 3SOAA 2E9NA 2JKMA 4BCPA 3HL7A 4GU9A 4OTIA 4F70A 4R78A 4F4PA 4GMYA 3OG7A 4JL9A 2E9UA 3GENA 2UW6A 4ACGA 4B6LA 3QLFA 4TT7A 4NJ3A 3V3VA 4D2RA 5I4NA 4C02A 4DGLC 3LQ5A 3I4BA 2V55A 3GC0A 5A4QA 1ZY5A 3OWLA 1H1QA 3OCBA 3ACKA 4FIFA 4EQCA 1Q41A 5JFSA 3MBLA 2PMNX 2XNEA 5M08A 3I0QA 3DK3A 3EN6A 4FV0A 5AP1A 1OL7A 4IZ7A 5E8TA 4QMQA 5DA3A 2JIVA 4BTFA 3A2CA 3KY2A 4XOZA 1REJA 1SM2A 3CPBA 2W1GA 4W4VA 4GV1A 1OL6A 2ZB0A 1P5EA 1R0PA 3DB8A 4CT2A 2R0IA 2WELA 2VTIA 5E92A 3H3CA 1OKWA 1YDSE 2PWLA 5I0BA 3VVHA 1S9IA 1OVEA 4H36A 5JK3A 2C6KA 3CP9A 3KU2A 5A4CA 3P08A 4D4SA 4NW5A 3GQIA 4TYJA 3P86A 4L52A 3EQBA 4GFOA 5EYDA 2XS0A 4TN6A 4BIBA 4Q5EA 4E4MA 2YDKA 3PXYA 2PU8A 3LHJA 4F9BA 4D0XA 4BTJA 4FTNA 4WUAA 4W4XA 3DB6A 3OC1A 4L67A 3QZGA 2EB2A 2R3HA 2VAGA 1ZLTA 3LFBA 3N4TA 4E4XA 2P2HA 4JQ7A 4LV8A 3REPA 2C69A 3F3TA 4ANOA 3ZXTA 2C6OA 2YN8A 1YHVA 4F7SA 1ZZLA 3ELJA 2IZSA 2YIWA 3HMIA 4QMOA 4HNFA 4EH9A 4EOJA 3QTSA 4EH8A 1PRYA 3FLYA 1WVWA 1WBSA 2VWUA 1G5SA 1KE9A 2VTSA 3GP0A 4BF2A 4G3EA 2YISA 3RK5A 4CFXA 4E5WA 2YLFA 4OTRA 5LOHA 1FVVA 3COHA 3DY7A 3SG9A 2X9EA 3ZSHA 3KK8A 4E20A 2YDIA 3UIMA 4QQTA 2CMWA 3QWJA 3R7OA 1KOBA 2Y9QA 2CNQA 4BTMA 3WYXA 4YGAA 4WNPA 2PVRA 2WO6A 4P90A 4RJ8A 3TCPA 4IEBA 1LEZA 3QQKA 3FPQA 4BCOA 2WD1A 4QRCA 5ANOA 1KE6A 2VUWA 4I6FA 3R9NA 4JQEA 4PDYA 3IW8A 3LCSA 2VWWA 2BZKB 4AUAA 5BX0A 1J7UA 5A14A 3LFFA 2OI4X 1PKDA 3HDNA 3OXIA 5FXSA 3CE3A 4GRBA 3VHKA 2JIIA 3LFSA 1U5RA 2FSMX 5B7VA 4D2SA 5JQ8A 2BZHB 1R39A 3RNYA 4CMOA 4D1XA 1CMKE 3A60A 4G3DA 4XP0A 1ERKA 3RBWA 3TZ9A 3DKFA 3RAIA 2DS1A 4RGJA 4BCIA 3C50A 4O0SA 1UWJA 4D9UA 2XRWA 1PXJA 3OOGA 5DGZA 4PL5A 3NMUF 5GIOE 2X2KA 3WARA 4MAOA 4K0YA 5IDNA 3CKXA 2C6EA 3HNGA 2O0UA 2I0HA 3FLZA 3OUNB 3UQCA 5HI2A 3TEIA 4IB5A 2J50A 4EJ7A 5CAPA 2BR1A 4IB1A 3QBNA 2CHLA 4BYJA 4HVHA 2ERZE 4WNOA 4FE2A 3RJCA 3EMGA 3ORLA 3PXFA 5L2SA 4JR7A 2OW3A 3L9NA 3LPBA 1YRPA 2EWAA 3PY0A 3QTIA 4JG8A 2QOOA 3LXPA 4W9XA 3WOWA 1KE5A 1Q8WA 3FBVA 3ZS5A 2UUEA 4NTTA 2W1HA 4X3FC 4ASZA 3QRUA 4BY9E 4EH7A 3VS4A 4HJOA 4M8TA 4CNHA 3R02A 4AF3A 5TKDA 3FZTA 3DNDA 5CU6A 1IEPA 1M2PA 1WBTA 2PZPA 3LFQA 3AD6A 4FNWA 1PXLA 4IAIA 3RGFA 2OK1A 1JQHA 5HIEA 4UXLA 2RFNA 3LCTA 2XEYA 4FSZA 2PZIA 5K5NA 5HVJA 5ITAA 2X4FA 1URCA 3GU5A 4FKIA 4RZWA 5E1EA 4DCEA 4EZ3A 2WMQA 3BEGA 1JNKA 2C6LA 3RPOA 4BR3A 2W99B 2JDTA 2P3GX 3K54A 5FEQA 3BWFA 3CS9A 1GZKA 2ONLA 4FKUA 4HVDA 4WD5A 4UMPA 3G9NA 5CY3A 3ZM9A 4JG6A 3PSBA 4DBNA 4Y8DA 4RG0A 1PMEA 5FEDA 3NZ0A 4APCA 2R3GA 4EH5A 3G5DA 4U43A 2V62A 5HCZA 4D28A 4FTUA 4EOKA 3M11A 2V0DA 4L44A 4UV0A 1GAGA 3FC1X 3P5KA 5AR3A 3O2MA 5H2UA 4XEYA 3RPSA 3HV3A 3V8TA 4BVUA 4O7VA 1V0BA 4FI1A 4DH7A 5EFQA 3AGMA 1KSWA 3BYOA 5CF8A 5ICPA 3UYTA 3B8RA 3R8VA 4Q2AA 3LFDA 3R21A 4OBQA 4C62A 5KMOA 2ZV2A 2C5XA 1PYEA 4CFUA 3UZRA 5HLWA 4WA9A 4F7NA 4WNKA 4KIOA 3EWHA 4J97A 2GTMA 3O8TA 5AWMA 3VS7A 4B8LA 3MIYA 4ANMA 1IG1A 4FTQA 3FMLA 4PDSA 4FIHA 4F1TA 2J0KA 4F1MA 2VTMA 4B9DA 4QPMA 2H34A 3OWKA 4FR4A 3O7LD 5B0XA 3KC3A 5HICA 4DINA 4EKLA 4RJ5A 4CRSA 3OD6X 3R30A 3UO6A 4C3PA 2JITA 3H9RA 2ZJWA 3KGAA 1F5QA 5AX9A 2QKWB 3SD0A 3BX5A 1OUYA 4EORA 4O7YA 4X2NA 5M57A 5CEIA 3EQFA 4APPA 3EQCA 1QPEA 2DUVA 2GNJA 3O71A 4ZZMA 