4QNAA

Mst3 in complex with 2-(4,6-diamino-1,3,5-triazin-2-yl)phenol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
284
Chain Sequence
NLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 284
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qnaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qnaA01
4I5CA 3CGFA 4PP7A 3Q6UA 1YI4A 4C33A 3KQ7A 3LM5A 5DG5A 2V7OA 4DEBA 4L9IA 4G31A 3KRJA 4BVUA 5H3QA 5CEQA 4O83A 3GU6A 4YJOA 5FP5A 1YOMA 2W5AA 3KRLA 5L2QA 5LVMA 5M4UA 1A9UA 2R2PA 3F61A 4C3FA 2YIQA 2JD5A 4FVQA 3QQGA 2QOKA 4AZVA 3BEAA 3EWHA 3PVUA 4OTRA 5AA9A 3CQUA 3QZIA 2GQGA 3PUPA 3RNIA 4Z9LA 1PXMA 2OXYA 3LOKA 1XKKA 4GCJA 4AGCA 3PIZA 3A60A 3E88A 4G6NA 5BVWA 3DJ5A 4JRVA 4RC2A 4RG0A 4ENYA 4PDPA 3VS3A 2J5FA 2HW6A 1CKJA 4UYAA 4DBXA 4ACDA 3GOKA 1H1SA 4W4XA 3RVGA 1J91A 3OG7A 1WZYA 3UO5A 2X8DA 3QF9A 4RPVA 1H1WA 4I21A 4CMOA 5IA0A 1K9AA 1TKIA 4M7IA 4BDFA 3C5UA 4A4OA 2GFCA 4ALWA 1H27A 4ZMEA 1E1VA 2GU8A 2J0KA 2VWIA 4FYNA 3G33A 5KE0A 4MBIA 2YM8A 5DRDA 5E8SA 3Q9ZA 5KUPA 3KKVA 3KFAA 5CF6A 5JGDA 3UG2A 3FQSA 3GCQA 4X3FB 1BYGA 3I5NA 3QCYA 4JXFA 3NRMA 3V01A 4BCJA 2UZNA 3RM6A 4GFOA 3VBVA 1JQHA 4RQKA 1YQJA 5FEEA 1F5QA 1GZOA 2E9UA 3W8LA 5M09A 4EOKA 4C2WA 5B0XA 5B2LA 5HVJA 3RPSA 3T9TA 2PU8A 3ULZA 2QR8A 4MBJA 4C58A 3CTHA 2CLXA 4EBVA 2ETKA 3HV5A 3ETAA 4BF2A 4QTDA 2BDWA 3C4XA 4RGJA 4MEDA 4XRJA 3W2PA 3F3TA 3Q52A 5IQAA 4EK8A 2FSOX 4QP8A 1OKZA 5AV0A 3UIBA 3BX5A 2WFYA 5I9VA 3VO3A 3FZOA 5CS6A 4ZS0A 5CASA 4AFJA 5KMLA 4YU2A 2XVDA 2BALA 2UW6A 4FSTA 4F7LA 3QKKA 5ACKA 3B2WA 2W5HA 3GU5A 4GJ2A 3NUNA 4EYMA 3NVMB 2VO6A 5K4JA 3SG8A 3MY5A 4FKPA 4JT3A 4C7TA 1UU7A 3EL8A 2GHLA 4DH1A 2OGVA 4FV7A 3KCKA 5CAOA 3ORKA 5HTBA 3SG9A 3V8WA 3OOGA 5CT7A 5AV1A 5TO8A 2QVSE 2PK9A 2QOIA 4M12A 2A27A 3A4OX 3TDVA 4LGDA 4MD9E 1JVPP 3HA6A 1XH5A 3I6UA 5A4EA 3RMFA 4K2RA 4YJNA 4LMNA 3BE9A 3P86A 5AR5A 3PVWA 5I5ZA 1BL6A 3Q96A 4IWOA 3FMJA 5HICA 1PMNA 2PYWA 5FEDA 4DGGA 2B4SB 1WBOA 4I20A 2IW9A 3BKBA 4JAIA 1JWHA 1Y6BA 5DR2A 3ATTA 1H00A 2VN9A 5DT4A 3FI3A 4DAWA 2GCDA 2UVYA 4QP7A 1UKIA 4APCA 4DEHA 5H8GA 2E9OA 5AP5A 4JR7A 2XEZA 3P7CA 2FA2A 4DFZE 1APME 3RK5A 4G9CA 3NW7A 3MESA 4FEQA 4ASEA 4M13A 3UVQA 4F0GA 2VZ6A 2XBAA 2UZLA 4FV6A 1S9IA 4ASZA 2VTPA 3PXYA 5BMSA 5J87A 4G6LA 4BL1A 4DG3E 4FKRA 5AUTA 3NX8A 3QZHA 2WTKB 3LCSA 5CVFA 1GY3A 3TV6A 4UWCA 5D7VA 4CCBA 2QU5A 4F9YA 4I5HA 4EOIA 4YTCA 4ORKA 2DQ7X 3WYYA 1M17A 2WD1A 2I0YA 4FK6A 3A7HA 4FV2A 4D0WA 2GDOA 2OXXA 5EDPA 4AW0A 4QP2A 2JKMA 4E1ZA 4OUCA 3SXRA 2VTRA 3MH2A 5AR8A 4A4LA 2G2FA 3F9NA 2XP2A 3QRJA 4QMTA 4ID7A 5A6OA 5IEVA 3FLYA 2JBOA 4XV1A 3U4WA 1YRPA 4RT7A 3FI8A 5ETFA 3PP1A 4FVRA 3ZHPC 4ZY5A 4O0UA 2WMAA 4N6ZA 2Y7JA 5CEKA 3RHKA 3HV7A 5HVKA 4O81A 4V05A 1IRKA 2YA9A 4XS2A 2P2IA 2RG6A 2XH5A 1WCCA 3Q53A 4RFZA 1UU3A 5HCXA 1ERKA 4WSYA 2VD5A 2PUUA 3VBYA 3CTQA 2PL0A 5IG1A 5IQCA 3ORPA 5F94A 4L3LA 5EQYA 4EQCA 5B7VA 3KK9A 2AC3A 3POOA 4HPUE 4CFMA 1OBDA 5LVLA 4FF8A 3G51A 3UO4A 3I79A 3WZEA 4O0WA 5L2WA 4DG0E 4WNMA 2ITUA 2IVUA 4AS0A 5AUUA 4FTNA 4HZRA 4NSTA 5HIBA 4BDCA 4ERKA 3ID6C 3QD0A 3P1AA 5JZJA 2ESMA 4O2ZA 4ANSA 3KXMA 1B39A 4JNWA 3ANRA 3DZQA 2C3LA 4FZ7A 5CI6A 4BWKA 4TT7A 3REPA 5CZHA 4I41A 3U8WA 2C47A 4W8EA 3ZM4A 3DBDA 4GT5A 3MB6A 2RGPA 