3NIZA

Cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with adp bound.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
297
structure length
288
Chain Sequence
YFQGLMEKYQKLEKVGEGTYGVVYKAKDSQGRIVALKRIRGIPSTAIREISLLKELHHPNIVSLIDVIHSERCLTLVFEFMEKDLKKVLDENKTGLQDSQIKIYLYQLLRGVAHCHQHRILHRDLKPQNLLINSDGALKLADFGLARAFGIPVRHEVVTLWYRAPDVLMGSKKYSTSVDIWSIGCIFAEMITGKPLFPGVTDDDQLPKIFSILGTPNPREWPQVQELPLWKQRTFQVFEKKPWSSIIPGFCQEGIDLLSNMLCFDPNKRISARDAMNHPYFKDLDPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rhodanese family protein
publication title Cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with ADP bound.
rcsb
source organism Cryptosporidium parvum
total genus 74
structure length 288
sequence length 297
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nizA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nizA01
3E5AA 5EK7A 4CMUA 3PP0A 4ZTNA 3I0QA 5CSXA 4P4CA 4Z3VA 2YJSA 2WQOA 4O0RA 3DQXA 3QBNA 3U54A 3RNIA 4NH1A 3T9IA 3C50A 1OECA 2V7OA 4GG5A 2Z8CA 2QU6A 4RQKA 2GFSA 4IBMA 4F1TA 4RFMA 5JSMA 3UDBA 2G1TA 3BGQA 4M97A 4Z7GA 4NM7A 4U5JA 2UUEA 1A06A 5CU4A 4EBWA 1XH6A 2B1PA 2R7BA 2BDJA 4ANMA 2DYLA 1Q8WA 2R9SA 4HYHA 2VUWA 4IWPA 3GXLA 4JT3A 5TO8A 3U9CA 4ANNA 3QLGA 4O6LA 5EYKA 4WOVA 3EQDA 3EOCA 3EQBA 5G1XA 3REPA 1YXXA 3DKGA 4FT0A 4L7FA 4RJ8A 2ZYBA 4FT5A 5HIDA 4L8MA 4YGAA 4IDTA 4CV8A 3W2OA 1H28A 3RPOA 3UYSA 5BNJA 1DAYA 2PVRA 2XH5A 3I6UA 1J91A 3ZRLA 3QCYA 4F7LA 2JBPA 4F1OA 1Q3DA 1WVWA 4G31A 3R01A 5CF5A 5KMOA 3HECA 2V5QA 3IO7A 2X6EA 5I9VA 1J3HA 4UY9A 2QONA 5LARA 4JG7A 5ACBC 2CN8A 3FMDA 3QC4A 4IAYA 4XV2A 3P1AA 2WMTA 4NM0A 3R83A 3VHEA 3VS1A 2QCSA 3ZBFA 3ZUUA 3U6IA 2B9FA 4DGMA 3H4JA 4IZYA 4F63A 3OOGA 2GHLA 4ZJIA 2XKEA 3KRLA 3LKMA 3Q4UA 3HMOA 3OT8A 2OXDA 3COKA 2W0JA 1IA9A 4L01A 4MVFA 5LJJA 1QPCA 3FMMA 2X7FA 4EUTA 2J6MA 2HXQA 4QTAA 3B8QA 4MYGA 2VX0A 2W1GA 4H05A 2YISA 2YEXA 3IOPA 1WBOA 3NW6A 1H0WA 5GINE 3D7ZA 3R7YA 3ZYAA 4QMPA 1PKDA 4RIWB 2BAJA 3TJCA 1F5QA 3QTQA 2XYUA 2A19B 4ITJA 3MPMA 3ORLA 4U41A 3FPQA 5HG9A 4D2RA 5LMBA 5EYDA 4FZ7A 3NIEA 3RJCA 4DT9A 5KZIA 4MKCA 4IVCA 4FI1A 2HIWA 3R9NA 2YJRA 3SOCA 2C5VA 3UOJA 5AAEA 3KK9A 4F99A 4MF0A 1UWHA 1APME 3H0ZA 4RIYB 5CSPA 2YHVA 3VUIA 4M68A 4U3ZA 4KS7A 4MBIA 1E1VA 2BRMA 4W4YA 4AAAA 3Q5IA 4IB3A 1YI4A 5BVFA 3ZO3A 2OJ9A 1ZMUA 5E9EA 4RWIA 2C0IA 1OPKA 3A7FA 3C4CA 4A9YA 5AUZA 2YM4A 4M14A 3PJ3A 5C8MA 3OOMA 5K5NA 4G3FA 5KMIA 2WMUA 5AX3A 2CKPA 1P5EA 3DNEA 5AP7A 1ZXEA 3RI1A 4BWPA 3U8WA 3E7VA 1FVTA 2CCHA 5FLFA 3FZSA 4JBVA 4AQCA 1PKGA 3GOPA 5ETCA 2J9MA 3KRRA 5ITAA 4PPBA 4PUZA 1OKZA 2BVAA 3PRFA 5E8VA 3OFMA 5HI2A 3QC9A 4CFFA 4DHFA 3ORMA 4U0IA 2BROA 5AX9A 4QQJA 1YOLA 2XEZA 2BILB 2C5NA 3BI6A 3GBZA 3EB0A 1PMEA 3AD5A 5CEOA 2CLXA 5EDRA 5F94A 4XG8A 1LR4A 1Y8GA 3H3CA 4QO9A 2YN8A 4Y85A 4BDAA 1XQZA 2C6KA 3QHWA 3RWQA 4C62A 2OK1A 1V0OA 2XKCA 5CNNA 4DE4A 2O64A 2UVYA 3A7GA 3CLYA 3DBCA 3FQHA 4I24A 4KB8A 1KV2A 3LM0A 4NCTC 3TV4A 4E1ZA 3HAMA 4YPSA 4IB1A 4ZSEA 3SQQA 4A7CA 5IQCA 3DB8A 4FTAA 2XUUA 2PZPA 1OBDA 4NIFB 2XZSA 3QX2A 3VRYA 4P5ZA 3TCPA 4I6QA 5CT0A 3THBA 4D4RA 2EWAA 5EM5A 2ZM1A 1HCLA 2HY0A 2B9JA 3DB6A 3ORXA 3OW3A 3ZUVA 2YAAA 3BGZA 3QTZA 5CF4A 2W5BA 4BWKA 3IW4A 5T3QA 3P23A 2JLDA 4V0GB 2VTPA 4O82A 5ANOA 5IA4A 3P5KA 4XLVA 4JBPA 4APCA 5LWNA 3EHAA 2OH4A 3KN6A 4X21A 2W1CA 4QMOA 4C4HA 3ALNA 4C2VA 3W18A 4E4MA 4F65A 5IQBA 3F5PA 3EWHA 2W1EA 2J4ZA 2J90A 4XV3A 3POZA 5CASA 2JAVA 3R7UA 3ZOSA 1YRPA 4XG9A 5GJGA 2R3PA 2CGXA 4OR5A 1BL6A 3QGWA 3Q9WA 5DVRA 3E63A 1Q4LA 1SMHA 3W8LA 5HZNA 4G5PA 3E64A 4M0ZA 4M3QA 4KWPA 3PJ1A 3TKUA 4AZTA 2B55A 4IM3A 4X3FA 3VWAA 3ET7A 4LGDA 3D5UA 1ZYCA 2JIIA 5A14A 2VTOA 3OWLA 3UNKA 3G90X 3BHVA 3VIDA 5JN2A 1FGKA 4U43A 4DG0E 1HOWA 2AYPA 4PPCA 1OM1A 2Z7RA 2WQBA 2R3JA 3AC1A 5AP2A 3TIYA 3A7JA 2R0UA 5J9LA 3DLSA 2JKMA 3HMNA 2A2AA 3BE2A 3PZHA 4F70A 5BVEA 2QOBA 3VW8A 1ZWSA 4FV9A 5CEMA 2C69A 2UVXA 4YMJA 3EN7A 1JSUA 4D5KA 2F49A 3SXSA 4EZ7A 2VX3A 3CTQA 4LM5A 5ACKA 1WMKA 1X8BA 1YOMA 2WTKC 1PMUA 3RMFA 4G3DA 1V1KA 1O6LA 1F0QA 3PXFA 4UMQA 4YLJA 1H07A 3RM6A 4AGDA 5CU3A 3I60A 5FXRA 2UVZA 1RW8A 4FSNA 2UZUE 2KULA 2B0QA 1OUYA 3NNVA 4L45A 4LRMA 3KULB 4EOSA 1FINA 4RWJA 2CPKE 3AC3A 3V5PA 5CYIA 2Q0BA 4FTKA 5AR5A 3MVLA 4FVQA 2PUIA 5CVGA 5F20A 5CEIA 4BCKA 4R78A 3NNXA 3ZLSA 4NYEA 1A9UA 4U42A 1W82A 5L2WA 4D2PA 3ZZEA 3FLWA 3DDQA 3K2LA 3COMA 3CTHA 4FKVA 4FTTA 1ZOEA 3TI1A 2C30A 4O0SA 4ALVA 3L1SA 5HLNA 5IKWA 4WSQA 4O1OA 3V51A 3COHA 2RGPA 3CQUA 3FMJA 4AT5A 2HW7A 2P2HA 4BCJA 4O7YA 3ZLWA 2IVUA 3QTSA 5M56A 2RG6A 3MTLA 4FV1A 4K18A 5JRSA 4DGOA 3UIBA 1BUHA 3BYOA 3RPRA 3R9OA 4IVAA 5IZFA 4EL9A 1WVXA 5M4IA 2WMXA 3O8UA 3FI4A 3F7WA 4A4OA 3VS6A 2ITUA 5ANKA 3DXQA 4JR7A 3E88A 2X4FA 3F88A 3VULA 3Q32A 3UTOA 2VZ6A 1OPJA 4HCTA 2WTDA 5GZAA 4W8EA 3MVJA 1REKA 3FZPA 5TKDA 4BBEA 4J99A 1PMVA 1XO2B 5M4UA 5AUVA 5AP0A 4ZLZA 5DHJA 3G6HA 3O7LD 1JNKA 2C5YA 4BBMA 2UZNA 5FRIA 3Q6UA 4RVKA 4R3CA 3O8TA 5IDPA 2GHGA 2BKKA 2PE2A 4AT3A 3OUNB 2WQNA 3MFUA 5FGKA 4E4LA 1KE9A 2VAGA 2JFLA 5JFWA 1FOTA 4U97A 5A6OA 3W8QA 5C8KA 4W4XA 5C1QB 2OZAB 3KCKA 4JAJA 3T3UA 3QKMA 3GCUA 3QX4A 4BZDA 1GJOA 4K0YA 1I09A 4TRLA 2VTAA 3FHIA 3LFBA 