3UP7A 4C8BA 5B2MA 3ET7A 2BAJA 3G6GA 4S33A 5E8ZA 2CNVA 4DFUA 4OAUC 4BWXA 3FYKX 3KN5A 1YOLA 2ITNA 1Z57A 4J96A 5JH6A 3DZOA 3LW0A 1GZNA 2VD5A 3MYGA 3R9HA 5HGIA 5IMEA 3PIXA 1W7HA 2GNFA 4GSBA 3SQQA 5JZJA 2Z2WA 3FLWA 1W8CA 3MY0A 4O7WA 3QL8A 4E1ZA 4FKTA 4CTBA 4FIJA 4FG9A 3ZCLA 4FKJA 4ZTHA 2VGPA 3ODYX 4XJ0A 4CFMA 3LAUA 4DEDA 2G2IA 2EVAA 3HEGA 3RPRA 1YKRA 3AT3A 4QP7A 5CNNA 4Z16A 5H9BA 4WBOA 3AC8A 5HTBA 3R00A 1R1WA 5IQIA 2WPAA 4IX5A 3V5PA 4XLIA 4Y5HA 2XCHA 3DNEA 2YACA 2R7IA 3PJ1A 4NH1A 4F99A 3U51A 3UODA 4E7WA 3UQGA 1PMUA 3NNWA 2XK9A 3R8UA 5DRDA 1FPUA 5E8YA 3PXZA 3DT1A 3OZ6A 3BHVA 1HCKA 3C1XA 5CAVA 1Y6AA 4XG7A 5M56A 2OBJA 4Z3VA 2CKOA 2GU8A 3IW4A 5AA8A 4C4IA 3Q4TA 3QQLA 4GJ2A 3GU6A 3OP5A 1SVHA 1W0XC 3JS2A 3B2WA 3E87A 3EFWA 2WTKC 4BCNA 2V7OA 2BAKA 3IG7A 5C01A 3Q6UA 3ZRKA 5ETFA 3MVHA 1Q97A 3W1FA 4LMUA 4BDKA 1BI8A 3UJGA 2ZM1A 4TTHB 3VS1A 2F4JA 3K5VA 3Q4ZA 3PRFA 4XG9A 4YJOA 4EBVA 2QU5A 4RIOA 5L8LA 3TUCA 3QRIA 3OCGA 2X2LA 3PIZA 4O84A 3VJNA 4EBWA 3DJ7A 2J2IB 2BIYA 2R4BA 5LMKC 2BRGA 1UKHA 3FZRA 3F2AA 1HOWA 4QTBA 4FEWA 5IMXA 3CCNA 1G8SA 4G34A 3T3VA 2Q0BA 3VBXA 1NVQA 4FTMA 4GVAA 2HIWA 3E7OA 4XG2A 3MY1A 3QCSA 2GHLA 2HWPA 1H0WA 4QD6A 3I7BA 4FL2A 4BDDA 3OT3A 4U44A 5J87A 2C0IA 5I9YA 4TWOA 2PL0A 1ZMVA 4DH3A 4CG9A 4AZEA 4II5A 4YSMA 4FTLA 1DAYA 5IISA 1YVJA 2J0LA 4JR3A 4M66A 5BMSA 5FGKA 5TF9A 2GQRA 2F7XE 3R73A 4JBVA 3LJ0A 4O6LA 3SHEA 3UPXA 1F0QA 1VR2A 5IQEA 4L45A 2X1NA 2X6DA 1CKIA 4L00A 2H8HA 2PMLX 5AR4A 5KMMA 2W5AA 4JDKA 3UOHA 5CEQA 4FVPA 3I7CA 4U5JA 3BV2A 4IWOA 3DOGA 2HOGA 5DRBA 4YTIA 4YLKA 3A4PA 1OIUA 3TNPC 4F1OA 1OIYA 4FKGA 4A9UA 2OJIA 3HV5A 3WF9A 3U6IA 4HYUA 3TZ8A 1FGIA 4K33A 2XA4A 2WOUA 2QOCA 3KXMA 3PZEA 4LRJA 3UTOA 4AT5A 4QTEA 4MVFA 2CLXA 3R2YA 2W17A 4OGRA 4H3QA 3PIYA 4KKHA 4ASEA 3RKBA 3L8XA 4EC8A 5JRQA 5E9EA 3NVKI 1ZXEA 5AR2A 4D2TA 5BUJA 4FSNA 1V0PA 3KCKA 3LXNA 3JUHA 4V05A 3KCFA 4FX3A 2F2UA 5AJQA 2C47A 3WZJA 4X2KA 4AOJA 3BU5A 4R3RA 4MXZA 5EM8A 4YTCA 2AC3A 4FL1A 4HPTE 4BGGA 5ANJA 1PW2A 3I5NA 3L8SA 4RJ6A 3FI4A 4N57A 3NW7A 1BYGA 4BC6A 2QODA 2Q83A 2XVDA 3R1YA 5GZ8A 4IX6A 2FSOX 2W1EA 2B9FA 2R3NA 4IZYA 2XK7A 4X3FB 3I6WA 3NAXA 2W7XA 5EI6A 3QTRA 4LM5A 4M0YA 4MH7A 2YM7A 3CGFA 3PXRA 3WZKA 5J5TA 1ZYSA 2WEIA 5IF1A 4BDFA 3ZYAA 3K5UA 2PULA 4NEUA 5IEYA 3LLTA 4H3BA 1KV1A 5AUWA 3TNWA 3Q2JA 1GIJA 4RC2A 2CDZA 2GNGA 2YM5A 2VTLA 3R2BA 3MESA 4BGQA 3UC3A 4RVMA 5GJFA 4F9WA 2QG5A 3RHKA 4Y95A 4C37A 3VF9A 4YTFA 2BAQA 5BVOA 4DEAA 3MA6A 3DDQA 3QTQA 4BFMA 4YHJA 2XIZA 1M17A 3DBDA 4JX3A 5AP2A 1BLXA 4QMSA 4JDJA 3FXXA 4UY9A 2UZVA 4F09A 4I20A 4HVSA 3ROCA 4C4EA 5HEZA 3CGOA 4MF0A 4NM0A 1OKZA 1JWHA 5CT0A 3DDPA 2XJ1A 4H58A 2VNYA 5FEEA 4F6WA 5EDPA 2YFXA 3M42A 5LMAA 2Z7QA 2QHMA 3DAEA 4L01A 4K8AA 3KN6A 4KS7A 4UB7A 5KMKA 2I0VA 2P33A 2O3PA 3PVBA 2QI8A 2XKEA 5CANA 4NKAA 4C34A 4JIAA 4NT4A 4AZFA 1V1KA 4FKOA 1J3HA 5ACKA 4J8NA 3TV7A 5DE2A 1FBNA 4UWYA 3IS5A 4B7TA 4ZZOA 4S31A 2WHBA 1NY3A 3FI3A 5FLFA 3LM0A 3LMIA 3RMFA 3ZZWA 3PVUA 4EI4A 4PUZA 4G17A 2IZRA 4IADA 3DXQA 4X2FA 4NM7A 1ZZ2A 3CD3A 5HESA 3P7BA 4D2WA 3FL5A 4GFGA 4QMPA 4XG8A 4G3CA 3DAKA 4A07A 1H8FA 3F82A 3O96A 4EJNA 3EZRA 4GK2A 3BZ3A 5AP4A 2OJFE 1PMNA 