5EDQA 5J9LA 4OR5A 3HYHA 4HNIA 1REJA 4NIFA 4CZTA 1O9UA 4DGNA 5IQBA 4L7FA 2UZEA 3PRIA 5L8KA 3AGLA 4G16A 4HCUA 3TTIA 4GJ3A 3KN5A 3NZ0A 1R1WA 3ROCA 2XNPA 1OVEA 2B9IA 5ETIA 4BKYA 5BUIA 5FD2A 4USDA 5CU6A 3LXNA 5EM5A 5HVYA 4BCIA 3EHAA 2WMSA 3PA3A 4FNYA 4FV1A 4G3CA 3RAKA 4FG9A 2PZYA 4DA5A 1G8AA 5H8EA 3GCSA 2BRNA 3QX2A 1H0VA 4GFMA 3TIYA 2Z2WA 3OWJA 4YHTA 4FI1A 3VUGA 4DCEA 2JAMA 3ZC6A 3H9RA 1LUFA 4U40A 5CENA 1FGKA 5LARA 4A07A 4KIKB 4FKOA 4QQTA 3ZUTA 3VS4A 3E87A 3UZRA 2BKZA 3MPMA 2BIYA 2GNFA 2VWYA 3SHEA 2EU9A 1HCKA 2IW6A 1UWHA 5EQEA 2HZNA 2Z60A 4QT1A 4DITA 1XWSA 5AIKA 4ZSAA 2ONLC 4KS7A 2W1ZA 1R0PA 3RPVA 1SMHA 3SXFA 2C69A 2FUMA 4EH5A 2X39A 5BVDA 5I9XA 4NUSA 2X1NA 4FTOA 5HG9A 4FTUA 4XG9A 1JPAA 3L9PA 4EOQA 1OMWA 3ZCLA 3DKFA 3AGMA 2HIWA 1QPCA 2C5XA 2QD9A 2X9FA 3QTSA 5B2MA 3GC9A 4Y73A 1M2RA 5FWKK 4A9RA 5EYKA 1FVVA 2I0VA 3D5XA 4HGTA 1O6LA 4X2JA 3HMPA 3NNWA 3R1SA 4F0FA 3U54A 4BN1A 1ZYCA 2WTCA 2OFVA 4O0XA 4P90A 4I1ZA 3UE4A 4B9DA 2O2UA 2UW9A 2XBJA 3AT4A 4S32A 2ONLA 3ORMA 3BCEA 2GS7A 1TVOA 3DOGA 4FL1A 3HAVA 3D2IA 5HIEA 4QP4A 4F70A 5F95A 3RZBA 1BI7A 3K3JA 4IAKA 4UMTA 1XR1A 3VHEA 4RX5A 2BFXA 4FOCA 5HI2A 3DS6A 1GAGA 2Q0BA 4YLKA 1F0QA 3KA0A 4E6DA 1OIUA 4XG6A 2X4ZA 4IB5A 2OZOA 4IEBA 1XH6A 3HV4A 4EOLA 1WBNA 3PA4A 1KE7A 4XP0A 4BBEA 4DLIA 4IB3A 4FTJA 5E8YA 3HNGA 2GHMA 3MVJA 3W32A 4EOMA 4LRJA 5M44A 3F2AA 3FMMA 4RC4A 1P4FA 5JQ8A 2PE0A 2HZ0A 3KREA 3NUXA 2BZJA 3II5A 3OP5A 4ASDA 4U41A 4NM3A 4AZEA 4HGSA 1YHVA 4OTWA 4Y5HA 5CAVA 1URCA 3D94A 5FXRA 4FTQA 3Q2JA 4K6ZA 3F69A 2VWXA 3MA6A 2W1CA 2J50A 3LPBA 4PNKA 4FTMA 4QMVA 2B7AA 4BCHA 2YM7A 2X4FA 3KULB 5JFVA 4DH7A 3Q5IA 1VR2A 1IEPA 5IQEA 2Y4IB 1PY5A 3MTFA 5AX3A 3GUBA 3UP2A 3NSZA 2VWWA 3WBLA 3R1QA 4E73A 5AP0A 5EM7A 4R3CA 4JR3A 3BHTA 4I0TA 2B9FA 3KVXA 2OSCA 3A8WA 3OXZA 3C13A 4YC3A 2I40A 4F1TA 3AMBA 3MVMA 4QQCA 3FMLA 4Z16A 4E5BA 3CD3A 3KCFA 2E9NA 2O0UA 5E8XA 2CCIA 2XIZA 3VJOA 3FY2A 4DEDA 4II5A 3IPHA 4HOKA 4QMUA 3KU2A 4A7CA 2QQ7A 2YACA 2W1FA 5ANIA 2Z7SA 4KIQA 3PPZA 2OG8A 3CSVA 4F1MA 4IQ6A 4GH2A 3HRFA 1H24A 4UWYA 3R83A 3V5QA 4F9CA 2YZLA 3P08A 4QYHA 4BBFA 3ORIA 3OT8A 2R0UA 2QNJA 4AW2A 3NIZA 1J1BA 4EL9A 4OAVB 4TPTA 2BTRA 3PA5A 4CXAA 5AIRA 4LQMA 2PWLA 2EXMA 3R8LA 3QRKA 4XJ0A 3WOWA 2F49A 5J9YA 1OL1A 5CX9A 3UIMA 3VUMA 1PRYA 3GGFA 4EZ5A 4C4HA 5M51A 2Z8CA 3HP2A 4JVGA 2I1MA 3DU8A 2IZSA 3GC0A 3BYSA 4O0RA 1JKTA 3VNTA 4CSVA 4AG8A 4GIHA 5KKRB 1ZY4A 3MTLA 1MRVA 4MWHA 3I0QA 3TZ8A 3AT3A 3GVUA 3QQHA 2XZSA 1WVXA 4LGGA 2RL5A 5CAPA 1JLUE 4EK4A 3U9CA 4KKEA 3VHKA 3I6WA 3P5KA 3MB7A 2QOBA 4BYIA 3E93A 1ZYLA 4YHJA 4O1PA 3TNWA 4FKTA 4IW0A 1DI9A 5A6NA 3DZOA 2XS0A 3LCTA 3SD0A 3A7JA 3BE2A 3OW3A 3A7FA 4ZXTA 4FV0A 3VAPA 4AOJA 5A9UA 2IZRA 4GFGA 4TYJA 1BUHA 4YBJA 5FXSA 3UOJA 4MK0A 4R7BA 3TNQB 3TJDA 2XKDA 3AOXA 3WARA 2O64A 4G6OA 4BGQA 2BAQA 4JDIA 2GS2A 4KBCA 3GQIA 2BTSA 5HHWA 4UZHA 5C27A 3PSDA 1R78A 3QQUA 2FH9A 5CLPA 3R9NA 4EHZA 2VTOA 4RX7A 2PVMA 5HZNA 2QKWB 1RJBA 1KSWA 2XKFA 2C0OA 4D1SA 5CXZA 1JBPE 2YJSA 2VNWA 2UZVA 3WI6A 2QKRA 3F6XA 1U5RA 2VO7A 2WZJA 3GQLA 3HX4A 4O0YA 3S00A 1H8FA 1Q61A 5E92A 2EB2A 4RIOA 4IAAA 2BILB 3CGOA 4OBOA 4Q9SA 4DFYA 4HYHA 5L2TA 1BLXA 4FZDB 3LFQA 3JVRA 1NVRA 1E9HA 3LZBA 3U87A 3EIDA 1J1CA 3A61A 2CKOA 