1XH4A 2X6DA 4UWYA 5AP6A 4AOIA 2Z7LA 5KZ0A 3JPVA 1VYZA 4AUAA 4YSMA 3I0OA 3FMKA 3L9LA 5KMMA 4D58A 2DWBA 2FUMA 4ONAA 4AXAA 3KKVA 1JSTA 4DH5A 4XUFA 3DFAA 2G01A 3LVPA 4I0SA 4QYGA 4FODA 3ZO2A 2O2UA 3QRTA 4WNMA 2W4OA 3W2QA 3D5XA 2XYNA 3CJFA 3K3IA 3DGKA 5EI8A 2O0UA 1J1BA 1ZYJA 4CFNA 1Y6BA 4KBAA 2QOOA 4ZMFA 4F0GA 3Q60A 4XOZA 1ZYDA 4DCEA 5A4CA 2WB8A 2UW8A 1PXOA 2JKOA 4FKJA 5CXHA 4ZAUA 2YWVA 3TTJA 1LEWA 4EH7A 1R1WA 2HYYA 4TWOA 5E1EA 3GCQA 4C57A 3U6JA 5DNRA 3ZH8A 3A8WA 5LWMA 5A4LA 1A48A 3DAKA 2RFEA 3R21A 4WRGA 3G6GA 3VBTA 4MNEB 4YTIA 2IZTA 3Q96A 1OIRA 4PTCA 4QQCA 5J7BA 2JIUA 3SA0A 4MXCA 4M7IA 4G3CA 3FMHA 3G5DA 4DH8A 4FZ6A 3NGAA 2RG5A 3PJ2A 5EOBA 4AFJA 5A6NA 2FVDA 2W1IA 4I22A 4JRNA 4ASXA 2ZB1A 4EH8A 2OIBA 3NVKI 1FGIA 1H0VA 1R3CA 2OICA 4HNIA 3F2RA 3L8VA 4L3JA 3FMLA 4F9CA 2PYWA 4A9TA 3OROA 3AT4A 3F7ZA 5HCZA 4RIXB 5AUTA 1NVQA 2CGVA 2JITA 4G3EA 4PDSA 4APPA 4BCOA 4BDGA 5CY3A 3MH0A 3HRFA 1Q99A 2UZEA 1T45A 3PVGA 4M84A 4KIOA 5AUYA 4BCPA 4MXYA 4ERKA 5DT0A 5J87A 3TNPC 5EQEA 5EKNA 1BYGA 3P4KA 2HXLA 2X1NA 3R71A 3WZUA 5BQ0A 4L9IA 1YHWA 5T68A 1AQ1A 5I0BA 4AOJA 5BYZA 4YJRA 4IZ5A 4ZY6A 4ACDA 2PE0A 2YFXA 5BVWA 2F57A 4UMUA 4QMSA 2CJMA 3QGYA 2B9IA 4BDBA 3UVQA 4X3FC 2GHMA 5LOHA 5AWMA 4XBUA 4TYIA 3W10A 4CFXA 4B6LA 4AT4A 4QMZA 5C01A 3GT8A 4FKGA 1YHVA 2XCHA 3SX9A 4GIHA 5CAPA 2ZMCA 4FKUA 5IQIA 5TR6A 1PYXA 4ZTRA 2PUUA 4MXAA 2W1DA 1UNGA 4Y5HA 4YLLA 3NUYA 3LIJA 1W7HA 2R3MA 2AC5A 1ERKA 3LMHA 1H27A 1RDQE 2ITWA 5FEQA 4JRVA 3BWFA 1TQIA 4E3CA 2BRNA 2VWYA 2QLQA 4RC2A 4M8TA 4D55A 3CQWA 1JWHA 3LFNA 4EOKA 3QLFA 3B2WA 1UWJA 3CY2A 4FTIA 3T3VA 5HTCA 4ID7A 4CZUA 3VRZA 1H25A 4KSQA 4WBOA 3MA3A 3HKOA 3QHRA 4PDPA 4DITA 4LOQA 2QOLA 2OJJA 2BCJA 3DK3A 4OTGA 4P90A 3R00A 4GFMA 4C58A 4FIIA 3CKXA 1PY5A 1SVHA 4KA3A 1OITA 3QXOA 4DEIA 2PZRA 3FLSA 5JFVA 2P3GX 2IVVA 2JKQA 3E62A 4BIEA 3BHYA 3I7CA 1OI9A 3WF5A 2OXYA 4OW8A 2W17A 4F6UA 3Q3BA 3UE4A 4B4LA 1SNXA 2OBJA 3DK6A 3ROCA 3VJOA 3EFJA 4R7HA 3F3VA 4L67A 2R3HA 4PNKA 4XV9A 1DI8A 4ITIA 3SG9A 1OL1A 3A60A 3DJ5A 4RFZA 5HO8A 4I92A 4CMOA 1H1PA 3DKFA 3DBEA 2XBJA 3UMWA 4FV6A 4FF8A 4W4WA 4DGLC 3CS9A 5DRDA 3QAME 2GU8A 5HX8A 3Q4TA 3F3TA 4E5BA 5IQDA 2CGWA 3C5UA 4QP2A 5J8IA 5KKRC 4KKEA 1OL5A 3HRBA 3UOKA 4EHGA 4N6YA 3VS0A 4ZSLA 4KIKA 2XK6A 4CFWA 2JDVA 2QR7A 4G16A 3C7QA 2XNMA 4QMLA 4O7RA 4ZJVA 3KA0A 3D5VA 4FSMA 2BKZA 4I4FA 4QOXA 5A4QA 3ZEPA 5AR4A 4EQMA 4JG6A 1ZRZA 4O83A 4FTMA 4JBOA 4N57A 1UU8A 2B4SB 4X2NA 2VD5A 3OP5A 3R1YA 3V5TA 4BCNA 5GIOE 3WI6A 2OF4A 3QQJA 5CQWA 4TN6A 3LE6A 4IAZA 4TNDA 4U44A 4Y73A 4PMPA 2IW8A 1H1WA 2GNHA 2RFNA 3EQGA 2WTJA 4NUSA 2PWLA 3R8MA 4AN3A 2R3RA 4CGAA 2ONLA 4MH7A 3MV5A 3HX4A 4M69B 1IR3A 3HYHA 4LGHA 4MXOA 4IAFA 4TT7A 5A54A 2CGUA 4ZY4A 4O6EA 4QNAA 3AD4A 4YPDA 2JKKA 5DEWA 5E8YA 1NW1A 3IKAA 4B8LA 2XK7A 3EL7A 5F95A 4ENYA 5L3AA 4ZS4A 4ARKA 4GJ3A 4Q5EA 3MDYA 3OXTA 2XBAA 2YDIA 1Q8YA 3ANQA 4IANA 5DR6A 1S9JA 3C9WA 3II5A 2PVHA 2GQSA 5J5TA 3D7TB 4EOQA 3DXPA 3MJ1A 4GCJA 3H9OA 4FTQA 4M15A 4DFXE 4NKAA 3UOLA 3UGCA 2O5KA 2RFSA 3MTFA 1OL2A 4MD8E 3OC1A 3P7AA 5IQEA 4RZWA 3KQ7A 4GJ2A 1QPDA 4BFMA 4DYMA 4BY9E 4FK6A 4G34A 3ZDIA 4NTTA 4XYFA 4I5PA 2A27A 2YDKA 3SXFA 5L4QA 3UPZA 2GS7A 1M52A 3MY1A 1YI6A 1PF8A 4UYAA 2QG7A 4J1RA 4I5CA 3FXZA 2CCIA 3WARA 3O8PA 2QO9A 4FNWA 3W33A 5DRBA 3NAYA 3MSSA 3FC2A 4DC2A 4O84A 4KD1A 4YLKA 3A61A 3BRBA 3FMEA 3FC1X 5DLSA 3DY7A 4C0TA 3OCBA 2BZIB 4FL3A 4OBQA 5K5XA 4O86A 4AG8A 4CD0A 2YCSA 2HWOA 4GG7A 5EDQA 3V5LA 3ZU7A 5LVNA 4DN5A 4EKKA 3FLZA 1FMKA 3K5VA 3Q04A 4CQGA 3A8XA 3BEAA 3HA8A 2OZOA 3D0EA 2XJ1A 3BLQA 3KXXA 3JVRA 4JG8A 5AV0A 5CALA 3CKWA 4DLIA 1Q61A 4H39A 2NPQA 5IMXA 3LQ5A 2C0OA 3TKIA 5M4CA 2VTRA 1O6KA 1WBVA 3LCDA 3CPCA 4FTJA 4JOAA 1CKIA 4XX9A 3VVHA 3HEGA 4FVPA 2GQGA 1Y8YA 3HP5A 4GFOA 4R1VA 4ZXTA 2BHEA 4NFNA 3V8TA 5A4EA 2VX1A 2YM3A 3TZ8A 3GP0A 3HV3A 5KUPA 3EQCA 3ODZX 4FT7A 5CVFA 3I1AA 3VUGA 3EQFA 1H08A 2ZAZA 4EH6A 4YC3A 4BI0A 5IEYA 1URWA 2QHNA 4JJRA 4BC6A 2PVFA 4BKJA 4C3RA 4R5YA 5AR2A 5IH5A 2YZLA 1JVPP 1OB3A 2QQ7A 3UIMA 4U6RA 3FZ1A 2I0HA 5CVHA 2R64A 2EUFB 3LCKA 5CENA 5L6OA 1IAJA 2XCKA 3D94A 2X7GA 1BX6A 4ANSA 3TUBA 5BX0A 5ICPA 1ATPE 1LEZA 4IX4A 3PP1A 4QMTA 3L9NA 3LXNA 4I5MA 3V5QA 3ZONA 1OUKA 4Y46A 3LCOA 1JPAA 4QTBA 1GZKA 4KKHA 3VC4A 4V01A 4FIJA 1GIIA 4K1BA 1KUTA 2QD9A 4J7BA 4AZSA 3RWPA 2QODA 2VWXA 3R28A 1Z9XA 4FIGA 2OO8X 3LAUA 4HJOA 4HYIA 1H8FA 4QYHA 3RZFA 3WOWA 4AGUA 4HVSA 5IA2A 3HUBA 3VN9A 3KN5A 2FB8A 4J52A 5I4NA 1J1CA 3SW4A 3FKLA 5KMJA 1VJYA 4C4EA 4J97A 1VEBA 3POOA 3D2KA 3PSBA 3EFLA 2B52A 4X0MA 2QOIA 4BCQA 4EQUA 3G2FA 4J8MA 4O7TA 2XS0A 2X7OA 3CGFA 5HG5A 4D9TA 5IH4A 4S30A 2ZM4A 4F9YA 5IU2A 3VHKA 3MS9A 3TKHA 4J95A 4YJNA 5LVPA 5EHYA 1Z5MA 4CFMA 4EORA 2GMXA 4GT5A 3WF7A 3SKCA 5F9EA 2NRUA 4C4FA 4L68A 4O1PA 4XP0A 2HELA 5DR9A 3GC8A 3BLHA 3TV6A 2QOQA 4XHKB 2UW6A 2HOGA 5HGIA 4U40A 4RWLA 5BUEA 3R8ZA 5GNKA 5FWKK 2WEIA 3IDPA 3F5XA 4H36A 2HCKA 4PWNA 4EUUA 3TM0A 2UZTA 4PF4A 3O96A 5EKOA 5DMZA 5KHWA 3VUHA 5JGBA 4PTEA 3WIKA 1XR1A 4O38A 3P86A 3R1NA 3FZTA 2YACA 3ZO4A 5LMKA 3EQIA 5IH6A 4O7VA 4O91A 3D14A 3CCNA 5CAVA 4RX8A 5K0KA 4QP6A 2WIPA 5EQYA 5FUTA 4UMRA 2F2UA 4EWQA 3HLLA 4EK6A 5IQFA 2QR8A 4YO4A 