3DKOA 2CGXA 4KWPA 5D12A 3B8QA 3MPAA 3BV3A 5EW9A 4X3FA 5I9UA 5D7AA 1IAJA 3S4QA 4EHGA 4Y46A 2CLQA 5AP7A 5ANDA 3V51A 1M7NA 4O0UA 5F1ZA 3ORNA 4TPTA 1REKA 4BL1A 5M4IA 4B4LA 1H07A 3GBZA 4L8MA 4BKZA 4GYIA 5CNOA 4C57A 2XJ0A 4KBCA 3HKOA 4A9YA 4EOOA 2XBAA 3GGFA 5DT3A 4DBXA 3MTFA 2WKMA 4FF8A 3RZBA 1LR4A 2YZAA 3H9OA 3LOKA 3W18A 4P5ZA 2BROA 2UV2A 3SOCA 4ANBA 2BKKA 1U54B 2X4ZA 3KRXA 4MEDA 4DYMA 1PXOA 3DLZA 3ID6C 2ITUA 5FTGA 1Q8UA 4O1OA 4S32A 5IQBA 3K3IA 4RJ7A 3R71A 4LOQA 4EL9A 4QYYA 5TOZA 2QOFA 5EYMA 3VS6A 3PSCA 1Y6BA 4YJPA 1NXKA 3LIJA 5HTIA 5IEVA 1FGKA 2XUUA 4N70A 3OXTA 3GOKA 3VS0A 5H8EA 4EZ5A 4FYNA 2WQBA 2QU6A 3PZHA 3FY0A 5EI8A 3FSKA 4JIKA 1ZOGA 4AN3A 1E1VA 4EOLA 3V6RA 2CGWA 2XNOA 5BYZA 2CKPA 4MD9E 4XP3A 2UW7A 2WTKB 4IHPA 2XH5A 2WU7A 2PVLA 3CJGA 3O17A 3P7AA 3ZLSA 3D0EA 2PUPA 3FYJX 4FC0A 2AUHA 3PPJA 3KB7A 3PE2A 3LFCA 5IA1A 3EYGA 3TZ7A 4PPAA 4BDCA 3NSZA 4O2PA 5C26A 2RFEA 5HO6A 4NTSA 4NSTA 5AM6A 4ANSA 4I3ZA 1OGUA 3DFCB 3KULB 3PFQA 5L2WA 2HK5A 2FYSA 3LXLA 1OECA 2HW7A 4CYIA 5CXZA 5CASA 4Y73A 4ALVA 4D4VA 4DG3E 5HD7A 4M7IA 4RA5A 4NYEA 3QRTA 2XK6A 4IB0A 4XH6A 4IE9A 2EUFB 3RAKA 2BRNA 4D55A 3FZSA 4RIYB 4FEVA 5EQPA 2REIA 4TY1A 4JXFA 5GJDA 4F0IA 4B8MA 2HYYA 4I0TA 3MJ1A 4PP9A 2C68A 5CU4A 1GIHA 1JKTA 3LMGA 3BEAA 2PZYA 4AG8A 3TDVA 3S95A 4G9RA 5M55A 2PVFA 4X21A 3HMNA 3QKKA 4CCUA 1FMOE 3C9WA 3RTPA 5T68A 2W5BA 4I23A 2UVYA 5HE1A 2OFVA 2XIXA 3QTXA 5C03A 2EXMA 1H0VA 4D2VA 4YC3A 3RAWA 2X0GA 4IVDA 5D7VA 2HCKA 4KIPA 4FT5A 4AT4A 4C2VA 1Q5KA 4AGUA 5HD4A 2R3RA 4DHFA 4HW7A 5DFPA 2WQOA 3D5UA 2RL5A 2JAVA 4P4CA 3FMJA 3Q9YA 4H1JA 2NPQA 3LE6A 4YJQA 4BCJA 1I09A 5EKOA 2W4KA 4TNBA 5IG1A 3JY9A 1GZ8A 2Y8OA 2FB8A 2OWBA 3F9NA 4QTCA 3W2SA 4X0MA 4DGMA 4AW1A 5LWNA 3QALE 3D15A 4FKRA 5DOSA 1H1RA 3EJ1A 1E1XA 3TNHA 3VBYA 4D1ZA 5I9WA 1KV2A 1WBVA 5FBNC 4BDIA 3O7LB 3IOPA 4GL9A 2GHGA 2OXXA 1OKYA 3QA8A 4UMUA 2OU7A 1LUFA 3NCGA 4NZWB 4XV1A 1JOWB 2C3LA 3PA3A 5I5ZA 3ZOSA 3VBVA 4U45A 3SW4A 3IPHA 3PP0A 1WVYA 5AAFA 4ZAUA 3LXKA 3E8EA 2HY0A 3OUKA 5AP3A 1PXKA 2UW3A 4FKLA 4HYHA 2J7TA 4B0GA 4O2ZA 3EL8A 4XCUA 4ZLYA 3OCSA 2ZAZA 3KULA 2IJMA 4U3ZA 4AZSA 1AGWA 4QMMA 3CD8A 4BBMA 1JVPP 2PK9A 2G2HA 2UZUE 1VYWA 3T9IA 4PL4A 4AN9A 2A1AB 4IBMA 3TI1A 3A7IA 4W4WA 5EW3A 2W1ZA 1APME 2YCQA 3NX8A 3KXHA 4IAAA 4W9WA 3R7UA 4RIYA 4FSWA 4O22A 2O63A 4I0SA 1XBBA 2GTNA 3FMDA 1FVTA 4DC2A 5EK7A 5CU2A 3WE4A 1Y8YA 4FT7A 4WOVA 3DKCA 5E8XA 5KE0A 3QXPA 2IVUA 5CVGA 3Q96A 5H8BA 2QVSE 4JOAA 2XYUA 2QNJA 3C7QA 5HIDA 4I5HA 5BVWA 5B2LA 1WMKA 3SGCA 5KZIA 3C0GA 3FXWA 3KA0A 3F7ZA 4RX5A 3S2PA 4WSYA 4LRMA 4TYHB 3FI8A 2F57A 4R3PA 2VTHA 5CSHA 3I81A 5AM7A 4CTCA 4E4NA 2UW9A 2XCKA 5LJJA 1AD5A 1OL1A 5BVKA 4AN2A 1WBWA 4XRJA 1WZYA 3EYHA 1ZMUA 4MCVA 4KSPA 4EYJA 4DGGA 4W4YA 5HVKA 1Q4LA 2LAVA 3GI3A 4FNYA 4IM3A 4JRNA 5C27A 3U6JA 4OAVB 4GUEA 4YZ9A 1JSVA 3POOA 4GIIA 5K0KA 3D7ZA 3VS2A 4QMXA 5TE0A 2GFSA 2Y4PA 3N4VA 3W32A 3CY3A 3ZFMA 2J5EA 2XM9A 2CSNA 3HV7A 2JKOA 4FT3A 4MXYA 1UU9A 4K11A 4TWNA 4C36A 4FOCA 3GU4A 3GCPA 4MWHA 4HCVA 4NCTC 2YCRA 4TXCA 5CYIA 4ZXTA 4ARKA 3ULZA 3HA8A 4D1SA 4RBLA 2X8EA 2W0JA 5DN3A 3A7JA 4CVAA 5EI2A 4DFXE 3QX4A 3R1QA 1GY3A 3QF9A 4USDA 4FA2A 2PVMA 