4WD5A 4BDHA 2XNGA 3O96A 4GRBA 4G5JA 3TI1A 3V8SA 3V5TA 4IMYA 3LJ1A 3RCJA 3NNXA 3E7VA 4XV9A 1XQZA 4D55A 2XK9A 5AMNA 4F65A 1IG1A 1OUYA 3MPTA 3LE6A 3OW4A 3FWQA 1IA9A 3F3VA 1UNGA 3BV2A 3R7IA 1YOJA 2RF9A 3FQEA 3V8TA 3GFEA 5C8NA 2OIBA 4IDVA 5CNOA 3RWQA 5JFSA 3L9NA 1YXSA 2IJMA 3MY0A 4H3PA 2XKCA 2W1IA 4EQUA 4TW9A 4X2KA 2RG5A 2JIVA 4ACHA 4JBVA 1QPEA 1MRYA 2ITZA 2OIQA 2QO9A 3EQFA 4FBXA 4EH8A 5ITAA 4M68A 3QHWA 4I24A 2VV9A 4NFNA 4ZTSA 4MNFA 1AQ1A 1W0XC 3RALA 2WMTA 4CRLA 3EKNA 4KSQA 2AUHA 4D2RA 4DG2E 4ZTQA 3CXWA 3NVKI 3TNIA 2GQSA 4FR4A 1WAKA 2IVVA 3R30A 1Q8UA 3DGKA 3VC4A 4QOXA 3VVHA 2X6DA 1QCFA 2NP8A 2OJIA 3DQXA 4IM3A 3ZH8A 5BYLA 4OTGA 2W7XA 3EKKA 5CALA 3QALE 2J90A 4B8MA 2CLQA 2OXDA 4RA4A 4E93A 3N4UA 4YC6A 2A2AA 3KGAA 2OH0E 3CJFA 2XNOA 1V0BA 3DXNA 3M2WA 4L68A 3OEFX 4UYNA 1RDQE 4J97A 3HV3A 2CDZA 1KV2A 2OJFE 1VEBA 2QHNA 3NWWA 3BBWA 4YC8A 4U97A 4M67A 1Z9XA 4YPSA 3H10A 3QC4A 3A62A 4Z3VA 4XG4A 1H1RA 4L67A 2A0CX 2WXVA 3ELJA 3RJCA 2Z7QA 3KXZA 4GYGA 5TOZA 3D9VA 2PZPA 4IX5A 4TXCA 4BZNA 5M57A 2F7EE 2X9EA 4J7BA 3U6IA 3UIUA 3UQGA 1ZOHA 4BCQA 2X7FA 5M53A 5ICPA 4E20A 2GPHA 3DDPA 4CLIA 3G15A 3JY9A 3IW8A 3ZRKA 3M42A 4FV5A 3OT3A 4M0ZA 3ZS5A 4NCTA 3MIAA 3FYJX 3U6JA 4EEVA 4J71A 3MJ1A 4UMPA 5JMSA 3ZBFA 5TKDA 4MXZA 5C8MA 4HYUA 4MD7E 1PW2A 4WUAA 4BKZA 4MCVA 4MVFA 2YLFA 3TZ9A 4XRLA 4XYFA 3ODYX 5HG7A 3RZFA 1U46A 2B1PA 4B8LA 4EWHA 3D5UA 2QODA 2ZVAA 4U79A 4XG7A 5DEYA 3E62A 4MNEA 3VBQA 4DH3A 3P79A 3CY3A 1R3CA 3VF9A 2QI8A 1OUKA 2JKQA 1XBAA 4FICA 4QYFA 3KF7A 3DB6A 3LFCA 3TNPC 3CIKA 3UC4A 3E7OA 4QP1A 4M66A 2P3GX 2BRHA 3FMKA 3FXWA 4GIIA 3SW4A 3T3UA 4TN6A 2F2UA 3SVVA 3Q9WA 3KF4A 3VUTA 1MRUA 2BVAA 3EYGA 4C4FA 3CPBA 3GU7A 1ATPE 3WE4A 3WZJA 5CEPA 3AC2A 4H39A 4EH2A 1IAHA 2V55A 2J4ZA 4FL2A 4CKRA 2EWAA 3KMMA 2PVHA 4QMMA 5IUIA 2C6LA 5HESA 3UOKA 4U44A 1XO2B 5BX0A 2W05A 1OPJA 3M1SA 4DEGA 4I22A 5EHOA 5BVKA 4I6BA 4EOOA 5A14A 2CN8A 3P4KA 1CDKA 3TT0A 2G15A 4M97A 3FKOA 3C4CA 3QCSA 2G2IA 3DJ6A 3PPJA 2YEXA 3LQ3A 3OWPA 3UP7A 2DUVA 5JZNA 4R1VA 2C68A 4IAZA 4WNKA 1MUOA 3DV3A 3SC1A 3QLFA 5J1VA 2HELA 4ANOA 3DY7A 3QUEA 4IH8A 4Q9ZA 4C2VA 3E63A 2HAKA 2HZIA 1XBBA 4NK9A 1NT2A 5J79A 3NR9A 2I0HA 1R0EA 3H9FA 3KRWA 1Y8GA 1DS5A 3O8TA 2YERA 4L42A 3R00A 4C0TA 1IAJA 3COHA 3FZSA 4E5AX 5A4TA 2C6EA 2CHLA 4KKHA 3RTPA 1KOAA 3NUYA 4JOAA 2WMQA 5EDRA 1TQIA 5AR2A 2Q0NA 4PMTA 5DMZA 5IA4A 3QBNA 2VRXA 3FLZA 4QMWA 5D9HA 5EOLA 4EOJA 5C26A 3FJQE 2YAKA 4GSBA 4IAFA 4ERWA 2PE1A 4X3JA 3BRBA 1PMVA 4I3ZA 3WF9A 2WEIA 4JRNA 2RFEA 3DTCA 4FTLA 5EI6A 3R8UA 4EYJA 3NYNA 3PWDA 4R5SA 3TTJA 1BL7A 3HGKA 3FZPA 4LM5A 4RVMA 3R21A 3NMUF 2R7IA 2OIDA 4L3PA 4U0IA 2J2IB 2V7AA 4ZJJA 4FVPA 4ALVA 3GCPA 2R3KA 4YTIA 3ZDUA 4CRSA 4HVSA 4PDOA 4YNOA 3R7EA 3WF8A 4LUDA 4DTAA 4FTCA 3S2PA 4RJ3A 4YUQA 1Q97A 4XV2A 1FPUA 5CQUA 5AUWA 4O96A 4J8MA 4JJRA 2XEYA 3CKXA 2QLQA 3TCPA 5KBQA 3L1SA 3QTQA 1MQBA 4CQGA 1YHWA 4R5YA 3BPRA 4TYHA 3O8PA 3UQCA 5LQFA 3BV3A 2C4GA 3GU4A 3VRYA 1CKPA 3DNEA 3VS2A 3GCVA 4PPCA 4BDEA 4K18A 3QQFA 4J98A 2UV2A 2XB7A 4UMRA 2JFLA 5GNKA 5KCVA 3ZO2A 3F66A 5ANOA 3MVLA 4FUXA 4E5WA 3MN3A 5JH6A 5CF5A 4RA5A 4UALA 5BVEA 3UNZA 3PXRA 4RVLA 3T8OA 1G5SA 3QX4A 4TWPA 4RVKA 3TNHA 4D2PA 3R02A 1OKWA 3DK6A 4JDKA 2C5NA 4RFYA 3HLLA 