2Y4IC 4RZVA 4DAWA 3IQ7A 4JXFA 3LJ2A 3PRIA 4ZZNA 3QTIA 1XJDA 2VWWA 4YTHA 4Q9SA 3EH9A 3NAXA 2ETKA 3UNZA 4F0IA 3NUAA 1PXKA 5AADA 2WTCA 1TKIA 4UEUA 2EXCX 3MH2A 2X81A 4PY1A 4BDFA 4EZ5A 2BDWA 2R3LA 5TE0A 2Y0AA 3ZDUA 4AZWA 3KXNA 3JR1A 3C4EA 4BDEA 3SRVB 2ONLC 3DZQA 4IDVA 4YTFA 3R1QA 2IZUA 2W9ZB 4S34A 2H34A 3ROYA 3UP7A 4FR4A 4EOPA 4JNWA 5TF9A 4BYIA 5CSHA 5A9UA 3WZEA 2HW6A 2YERA 3EYGA 1IAHA 4IQ6A 3G9NA 4F08A 4FEVA 3OY1A 3NNUA 5DT4A 4AN2A 4C4JA 2A0CX 5HEZA 4AE6A 4AX8A 3GCSA 3R9DA 2XIKA 2REIA 2UZDA 3BHHA 3L8PA 1KE8A 4FOCA 3TIZA 5AA9A 4XG3A 2BFYA 1M17A 4DH7A 3DDPA 4I23A 4DEHA 3F3WA 1YVJA 3AQVA 3DBFA 4MTAA 4RT7A 3RBWA 3PLAE 3E8CA 4IM0A 3GUBA 3HV5A 5IUIA 3U9NA 3LOKA 4JDHA 4WIHA 4S33A 2AUHA 3BYVA 1VYWA 5A3XA 4AW0A 4NWMA 5E8TA 2CNUA 4RLKA 4YSJA 3ZLYA 3L8XA 3BHUA 3Q6WA 3R7GA 3SD0A 1NVSA 3DZOA 3UG2A 3F6XA 4MAOA 1Y6AA 5DPVA 3QYZA 3V8WA 3R30A 1U54A 1WZYA 4O0XA 4D1ZA 5B7VA 3K5UA 4RX7A 5BUJA 4MXZA 5IISA 4QP8A 2H6DA 3GU8A 4MWHA 3NWWA 5AJQA 5AM6A 2Y8OA 2LAVA 2X2KA 4O0VA 3AMYA 3V6RA 4UN0C 2WXVA 4FGRA 4HGTA 4KS8A 5AMNA 2VNWA 2J5EA 3LJ1A 2VGPA 2VTHA 4GL9A 3G9LX 2VWBA 3IONA 4YJOA 3RK7A 2H9VA 3C51A 5CTPA 4ZSGA 4QQTA 3DCVA 2W96B 2WMRA 4LL0A 5HICA 3QRJA 4XG7A 4FVRA 1FQ1B 4D5HA 3VS7A 2UW7A 3DAEA 3PYYA 4FEQA 3DXNA 4YJVA 3FYKX 3WYXA 3ZFXA 4M67A 2B53A 3CY3A 4MQ1A 4NW5A 4RC4A 5BMMA 3ZSGA 1PYEA 1DS5A 2C6IA 1JKKA 4NSTA 1NT2A 3BLRA 3HL7A 4FZFB 4BF2A 2IW9A 5HIEA 1CKJA 4HYSA 4FEUA 5L8LA 1FVVA 5H3QA 4CLJA 4LOPA 5L2TA 5HCXA 3M2WA 4JX7A 4L3PA 4C3PA 3LQ3A 3UZRA 1XH9A 2B54A 3E3PA 3A4PA 4DEDA 2ZV9A 2OSCA 4MCVA 5ANJA 3LW0A 5IPJA 4AGWA 4PTGA 2C6EA 5KNJA 1SVEA 2C6TA 3CJGA 2GTNA 2OGVA 5BVKA 1SM2A 2BRBA 2Y7JA 4BDIA 5D11A 3C0IA 1IG1A 1FVRA 3GENA 4S2ZA 4ZTLA 2C1AA 4HGLA 4DEGA 4E6QA 2KTYA 5I3OA 2YCFA 4IADA 4C35A 4FKTA 4QP3A 2IZSA 2WGJA 3RVGA 4QP9A 4MX9A 5L6PA 1OBGA 5J1VA 3EQPA 3Q2MA 2YITA 3JVSA 5FEDA 5CNOA 4S32A 4XS2A 2PZIA 4F9AA 2QLUA 2WTIA 5E1SA 2BPMA 4C33A 4DFLA 3BU6A 4IIRA 3RK5A 2BZKB 3ORKA 4CT1A 3RALA 3EIDA 4E5WA 4AP7A 3G0EA 3RNYA 2Z7SA 4GV1A 4JX3A 4EOMA 3VF9A 5CU0A 5LCJA 1L8TA 4RX9A 5J1WA 3PXZA 3DJ6A 4R3PA 4WG3A 3FBVA 5HE1A 3E8EA 4TWNA 3FQEA 1R78A 4IX5A 5GJDA 3VUMA 4DLJA 2GNLA 4B0GA 1Q8UA 4BBFA 4N70A 3BEGA 4EH3A 3NMUF 1M7NA 3W16A 2WTVA 2YABA 3KVXA 5DA3A 1BI7A 3OEZA 5IA1A 3UZPA 1Y57A 4W8DA 4CQEA 2G15A 3NUXA 4JAIA 3RAWA 5JT2A 3QWJA 4UXQA 1YW2A 5F1ZA 2FSTX 2GNGA 1Q62A 3AC2A 4V04A 3UIXA 3A4OX 4XMOA 5DWRA 5DT3A 5IUGA 2QO2A 1NVRA 4RBLA 2E9VA 2F7XE 2X2MA 5IEVA 1YDTE 4ORKA 2C5OA 3A7HA 3KRWA 5EI6A 3UQCA 3AC8A 2WMWA 3BYMA 3NCZA 5EYMA 3BU3A 5J79A 4P5QA 2PMOX 4BTKA 2R3NA 5IA3A 3ZZWA 4X3JA 3M11A 4H3BA 4K2RA 4X2JA 3GCPA 3UC3A 3NNWA 3CE3A 5J9ZA 2BRHA 4N4SA 4QPAA 1Q3WA 2UV2A 3E8NA 4UMPA 1XH5A 4YZ9A 3FWQA 2VN9A 3SOAA 3N9XA 3BYSA 3WE4A 4GIIA 4DH1A 3KXMA 3LCTA 4MBLA 5BPYA 2GNJA 3DTWA 4FKPA 3TV7A 1YOJA 2XNNA 5LMKC 2R0IA 3R0TA 3K3JA 2C1BA 3R04A 2QOFA 4BI2A 2RSVA 3ZRKA 4K6ZA 5AP1A 3NYXA 3DTCA 4YBJA 3TUDA 1B6CB 2XJ0A 4GFGA 4IH8A 2IJMA 3IW5A 4GK2A 3UBDA 3ATSA 3LXKA 3SC1A 3SXRA 2I0EA 2BTRA 2F2CB 4Z9LA 3PE2A 5DR2A 5I9WA 3FL4A 2LGCA 3OBGA 4LFIA 3VAPA 3ZC6A 4AOTA 2R2PA 4LRJA 4RJ5A 2CDZA 4ZTMA 5G6VA 4KIQA 3FKOA 2WU7A 1GZNA 4D9UA 2QKWB 4JS8A 2X0GA 4IWOA 5H8BA 4GT3A 1MRUA 4C4GA 4TYHB 4ASEA 1U46A 4DBXA 4BDJA 3LFDA 2C3IB 4ZTHA 3F2AA 4R3RA 2GTMA 4GS6A 5HE0A 1VR2A 3AG9A 4YJQA 5LXMA 3SHEA 3R22A 3VUTA 1PHKA 2E9OA 5J5SA 3GB2A 2CHLA 4R1YA 5HCYA 3PIYA 2ITQA 4EJ7A 4IAAA 4DFZE 2DUVA 4YZCA 2OF2A 3O7LB 4NFMA 5HG7A 4EONA 4RJ6A 4GVJA 3ZXZA 4Q5HA 1KOBA 3UZTA 4A4LA 3N4TA 4ZOGA 3PUPA 4AZVA 2NP8A 4HPTE 2BFXA 4YURA 4DTKA 1L3RE 2OG8A 2HZ4A 1KSWA 3TZ7A 5BYLA 3GVUA 3KRXA 3QA0A 4IWDA 4CVAA 1IASA 1PXMA 3RTPA 4A9SA 2J0LA 2XEYA 4FSWA 2RIOA 5JRQA 1BLXA 4KKGA 1H26A 5E8ZA 3VBWA 4RX5A 1YXVA 3MGYA 4GYIA 3KF4A 5FD2A 4LYNA 4C38A 4PV0A 4OTDA 3WILA 3MJ2A 4FKOA 2WIHA 2YIWA 4RGJA 2RL5A 3QZHA 4CZTA 2OKRA 5AUXA 4X7QA 3KREA 4CEGA 3H9RA 2XK4A 2HAKA 5H8EA 4IXPA 4EJNA 4FTLA 4FNYA 4GVAA 4OAUC 2XF0A 1OIYA 2VO6A 1SVGA 4FSTA 4IFCA 2WMQA 4NK9A 5DFPA 5FXQA 3D9VA 1B39A 4C3FA 2I1MA 4AA0A 1E9HA 2BZJA 4XG6A 3EMGA 3PY0A 4S31A 2BR1A 3F5GA 4WHZA 4Y83A 4G3GA 5GZ8A 2XMYA 5K4IA 4R77A 3TDVA 4FMQA 5CAOA 4KBCA 3NPCA 4FT3A 4PMSA 3SV0A 3VS4A 3I5ZA 4E7WA 3E93A 5EHLA 3RPYA 3HV7A 4UB7A 3MH3A 4CFVA 4RIWA 3EN5A 2C3LA 5HNBA 4DF3A 2GFCA 4G9RA 4NZWB 1JOWB 1YWRA 2YIXA 2JC6A 4QRCA 5CU2A 4B99A 3P79A 4DEBA 3DV3A 5AV2A 1V0BA 2C6MA 2WTKB 4LRKA 4AS0A 2PMIA 2YM8A 5D10A 4LOOA 1ZZLA 1R0EA 1UKHA 3OCSA 4CTCA 3NCGA 4FKWA 2ITXA 3LMIA 2XJ2A 3EJ1A 4MHAA 5E8XA 3EKKA 3TZ9A 5DGZA 2XIXA 3F61A 4NM3A 4RIYA 2NNWB 1IRKA 1XWSA 5I9ZA 5GIPE 4ZTQA 4JIAA 2IPXA 3L8SA 3MH1A 4FT9A 3UVPA 3PVBA 3VW6A 5M55A 2XA4A 2I0VA 2PVYA 3O23A 4IX3A 3TXOA 4I20A 1IEPA 3L9MA 4YP8A 4ACGA 5HTIA 2R4BA 4Y72A 5IMEA 2VTSA 2Y6OA 4DG3E 2X4ZA 1DAWA 1ZY4A 3OS3A 5HBHA 2XP2A 3LZBA 4H3QA 5AA8A 5HQ0A 5HIBA 1M7QA 1U59A 4IVBA 3PG1A 1K3AA 2WQEA 3GC7A 3VUKA 3TN8A 5EHOA 4FSUA 3HV6A 3RPVA 3FAAA 4MWIA 3KRJA 4DGNA 3QZFA 2XK8A 4WUNA 4CG8A 1JKSA 2O8YA 3KEXA 3BKBA 3JXWA 3A99A 4F7SA 4G1WA 4G5JA 4UZDA 3C0HA 3KL8A 4L44A 5IG1A 3MFSA 4P2KA 4Q2AA 4OBOA 1OZ1A 3NRMA 4D1SA 4EH9A 4DG2E 3LPBA 1G8SA 