5BVNA 4J1RA 5I9XA 2UZEA 4R6VA 3NIEA 4DH1A 5F9EA 5LVMA 5DBXA 3CKWA 3NR9A 3MA3A 1NT2A 1OITA 3Q04A 3KRWA 3DK7A 3MJ2A 4RVLA 1YOJA 4JJRA 1ZYDA 4YJUA 3R7GA 2QO2A 4WBBB 4YZCA 4BICA 4LUDA 4QMTA 3PLAE 4F65A 4EK6A 3EB0A 3TKUA 4QMWA 4IAYA 4O7LA 4IDTA 5LMBA 5C9CA 4G3GA 4ACHA 3ZBXA 4ZS0A 4AOIA 4AE6A 4PNKA 4GK3A 1XKKA 5HZNA 3R7YA 1YI4A 2R2PA 5L2TA 4A4XA 2RF9A 2Z60A 4ZJJA 3WE8A 3MFRA 3FHRA 1UWHA 4TYHA 5CSVA 4TNDA 4ZK5A 3UPZA 4KSQA 5A9UA 3C13A 3EQPA 3UZPA 2XEZA 3FLQA 3RCJA 5KX8A 4IW0A 3E88A 3N51A 4U81A 3FMMA 2JDOA 2BDJA 1H25A 5BVEA 2EXCX 3JVSA 4CT1A 2ZVAA 1ZRZA 3BI6A 3VBQA 3BHYA 4PMMA 2VTPA 2FVDA 3PUPA 4H39A 5JKGA 3EH9A 2J90A 4MBJA 1PYXA 3W8QA 3V5LA 5HO8A 4LGGA 3WI6A 3AQVA 4AX8A 3C4XA 3UIUA 1YI3A 5KKRC 1JSTA 4FV6A 5DH3A 1B38A 5AR7A 3MH1A 4QOXA 3AC5A 5JFXA 3Q9ZA 3BU3A 5JT2A 4DH8A 4AACA 3ZSIA 1P4FA 4IFGA 1SVGA 2PVNA 5EKNA 1O6KA 2GFCA 2PZ5A 3COIA 4BN1A 4YURA 1MRYA 2ITWA 4F7LA 4ZLOA 4O83A 2YAKA 1JKLA 3IK3A 4J7BA 4LFIA 3UG1A 1BL7A 2J0MB 3LJ2A 4IJPA 4Z7GA 3HDMA 1J91A 3DV3A 5HE2A 5CEKA 4OTHA 4DFZE 5CZHA 3QU0A 4J98A 4MWIA 2R3OA 3BLHA 3NUNA 2IW8A 3COMA 5C8MA 3EN4A 3BIZA 4MQ1A 2QURA 2PE1A 4WRSA 5HVYA 3RPYA 3ULIA 3ZO4A 1URWA 1W82A 4DH5A 2VWYA 3G90X 3MB7A 3PE1A 5EOBA 3Q32A 3C0IA 4E3CA 4ERWA 5DG5A 5K9IA 2XK8A 2V5QA 2ZV9A 4PV0A 3OW3A 3PJCA 3RINA 2X8DA 3NUSA 5EHYA 4BDJA 5EDRA 3WYYA 3MVLA 2W4OA 4GIHA 4NWMA 4QNYA 3FI2A 5HKMA 3VUKA 4NFNA 4FEQA 4NKSA 2VO0A 5AUYA 4QNAA 1PXIA 4ZTLA 2WTJA 5C8KA 2YHVA 5DI1A 3RALA 5HG7A 3C51A 1YDRE 4LYNA 3ZLWA 1CKJA 4I6HA 4I6BA 1ZY4A 4C7TA 4CKIA 2PUNA 3TM0A 2BHEA 2WMTA 2WTVA 5AR5A 4V01A 5K4JA 4K18A 4O7ZA 4M13A 3QZIA 3GB2A 5EH0A 2YWVA 3HV6A 4J99A 5HOAA 3ZO2A 3FE3A 2RFDA 4GUBA 2VO6A 2X7OA 4FKWA 4HGEA 3SAYA 4DITA 4BDHA 4NK9A 3KXXA 2OZOA 2WMUA 3HRCA 4ZP5A 3L1SA 4O81A 4F0FA 5DT0A 5AADA 4DEBA 2WMAA 4BCFA 1TQMA 3OHTA 3VUDA 3Q4UA 4CMTA 1F3MC 2I0YA 2ZOQA 3R6XA 4PX6A 3KREA 3EIDA 5HCYA 3MV5A 4OTPA 5IQHA 3F5XA 3UOLA 4RIWB 4YPDA 1P2AA 3FHIA 2PVHA 3LCOA
chains in the Genus database with same CATH superfamily
2UW0A 3ERKA 3SC1A 3IW7A 3WF6A 2ZMDA 1YOMA 2FO0A 4CLJA 4UBAA 2BZIB 4QP4A 1ND4A 2Y6OA 2C3JA 3FUPA 5M4FA 3EN7A 3BQRA 4LL5A 5HE3A 3W0MA 4AA4A 4JBQA 3G2FA 2B9JA 2YCSA 5CZIA 3OEFX 3A8XA 1Q8TA 3G9LX 3OROA 5A6NA 5HBJA 3U6HA 3NWWA 2HZ4A 4P2KA 4CKJA 3U4UA 5J9YA 3BHHA 3E8CA 4FG7A 4FV4A 4KRDA 1Q3WA 1HCLA 3RWQA 3R83A 1P4OA 4RFZA 2EB3A 5JQ5A 3ZRLA 2B1PA 3FJQE 4XUFA 2ZV8A 3QZHA 3U87A 4RQVA 4F9CA 5D10A 1M2RA 4ZY4A 5FP5A 4FKSA 4IVCA 3CJFA 3UE4A 4MBLA 1YDTE 3C4ZA 1A48A 4HPUE 2R3KA 4I24A 3NYXA 4BI2A 3MFSA 4A7CA 3BU6A 3SX9A 4QP1A 4C59A 3ACJA 2ACXA 1BL6A 4XHKB 3MPMA 2NRUA 1OZ1A 2JBOA 4ERKA 3IDPA 2VWZA 4QYFA 1Q61A 3HX4A 2C5VA 4HNIA 2XJ2A 4YTHA 4JT3A 3PXQA 4EUUA 4YJNA 2P4IA 4EH4A 4BHNA 2YM6A 4USEA 2XNNA 4MYGA 4Y5QA 3ZO1A 1PXMA 4FMQA 4R1YA 4GG7A 4FTTA 1BUHA 2A2AA 3WZDA 4CSVA 2CKQA 4ITJA 3QTUA 1O6YA 1XHAA 2XM8A 3CC6A 1NVRA 1OB3A 2BKZA 5HCXA 3RK7A 3RNIA 2IWIA 3AC2A 4RIWA 3VC4A 3NPCA 4FZDB 5EQEA 4A4OA 4DGNA 3TV4A 3W33A 4IQ6A 4A9RA 4BDBA 4BZNA 3GCSA 1H24A 4QYEA 4UZHA 3NNUA 2C4GA 4J71A 2HENA 3QQJA 4XLVA 3D5WA 4LQMA 5KMJA 1WCCA 5I9ZA 4K6ZA 3KVWA 5CS6A 4JRVA 5LVNA 4R77A 4ZSEA 3TN8A 