2RFNA 2YIWA 4BIBA 3AXWA 2ZM4A 4UN0C 4XMOA 4A9UA 3KXHA 4CMUA 4PMMA 3N51A 4MAOA 4N6YA 2VTIA 2R3JA 4RX8A 5HBHA 4GKIA 2XCKA 3LXLA 2BHHA 2C6DA 2W99B 3B8RA 4AUAA 4MH7A 4IACA 1MP8A 4MHAA 3Q5ZA 2OF2A 4JI9A 3UDBA 4U8ZA 4CYJA 3FMEA 5IEXA 3VBXA 3SOAA 4PTCA 4Y83A 2R5TA 2B55A 2GMXA 2VTMA 2W4JA 2XF0A 4FKUA 4V0GA 4WOVA 4CYIA 1BI8A 4FMQA 2W1HA 3QUDA 2XUUA 3FZRA 3ITZA 4MD8E 4BTMA 3ZO1A 2OLCA 2R3MA 2V62A 4M0YA 4EK3A 3G9NA 3VRZA 3NYVA 4FV9A 1H4LA 2WEVA 5CZIA 2HZ4A 4AT5A 3RBWA 5A3XA 4GT3A 4BTJA 3DNDA 4AXAA 5LVNA 4O7YA 3BLQA 1I44A 2IZTA 3F5UA 3LXPA 1DAYA 1ZOGA 2UW5A 3EQIA 3ZRMA 4AGWA 4I93A 4OT5A 2ETMA 3LQ8A 3ZC5A 3FMNA 3IDBA 4DTBA 5I9ZA 4IFCA 4IWPA 4U5JA 5E4HA 3SGCA 5DT3A 4DEEA 3HV6A 3HMNA 1P4OA 1FMOE 5EYCA 4CTBA 4Q2AA 2QG7A 5I4NA 4FIFA 1G8SA 2VX1A 2J7TA 2PVRA 4ZEGA 1PXPA 3W16A 2UVZA 4GEOA 4M69A 4QO9A 3VULA 4FIJA 5CU3A 5EFQA 1BX6A 3I81A 5HE2A 2WTVA 5IMEA 5EQPA 2UZOA 5CY3A 2XJ1A 3NUPA 3RK7A 5CSXA 3LCDA 1ZRZA 4C4GA 5BUJA 3C0IA 4WUNA 5L6WL 2QU6A 3C51A 4AN2A 4IC8A 1YXUA 1ZMUA 3DFCB 4YJPA 3VF8A 2WMVA 3F3UA 3QQLA 5KHXA 4E3CA 4UX9A 3MBLA 1WBPA 2IN6A 5HEZA 4DH8A 4MTAA 2QC6A 4HVHA 4DFBA 3A7IA 1SZMA 1YDTE 3ZXTA 2V22A 2ITNA 3QL8A 1MQ4A 3GC7A 4X2GA 3HMIA 4NM7A 5GJFA 4LUEA 3UYTA 4K9YA 3QLGA 4WNOA 5M4IA 2PVJA 4IB1A 1M7NA 3SQQA 2RKUA 3EZVA 4QMQA 1UVRA 2GNJA 5IU2A 5DGZA 3FPMA 2OH4A 1Z57A 2LAVA 1WBWA 5BUEA 3EQPA 3R7VA 3I4BA 4FTRA 2VAGA 4ANMA 4ZTLA 1NVSA 2C0TA 3NS9A 1PMUA 4MXXA 4CLJA 3TM0A 4DT9A 2PVYA 3EFJA 5IPJA 3DT1A 4IADA 3RPYA 5GHVA 2OKRA 3L9MA 5E1EA 3FI2A 4IFGA 1WBTA 2YIXA 3PVGA 4FT0A 4AOIA 1Q62A 2Z7RA 1FMKA 4O38A 2R64A 3ACJA 4U45A 2W4KA 4L00A 3D4QA 4AU8A 3OC1A 3T9IA 4I6FA 3DXPA 4XX9A 5KBRA 4L43A 4QQ5A 3FPQA 1JKLA 4KRDA 4M14A 3SRVA 3JXWA 4P5QA 1XBCA 3WIKA 4IBMA 5CANA 1STCE 3OTVA 4PMPA 1ND4A 5LOHA 4HNFA 2PMNX 4BWPA 5EW3A 1NVQA 4OT6A 2BRBA 2H96A 1H01A 5FLFA 5TE0A 2F7ZE 2YLEA 5EHLA 3SLSA 4EJNA 4BDAA 4OTHA 4KUJA 4O84A 3AC3A 3ORTA 4YPDA 1OZ1A 3ZRLA 3VS1A 2YISA 1J7LA 3COMA 5JGBA 2BKKA 4USEA 5HIDA 4KABA 3EL7A 3EZRA 5GJDA 4IVCA 4BI1A 4FZAB 4MXOA 3FZTA 2RFSA 2VTSA 3HVCA 3IGGA 1Q8TA 2ZMCA 4GVAA 2OI4X 4KSPA 3R22A 5ACBC 3DB8A 5CQWA 3QRUA 4BDDA 5D1JA 4JG8A 4UBAA 3TZ7A 3PTGA 3AT2A 4HJOA 2CGVA 4XHKB 4YHFA 5CVHA 4RIYA 1BMKA 4IWDA 1OIRA 3DAEA 2XNNA 4UY9A 4O1OA 3RAWA 3W8QA 3R9RA 4BDJA 3LIJA 3O17A 4FODA 5ETCA 2F4JA 2W9ZB 4LI5A 4LRKA 5HO7A 3RGFA 1Q8ZA 2VWVA 2R7BA 3EH9A 4NJ3A 2YDKA 4EOSA 2Y6MA 2ZJWA 3ZUUA 3D7ZA 3CQWA 4RIWA 3PY3A 3EYHA 5JRSA 4C59A 2B9JA 4NYEA 5IH4A 4ZTRA 2BZKB 5DN3A 3EQRA 2RFDA 5K0KA 5IUGA 5E8ZA 5E8WA 2GTNA 5EI2A 5IQDA 4GVJA 1ZMWA 4O0SA 3OMVA 4YZMA 3DJ7A 4U6RA 3H30A 1OB3A 3LFSA 4ZSGA 5KX8A 4CVAA 4L3JA 4Y5QA 4G3EA 3WYXA 1LEWA 4YLLA 2ZM3A 5DT0A 2XK8A 5AUZA 5IH6A 2VUWA 1U59A 2OK1A 4G17A 5L6PA 4W8DA 3FYKX 3KK8A 4A9TA 4ZZOA 3FLNC 3QTXA 4RMZA 2QG5A 1GOLA 4FIIA 2CGUA 2C5YA 4ZY4A 3UZTA 1JSUA 1H1PA 3EFKA 1Q3WA 3FXXA 3P23A 1RW8A 1P2AA 2PVFA 3D7TA 4FKWA 4U80A 2DS1A 3QTRA 4EH4A 2YCFA 5L8JA 4CQEA 4RVTA 3BWFA 1XHAA 1W98A 2C6OA 3MFRA 3OOMA 3Q4TA 3VW8A 4E26A 3ODZX 4PL4A 3UVRA 4GK2A 1UU8A 2KULA 3BGQA 4IVAA 4EC8A 5CSVA 5CU0A 3NEWA 3VN9A 3D14A 2WU7A 3U55A 4FEXA 5KZIA 4P2KA 3OHTA 4NEUA 3UMXA 5AX9A 3NCGA 4EJ7A 2BDFA 4J53A 1VZOA 1SVEA 5AR7A 4YR8A 