2H96A 4HVGA 1H24A 2O65A 5HU9A 2HK5A 5D7VA 3RGFA 3A7IA 3MI9A 4UALA 4RA4A 1QPJA 3QUPA 3Q4CA 4J8NA 2PVLA 3MB6A 3KMWA 3QRIA 4QMXA 4XP3A 3MPAA 2WZJA 3PXQA 4CNHA 2Z7QA 4NIFA 5J95A 3IK3A 2W9FB 3BQCA 4JLCA 3UPXA 4E20A 4O81A 3COIA 3PXYA 3QQHA 4GH2A 4U9AA 3VJNA 3W2RA 5AP4A 1PXIA 1UV5A 2F9GA 4FTRA 4IVDA 4CYIA 5J9YA 1KV1A 4EC9A 2GCDA 4V0GA 4USFA 4QMWA 5HLWA 2X8IA 3LLTA 5AR7A 5JGAA 4BCFA 4QD6A 1G5SA 2H8HA 1Q5KA 4GT4A 5HNGA 5M51A 3R8LA 3MYGA 3OTUA 4E6CA 4HVHA 2PULA 3BBWA 4BN1A 3IW7A 4TY1A 4FV4A 4TNBA 3FKNA 4TW9A 4ASZA 4BGGA 3OHTA 4CSVA 5AAGA 1J7UA 3CQEA 2FYSA 3KVWA 4QTCA 3WE8A 4I5HA 4MBJA 4FV5A 4YHTA 3LJ0A 2PHKA 3NW5A 4TYJA 4HW7A 2QOHA 1S9IA 3IGGA 5HX6A 1Q97A 2F7ZE 4DCAA 4USEA 2OWBA 2JDOA 3NIZA 2BUJA 4BYJA 5DOSA 3HMPA 3PA5A 2VTJA 5CS6A 5FDXA 3UMXA 4KAOA 3FQSA 1GZOA 3OWKA 4O2ZA 4L42A 3ZUTA 3FSKA 2OJGA 4ANBA 4BCHA 5HTBA 4FIFA 4I93A 1U54B 4JI9A 4RVMA 4IAIA 5AR8A 4EWHA 4IMYA 3PIXA 5JEBA 4DFYA 4WA9A 4ZK5A 5AV1A 3ZRMA 4BIDA 2OU7A 2VTTA 3PZEA 5E8UA 3LHJA 2XRWA 3LFCA 4CKRA 1M2QA 2OLCA 2WMAA 4DA5A 4PP7A 2P55A 3AMAA 3NSZA 3IECA 3JUHA 4FL1A 4C8BA 2WKMA 3RPSA 2AC3A 4WO5A 2GS6A 4F1MA 4Z55A 2G2HA 2ZV2A 4XG2A 2PMNX 5D9HA 3WF8A 3CD3A 2C3KA 3O0GA 4M0YA 5HBEA 3HZTA 3UO6A 4CTBA 4KRDA 2JDTA 2OJIA 1WCCA 5IF1A 2ITYA 3CD8A 4CLIA 3F5UA 2Y4PA 3F66A 2Y6MA 5E91A 4EC8A 3UQGA 3UO5A 4CYJA 3PSCA 4TYGA 5IUHA 2C6LA 3HAVA 1P2AA 2JD5A 3MB7A 4U81A 2Y9QA 5HG8A 3EYHA 1BL7A 3KULA 1XKKA 3QQKA 3OT3A 4G2FA 3QQFA 2X8DA 2VU3A 3R63A 5AP5A 4ACHA 4IEBA 3IOKA 4O7ZA 2X39A 4ERWA 2XNBA 3N51A 3NR9A 4LUEA 4LUDA 4WG5A 5FBNC 3FY0A 3QZGA 4LMUA 5HU3A 4X3FB 3UYTA 2DS1A 3FI2A 3AT2A 3KXHA 1STCE 1OKYA 4LV8A 4LQMA 4XP2A 2YLEA 4FK3A 2PVKA 2EB3A 1YXTA 3JY0A 3PIZA 2JGZA 2GSFA 2VNYA 2V22A 5EQPA 4JVGA 4K11A 5LQFA 1YHSA 4G6OA 4K33A 4FV3A 3TWJA 2PVJA 4QP7A 2XNOA 1UVRA 2VWZA 3UNJA 3MIAA 3BV2A 5LVLA 2ZDUA 1KE6A 3LCSA 4FL2A 4DINA 5A4TA 2CSNA 4AACA 5HNIX 4KUJA 2XIZA 3DAJA 4MQ2A 2XK9A 3MY0A 4GMYA 4BCIA 2VWVA 2YA9A 4AF3A 4FKLA 4Z7HA 4MD7E 3CP9A 2ZV7A 4GRBA 3V8SA 5KBQA 2C3JA 3FI3A 4XV1A 1JSVA 5JQ5A 2FSLX 3QQLA 4ZMEA 2DQ7X 2OIDA 5E8WA 3V5JA 4EH4A 4YR8A 1Y91A 3QZIA 1SZMA 3ZCLA 4CT2A 3RCJA 1RE8A 2IZRA 3NW7A 4I3ZA 3LFAA 4CRSA 3CBLA 3DOGA 2HZ0A 4D28A 4YTCA 5JH6A 5AIRA 4C59A 3R9RA 3KY2A 4GKIA 3P0MA 1CM8A 5ETFA 1XBCA 2YIQA 4V05A 4YNOA 4IC7A 4N6ZA 4XG4A 2CNVA 1XBBA 4FZDB 4BI1A 4ZIMA 3NUNA 2OZAA 3EFWA 4IZAA 1HCKA 1VZOA 2IN6A 4KABA 3BHTA 2HZNA 3O51A 2G2FA 5CI6A 1EH4A 2W7XA 5KX8A 3GC0A 4R5SA 2WNTA 1MRYA 4DGGA 3MY5A 2QG5A 4B7TA 1PJKA 1FBNA 2R3IA 4QP4A 2Z02A 5GHVA 2OFUA 4FSZA 3FEGA 5AFVA 4Y8DA 5AUWA 2J5FA 1P4FA 5KKRB 5D12A 2QO7A 4C7TA 2NRYA 4JL9A 3PY3A 3P78A 3SG8A 4YC8A 3O17A 4YZBA 5F4NA 2IO6A 4OTWA 4CCBA 3DQWA 4M12A 4EOIA 1R0PA 5I9YA 3PTGA 4FIEA 3FLNC 4Z16A 4PL3A 3R9HA 4FC0A 3F82A 2NO3A 1B38A 3OY3A 4GK4A 4TL0A 2WOTA 5IDNA 1JQHA 3A62A 5IEXA 3Q2JA 3NYOA 4FNZA 4RQVA 3IS5A 3OBJA 2R3KA 4WT6A 5AP3A 5AV3A 3AC5A 3UC4A 3TG1A 2HWPA 4OLIA 3WYYA 3PDTA 4OBPA 5CQUA 5CAUA 5TOZA 3UP2A 2OJFE 3G15A 4XBRA 5E4HA 4FOBA 3C5IA 3QD4A 5K0XA 5L2QA 4MNEA 5GZ9A 4ASDA 4HOKA 3ALOA 3R7EA 4YZDA 2GS2A 2OIQA 4PMMA 5DE2A 3H9FA 2R5TA 4KRCA 5KCVA 4Y5QA 4EI4A 2C6OA 5H2UA 3OD6X 4F9WA 5I9XA 1CDKA 3R7VA 3W2PA 4E6DA 2WQMA 4OAVB 2PUNA 3DNDA 3IDBA 3QD2B 4GUEA 4KNBA 3TNIA 3QCSA 5FTGA 2FO0A 1PXJA 3K54A 3HNGA 2QHMA 5M57A 4XRLA 4RIXA 5JZNA 4ZJJA 3FYJX 5FM3A 4ANLA 1H4LA 3M42A 1WFCA 3OVVA 2R3FA 5LCKA 5E90A 4MK0A 4IZ7A 4L6QA 4AA5A 3CTJA 4TPTA 5ANIA 1TVOA 3P9JA 2PK9A 4X2GA 5GJFA 4FICA 5LVOA 2RFDA 3EKNA 3P7CA 5FEEA 4CCUA 4H1MA 2W06A 3NDMA 3LXPA 4OTPA 2ETMA 4ALWA 3MW1A 3OTVA 4EKLA 1CMKE 1YQJA 5AAFA 4FV7A 2WPAA 4X2KA 5BUIA 1P4OA 3QRKA 2V55A 4I6FA 3DK7A 2R3GA 5DEYA 4FX3A 1NY3A 1UNHA 3JY9A 1WVYA 1GY3A 1M14A 4HYUA 4LMNA 4JQ8A 5B0XA 4DEAA 4QTDA 1K2PA 3DLZA 4FZAB 2I40A 4A4XA 5CXZA 2HZIA 4BHNA 5E7RA 5IQGA 3ZBXA 1FMOE 4YZNA 3R7IA 4BL1A 4C4IA 3WF9A 4BRXA 5HORA 4PL5A 3PXKA 3AGLA 4JDKA 4BKYA 4ZZOA 3RKBA 1ZAOA 3Q52A 4YHFA 4F9BA 4A9RA 3F2NA 3GFEA 3KXGA 3QU0A 5EOLA 3EZVA 3SDJA 4GSBA 3QD0A 4GW8A 2E9NA 1G8AA 1CSNA 2JDSA 5I9UA 1JKTA 2JBOA 2Q0NA 3Q9XA 4CZYB 3VUDA 1UKIA 3OCGA 3U6HA 3QRUA 1V0PA 2ERKA 2UW4A 2C4GA 2OI4X 3UOHA 3TNWA 4PPAA 2O3PA 5FG8A 4OTHA 3PVWA 5C26A 4BIBA 2IG7A 4FSYA 4J71A 1W98A 5KHXA 3BPRA 4D0WA 5L8JA 4O22A 5FQDC 4F7NA 3OUKA 3U4WA 2CKQA 1KE5A 3V5WA 3WZDA 4BICA 2XKDA 4USDA 5CSWA 4PMTA 3AOXA 2RKUA 5FTQA 3NVMB 3MPTA 3OWJA 1ND4A 3C4FA 5CT7A 3KMUA 2FSMX 3DKOA 3BU5A 5DBXA 3SW7A 5CEKA 3QKLA 5E92A 4OTIA 5LVMA 3FE3A 3ORIA 4FEXA 3U55A 2Z2WA 2XNGA 4AW1A 4GKHA 3I81A 5DYJA 4YJPA 1TQMA 3RAHA 2HY81 4CV9A 1BKXA 2I7QA 3IG7A 5BMSA 4CKJA 3N4UA 4GYGA 1SYKA 3NLBA 5CZIA 3O2MA 1AD5A 5IA5A 3RAKA 5B2KA 1T46A 3W2SA 3HDMA 3QCXA 3E7OA 2PY3A 3R8UA 3P7BA 4Y95A 4EOJA 2ZB0A 3KK8A 4FBXA 3NYNA 4ZEGA 4FA2A 4F4PA 2E2BA 3E8DA 5KE0A 4CMTA 4ZTSA 4NTSA 1YXUA 4QYEA 2F4JA 3S00A 1ZARA 4U3YA 5HBJA 4J96A 3DS6A 2CKOA 3ID6C 5EI2A 3LM5A 5I5ZA 2P2IA 2YIRA 1WBNA 3BZ3A 4FIHA 1WBPA 3GGFA 4L00A 2R3OA 4HCVA 4YZMA 4ZP5A 4M69A 3C0GA 3ZSHA 3LFFA 3CXWA 4RC3A 3VS3A 4J98A 3FMNA 2VTNA 2BAQA 2BHHA 3EN4A 3I79A 4L53A 1URCA 1BI8A 3GQLA 4UMTA 1P14A 2C47A 3GU6A 5M06A 3ZLXA 4JBQA 3Q9ZA 