3ZUUA 2F2CB 2QQ7A 2VX0A 4G31A 5IA0A 1YXTA 3TUDA 4PRJA 5J9LA 3U8WA 2AC5A 3DBQA 3QUEA 4RMZA 5HU9A 3AC4A 3S00A 1ST0A 4JQ8A 4BCKA 3ORMA 4YO6A 4I4FA 3BYSA 4GH2A 4ENYA 2ZYBA 2CGVA 4XBUA 2FGIA 4RWIA 3Q5ZA 4XOYA 3SXRA 3HYHA 2HZNA 4G6NA 2G2FA 1M2QA 2JD5A 3NW6A 4M84A 3W16A 4AT3A 4CLIA 3PDTA 5G1XA 4WT6A 4WO5A 3KXZA 3W2CA 3UDZA 4FODA 4DT9A 2QONA 3K2LA 4ALWA 2XP2A 3BLRA 5FM3A 2XARA 1Q8YA 3L8VA 4FK6A 1JPAA 2XKDA 4QQ5A 4WHZA 2ITTA 4AW5A 1OL2A 4WG4A 3W2OA 4O0TA 2UZDA 4KS8A 1S9JA 4M69B 5DLSA 2WQEA 4JBPA 4PY1A 2VTNA 3FKLA 3U9NA 3ZUTA 4KNBA 5CF4A 2F49A 5IA3A 4DDGA 3L9MA 2R3IA 2PTKA 5DMZA 3D9VA 2IZTA 3FAAA 3QA0A 4A4LA 5CI7A 4DGOA 4ZY5A 3HUBA 1H01A 3HMMA 4UWCA 4F6SA 4BCGA 4DEGA 2Z02A 1OM1A 1J7LA 4PP7A 2UZTA 3BHTA 4QQCA 5DYJA 4YZDA 4ID7A 4O7SA 3NLBA 4ITHA 4DAWA 1PJKA 4N4SA 2Y0AA 4RIXB 2PUIA 2W96B 4F6UA 4U3YA 5AV0A 5HLPA 3UVQA 2ZMCA 5EQYA 4NUSA 4UX9A 3PG3A 4O91A 1RJBA 1SVEA 4NCTA 1KUTA 4BIEA 2QLQA 4P7EA 4F9YA 3ZC5A 4WSQA 3O8PA 3DLSA 4GU6A 3SKCA 3QYZA 4CFWA 2J0JA 4CZUA 2VV9A 2PUUA 3NRMA 3W8LA 4D58A 5L6OA 3UNKA 1IAHA 2GQGA 4BDEA 2YM3A 3KL8A 4KAOA 3II5A 3OMVA 4FUXA 5D9HA 4JMQA 2C3KA 2C30A 4IJ9A 3PFYA 4L7FA 1JAMA 4BCMA 1BI7A 4K9YA 5KZ0A 3NUUA 4R5SA 3IW6A 4Y83A 3R7IA 3ZFXA 2O2UA 2W9ZB 3NNXA 2OG8A 3PTGA 3UVPA 3ZXZA 4L68A 4E73A 1ST4A 2R9SA 3ORZA 2JBPA 4C4GA 2X81A 4X6RA 3FDNA 2ITYA 4ZSGA 5HG9A 3FQSA 4IVBA 3L9PA 4NFMA 4QDVA 1Q3DA 3R7VA 3COKA 4FV1A 4XYFA 5DR9A 3IW5A 2R3JA 2FSTX 1UNLA 2JLDA 4GEOA 4PDPA 5FWKK 5KBRA 5C4LA 2YERA 1QL6A 4I22A 3GCQA 4O0XA 4YZNA 3GC8A 4BBEA 3BE2A 3FMHA 3BBWA 3VAPA 3KMMA 5C8NA 4IXPA 2H9VA 5AV2A 4WKQA 3QD3A 5ETIA 2O8YA 2X39A 2J6MA 4G9CA 4J52A 4E5AX 3UO4A 2GNIA 3D94A 4M67A 3ORXA 1PF8A 2OJGA 4FIGA 4CMUA 3WIGA 2Y6MA 3F7WA 5IUGA 3DJ6A 4FZ7A 2VWVA 3QCYA 5BYLA 5FXRA 3EZVA 3TNIA 4R8QA 3H4JA 4WUNA 3RVGA 1GJOA 1GNGA 2VU3A 2JKKA 5DHJA 5CVFA 4GYGA 3WZUA 4DA5A 2CN8A 3F61A 5EM7A 5E8VA 4DE4A 1RE8A 3F6XA 4FGRA 1B6CB 3HAMA 4MTAA 4U42A 2E9VA 5CAOA 1TKIA 4EOIA 4WG5A 4IMYA 2HY81 4RQKA 2UZWE 4IC7A 1DS5A 3QHRA 3R9DA 3QUDA 1R3CA 3KVXA 2O5KA 2Y7JA 4ZTNA 5F94A 3ZEPA 4OTDA 4AGCA 3UDBA 2VTRA 3P0MA 1OL5A 2VNWA 3JY0A 4O1PA 3TTJA 4DEIA 4LDTA 4ACDA 2BRHA 3GOPA 4L3JA 3TJDA 4BIDA 4PMPA 3V5JA 1OIRA 2W05A 1Z9XA 5G6VA 2W9FB 3V6SA 4C38A 5KUPA 3MH0A 3IOKA 3TL8A 4HGTA 2ZDUA 4FL3A 5HX8A 5KBQA 5L8KA 5KHWA 5GINE 2YA9A 3N9XA 2X2MA 3CTQA 4BWKA 2Y4IC 3F5GA 4O38A 5FTQA 5CF6A 1OBGA 3PJ3A 2OGVA 5M44A 1UKIA 2YJSA 3VWAA 4OBOA 3MY5A 3DJ5A 3KQ7A 5HE0A 5T3QA 3NDMA 5EYKA 4O27B 1M14A 3VF8A 4AU8A 3UNZA 4H1MA 2V7AA 5AIKA 3CR0A 5EDQA 5AA9A 2PSQA 2GS7A 3I5ZA 5I3RA 3EQRA 4PTGA 5HIBA 4CRLA 4BKJA 4FTRA 3R8PA 5HLNA 5IQGA 3LM5A 2ESMA 4QP3A 4MX9A 1ZOEA 5FBOA 4U80A 4U79A 4IWPA 3EQGA 2ZV7A 3EQDA 1JLUE 4G2FA 3VUTA 2JDVA 3MFUA 4L53A 4YC8A 4IIRA 4YUQA 2QCSA 5JGAA 3FQEA 2OLCA 5CXHA 2ITQA 2YM4A 3FZPA 3TWJA 3QX2A 2PYWA 3GT8A 5BVFA 5FUTA 3K3JA 2OF4A 3L9LA 3PVWA 4Z55A 3A62A 3KKVA 4EOSA 2HELA 1WFCA 4QMNA 2C1AA 3OBJA 5K4IA 4EHZA 1VYZA 4FKVA 4HVGA 1OPJA 2R7BA 3FWQA 3MPTA 2RFSA 3E8NA 4X7QA 5B2KA 1LPUA 2ETRA 5L6WL 5HO7A 3NGAA 3QRKA 2NP8A 2P0CA 1GIIA 3IGOA 4AFEA 4BTKA 4FVQA 2IG7A 4I6QA 4UMTA 3E62A 4C61A 4DG2E 2ONLC 2BIKB 