3MH3A 5FDXA 2QR7A 3HRCA 3AD5A 2Z02A 4DFLA 5IQGA 4F7NA 5CVGA 1UV5A 3GU8A 3RKBA 4AGDA 3VUDA 3OS3A 5EKOA 3R8MA 4PUZA 3UTOA 2JDOA 2PSQA 4PTGA 4IAYA 4ZJIA 3FXZA 3OY3A 4YURA 5AADA 3SA0A 5J7BA 3MV5A 3LMHA 3ET7A 4ZK5A 4EWQA 1SNXA 4TY1A 3C0GA 1J7UA 5M08A 2B52A 3FDNA 3ROYA 4QMOA 4C57A 2IG7A 4LFIA 3PZEA 4JLCA 2I6LA 3NLBA 4D2VA 4YO4A 3DAJA 2YCRA 3R9DA 4JX7A 2F9GA 3H9OA 1YXVA 4BCOA 3FUPA 4OTIA 4RJ6A 2ZV2A 4XCUA 1ZARA 4EHGA 2P4IA 4FKVA 1DAWA 2G2HA 1YXXA 3QD2B 4R78A 2R9SA 4FKSA 1GZ8A 5HD7A 4WHZA 4JS8A 3PY1A 4OLIA 3U4UA 2Y0AA 3KXGA 2ETRA 3BELA 5DYJA 3TDWA 5C4KA 4HGEA 4KIPA 3LKMA 2PZIA 4PDSA 3GOPA 5JGAA 4EZ7A 3A7GA 2HK5A 3NCZA 1SM2A 4R7HA 5ANKA 3OZ6A 5FXQA 3TZMA 2XK4A 2ZAZA 4DEIA 4RWLA 4Y72A 3ZUVA 5EM6A 4EUUA 2VO3A 4C8BA 3CD8A 3CKWA 3KXXA 4NKAA 2VU3A 4ZZMA 4BCKA 4EBWA 4MF0A 2R4BA 3SOCA 5AV4A 4J1RA 1M52A 4I92A 5DFPA 5BYZA 2YZAA 4IVBA 4WSQA 4JIAA 3VS7A 3I0OA 3IW7A 1YW2A 4EUTA 3CE3A 4U3ZA 3TN8A 4CD0A 4Z7HA 3THBA 1A48A 4LRMA 4JG6A 5AUXA 5IQIA 2W06A 2WTDA 2PVNA 3MY1A 5DEWA 4EK6A 1OL6A 5AA8A 3M11A 2OW3A 5C01A 4YZNA 4UB7A 3GENA 1ZMVA 2IZUA 4G2FA 4MQ2A 4BI0A 5GINE 4AT4A 4FE2A 3LFFA 4ZMFA 4OTDA 3WE8A 5AP6A 4FA2A 2EUFB 4JBOA 4LL0A 2WMWA 5CWZA 3KN6A 1P14A 5E7RA 4A06A 4D1XA 3CY2A 3ALOA 5F1ZA 4MXCA 3QAME 4BZDA 1VYZA 2YDIA 4QTCA 5LCKA 1SNUA 4CKJA 4FZ6A 2QHMA 4AZTA 3DBFA 4AAAA 2QO2A 2VTJA 5L2SA 2YIYA 3R6XA 2HXQA 2JAVA 4I6QA 3TWJA 1KOBA 1KWPA 5H9BA 2OFUA 4KAOA 3N4TA 2WQOA 5IH5A 2BR1A 1LR4A 3U6HA 2W9FB 4P4CA 4XBUA 2WKMA 1UNLA 2BROA 1SVHA 3VQUA 4AN9A 4AW5A 1OL2A 3R8VA 3GB2A 3ALNA 2WO6A 3RAHA 1OI9A 5DWRA 4J96A 4PQNA 3O7LB 4TYHB 3QQKA 3W33A 3CEKA 5AAEA 1NY3A 1V1KA 2CSNA 2X8IA 1GIHA 1HOWA 2B53A 2J0JA 2YM6A 4QTEA 1CTPE 3QRTA 4PWNA 4GT4A 4CKIA 4F9AA 3R8PA 5JFWA 3R2BA 3D83A 3C4FA 3COKA 3Q4CA 3OFMA 1H25A 2YN8A 3ERKA 5JSMA 2VX0A 5L3AA 4YGAA 2WPAA 2C3KA 2R3RA 2ZB0A 5K5NA 5HLWA 3R1NA 3EQGA 3MH1A 5IDNA 4B6LA 5JFXA 4M15A 2HCKA 3BLHA 5KHWA 3BGZA 3I1AA 4M3QA 3A99A 4BHNA 2VX3A 3TIZA 2CNUA 3PLSA 1NA7A 3W2CA 4C61A 5FEQA 2NPQA 2WTKC 4PDYA 3CC6A 3R7GA 4GU6A 4FX3A 4LYNA 5BYYA 4TYIA 3I7CA 3CR0A 4QP6A 3EQDA 3W18A 3LJ2A 4QMXA 4S31A 2NRUA 3NNVA 3NDMA 2E2BA 4S33A 4F08A 5FG8A 3H3CA 5BPYA 4EHVA 4DT8A 4FSRA 4R3PA 4D4VA 2WOUA 1I09A 5E8TA 4O7WA 4HPTE 3V5LA 4HYSA 3COIA 4V0GB 4QP9A 2VWUA 3GXLA 1PHKA 2O8YA 4GV1A 4ARKA 2JDRA 3LW0A 5CSWA 4O0TA 4GMYA 1AGWA 4CV8A 2WHBA 4QTBA 5EK7A 1XH4A 5IZFA 5HE1A 5F4NA 4D9TA 3UNJA 4ACGA 4QMLA 1NXKA 3IW5A 4ITHA 3F5GA 3ZSIA 1CKIA 4ZLZA 3R0TA 5CU4A 3QKMA 4QP3A 3KRRA 1PYXA 3GC8A 2X2KA 4AOTA 4GW8A 3V5WA 4G3FA 4C4EA 3ZLXA 5A46A 3EJ1A 2B9HA 4IANA 2EVAA 5CF8A 4WBOA 3I7BA 2UZBA 2F57A 3E64A 4DEAA 4P7EA 4YSJA 3E92A 3OUKA 4L44A 5M56A 2XJ0A 4C34A 3HRBA 3DQWA 3CS9A 2BHEA 5LVOA 2OZAA 2XNMA 4QQJA 4X2NA 3DK7A 3S95A 5GIOE 4RJ5A 3C4EA 4M69B 5L6OA 3OXIA 4K33A 4D0XA 4N57A 1PJKA 2XIXA 3CCNA 4GG5A 3HP5A 2HENA 5EYMA 4BCMA 4QPAA 3QXOA 5HCZA 2OU7A 5D7AA 3NW5A 4MQ1A 4IC7A 3UNKA 4U7ZA 3TL8A 5F9EA 2O63A 5G1XA 2SRCA 5IF1A 3D5VA 5AV2A 2JGZA 5HBEA 5L4QA 2YHVA 3HMMA 1ZOEA 3OBGA 1Q41A 1K3AA 4D2TA 4YJVA 4L53A 3PJ8A 2VTTA 3WF6A 1M7QA 2G9XA 2P33A 3FHIA 3TUDA 5A54A 3PP0A 3AQVA 5DVRA 4ZAUA 3DLSA 5HLNA 5HTIA 3V04A 4Q5EA 2YFXA 4FNWA 3OWLA 4I0SA 4JG7A 4BICA 4Y95A 1LPUA 