3BELA 4U79A 2JDRA 3RHXA 3V01A 4DTAA 4PDYA 3JYAA 4HZSA 4WNOA 3NS9A 4EH2A 4EHEA 4XLIA 4RJ4A 1RQQA 3KMMA 4WBBB 4K77A 3U51A 2IVSA 5FM2A 2UW9A 2X2LA 1DI9A 3CR0A 4G6NA 3D7TA 4D0XA 3KXZA 2PU8A 4O7SA 3EQRA 4U80A 3QD3A 3O50A 4OTRA 5EW8A 3BCEA 3W2CA 3RAIA 3QF9A 3ORNA 4DFUA 1GNGA 4RRVA 5ANEA 3TJDA 5KBRA 3ZC5A 1U5QA 4D2VA 4IJPA 2SRCA 4EZ3A 2VTQA 2CMWA 4O96A 4W4VA 5M53A 1YDRE 5JK3A 3KB7A 2WMSA 4K9YA 4PP9A 2VO3A 5ANDA 4BDHA 2WO6A 3CGOA 4IB0A 5DIAA 5FBOA 1WBTA 4EK8A 4PRJA 5M08A 2Y4IB 3PE1A 4KIKB 3DBQA 3R7OA 3VBXA 4W9WA 2VV9A 1RJBA 4UYNA 4ANOA 3TL8A 3UQFA 3OXZA 1O9UA 5HO7A 4RA5A 3E92A 4AW2A 3M1SA 4BWXA 4AW5A 3R1SA 2W1FA 4MXXA 4QMQA 5CF6A 2YCRA 3R8PA 4EYJA 2I0YA 4FSQA 4IB5A 3VS5A 3PPZA 4ZZMA 5HD4A 5EM8A 4BGHA 3QTXA 3MN3A 1LUFA 2UZOA 3PG3A 2BALA 5CWZA 3ERKA 4RVLA 4ITHA 3S95A 3T9TA 1ZYLA 3C4ZA 4UXLA 4GU9A 5L2SA 5C4KA 1OL6A 5CZHA 2P4IA 4O0UA 1F3MC 4R7BA 2PE1A 1Q41A 3KF7A 3OG7A 3CPBA 4FKQA 4PQNA 4FTUA 4I6HA 3RHKA 2W4KA 1W84A 3OZ6A 3SGCA 4EQCA 2EVAA 3HV4A 3OMVA 5JQ8A 4IJ9A 3ZO1A 4ENXA 1YWNA 3VBYA 4QQ5A 4R8QA 2R3QA 4PDOA 5ETAA 2VRXA 4O2PA 2YIYA 5EDPA 5HE3A 4CXAA 4YU2A 1H1RA 2XM8A 5H9BA 1ZY5A 3T8OA 3TACA 3WIGA 2VWUA 4XJ0A 5EW3A 3NUUA 3QTRA 2ITZA 3DJ7A 2VTIA 2YCQA 4O0TA 3R02A 2V62A 2C0TA 3R73A 3I5NA 4I6BA 1OL7A 4EOLA 4WNKA 3HUCA 4FYOA 3DA6A 3FDNA 1UNLA 2R7IA 3MVMA 4BCGA 2FSOX 4QTEA 3ELJA 4I0RA 2XRUA 3WBLA 5JMSA 3Q4ZA 4OTFA 4FNXA 4L46A 3UJGA 3ACJA 4TYEA 4LGGA 5KMLA 4UX9A 1NXKA 2V0DA 5KO1A 4CRLA 1UA2A 4MNFA 4IX6A 5ETIA 3LFQA 3HA6A 3W55A 4ZLOA 5HHWA 3R6XA 4OT5A 4R7IA 4E4NA 2BRGA 3GU5A 1KWPA 4LV5A 2PZ5A 4RJ7A 4WRSA 3HVCA 3BE9A 3QQGA 4ACMA 1MQBA 2PVNA 4F6SA 4PNIA 4IE9A 5A46A 4MEDA 2UW0A 2QKRA 3AC4A 2JFMA 1Z57A 4O7LA 2IW6A 3DKCA 2JAMA 3FZRA 4HZRA 4BZNA 4F6WA 2ITTA 4WD5A 4HNFA 5CU6A 1E1XA 4ZS0A 3ZFMA 5IA0A 5JFXA 2BAKA 3QQUA 4TTHB 4EK5A 4FV0A 3PJ8A 3NYVA 3FXXA 3QTWA 4GU6A 4II5A 1LPUA 4I41A 3TT0A 1M2RA 4A07A 4IFGA 1GAGA 2XK3A 4NJDA 4XCUA 4F7JA 4QMNA 2J51A 3CEKA 1FPUA 4JIKA 4I94A 1YI3A 4FSRA 4TWCA 3CC6A 3FLQA 1H1SA 3RM7A 3VQHA 2UZBA 4OGRA 4KBKA 3QL8A 3OWPA 3RINA 5CX9A 4EEVA 4CFUA 4ZSAA 4OT6A 4QPSA 3PA3A 5EFQA 1OPLA 3B8RA 3H10A 3CSVA 4AGCA 2J0MB 3KFAA 4BB4A 5EW9A 4AA4A 4E8AA 5AV4A 3OCTA 3FV8A 4E5AX 4D1XA 1PMNA 4DTBA 4BKZA 3HGKA 1O6YA 5M09A 2V7AA 4L3LA 4WUAA 1W83A 5B2MA 3EN6A 2XKFA 4TWPA 2ITPA 3I7BA 3ATTA 4D2TA 1YWVA 2XB7A 4G9CA 5CEPA 3QCQA 3OXIA 1JLUE 2QOCA 3HP2A 4RIOA 4ZY5A 4E26A 4F0FA 4RSSA 3WF6A 1ZYSA 4AZEA 3F69A 3IW6A 4QYYA 3RP9A 4NL0A 1R39A 1QPEA 4GEOA 5JZJA 4AE9A 1MRVA 3UG1A 2CLQA 4QT1A 3R2YA 3LXLA 3TNHA 5C8NA 4D4SA 2WFYA 4NEUA 4WNPA 5HD7A 1GIHA 2YDJA 3ODYX 5JKGA 3ORZA 3F9NA 1OIUA 5E8SA 5H8GA 4E93A 5C03A 1JAMA 1WBSA 2EXMA 3BIZA 4GUBA 4JR3A 4L52A 2QURA 5EYCA 3MWUA 3HMMA 1NA7A 2Q83A 2OXXA 2W4JA 3QKKA 4IW0A 3HDNA 3QA8A 3QTUA 5LMAA 3ZSIA 4C61A 3S1HA 4N0SA 3LMGA 3VQUA 1ZOGA 2BIKB 3KCFA 4EBVA 4B8MA 1H01A 3VO3A 2PPQA 4E73A 2PVMA 4BZOA 4QMUA 4W9XA 2EU9A 3D15A 4QMVA 4C34A 2VO0A 4QPMA 1KE7A 5CF8A 3ZXTA 2J7TA 2JIVA 4YBKA 2E9PA 4O27B 4F64A 3SRVA 5HVKA 5C9CA 4EHZA 3HMIA 3NUSA 3E87A 3MVHA 1TQPA 3D5WA 3R8VA 4L43A 2IWIA 3CIKA 4DEEA 4M13A 2UZWE 1UU7A 3PWDA 2QI8A 3WZKA 2QU5A 3QALE 4XNEA 2FA2A 4QNYA 2ERZE 4M66A 2W05A 3JS2A 3SVVA 4AFEA 3L9PA 4FG9A 4LG4A 2GNFA 3N4VA 5FTOA 1W8CA 5K3YA 4NT4A 3ZS5A 4BTJA 3F3ZA 5ANGA 1OVEA 2ZV8A 2ETRA 5D41A 3LFEA 4DH3A 3NEWA 4OTQA 5L2IA 1ZZ2A 4KINA 1UU9A 4ALUA 4BDDA 2XIRA 2RF9A 4JDJA 5FP6A 4I4EA 2VGOA 4DFNA 4FKRA 3AGMA 3KC3A 4HVDA 5KMKA 2WU6A 3ETAA 4RWKA 3F3UA 4IWQA 2W5AA 3QUDA 4PX6A 5IQAA 4QP1A 3O71A 2WAJA 3ORTA 2ZM3A 3PLSA 4XRJA 3FZOA 5FP5A 1GOLA 4B9DA 3PXRA 1CTPE 2ITOA 3ORPA 3GFWA 1XH7A 3ZFYA 3GI3A 1Q8TA 4YJUA 4LI5A 3KU2A 5IQHA 4FKIA 4DT8A 4I21A 3ULIA 4L7SA 3AXWA 5FXSA 2XVDA 2OW3A 4YJTA 3UIUA 4FEWA 2W1ZA 2YAKA 4NW6A 4HPUE 1PW2A 4XH6A 2WTWA 3EZRA 4G6LA 1Q24A 4BVUA 1OMWA 1UU3A 3PA4A 1XBAA 2PSQA 4NM5A 5AIKA 1H00A 5I3RA 2WOUA 1M2PA 4MD9E 3DBDA 2ZDTA 2J0KA 2ZMDA 4H58A 1XH8A 3BV3A 5M4FA 2YM7A 3S3IA 2UZLA 2PZYA 4C02A 3PPKA 3WZJA 3Q53A 2VTMA 3GEQA 3BWJA 1YKRA 4YHJA 3KGAA 1J7IA 2QC6A 3OW4A 4I1ZA 4IM2A 1YXSA 4X6RA 4E6AA 5EM7A 5CI7A 4QMMA 3UO4A 2C6DA 2XM9A 5T6KA 4CKIA 4ZLYA 1SNUA 3EL8A 1PRYA 2W5HA 3GOKA 1OIQA 3FLYA 1QMZA 2P33A 5HKMA 3ITZA 3ZMMA 5B2LA 3H0YA 3U4UA 4BGQA 3FJQE 3QFVA 3NUPA 3BGPA 5JFSA 4F09A 4ZSJA 3RK9A 3ZM9A 4HCUA 4AWIA 4E4XA 1KOAA 4QYFA 2WD1A 2BDFA 4XOYA 4C37A 3GQIA 3U87A 3TZMA 2BIYA 3ZHPC 2YM5A 2YZAA 3QXPA 4O21A 5EG3A 2P0CA 4X6QC 3BQRA 4WG4A 3GCVA 2ZVAA 4U45A 4JQ7A 4EK4A 4O0WA 3W1FA 3V04A 2CKEA 3E3BX 4JQEA 4R6VA 3UVRA 4JDIA 4BTMA 1ZMWA 1Q8ZA 1XHAA 1REJA 3DU8A 4GK3A 2WMBA 2GDOA 1OKWA 3GNIB 3QWKA 2YWPA 3FXWA 2QOKA 4EYMA 4UV0A 4BCMA 4EH5A 5DN3A 4YC6A 4RLLA 5M44A 2GQRA 4ACCA 1W0XC 3GC9A 4C36A 5K4JA 1J7LA 4U8ZA 5BVDA 5L8KA 2X9EA 1BMKA 4FYNA 4AU8A 4H1JA 2FH9A 1K9AA 3G0FA 2C5XA 3PFQA 4EHVA 4FG7A 1AGWA 3DPKA 3OF0A 4FTNA 2JEDA 4UZHA 1MP8A 2Z60A 2WELA 3PWYA 5D7AA 5HO6A 2OH0E 3ZTXA 4O7WA 5AUUA 2PMLX 5HVYA 4D4YA 3ZEWA 5AM7A 3FSFA 4FUXA 4TKSA 4ANQA 4QMYA 2GPHA 5CANA 5EM6A 3VBQA 2B9HA 2ESMA 2YLFA 4BTFA 1QCFA 3IDCA 4EOOA 2A1AB 4UWCA 4IACA 2HENA 5HVJA 2C68A 3D83A 4RG0A 3S4QA 3SLSA 3LQ8A 3TNQB 