1YQJA 4LOPA 4G5PA 3MW1A 4ZMEA 2ZDTA 3DK6A 2F7ZE 2P55A 1FOTA 3NYVA 4CFVA 5M4UA 4D5KA 1QCFA 3V8WA 4FSQA 3QGYA 4I5CA 3R8ZA 3F88A 2VO7A 3PP1A 1TQIA 4AA0A 5IU2A 4TZRA 5AUUA 4GKHA 2XZSA 4F9AA 5ANEA 1U5QA 2BFYA 5CWZA 3UNJA 2GQSA 3G33A 5ACBC 4BHZA 3PY1A 2DYLA 4LV7A 4CFFA 4KBAA 3V04A 3D2IA 4D0WA 4XV3A 4XRLA 3G0FA 3F69A 3CQWA 3V5QA 2YEXA 3EFKA 3F2RA 1ATPE 4DT8A 4BKYA 4GKIA 1WVXA 2YAAA 4CXAA 5CEPA 3JVRA 2PMOX 3BGQA 1CSNA 4FVRA 3UBDA 5J1WA 3NUYA 2XKCA 1QPCA 1LP4A 2GMXA 4RT7A 1Q24A 2UVXA 4U7ZA 5LVOA 4GJ3A 1Q99A 1PHKA 4JX7A 4XX9A 3TIZA 1ZARA 2JDRA 5A54A 1ZMWA 5IDPA 4BZDA 1U54A 1H4LA 2G9XA 2VWBA 5M53A 2GPHA 4PNIA 4O7TA 2BHHA 2ITVA 4FJVA 3VIDA 2BZJA 4AOTA 3JYAA 4LMNA 1UV5A 4E6CA 3VBTA 4UEUA 5KMIA 3PUFC 3BRBA 3DBCA 4BYIA 3BYUA 3VS5A 2BVAA 4QP2A 2IVTA 2JAMA 3CQUA 4BDGA 3HLLA 5CQWA 3C4FA 3Q53A 4PL3A 1BKXA 4TRLA 3SDJA 3EKNA 5M51A 3NS9A 5E90A 1AQ1A 2OXYA 4DTBA 5HU3A 2WIPA 2WGJA 3MH3A 3PYYA 2WQMA 3MTLA 4FZAB 4LG4A 1Q62A 4FYOA 2I0EA 5T6KA 2IVVA 3JXWA 3UOJA 3DQXA 1ZOHA 1ZYLA 4RC3A 1J1CA 4FKQA 3EN9A 3WZEA 1XWSA 2R3QA 3Q6WA 4LUEA 4OBPA 4PQNA 3TMOA 3GEQA 1Y91A 4RFMA 5J9ZA 5DWRA 3R04A 3IDCA 3LJ1A 3Q2MA 5IKWA 3VW6A 3IQ7A 2QOBA 2G01A 4YC6A 3R63A 4Q9ZA 5LMKA 4BRXA 2QO9A 3BE9A 3HRBA 1J7IA 5IQAA 3RHXA 3F2NA 3W2RA 4RLLA 1L3RE 1FMKA 1E9HA 3TYKA 2QC6A 1YHWA 2WTIA 1UNHA 2GDOA 5DR2A 1W2DA 3AMYA 3GFEA 2RG6A 1PY5A 3HUCA 3QZFA 3E63A 3PA5A 1H1SA 3QAME 5CU0A 2WIHA 5J5SA 4R3CA 3W0SA 2C6DA 4ACCA 4U8ZA 5J79A 3M2WA 3VUHA 5E8SA 5KMNA 4ORKA 3VHEA 4GFMA 3R7EA 4AQCA 3E5AA 4FSUA 3C4WA 2W4JA 3R0TA 4DLJA 4AS0A 1V0OA 3I1AA 3BWJA 3W2PA 3ZZEA 3FY2A 3QXOA 5AX3A 5K5XA 2B0QA 3D83A 2XMYA 4C2WA 4EONA 3OF0A 1W84A 3ENMA 3ZDIA 5DIAA 2XIRA 4QMYA 2BMCA 3GFWA 1VEBA 4QMZA 5BMMA 1A06A 4OW8A 1KE7A 4RLKA 3LQ8A 3EN5A 4CQGA 2YM8A 4DLIA 4YO4A 5L6PA 1SNUA 3TJCA 4X2JA 3C0HA 4NJDA 3IKAA 4EH3A 4IWQA 4CGAA 2HZIA 4IAFA 2C5NA 5BYYA 4CFNA 3EKKA 3NUXA 5BQ0A 5J7HA 5AP0A 4G3FA 1UVRA 2PZRA 3ZSGA 3AMAA 2WU6A 2YCFA 1GOLA 2J9MA 4X6QC 4CV9A 2J0IA 2R5TA 2VWIA 3VUMA 3E64A 4IH8A 4M68A 4A06A 4IACA 2ITPA 1XH9A 2UW5A 2RIOA 5L3AA 3G51A 4IM0A 2XALA 3AG9A 4D9TA 5M4CA 4J95A 3BQCA 4BZOA 4OLIA 2J5FA 1XMLA 2J51A 3PJ8A 3QTZA 4ASXA 3QLGA 4FSMA 2G15A 4AGWA 3H10A 4FTKA 2J4ZA 4O0YA 3ZUVA 1R0EA 3ALOA 4RFYA 1O9UA 4Q5HA 4M14A 3O0GA 3I60A 3MIAA 1MUOA 2JKQA 4JDIA 2Y4IB 4QYHA 5GHVA 1XO2B 3H0ZA 4FEXA 5M09A 4BI0A 4KABA 5CAUA 3R1NA 3LKMA 2WEVA 3DU8A 3ZDUA 1XJDA 4QMVA 5J7BA 3PA4A 4LGHA 3HRFA 4EK5A 5I3OA 4PWNA 4HYSA 3NYOA 4QP6A 3CSVA 1XH5A 4Z7HA 4O4FA 4AWIA 3DFAA 4YJTA 4KD1A 3OY1A 3QQHA 4PMSA 3T3UA 4R1VA 4R7HA 4HVIA 3AGLA 2BDWA 2CCIA 2BRBA 2HZ0A 3BHUA 3RZFA 3T9TA 2B52A 2BTRA 4D2PA 2PMIA 2C1BA 4RPVA 4MBIA 5IH5A 4QYGA 2PVKA 2YWPA 3LCKA 3FSFA 4C58A 3JPVA 1DM2A 3MN3A 3D5VA 2PE2A 1UU7A 2XYNA 5LVPA 3F5UA 4KKEA 2B4SB 3VQHA 3LCDA 3ZH8A 1G8JA 4XV2A 3QQGA 3DBFA 2VZ6A 5JEBA 2V22A 3H30A 2YABA 5CLPA 3TUBA 4JDHA 1CDKA 1PMVA 5CVHA 2A27A 1JKSA 3LMHA 2WMBA 1WBNA 5HNIX 5E7RA 3RK9A 4EQMA 1WBOA 3U55A 5AUVA 4HZRA 4L7SA 4QP9A 4C3RA 2OO8X 3PPKA 3QC4A 3E93A 4ZOGA 3CXWA 5F20A 1MQBA 4L46A 4DFLA 4CZTA 5E4HA 4ZEGA 4MXXA 4I94A 1CM8A 2YDJA 3HZTA 5H3QA 2C0TA 2W1DA 2VWXA 3VS3A 1IA8A 