4XG2A 3UC3A 4EHEA 5E1SA 3R8ZA 5K5XA 2R3HA 3QTUA 4RZWA 4JDJA 4F64A 2QOQA 4CZUA 2CNVA 2CGXA 3TEIA 2GS6A 2Z7LA 5ETAA 4JAJA 3GBZA 4YZCA 3H4JA 3UIXA 3GCUA 5DE2A 3JVSA 1YVJA 3LJ0A 1OECA 3Q3BA 1T45A 2CCHA 4WRSA 5M4CA 4TKSA 4H05A 4C3RA 5C1QB 3V3VA 4KINA 2FSLX 5ANGA 2F2CB 1V0PA 5FQDC 3TKUA 1W82A 2PUPA 2WQBA 4LMUA 4UV0A 5EW9A 4X6QC 3F88A 4AE6A 2G1TA 1Q8WA 2WOTA 2VNYA 4FNXA 3QFVA 5TT7A 4R77A 4NL0A 4OTFA 4D2SA 1ZYJA 1WVYA 5JN2A 4N70A 3RNYA 2WQEA 3UOHA 4DBNA 4ALUA 4QMNA 2PTKA 2XRUA 3DFAA 1U4DA 2CKQA 2Y9QA 2ERKA 4U9AA 4QMSA 5EH0A 3B8QA 3P9JA 4QPMA 4RX9A 4WA9A 3AC8A 2KTYA 1LEZA 3FKNA 3TV7A 5DI1A 2C3IB 4IVDA 4AW1A 4O86A 2ITXA 3G6HA 3KB7A 3PWYA 5IEYA 3ANQA 4EH6A 4Z7GA 4W9WA 3DBQA 4PPAA 4YZDA 4YZBA 3W2SA 4D28A 5CNNA 3VUIA 3VBWA 4NW5A 3UPXA 2WIPA 4FSNA 3BYVA 3SAYA 5IA1A 1ZLTA 4HZSA 3EMGA 4R7IA 4GKHA 3LVPA 5F20A 2V5QA 4IZ7A 1GIIA 3CLYA 2IO6A 4E7WA 4RIYB 2W96B 3PG3A 5I9UA 3U51A 2JDSA 5M55A 4AZSA 4FTAA 4YJUA 4KBKA 2GNGA 5CT0A 3LCKA 4YO6A 3QGYA 4NW6A 2ZMDA 4ZTMA 2BMCA 2H8HA 2JLDA 4FSWA 4NIFB 1L3RE 3BIZA 2JFMA 4MYGA 4RIWB 4MXAA 2IVSA 4K11A 2QOLA 4MBLA 2IVTA 2VTAA 2J0MB 3D0EA 1EH4A 3G0FA 3K5UA 5BMMA 1FGIA 5JK3A 1J7IA 4FEUA 1V0OA 3AMYA 3QA0A 5HKMA 2J0LA 4U43A 4YBKA 2Y4IC 4F4PA 3LMIA 3BQRA 2YM4A 3PG1A 4LOOA 4QYYA 5HU9A 2FVDA 2DWBA 3O8UA 4L7SA 1OPKA 4DH5A 4FT7A 1OBGA 1PXNA 4X2FA 3IW6A 3OY1A 4FTKA 4WRGA 2OF4A 5FBOA 4MKCA 3BYOA 3L8VA 1TQPA 4IJPA 2BRGA 4GS6A 4UWBA 4OW8A 3ZSGA 3LMGA 3C4WA 3PSBA 3ORXA 1PXIA 4OTQA 3D7TB 4TWCA 4HVDA 4CEGA 4TL0A 1LP4A 2X6EA 3P7BA 4O0VA 4ANNA 4EZ3A 3RM7A 3FQHA 4H3QA 5E9EA 5FDPA 3NUUA 4NM0A 3IDPA 5AJQA 3R9OA 1B6CB 1FQ1B 3FL5A 4C38A 5K3YA 1AD5A 4UMQA 5H2UA 2BDJA 3PVBA 4R6VA 1VJYA 2WB8A 2PE2A 3DLZA 4IAIA 4U42A 5AUYA 5FGKA 1T46A 5GZ8A 5L8LA 3DXQA 3UGCA 5D11A 3LCOA 4ZS4A 1WBVA 3R7UA 2O5KA 5HLPA 3HDNA 3RCDA 3TACA 1QMZA 4E4MA 4F7JA 5FTGA 2EXCX 3BWJA 1REKA 3ENMA 5K9IA 4YP8A 1W83A 4ZY6A 4LOQA 4QYEA 4HYIA 4PL5A 4Y85A 2JKKA 4EORA 1A06A 2H6DA 5IQFA 4FUYA 2C5VA 3G6GA 3MIYA 4FSZA 2IW8A 3UYSA 4BDKA 4TRLA 5IA3A 5J95A 3TUCA 3FEGA 5CEIA 3NNUA 1H07A 5DLSA 3K3IA 5EM8A 4EH7A 3KEXA 5D10A 2ZV8A 2UUEA 3ZBXA 4IZ5A 3A8XA 3CP9A 1QPDA 4O6LA 4ZP5A 4AF3A 4BDGA 4D5KA 5KKRC 5IQHA 3PRFA 1DI8A 1UKHA 2CPKE 4FV4A 2Y8OA 4OBQA 3P0MA 4X7QA 4FSMA 1Y91A 4PY1A 4CMTA 4CG8A 4USFA 3ZO3A 3Q9XA 2CKEA 3KXNA 4ZLYA 2YITA 3JPVA 3IDCA 4S30A 3GFWA 4PF4A 1CMKE 2C0IA 3L9LA 4I94A 2ZV7A 2ZYBA 5D41A 3GEQA 2X7GA 3F2NA 4J8NA 4DFUA 2ITTA 3LAUA 4KS8A 5G6VA 3R2YA 5EOBA 5LWMA 5A4LA 3OBJA 2W5BA 2BFYA 3GT8A 3OTUA 4FKGA 5HOAA 3MFTA 3FC2A 4L8MA 4YLJA 3FLQA 3Q6WA 5CF4A 2A1AB 2CGWA 3PIXA 4R1YA 5J8IA 5M07A 2C1AA 1H08A 4C4IA 2UW0A 4QMYA 3C5IA 3HMOA 5HO6A 2ITPA 3FLWA 4ZIMA 4J95A 3QXPA 2VTLA 4XP3A 3SV0A 4AA5A 4OAUC 2B0QA 3W10A 3HL7A 3JS2A 2PZRA 2Y4PA 4R8QA 4UZDA 3F5XA 4QPSA 3KVWA 3EB0A 5KMOA 3KMWA 3U9NA 2FSMX 4FKIA 3ZEPA 3UMWA 4Z55A 2UVXA 1KUTA 4CFNA 4DGMA 4F99A 3EN6A 3QQJA 4FIEA 5J5SA 1U54A 3FV8A 4KBAA 2YAAA 4ITIA 4BZOA 3DKGA 5K4IA 3ATSA 1YI3A 4A9YA 4D1ZA 4G5PA 3F7ZA 3ACKA 3MPAA 4W4VA 1OKYA 4AQCA 4ZLOA 3HZTA 4FT5A 2R3LA 4DGOA 1UNHA 5HG8A 1HCLA 3OEZA 4KKGA 3FMHA 3C7QA 1PF8A 4IX6A 4YJRA 4AX8A 1WVWA 4O7RA 4JQ7A 4PP9A 1WMKA 1OL7A 3ZFMA 3MS9A 3R01A 5CEOA 1YDRE 4WBBB 4KA3A 