4AZFA 4O0YA 3MBLA 1MQ4A 2WHBA 3MFTA 4FUYA 4H3PA 4J53A 2F7EE 3R2BA 4AN9A 3MA6A 2UW5A 3EN9A 4PL4A 1JBPE 4X2FA 3GU4A 4RMZA 4FGBA 2XNEA 2OFVA 3IPHA 4Q9ZA 2X9FA 2PUPA 3QYWA 2VWIA 2EXEA 2UZVA 4FV8A 2X8EA 2IVTA 2CN5A 4YO6A 4UBAA 3PPJA 1DM2A 1U5RA 4BDCA 3MFRA 3W32A 4YNEA 2EB2A 3NX8A 2G9XA 2XIYA 3LLAA 4FTOA 4I0TA 4BR3A 1I44A 3ZM4A 4OUCA 2O63A 1OGUA 4O7NA 5DI1A 2PTKA 3VBVA 3FHRA 2PL0A 3V6SA 4WSYA 3RCDA 4HVIA 3Q9YA 3FY2A 1G3NA 2CNQA 3ULZA 1GIJA 3Q5ZA 3RZBA 5M07A 4IAKA 3FUPA 4D4VA 3V3VA 1MUOA 4FKSA 4TXCA 2WEVA 1LP4A 3G51A 3HRCA 2YM6A 3D4QA 1CKPA 3DT1A 1ZMVA 4K8AA 2BTSA 3VS2A 3QUEA 2ZOQA 1ZLTA 3C4XA 3P08A 1U4DA 4FG8A 3IW8A 4D2WA 3BX5A 1WAKA 4NCTA 4EK3A 3FPMA 3I4BA 2ITVA 5HESA 2ITNA 3AD6A 3FL5A 5FDPA 3C4WA 3SAYA 4D2SA 4RJ3A 5D1JA 4FE2A 5HOAA 1JKLA 3B2TA 3EQHA 3EFKA 4RPVA 4KSPA 3C1XA 4A06A 4HGEA 4TYHA 3VF8A 3ANRA 3C13A 4TZRA 5C27A 4FV2A 3BBTB 3IGOA 2B7AA 4NKSA 3S2PA 2A4LA 4NU1A 4C2WA 1QL6A 5C4LA 4CG9A 1H1QA 1PXNA 3MIYA 1WBWA 2I6LA 4G17A 2FGIA 4DBNA 2G2IA 2E9UA 2WMVA 2ACXA 4UWBA 4XEYA 3ENMA 3H30A 4LL5A 4RFYA 5HLPA 1ZOHA 3OEFX 4IHPA 3VNTA 5DH3A 5TT7A 2VO7A 1IA8A 4IC8A 4BDKA 1GZ8A 2J50A 3G33A 5EH0A 3NZ0A 4RVTA 5KMNA 2QNJA 3DFCB 3I6WA 3TTIA 3UODA 4YUQA 3FI8A 3TDWA 2BMCA 1YDSE 3BYUA 5AR3A 4NJ3A 3TUCA 5K9IA 3ENHA 2VTLA 5BYYA 2QVSE 5BVOA 3S0OA 4HGSA 3AT3A 4DFBA 2ZJWA 5L6WL 3A2CA 4FTCA 3MESA 2J0IA 3PY1A 2J0JA 4WKQA 3PSDA 3LFSA 5DG5A 5CAQA 3D2IA 4P7EA 5AEPA 2UW3A 4BHZA 2W1HA 4MF1A 4YJSA 3PVUA 5CSVA 4A9UA 5CLPA 2GNIA 5HE2A 4KIPA 5JGDA 5CEQA 1PXLA 3AMBA 4U7ZA 3TEIA 3GU7A 3PJCA 3ACKA 2BZHB 1PXPA 2J2IB 5BVNA 2W99B 5J7HA 1OKVA 2XNPA
chains in the Genus database with same CATH superfamily
3E5AA 5EK7A 4CMUA 3PP0A 4ZTNA 3I0QA 5CSXA 4P4CA 4Z3VA 2YJSA 2WQOA 4O0RA 3DQXA 3QBNA 3U54A 3RNIA 4NH1A 3T9IA 3C50A 1OECA 2V7OA 4GG5A 2Z8CA 2QU6A 4RQKA 2GFSA 4IBMA 4F1TA 4RFMA 5JSMA 3UDBA 2G1TA 3BGQA 4M97A 4Z7GA 4NM7A 4U5JA 2UUEA 1A06A 5CU4A 4EBWA 1XH6A 2B1PA 2R7BA 2BDJA 4ANMA 2DYLA 1Q8WA 2R9SA 4HYHA 2VUWA 4IWPA 3GXLA 4JT3A 5TO8A 3U9CA 4ANNA 3QLGA 4O6LA 5EYKA 4WOVA 3EQDA 3EOCA 3EQBA 5G1XA 3REPA 1YXXA 3DKGA 4FT0A 4L7FA 4RJ8A 2ZYBA 4FT5A 5HIDA 4L8MA 4YGAA 4IDTA 4CV8A 3W2OA 1H28A 3RPOA 3UYSA 5BNJA 1DAYA 2PVRA 2XH5A 3I6UA 1J91A 3ZRLA 3QCYA 4F7LA 2JBPA 4F1OA 1Q3DA 1WVWA 4G31A 3R01A 5CF5A 5KMOA 3HECA 2V5QA 3IO7A 2X6EA 5I9VA 1J3HA 4UY9A 2QONA 5LARA 4JG7A 5ACBC 2CN8A 3FMDA 3QC4A 4IAYA 4XV2A 3P1AA 2WMTA 4NM0A 3R83A 3VHEA 3VS1A 2QCSA 3ZBFA 3ZUUA 3U6IA 2B9FA 4DGMA 3H4JA 4IZYA 4F63A 3OOGA 2GHLA 4ZJIA 2XKEA 3KRLA 3LKMA 3Q4UA 3HMOA 3OT8A 2OXDA 3COKA 2W0JA 1IA9A 4L01A 4MVFA 5LJJA 1QPCA 3FMMA 2X7FA 4EUTA 2J6MA 2HXQA 4QTAA 3B8QA 4MYGA 2VX0A 2W1GA 4H05A 2YISA 2YEXA 3IOPA 1WBOA 3NW6A 1H0WA 5GINE 3D7ZA 3R7YA 3ZYAA 4QMPA 1PKDA 4RIWB 2BAJA 3TJCA 1F5QA 3QTQA 2XYUA 2A19B 4ITJA 3MPMA 3ORLA 4U41A 3FPQA 5HG9A 4D2RA 5LMBA 5EYDA 4FZ7A 3NIEA 3RJCA 3KIOC 4DT9A 5KZIA 4MKCA 4IVCA 4FI1A 2HIWA 3R9NA 2YJRA 3SOCA 2C5VA 3UOJA 5AAEA 3KK9A 4F99A 4MF0A 1UWHA 1APME 3H0ZA 4RIYB 5CSPA 2YHVA 3VUIA 4M68A 4U3ZA 4KS7A 4MBIA 1E1VA 2BRMA 4W4YA 4AAAA 3Q5IA 4IB3A 1YI4A 5BVFA 3ZO3A 2OJ9A 1ZMUA 5E9EA 4RWIA 4AAYA 2C0IA 1OPKA 3A7FA 3C4CA 4A9YA 5AUZA 2YM4A 4M14A 3PJ3A 5C8MA 3OOMA 5K5NA 4G3FA 5KMIA 2WMUA 5AX3A 2CKPA 1P5EA 3DNEA 5AP7A 1ZXEA 3RI1A 3UDSA 4BWPA 3U8WA 3E7VA 1FVTA 2CCHA 5FLFA 3FZSA 4JBVA 4AQCA 1PKGA 3GOPA 5ETCA 2J9MA 3KRRA 5ITAA 4PPBA 4PUZA 1OKZA 2BVAA 3PRFA 5E8VA 3OFMA 5HI2A 3QC9A 4CFFA 4DHFA 3ORMA 4U0IA 2BROA 5AX9A 4QQJA 1YOLA 2XEZA 2BILB 2C5NA 3BI6A 3GBZA 3EB0A 1PMEA 3AD5A 5CEOA 2CLXA 5EDRA 5F94A 4XG8A 1LR4A 1Y8GA 3H3CA 4QO9A 2YN8A 4Y85A 4BDAA 1XQZA 2C6KA 3QHWA 3RWQA 4C62A 2OK1A 1V0OA 2XKCA 5CNNA 4DE4A 2O64A 2UVYA 3A7GA 3CLYA 3DBCA 3FQHA 4I24A 4KB8A 1KV2A 2A98A 3LM0A 4NCTC 3TV4A 4E1ZA 4YPSA 4IB1A 4ZSEA 3SQQA 4A7CA 5IQCA 3DB8A 4FTAA 2XUUA 2PZPA 1OBDA 4NIFB 2XZSA 3QX2A 3VRYA 4P5ZA 3TCPA 4I6QA 5CT0A 4LDTA 3THBA 4D4RA 2EWAA 5EM5A 2ZM1A 1HCLA 2HY0A 2B9JA 3DB6A 3ORXA 3OW3A 3ZUVA 2YAAA 3BGZA 3QTZA 5CF4A 2W5BA 4BWKA 3IW4A 5T3QA 3P23A 2JLDA 4V0GB 2VTPA 4O82A 5ANOA 5IA4A 3P5KA 4XLVA 4JBPA 4APCA 5LWNA 3EHAA 2OH4A 3KN6A 4X21A 2W1CA 4QMOA 4C4HA 3ALNA 4C2VA 3W18A 4E4MA 4F65A 5IQBA 3F5PA 3EWHA 2W1EA 2J4ZA 2J90A 4XV3A 3POZA 5CASA 2JAVA 3R7UA 3ZOSA 1YRPA 4XG9A 5GJGA 2R3PA 2CGXA 4OR5A 1BL6A 3QGWA 3BL7A 3Q9WA 5DVRA 3E63A 1Q4LA 1SMHA 3W8LA 5HZNA 4G5PA 3E64A 3W0QA 4M0ZA 4M3QA 4KWPA 3PJ1A 3TKUA 4AZTA 2B55A 4IM3A 4X3FA 3VWAA 3ET7A 4LGDA 3D5UA 1ZYCA 2JIIA 5A14A 2VTOA 3OWLA 3UNKA 3G90X 3BHVA 3VIDA 5JN2A 1FGKA 4U43A 4DG0E 1HOWA 2AYPA 4AXCA 4PPCA 1OM1A 2Z7RA 2WQBA 2R3JA 3AC1A 5AP2A 3TIYA 3A7JA 2R0UA 5J9LA 3DLSA 2JKMA 3HMNA 2A2AA 3BE2A 3PZHA 4F70A 5BVEA 4FJVA 2QOBA 3VW8A 1ZWSA 4FV9A 5CEMA 2C69A 2UVXA 4YMJA 3EN7A 1JSUA 4D5KA 2F49A 3SXSA 4EZ7A 2VX3A 3CTQA 4LM5A 5ACKA 1WMKA 1X8BA 1YOMA 2WTKC 1PMUA 3RMFA 4G3DA 1V1KA 1O6LA 1F0QA 3PXFA 4UMQA 4YLJA 1H07A 3RM6A 4AGDA 3NFFB 5CU3A 3I60A 5FXRA 2UVZA 1RW8A 4FSNA 2UZUE 2KULA 2B0QA 1OUYA 3NNVA 4L45A 4LRMA 3KULB 4EOSA 1FINA 4RWJA 2CPKE 3AC3A 3V5PA 5CYIA 2Q0BA 4FTKA 5AR5A 5BV3A 3MVLA 4FVQA 2PUIA 5CVGA 5F20A 5CEIA 4BCKA 4R78A 3NNXA 3ZLSA 4NYEA 1A9UA 