3DTCA 1U46A 2BDFA 3MH2A 4I21A 4YP8A 4ZZNA 4EK8A 3ENHA 3FKNA 3VUIA 5AV1A 4RX8A 4O86A 5CQUA 4E6QA 2YITA 4U97A 3UGCA 4YJSA 3O5AA 4I93A 2YIQA 4Q9SA 5AMNA 3Q5IA 2ZM4A 3QYWA 3EHAA 3LVPA 4MXOA 3DTWA 3N4UA 5DR6A 4O96A 3RAHA 4ASDA 2VN9A 2ITXA 3I79A 3B2TA 4KKGA 1L8TA 1IASA 5CSWA 2WB8A 2UZNA 4QQJA 2XRUA 3CTJA 4E6DA 4ONAA 3C4EA 3MFTA 4D5HA 4FEUA 3G6HA 3ZMMA 1XH8A 2HAKA 2YJRA 3PSDA 4AFJA 4EOMA 2XBJA 3VN9A 3UDSA 3VONA 2RKUA 2JIUA 2ZB1A 3OVVA 4M15A 4GCJA 2OXDA 5BV3A 2BUJA 2F9GA 5FDXA 2B55A 1MRUA 1XH7A 5FP6A 4CCBA 4V0GB 5TT7A 4I41A 3HA6A 3S1HA 4EOPA 1H26A 1MRVA 3BYVA 4YPSA 2JFLA 3IO7A 3HV4A 4IX3A 5A4LA 4MXCA 5JRSA 2XNGA 4NM3A 1IR3A 1K3AA 1X8BA 4PMTA 3VUGA 5GIPE 2JFMA 4AP7A 1BMKA 2E9PA 2WTWA 2I7QA 1YWNA 3VJOA 1DAWA 3F5PA 3P78A 3ORKA 3C5UA 4MNEB 3SXSA 1NVSA 2GNLA 4R5YA 3ZONA 3KFAA 2OIDA 2XKFA 2X6EA 4DEEA 4A9TA 3SG8A 5DVRA 3WBLA 4B99A 4OT5A 4OTQA 2CGUA 4GT5A 2XIYA 3MVJA 4QTAA 4FT9A 4OTFA 4EQUA 2C0OA 3FPMA 3TACA 1H00A 1QPDA 2WMSA 4XG3A 3WF8A 3MSSA 2PVYA 5CTPA 5FQDC 3BELA 3KRJA 3OXZA 2A19B 4RVTA 3S3IA 2QG7A 1T46A 2R3FA 3QRJA 4OT6A 3V8SA 2RSVA 2GCDA 3RCDA 4AW0A 4O82A 2PVJA 3QTWA 2I40A 2IW6A 3MWUA 3NEWA 3HMPA 3BL7A 2YIRA 2GSFA 1Y57A 2JEDA 3OWJA 5FRIA 4O6EA 3KMWA 4S34A 2XNMA 4KB8A 4HGSA 4U0IA 2VTJA 3SVVA 2QD9A 2WZJA 4NIFB 2UW8A 4QPAA 3ZBFA 4H05A 4TKSA 1TZDA 4NU1A 4RJ4A 4CYJA 4G5JA 4YSJA 4RX7A 5JFWA 1MQ4A 1YI6A 2WMVA 3BGPA 3GUBA 1UNGA 3QKMA 5HNGA 4FV3A 3IONA 4MK0A 3R9OA 1LEWA 5DEYA 3RPVA 4YBJA 3QD0A 4BB4A 4PDOA 2UZOA 4XP2A 4DEHA 5IEXA 3ORIA 2HXQA 4JLCA 3FXZA 5IA4A 3I6UA 4AXEA 4FIIA 5A46A 5C4KA 5M07A 2P2IA 3P1AA 1KE8A 3EQHA 3ROYA 4ZIMA 4RSSA 1XH4A 3ALNA 4OR5A 4UXQA 3W2QA 4ZJVA 4RWJA 3CPCA 5CEOA 1SNXA 1O6LA 4HOKA 4EHVA 3OT8A 1JSUA 2WMWA 4FG8A 3SLSA 2IO6A 3TTIA 3DQWA 4QPSA 4YMJA 4V0GA 1Q8ZA 3QCQA 1UU8A 4IC8A 5K3YA 3V01A 5M06A 3O8UA 3FV8A 1PXNA 2C6IA 2EU9A 2OJJA 3NNVA 5J95A 2KTYA 4AZTA 4NL0A 2QOHA 4I5PA 3IGGA 4ZTSA 3TV6A 3G15A 4ANNA 3KRLA 3TT0A 4FTJA 4FTIA 4U40A 5EW8A 1WAKA 5ETAA 3ORPA 1EH4A 3DAJA 3KEXA 5CI6A 3AXWA 3TKIA 1UU3A 4O0RA 4E93A 4MNEA 5J8IA 4O21A 5JFVA 3LLAA 4AW2A 4AZVA 4RWKA 4C4JA 3PWYA 3UVRA 3D5XA 4TWPA 2WTCA 5TO8A 3UIXA 5K0XA 4FV2A 5BVDA 3OEZA 4Z9LA 5HX6A 3HAVA 4XMOA 3NUAA 1KOAA 2C6TA 2XNPA 3GCUA 3ITZA 5HHWA 3TDWA 4IAKA 3A8WA 4FV8A 3QC9A 4C35A 4EZ7A 4OTWA 3TIYA 4CQEA 3RM6A 2B54A 3HMOA 2YLEA 4MKCA 3FKOA 2BILB 4FSTA 4TL0A 4AXAA 2R3LA 2E2BA 3UMXA 2LGCA 4GW8A 5EHOA 5A6OA 3ODZX 3SV0A 5CEMA 4Y72A 3F3VA 4JNWA 1OKVA 4ANQA 2PE0A 5L2QA 4C33A 4JBOA 4QP8A 3GQLA 2C3IB 3Q52A 5CENA 2VTOA 1A9UA 3CEKA 1DI9A 2BCJA 2IN6A 5HG8A 4IAZA 4NIFA 4ZJIA 4EKKA 4DFYA 3E3BX 5L8JA 2W1CA 2XF0A 3NW5A 1XR1A 4JAJA 3VNTA 3R22A 4DDIA 1CKPA 4I92A 5L4QA 3G0EA 3KXNA 4ITIA 2CCHA 3BLQA 3BCEA 3MGYA 5AV4A 3RP9A 2B7AA 5HBEA 2CN5A 3UO5A 2WFYA 4IANA 4M0ZA 1YXVA 3F3ZA 4XG4A 1ZYJA 4M12A 3V5TA 1FVRA 3DBEA 3AOXA 1U59A 3BYMA 2UW4A 4EUTA 5IQDA 2OF2A 3NAYA 5A3XA 2HXLA 5D41A 3LZBA 3A7GA 3AKLA 3PG1A 3NFGB 4EH6A 4UMQA 2Z8CA 3U54A 4DHJA 4L43A 4N6ZA 3RI1A 4RA4A 4MXAA 3OFMA 3DS6A 3ORTA 3AD4A 2QR8A 4YZMA 5HNBA 3EL7A 1OUKA 1W2CA 3WF7A 4EWHA 4S30A 2R3MA 3UP2A 4ACMA 2X7GA 4CKRA 2OFUA 2IPXA 4UWBA 5AIRA 5IQCA 3ZU7A 