4E6QA 3EQBA 3R28A 3PYYA 4TWNA 3KRXA 4KIOA 1JAMA 4C02A 4AP7A 2PMOX 4UXQA 3VS6A 2OO8X 2XM8A 1FVTA 1ZZ2A 4O7LA 4I5PA 3RHXA 4Q5HA 1UU9A 3DA6A 4N4SA 3V5JA 5KMNA 2EB3A 5LMKC 3CBLA 2W1EA 5ANDA 2EXEA 3KY2A 2GTMA 1PYEA 2E9VA 3D5WA 3G9LX 5FTQA 1SVGA 4NTTA 4B0GA 4XEYA 4PMSA 2HW7A 3LQ5A 3GP0A 3VS5A 3PJ3A 2AC5A 3MW1A 5C9CA 3TUBA 3AD4A 2WELA 2R3NA 3PE2A 1JSTA 2W0JA 5CAUA 2C5OA 3Q9YA 2WTWA 2DYLA 2HY0A 2W17A 3HEGA 5LCJA 4O6EA 5J1WA 2GFSA 5AP7A 2NNWB 4B7TA 1UWJA 4BDBA 2RSVA 4IJ9A 4RFMA 4O7TA 2XK6A 3F82A 3QZFA 4ENXA 5LMKA 3G2FA 1E1XA 4FG8A 2P0CA 2UW3A 4L6QA 5ANEA 3WZDA 2VTNA 5EHYA 4BIEA 4KNBA 4F6UA 4WIHA 2P2HA 4NJDA 4RIXA 1OM1A 5IKWA 4C3PA 4IB0A 3QC9A 3ZOSA 4XOYA 2WQMA 3QYWA 1YWVA 1QL6A 3MYGA 4I23A 4X6RA 3FBVA 4XBRA 5AAGA 4DFNA 2GNLA 2PVLA 4QYGA 4U81A 3RI1A 5EYDA 4YZ9A 4C4JA 2C6KA 1TQMA 3FSKA 5AAFA 3RINA 5EW8A 2J6MA 3S1HA 3AD6A 4QNYA 5JEBA 5DHJA 5AM7A 2Q83A 4RQVA 3FKLA 5E91A 4NZWB 4F6WA 5LXMA 5AFVA 3LXKA 4IIRA 4WKQA 2G01A 5BNJA 3R63A 4EKKA 1IASA 3FZ1A 4C62A 2X2LA 1Y6AA 1F3MC 4WNPA 2IPXA 2ZOQA 4GL9A 4FSYA 2QURA 4CV9A 4EK5A 3HKOA 4JBQA 3E8DA 4D4SA 2YWVA 1IR3A 3FY0A 2OZAB 3I60A 3QU0A 3ZEWA 2JEDA 1W84A 4DGLC 3MFUA 3Q4ZA 2XM9A 5AR4A 2C6MA 3RAIA 4XV3A 2YIRA 2BIKB 1OPLA 3IG7A 2C30A 1FOTA 2ZDTA 3A4PA 3MDYA 4IX3A 4KRCA 2W1DA 5CSHA 5DPVA 5FBNC 3FC1X 3VUHA 3HUCA 1FBNA 3EQHA 1KE9A 3LFEA 3VW6A 4FEWA 4PV0A 3UPZA 3CTJA 4FKQA 2I7QA 4QRCA 3L8PA 3ZU7A 4ACCA 3UQFA 3QTIA 4ASXA 3QA8A 5HNIX 3O51A 5KO1A 5DBXA 1Q5KA 2QO7A 4O7VA 2NO3A 5JT2A 2VTQA 2R3IA 5BQ0A 2HXLA 3W2OA 3F7WA 3VWAA 3C0HA 3Q4UA 2HOGA 2REIA 4H36A 4ZJVA 3ZM9A 5AP3A 4E6CA 4ZSJA 4O7SA 2ZB1A 3MVHA 4BTFA 3ORLA 2WNTA 2QONA 5LMAA 3LLTA 3BEGA 5HE0A 3SDJA 3GNIB 4PTEA 5TF9A 3LFAA 4CG9A 2YJRA 4FTIA 4GG7A 3PJ2A 2W1GA 3PXKA 4ANLA 3IONA 2PVKA 2A19B 4D58A 4F9WA 5AEPA 3IQ7A 4CGAA 2ERZE 4NT4A 4F9BA 2PUNA 3SKCA 4JX3A 3LLAA 4EONA 5E8UA 1XH8A 4E6AA 3PDTA 4QTAA 3MH0A 4X0MA 3O7LD 5CXHA 2Y6OA 3A2CA 4E4NA 2BRMA 4PL3A 3T3VA 5IISA 2R0IA 2YM5A 1ZYSA 3OCBA 2WQNA 3BHUA 1R39A 1YKRA 1M14A 3IGOA 3PXFA 4W4YA 3FMDA 2X81A 3O23A 5DA3A 4NFMA 3RWPA 3WF7A 2H9VA 1FVRA 2ZDUA 4DCAA 1OKVA 4WG4A 3GI3A 3R7YA 2O3PA 5EKNA 3D15A 3WILA 4K8AA 1K2PA 1Q3DA 3B2TA 2UZTA 4J99A 4NTSA 4DINA 2XCHA 4IZYA 2XIRA 4RSSA 4ONAA 5E8VA 2J9MA 5FM2A 2JDTA 5CYIA 2ITWA 2VGPA 4FKJA 4BGHA 3W2RA 3P78A 3H0ZA 4AZFA 4ANQA 2PMLX 2WMUA 4BC6A 3NAYA 3N9XA 5GZ9A 4EQMA 4ANBA 2XJ2A 5HG5A 5LVPA 5DR9A 1X8BA 4TTHB 4H3BA 4MNEB 4CZYB 3PIYA 3NW6A 2LGCA 2FB8A 4XUFA 3BHHA 3E8NA 2QOFA 3ZO4A 4GK4A 3O71A 4K1BA 5AP2A 2ITQA 4HGLA 2UW7A 3OUNB 5I0BA 1YOLA 4RJ8A 5JRQA 4O21A 3NAXA 3Q2MA 2R3OA 2OWBA 2XA4A 2F7XE 3BGPA 5C4LA 1ZY5A 3NUSA 3QTZA 4GYIA 2ITYA 5DRBA 3K5VA 2X2MA 1ZAOA 2FO0A 3MWUA 2BCJA 3PE1A 4LL5A 5FM3A 4BTKA 4QD6A 4ZTNA 2XK3A 2XYNA 1NW1A 4FIGA 2OBJA 4FSUA 3QWKA 4IX4A 1H1QA 2XRWA 4AE9A 3G0EA 3E3PA 4H1MA 3PXQA 1ZXEA 1CSNA 4JDHA 4YJTA 3ZZEA 4EKLA 5FTOA 5C03A 4FNZA 3VIDA 3ZSHA 4EC9A 4FC0A 3QHRA 3PLAE 3SX9A 3IOKA 4OGRA 1U5QA 4I4FA 4JIKA 5HE3A 4FL3A 4X3FC 4ZSEA 4O91A 1PMEA 5AP4A 3DAKA 5IUHA 3BQCA 3JUHA 3R9HA 2FYSA 3EN5A 5HQ0A 5IMXA 5KNJA 3PFQA 1W7HA 4R3RA 1YWRA 4YMJA 3AC1A 3JY0A 3QRIA 1IA8A 4P5ZA 4RC3A 4WG3A 5HNGA 5A4CA 3F2RA 4O82A 4GUEA 3JR1A 5M06A 1PXLA 3PJ1A 3QYZA 