4U42A 1W82A 5L2WA 4D2PA 3ZZEA 3FLWA 3DDQA 3K2LA 3COMA 3CTHA 4FKVA 4FTTA 1ZOEA 3TI1A 2C30A 4O0SA 4ALVA 3L1SA 5HLNA 5IKWA 4WSQA 4O1OA 3V51A 3COHA 2RGPA 3CQUA 3FMJA 4AT5A 2HW7A 2P2HA 4BCJA 4O7YA 3ZLWA 2IVUA 3QTSA 5M56A 2RG6A 3MTLA 4FV1A 4K18A 5JRSA 4DGOA 3UIBA 1BUHA 3BYOA 3RPRA 3R9OA 4IVAA 5IZFA 4EL9A 1WVXA 5M4IA 2WMXA 3O8UA 3FI4A 3F7WA 4A4OA 3VS6A 2ITUA 5ANKA 3DXQA 4JR7A 3E88A 2X4FA 3F88A 4O4FA 3VULA 3Q32A 3UTOA 2VZ6A 1OPJA 4HCTA 2WTDA 5GZAA 4W8EA 3MVJA 1REKA 3FZPA 5TKDA 4BBEA 4J99A 1PMVA 1XO2B 5M4UA 5AUVA 5AP0A 4ZLZA 5DHJA 3G6HA 3O7LD 1JNKA 2C5YA 4BBMA 2UZNA 5FRIA 3Q6UA 4RVKA 4R3CA 3O8TA 5IDPA 2GHGA 2BKKA 2PE2A 2X0QA 4AT3A 3OUNB 2WQNA 3MFUA 5FGKA 4E4LA 1KE9A 2VAGA 2JFLA 5JFWA 1FOTA 4U97A 5A6OA 3W8QA 5C8KA 4W4XA 5C1QB 2OZAB 3KCKA 4JAJA 3T3UA 3QKMA 3GCUA 3QX4A 4BZDA 1GJOA 4K0YA 1I09A 4TRLA 2VTAA 3FHIA 3LFBA 1XH4A 2X6DA 4UWYA 5AP6A 4AOIA 2Z7LA 5KZ0A 3JPVA 1VYZA 4AUAA 4YSMA 3I0OA 3FMKA 3L9LA 5KMMA 4D58A 2DWBA 2FUMA 4ONAA 4AXAA 3KKVA 1JSTA 4DH5A 4XUFA 3DFAA 2G01A 3LVPA 4I0SA 4QYGA 4FODA 3ZO2A 2O2UA 3QRTA 4WNMA 2W4OA 3W2QA 3D5XA 2XYNA 3CJFA 3K3IA 3DGKA 5EI8A 2O0UA 1J1BA 1ZYJA 4CFNA 1Y6BA 4KBAA 2QOOA 4ZMFA 4F0GA 3Q60A 4XOZA 1ZYDA 4DCEA 5A4CA 2WB8A 2UW8A 1PXOA 2JKOA 4FKJA 5CXHA 4ZAUA 2YWVA 3TTJA 1LEWA 4EH7A 1R1WA 2HYYA 4TWOA 5E1EA 3GCQA 4C57A 3U6JA 5DNRA 3ZH8A 3A8WA 5LWMA 5A4LA 1A48A 3DAKA 2RFEA 3R21A 4WRGA 3G6GA 3VBTA 4MNEB 4YTIA 2IZTA 3Q96A 1OIRA 4PTCA 4QQCA 5J7BA 2JIUA 3PFYA 3SA0A 4I6LA 4MXCA 4M7IA 4G3CA 3FMHA 3G5DA 4DH8A 4FZ6A 3NGAA 2RG5A 3PJ2A 5EOBA 4AFJA 5A6NA 2FVDA 2W1IA 4I22A 4JRNA 4ASXA 2ZB1A 4EH8A 2OIBA 3NVKI 1FGIA 1H0VA 1R3CA 2OICA 4HNIA 3F2RA 3L8VA 4L3JA 3FMLA 4F9CA 2PYWA 4A9TA 3OROA 3AT4A 3F7ZA 5HCZA 4RIXB 5AUTA 1NVQA 2CGVA 2JITA 4G3EA 4PDSA 4APPA 4BCOA 4BDGA 5CY3A 3MH0A 3HRFA 1Q99A 2UZEA 1T45A 3PVGA 4M84A 4KIOA 5AUYA 4BCPA 4MXYA 4ERKA 5DT0A 5J87A 3TNPC 5EQEA 5EKNA 1BYGA 3P4KA 2HXLA 2X1NA 3R71A 3WZUA 5BQ0A 4L9IA 1YHWA 5T68A 1AQ1A 5I0BA 4AOJA 5BYZA 4YJRA 4IZ5A 4ZY6A 4ACDA 2PE0A 2YFXA 5BVWA 2F57A 4UMUA 4QMSA 2CJMA 1G8KA 3QGYA 2B9IA 4BDBA 3UVQA 4X3FC 2GHMA 5LOHA 5AWMA 4XBUA 4TYIA 3W10A 4CFXA 4B6LA 4AT4A 4QMZA 5C01A 3GT8A 4FKGA 1YHVA 2XCHA 3SX9A 4GIHA 5CAPA 2ZMCA 4FKUA 5IQIA 5TR6A 1PYXA 4ZTRA 2PUUA 4MXAA 2W1DA 1UNGA 4Y5HA 4YLLA 3NUYA 3LIJA 1W7HA 2R3MA 2AC5A 1ERKA 3LMHA 1H27A 1RDQE 2ITWA 5FEQA 4JRVA 3BWFA 1TQIA 4E3CA 2BRNA 2VWYA 2QLQA 4RC2A 4M8TA 4D55A 3CQWA 1JWHA 3LFNA 4EOKA 3QLFA 3B2WA 1UWJA 3CY2A 4FTIA 3T3VA 5HTCA 4ID7A 4CZUA 3VRZA 1H25A 4KSQA 4WBOA 3MA3A 3HKOA 3QHRA 4PDPA 4DITA 4LOQA 2QOLA 2OJJA 2BCJA 3DK3A 4OTGA 4P90A 3R00A 4GFMA 4C58A 4FIIA 3CKXA 1PY5A 1SVHA 4KA3A 1OITA 3QXOA 4DEIA 1G8JA 2PZRA 3FLSA 5JFVA 2P3GX 2IVVA 2JKQA 3E62A 4BIEA 3BHYA 3I7CA 1OI9A 3WF5A 2OXYA 4OW8A 2W17A 4F6UA 3Q3BA 3UE4A 4B4LA 1SNXA 2OBJA 3DK6A 3ROCA 3VJOA 3EFJA 4R7HA 3F3VA 4L67A 2R3HA 4PNKA 4XV9A 1DI8A 4ITIA 3SG9A 1OL1A 3A60A 3DJ5A 4RFZA 5HO8A 4I92A 4CMOA 1H1PA 3DKFA 3DBEA 2XBJA 4AXEA 3UMWA 4FV6A 4FF8A 4W4WA 4DGLC 3CS9A 5DRDA 3QAME 2GU8A 5HX8A 3Q4TA 3F3TA 4E5BA 5IQDA 2CGWA 3C5UA 4QP2A 5J8IA 5KKRC 4KKEA 1OL5A 3HRBA 3UOKA 4EHGA 4N6YA 3VS0A 4ZSLA 4KIKA 2XK6A 4CFWA 2JDVA 2QR7A 4G16A 3C7QA 2XNMA 4QMLA 4O7RA 4ZJVA 3KA0A 3D5VA 4FSMA 2BKZA 4I4FA 4QOXA 5A4QA 3ZEPA 5AR4A 4EQMA 4JG6A 1ZRZA 4O83A 4FTMA 4JBOA 4N57A 1UU8A 2B4SB 4X2NA 2VD5A 3OP5A 3R1YA 3V5TA 4BCNA 5GIOE 3WI6A 2OF4A 3QQJA 5CQWA 4TN6A 3LE6A 4IAZA 4TNDA 4U44A 4Y73A 4PMPA 2IW8A 1H1WA 2GNHA 2RFNA 3EQGA 2WTJA 4NUSA 2PWLA 3R8MA 4AN3A 2R3RA 4CGAA 2ONLA 4MH7A 3MV5A 3HX4A 4M69B 1IR3A 3HYHA 4LGHA 4MXOA 4IAFA 4TT7A 5A54A 2CGUA 4ZY4A 4O6EA 4QNAA 3AD4A 4YPDA 2JKKA 5DEWA 5E8YA 1NW1A 3IKAA 4B8LA 2XK7A 3EL7A 5F95A 4ENYA 5L3AA 4ZS4A 4ARKA 4GJ3A 3TYKA 4Q5EA 3MDYA 3OXTA 2XBAA 2YDIA 1Q8YA 3ANQA 4IANA 5DR6A 1S9JA 3C9WA 3II5A 2PVHA 2GQSA 5J5TA 3D7TB 4EOQA 3DXPA 3MJ1A 4GCJA 3H9OA 4FTQA 4M15A 4DFXE 4NKAA 3UOLA 3UGCA 2O5KA 2RFSA 3MTFA 1OL2A 4MD8E 3OC1A 3P7AA 5IQEA 4RZWA 3KQ7A 4GJ2A 1QPDA 4BFMA 4DYMA 4BY9E 4FK6A 1XMMA 3AKLA 4G34A 3ZDIA 4NTTA 4XYFA 4I5PA 2A27A 2YDKA 3SXFA 5L4QA 3UPZA 2GS7A 1M52A 3MY1A 1YI6A 1PF8A 4UYAA 2QG7A 4J1RA 4I5CA 3FXZA 2CCIA 3WARA 3O8PA 2QO9A 4FNWA 3W33A 5DRBA 3NAYA 3MSSA 4AXFA 3FC2A 4DC2A 4O84A 4KD1A 4YLKA 3A61A 3BRBA 3FMEA 3FC1X 5DLSA 3DY7A 4C0TA 3OCBA 2BZIB 4FL3A 4OBQA 5K5XA 4O86A 4AG8A 4CD0A 2YCSA 2HWOA 4GG7A 5EDQA 3V5LA 3ZU7A 5LVNA 4DN5A 4EKKA 3FLZA 1FMKA 3K5VA 3Q04A 4CQGA 3A8XA 3BEAA 3HA8A 2OZOA 3D0EA 2XJ1A 3BLQA 3KXXA 3JVRA 4JG8A 5AV0A 5CALA 3CKWA 4DLIA 1Q61A 4H39A 2NPQA 5IMXA 3LQ5A 2C0OA 3TKIA 5M4CA 2VTRA 1O6KA 1WBVA 3LCDA 3CPCA 4FTJA 4JOAA 1CKIA 4XX9A 3VVHA 3HEGA 4FVPA 2GQGA 1Y8YA 3HP5A 4GFOA 4R1VA 4ZXTA 2BHEA 4NFNA 3V8TA 5A4EA 2VX1A 2YM3A 3TZ8A 3GP0A 3HV3A 5KUPA 3EQCA 3ODZX 4FT7A 5CVFA 3I1AA 3VUGA 3EQFA 1H08A 2ZAZA 4EH6A 4YC3A 4BI0A 5IEYA 1URWA 2QHNA 4JJRA 4BC6A 2PVFA 4BKJA 4C3RA 4R5YA 5AR2A 5IH5A 2YZLA 1JVPP 1OB3A 2QQ7A 3UIMA 4U6RA 3FZ1A 2I0HA 5CVHA 2R64A 2EUFB 3LCKA 5CENA 5L6OA 1IAJA 2XCKA 3D94A 2X7GA 1BX6A 4ANSA 3TUBA 5BX0A 5ICPA 1ATPE 1LEZA 4IX4A 3PP1A 4QMTA 3L9NA 3LXNA 4I5MA 3V5QA 3ZONA 1OUKA 4Y46A 3LCOA 1JPAA 4QTBA 1GZKA 4KKHA 