2OZAB 1H27A 4JS8A 1OPKA 1BX6A 5J1VA 3GC9A 2G1TA 2ETKA 4HZSA 4WRGA 3TKHA 3QGWA 4DCAA 5KKRB 4G16A 4PF4A 3Q9XA 5CSXA 3DXNA 2WAJA 3WILA 5BNJA 2W1FA 3AMBA 5DEWA 4PTCA 5KHXA 3GU7A 5IQFA 4UYAA 5IZFA 1IRKA 2GS2A 2ZM3A 1XH6A 5IA2A 1RW8A 5CALA 4FOBA 2YIYA 5KNJA 2C5YA 3MI9A 3VO3A 1JBPE 4FNXA 2OICA 4DTAA 2B9IA 1XQZA 2XNBA 3CIKA 3CQEA 2QOLA 3I0OA 4EH2A 4IZAA 4F08A 2FSLX 4FZFB 4G6LA 2XAMA 3AD5A 1SYKA 2OIBA 5E1SA 1H08A 3WF5A 3NYNA 2ITOA 2IF8A 2WQNA 2X0OA 3FC2A 4EK4A 1SZMA 3AC1A 5LQFA 5LWMA 1IA9A 3OY3A 5H8GA 4N0SA 3FQHA 5KO1A 2W06A 3EFLA 4G1WA 2VGOA 2QOKA 4O7NA 1H1PA 4FK3A 5FXQA 4KIQA 3LFNA 5D11A 5IUHA 5I9VA 2C6MA 4ZY6A 3ZM4A 4EYMA 4HGLA 4L9IA 3LQ3A 3S0OA 5FTOA 2GNHA 3FLSA 2E9OA 4U6RA 4R7IA 4R7BA 4IX4A 1CTPE 4DF3A 4FV5A 3ZHPC 4FZ6A 4DN5A 4FSRA 4EOQA 1YWVA 2X9FA 3PXKA 5HORA 1OIQA 5ANKA 5LCJA 3PLSA 1M52A 3OWPA 3Q9WA 5CX9A 3TXOA 1H1WA 4TYEA 4L6QA 4BCQA 4GS6A 3ETAA 1XBAA 4WNMA 2FUMA 2R0UA 3KK9A 5AAGA 5AFVA 2WOTA 5F95A 3MDYA 4M69A 4RX9A 5JN2A 4ZTQA 3EOCA 5JMSA 3MS9A 3PRIA 4L42A 3D7TB 5ANIA 2H96A 4AA5A 2XK4A 5AUXA 1UA2A 2YZLA 4ZTMA 1FINA 4LL0A 4YBKA 1GZOA 2BTSA 2X7FA 3GCVA 4RJ3A 1JKKA 5JGBA 3F3WA 4DG0E 4QDEA 2OZAA 3SXFA 2R64A 3ATTA 1RDQE 1G3NA 3CY2A 3PJ2A 4K77A 3BKBA 2OH4A 3GC7A 4MNFA 3CBLA 3R9RA 4RIXA 4EK3A 3BGZA 3AC3A 5AP6A 3FMEA 4GT4A 4ALUA 5CU3A 2GS6A 3OW4A 4ZSLA 3E3PA 2WXVA 4W8DA 4QMLA 3OBGA 2OKRA 2WTDA 4TW9A 2C5OA 5BUIA 2NO3A 3SW7A 3R8MA 4YZBA 3FLNC 2KULA 4FGBA 1YXUA 2X0QA 4P5QA 2GHMA 2UZLA 5EM6A 5CF5A 3R1SA 3UYSA 1TVOA 3A4OX 5EHLA 4A9SA 3ZC6A 4YR8A 2SRCA 3HP5A 3KMUA 4HCTA 4FIEA 5E91A 2UVZA 5HG5A 4RVKA 2VRXA 4LOOA 1QMZA 4RC4A 1SMHA 3P23A 3C4CA 4M3QA 4RZVA 2JGZA 3OOMA 5DNRA 5E8WA 3ZFYA 1P14A 4AE9A 3E8DA 2WMRA 5CAQA 4ZS4A 4HYIA 4ENXA 2B53A 5AUTA 3M1SA 3F3UA 5DPVA 1J1BA 1RQQA 3A7HA 4YLLA 4FT0A 3F66A 3ZLXA 2W1IA 2BFXA 2XB7A 1W98A 4YLJA 4FV9A 3PY3A 2OIQA 2JDSA 2A4LA 4UN0C 4YU2A 3R28A 3DPKA 4FTAA 4C3FA 3CTHA 4YJRA 3UC4A 5HBHA 3Q4CA 4D4RA 3W0QA 4QTDA 2NNWB 1Y8GA 3U9CA 5IH6A 2CNUA 4C0TA 5FDPA 2Z7LA 4AGDA 4JVGA 4O4EA 2VTTA 3QD4A 5JSMA 5LXMA 4YHFA 3QFVA 3RM7A 3WIKA 3VQUA 3E92A 4AAAA 2QHNA 4ZSJA 4GG5A 2O65A 3ZRMA 5A4TA 3IECA 4AZWA 3D2KA 3OS3A 4PPBA 4X2GA 4IB3A 2NRYA 3OTVA 3D7TA 5BUEA 3R01A 4O0WA 4F0GA 3HECA 5F4NA 3E7VA 3GU8A 5ANGA 2Q0NA 4E6AA 4MD8E 2RGPA 4QT1A 2VTQA 2YIXA 3QHWA 5AUZA 4I0RA 1B39A 1W83A 4DFBA 4EEVA 1OBDA 3UZTA 4IZ5A 2WNTA 4RRVA 2AYPA 3QD2B 4KIKB 4L3LA 4WIHA 5EM5A 2CJMA 4J8MA 4FNZA 4J53A 4E26A 4LGDA 4ZLZA 2BRMA 3O50A 3TNQB 2R3PA 3CLYA 2FH9A 4MQ2A 4UALA 4OUCA 5AR8A 5ETCA 4BGHA 4XBRA 4KA3A 3QKLA 1ZWSA 3O23A 3DGKA 4Y85A 4M97A 5AAEA 4FV7A 4YNOA 3Q60A 3NUPA 4ZSAA 1NW1A 5IUIA 3A7FA 3LFAA 5LCKA 5D1JA 2OJ9A 3P4KA 4IWDA 3HGKA 4UYNA 5L2IA 4PPCA 3JR1A 1I44A 5IA5A 2PY3A 3D4QA 4N6YA 4PTEA 2IZUA 2RG5A 3Q3BA 1KWPA 1M7QA 3GXLA 4GK4A 1PXPA 4IFCA 3FL4A 1ZAOA 3W10A 4F7JA 4I1ZA 3P9JA 4CZYB 3IDBA 3ZO3A 4TYGA 4FUYA 4E4LA 4W8EA 4USFA 3KF4A 2OH0E 4MHAA 4UMRA 3ANRA 4G6OA 4GT3A 3PVGA 4BI1A 4NW6A 3QQUA 3DKGA 3V5WA 4FBXA 5FG8A 3SRVB 4FTCA 4IDVA 4CV8A 4XV9A 3OCTA 3DCVA 5A4EA 1PKGA 5E8UA 3C5IA 4ANLA 4H3PA 4JG7A 3OTUA 3R8LA 2OSCA 1H28A 1YXSA 2ERKA 4F63A 4MUQA 3H9FA 3UG2A 3EQI