3VC4A 4V01A 4FIJA 1GIIA 4K1BA 1KUTA 2QD9A 4J7BA 4AZSA 3RWPA 2QODA 2VWXA 3R28A 1Z9XA 4FIGA 2OO8X 3LAUA 4HJOA 4HYIA 1H8FA 4QYHA 3RZFA 3WOWA 4AGUA 4HVSA 5IA2A 3HUBA 3VN9A 3KN5A 2FB8A 4J52A 5I4NA 1J1CA 3SW4A 3FKLA 5KMJA 1VJYA 4C4EA 4J97A 1VEBA 3POOA 3D2KA 3PSBA 3EFLA 2B52A 4X0MA 2QOIA 4BCQA 4EQUA 3G2FA 4J8MA 4O7TA 2XS0A 2X7OA 3CGFA 5HG5A 4D9TA 5IH4A 4S30A 2ZM4A 4F9YA 5IU2A 3VHKA 3MS9A 3TKHA 4J95A 4YJNA 5LVPA 5EHYA 1Z5MA 4CFMA 4EORA 2GMXA 4GT5A 3WF7A 3SKCA 5F9EA 2NRUA 4C4FA 4L68A 4O1PA 4XP0A 2HELA 5DR9A 3GC8A 3BLHA 3TV6A 2QOQA 4XHKB 2UW6A 2HOGA 5HGIA 4U40A 4RWLA 5BUEA 3R8ZA 5GNKA 5FWKK 2WEIA 3IDPA 3F5XA 4H36A 2HCKA 4PWNA 4EUUA 3TM0A 2UZTA 4PF4A 3O96A 5EKOA 5DMZA 5KHWA 3VUHA 5JGBA 4PTEA 3WIKA 1XR1A 4O38A 3P86A 3R1NA 3FZTA 2YACA 3ZO4A 5LMKA 3EQIA 5IH6A 4O7VA 4O91A 3D14A 3CCNA 5CAVA 4RX8A 5K0KA 4QP6A 2WIPA 5EQYA 5FUTA 4UMRA 2F2UA 4EWQA 3HLLA 4EK6A 5IQFA 2QR8A 4YO4A 2Y4IC 4RZVA 4DAWA 3IQ7A 4JXFA 3LJ2A 3PRIA 4ZZNA 3QTIA 1XJDA 2VWWA 4YTHA 4Q9SA 3EH9A 3NAXA 1W2FA 2ETKA 3UNZA 4F0IA 3NUAA 1PXKA 5AADA 2WTCA 1TKIA 4UEUA 2EXCX 3MH2A 2X81A 4PY1A 4BDFA 4EZ5A 2BDWA 2R3LA 5TE0A 2Y0AA 3ZDUA 4AZWA 3KXNA 3JR1A 3C4EA 4BDEA 3SRVB 2ONLC 3DZQA 4IDVA 4YTFA 3R1QA 2IZUA 2W9ZB 4S34A 2H34A 3ROYA 3UP7A 4FR4A 4EOPA 4JNWA 5TF9A 4BYIA 5CSHA 2IEWA 5A9UA 3WZEA 2HW6A 2YERA 3EYGA 1IAHA 3AKJA 4IQ6A 3G9NA 4F08A 4FEVA 3OY1A 3NNUA 5DT4A 4AN2A 4C4JA 2A0CX 5HEZA 4AE6A 4AX8A 3GCSA 3R9DA 2XIKA 4DHJA 2REIA 2UZDA 3BHHA 3L8PA 1KE8A 4FOCA 3TIZA 5AA9A 3W0NA 4XG3A 2BFYA 1M17A 4DH7A 3DDPA 4I23A 4DEHA 3F3WA 1YVJA 3AQVA 3DBFA 4MTAA 4RT7A 3RBWA 3PLAE 3E8CA 4IM0A 3GUBA 3HV5A 5IUIA 3U9NA 3LOKA 4JDHA 4WIHA 4S33A 2AUHA 3BYVA 1VYWA 5A3XA 3BL9A 4AW0A 4NWMA 5E8TA 2CNUA 4RLKA 4YSJA 3ZLYA 3L8XA 3NFGB 3BHUA 3Q6WA 3R7GA 3SD0A 1NVSA 3DZOA 3UG2A 3F6XA 4MAOA 1ST0A 1Y6AA 5DPVA 3QYZA 3V8WA 3R30A 1U54A 1WZYA 4O0XA 4D1ZA 5B7VA 3K5UA 4RX7A 5BUJA 4MXZA 5IISA 4QP8A 2H6DA 3GU8A 4MWHA 3NWWA 5AJQA 5AM6A 2Y8OA 2LAVA 2X2KA 4O0VA 3AMYA 3V6RA 4UN0C 2WXVA 4FGRA 4HGTA 4KS8A 5AMNA 2VNWA 2J5EA 3LJ1A 2VGPA 2VTHA 4GL9A 3G9LX 2VWBA 3IONA 4YJOA 3RK7A 2H9VA 3C51A 5CTPA 4ZSGA 4QQTA 2NYAA 3DCVA 2W96B 2WMRA 4LL0A 5HICA 3QRJA 4XG7A 4FVRA 1FQ1B 4D5HA 3VS7A 2UW7A 3DAEA 3PYYA 4FEQA 3DXNA 4YJVA 3FYKX 3WYXA 3ZFXA 4M67A 2B53A 3CY3A 4MQ1A 4NW5A 4RC4A 5BMMA 3ZSGA 1PYEA 1DS5A 2C6IA 1JKKA 4NSTA 1NT2A 3BLRA 3HL7A 4FZFB 4O4DA 4BF2A 2IW9A 5HIEA 1CKJA 4HYSA 4FEUA 5L8LA 1FVVA 5H3QA 4CLJA 4LOPA 5L2TA 5HCXA 3M2WA 4JX7A 4L3PA 4C3PA 3LQ3A 3UZRA 1XH9A 2B54A 3E3PA 3A4PA 4DEDA 2ZV9A 2OSCA 4MCVA 5ANJA 3LW0A 5IPJA 4AGWA 4PTGA 2C6EA 5KNJA 1SVEA 2C6TA 3CJGA 2GTNA 2OGVA 5BVKA 4DDIA 1W2DA 1SM2A 2BRBA 2Y7JA 4BDIA 5D11A 3C0IA 1IG1A 1FVRA 3GENA 4S2ZA 4ZTLA 2C1AA 4HGLA 4DEGA 4E6QA 2KTYA 2XAMA 5I3OA 2YCFA 4FRFA 4IADA 4FKTA 4C35A 4QP3A 2IZSA 2WGJA 3RVGA 4QP9A 4MX9A 5L6PA 1OBGA 5J1VA 3EQPA 3Q2MA 2YITA 3JVSA 3TMOA 5FEDA 5CNOA 4S32A 4XS2A 2PZIA 4F9AA 2QLUA 2WTIA 5E1SA 2BPMA 4C33A 4DFLA 3BU6A 4IIRA 3BLAA 3RK5A 2BZKB 3ORKA 4CT1A 4JMQA 3RALA 3EIDA 4E5WA 4AP7A 3G0EA 3RNYA 2Z7SA 4GV1A 4JX3A 4BJJA 4EOMA 3VF9A 5CU0A 5LCJA 1L8TA 4RX9A 5J1WA 3PXZA 3DJ6A 4R3PA 4WG3A 3FBVA 5HE1A 3E8EA 4TWNA 3FQEA 1R78A 4IX5A 5GJDA 3VUMA 4DLJA 2GNLA 4B0GA 1Q8UA 4BBFA 4N70A 3BEGA 4EH3A 3NMUF 1M7NA 3W16A 2WTVA 2YABA 3KVXA 5DA3A 1BI7A 3OEZA 5IA1A 3UZPA 1Y57A 4W8DA 4CQEA 2G15A 3NUXA 2XANA 4JAIA 3RAWA 5JT2A 3QWJA 4UXQA 1YW2A 5F1ZA 2FSTX 4QDVA 2GNGA 1Q62A 3AC2A 4V04A 3UIXA 3A4OX 4XMOA 5DWRA 5DT3A 5IUGA 2QO2A 1NVRA 4RBLA 2E9VA 2F7XE 2X2MA 5IEVA 1YDTE 4ORKA 2C5OA 3A7HA 3KRWA 5EI6A 3UQCA 3AC8A 2WMWA 3BYMA 3NCZA 5EYMA 3BU3A 5J79A 4P5QA 2PMOX 4BTKA 2R3NA 5IA3A 3ZZWA 4X3JA 3M11A 4H3BA 4K2RA 4X2JA 3GCPA 3UC3A 3NNWA 3CE3A 5J9ZA 2BRHA 4N4SA 4QPAA 1Q3WA 2UV2A 3E8NA 4UMPA 1XH5A 4YZ9A 3FWQA 2VN9A 3SOAA 3N9XA 3BYSA 3WE4A 4GIIA 4DH1A 3KXMA 3LCTA 4MBLA 5BPYA 2GNJA 3DTWA 4FKPA 3TV7A 1YOJA 2XNNA 5LMKC 2R0IA 3R0TA 3K3JA 2C1BA 3R04A 2QOFA 4BI2A 2RSVA 4O4CA 3ZRKA 4K6ZA 5AP1A 3NYXA 3DTCA 4YBJA 3TUDA 1B6CB 2XJ0A 4GFGA 4IH8A 2IJMA 3IW5A 4GK2A 3UBDA 3ATSA 3LXKA 3SC1A 3SXRA 2I0EA 2BTRA 2F2CB 3W0RA 4Z9LA 3PE2A 5DR2A 5I9WA 3FL4A 2LGCA 3OBGA 4LFIA 3VAPA 3ZC6A 4AOTA 2R2PA 4LRJA 4RJ5A 2CDZA 4ZTMA 5G6VA 4KIQA 3FKOA 2WU7A 1GZNA 4D9UA 2QKWB 4JS8A 2X0GA 4IWOA 5H8BA 4GT3A 1MRUA 4C4GA 4TYHB 4ASEA 1U46A 4DBXA 4BDJA 3LFDA 2C3IB 4ZTHA 3F2AA 4R3RA 2GTMA 4GS6A 5HE0A 1VR2A 3AG9A 4YJQA 5LXMA 3SHEA 3R22A 3VUTA 1PHKA 2E9OA 5J5SA 3GB2A 2CHLA 4R1YA 5HCYA 3PIYA 2ITQA 4EJ7A 4IAAA 4DFZE 2DUVA 4YZCA 2OF2A 3O7LB 4NFMA 5HG7A 4EONA 4RJ6A 4GVJA 3ZXZA 4Q5HA 1KOBA 3UZTA 4A4LA 3N4TA 4ZOGA 3PUPA 4AZVA 2NP8A 4HPTE 2BFXA 4YURA 4DTKA 1L3RE 2OG8A 2HZ4A 1KSWA 3TZ7A 5BYLA 3GVUA 3KRXA 3QA0A 4IWDA 4CVAA 1IASA 1PXMA 3RTPA 4A9SA 2J0LA 2XEYA 4FSWA 2RIOA 5JRQA 1BLXA 4KKGA 1H26A 5E8ZA 3VBWA 4RX5A 1YXVA 3MGYA 4GYIA 3KF4A 5FD2A 4LYNA 4C38A 4PV0A 4OTDA 3WILA 3MJ2A 4FKOA 2WIHA 2YIWA 4RGJA 2RL5A 3QZHA 4CZTA 2OKRA 5AUXA 4X7QA 3KREA 4CEGA 3H9RA 2XK4A 2HAKA 5H8EA 4IXPA 4EJNA 4FTLA 4FNYA 4GVAA 4OAUC 2XF0A 1OIYA 2VO6A 1SVGA 4FSTA 4IFCA 1VLRA 2WMQA 4NK9A 5DFPA 5FXQA 3D9VA 1B39A 4C3FA 2I1MA 4AA0A 1E9HA 2BZJA 4XG6A