4I6HA 1WBSA 1BKXA 3WIGA 2OJJA 4CFFA 3FI4A 2C3JA 4BRXA 4OTPA 4RBLA 4XLIA 4OBPA 4BYJA 5GZAA 5HX8A 1B38A 2YWPA 3QKLA 4YSMA 3I5ZA 1GJOA 3QCQA 5I3RA 1Y8YA 3KL8A 4BCFA 3UVPA 2XIYA 4UXLA 5GJGA 5HBJA 4AA4A 5AV3A 4X3FA 2XNEA 3ZFXA 3LFNA 4W4WA 4G1WA 4UEUA 3OD6X 3Q60A 3DDQA 3E5AA 1YDSE 2PPQA 4EH3A 2VGOA 2WIHA 4BB4A 2E9PA 5JKGA 2HY81 1M2QA 3DCVA 2UW8A 3K2LA 3ZFYA 3ZZWA 1FINA 5C8KA 5I9YA 1OITA 3FE3A 3QGWA 3BU3A 1S9JA 3WZUA 3OROA 2VO0A 4LV5A 3UBDA 4DE4A 5J5TA 3EN7A 5BVFA 1DM2A 5FRIA 3R04A 3NGAA 2WTIA 3ORNA 4KWPA 4LV8A 3DPKA 3NYXA 3F3WA 2ITVA 4PPBA 4TZRA 4Y8DA 2YCSA 4Y46A 5DH3A 4FKLA 4K0YA 5AP1A 3LFBA 4TWOA 1OIYA 4DTKA 4D5HA 5CI7A 3OCSA 4G3GA 1YWNA 2R3PA 3TV4A 4B4LA 5HO8A 4BBMA 4O27B 4CT2A 4D4YA 2CKPA 1KE6A 5TR6A 4F09A 4F63A 5K0XA 4L01A 4D9UA 4MWIA 4H1JA 1PXKA 3IW4A 4S34A 4IDTA 4IM0A 3ZMMA 4GUBA 4E4LA 4V01A 4FOBA 3L8SA 3BI6A 4BCPA 3R7OA 5H8BA 2HYYA 2OJ9A 3ZYAA 1KE5A 2PUIA 1OL5A 4BCNA 1PXOA 2AYPA 2R3FA 2FGIA 2JIIA 4O22A 4FIHA 3TKIA 3IOPA 3CJGA 4J52A 5ANJA 2R3GA 1PKDA 2WMXA 3ZDIA 3AG9A 1URWA 3FSFA 4AT3A 3ORZA 3TJCA 2JKOA 3DKCA 2X0GA 3PJCA 3Q32A 4LOPA 3ZTXA 4APPA 2BAKA 3BBTB 3DTWA 3HECA 5AM6A 5T6KA 4F0IA 3C4ZA 3O50A 4NU1A 4CFVA 2HWOA 5BVOA 4RJ4A 1JOWB 3HUBA 3OCTA 3IS5A 5JQ5A 2XMYA 3JYAA 2VTHA 5I9WA 3EN9A 2ITOA 3KC3A 3VBTA 4PNIA 2FSTX 4QMZA 3ULIA 1H26A 4L52A 5EI8A 4WO5A 5DR6A 4X21A 4CFWA 3MSSA 5IDPA 4JQ8A 1KE8A 4N0SA 1JSVA 3OVVA 4TYGA 4DC2A 4F7SA 2UZDA 3EFLA 4CFUA 3QTWA 5BVNA 4XOZA 4YNEA 4RLKA 4RRVA 3OF0A 1U54B 3IK3A 3ZONA 5HNBA 4HCTA 4JL9A 4DF3A 3QZGA 4FYOA 2WTJA 4I5MA 4JQEA 4B99A 2QLUA 1OGUA 5CAQA 3BYUA 4DYMA 3W2QA 1GNGA 3BLRA 1KV1A 3N4VA 4C37A 3MFSA 2VWBA 4A4XA 5HU3A 4L45A 2BPMA 3BHYA 4EH9A 3TG1A 3UG1A 2PHKA 3OXTA 3OWKA 4GK3A 4F6SA 4HCVA 3QUPA 4O7ZA 3NYOA 5CEMA 4DHFA 4W9XA 3C50A 3C9WA 3R71A 4G3DA 4ITJA 1YXTA 3UO6A 4E4XA 3R1YA 5KMIA 5AR3A 4BGGA 3VUKA 4BY9E 3LHJA 4V04A 5M4FA 1XJDA 3D2KA 4IWQA 3TKHA 2C6IA 4D2WA 2YDJA 4RWKA 2VWZA 4MX9A 4CTCA 4FV8A 4BKJA 3ZLWA 4NKSA 4HW7A 4JBPA 1YHSA 2YM3A 3O0GA 3QD3A 1PKGA 4LGHA 4ZSLA 4UMUA 4KD1A 4G34A 4EOPA 2OJGA 2B54A 1Q4LA 4G9RA 4QMPA 1OIQA 4IM2A 3MI9A 1QPJA 3BU6A 5EG3A 4CCUA 2RIOA 3NUAA 4EI4A 2XNBA 3IECA 4AACA 1J3HA 3HDMA 4NM5A 2BAJA 2UZWE 4FT9A 1PXJA 5AUVA 2QCSA 3DBCA 4DFXE 4F1OA 3S0OA 2GHGA 4D4RA 4WT6A 4HVGA 5DOSA 4CFXA 3HAMA 1H0WA 1P5EA 2CJMA 3IO7A 2UZUE 3EOCA 1Q8YA 4U3YA 5DNRA 5HX6A 4ZTHA 2X7OA 3HA8A 2GNIA 1G3NA 3BHVA 4IE9A 4I4EA 4FGRA 4PX6A 5E90A 2ZV9A 5HD4A 4M8TA 3K54A 3W55A 4FTTA 1CM8A 3LFDA 3VJNA 3W1FA 3EFWA 3S4QA 1Q99A 1JKKA 4RIXB 4BDIA 2WU6A 2WGJA 3LM0A 3Q04A 2A4LA 3E3BX 3H0YA 2GQRA 4AA0A 2H34A 1Z5MA 2CNQA 5L2IA 2GNHA 4H58A 4IXPA 2J0IA 2NRYA 5GIPE 3AMAA 3CPCA 4NCTC 1Y57A 3SRVB 5HCYA 4BHZA 3ZLYA 4RJ7A 4WG5A 2PULA 1WFCA 1L8TA 3UOLA 1GZNA 3BU5A 4KIKA 4XG8A 5A4QA 4RLLA 3RPRA 4BFMA 4I0RA 3TXOA 3V6SA 2ZM1A 1JNKA 5IA5A 3FAAA 4FGBA 2WMBA 4TNDA 2CN5A 4FZFB 3UJGA 4C35A 1JKSA 2PY3A 3NPCA 2JBPA 4AWIA 2QOCA 4FV3A 4AZWA 5J7HA 5KMMA 2PMIA 5AWMA 1YI6A 3EQCA 5FP6A 2ACXA 2X8EA 3MJ2A 5FUTA 3E8CA 4AFEA 2QOOA 2XYUA 4IZAA 2WMRA 4FEVA 2IWIA 2CMWA 3UODA 3KMUA 4RZVA 3L8XA 2JDVA 2XIKA 2J5EA 2P55A 2YABA 3FLSA 3V51A 3G5DA 2XKEA 5D12A 4BI2A 3RPOA 5J9ZA 2V0DA 3ENHA 5LJJA 4YTFA 4MXYA 4HVIA 4O2PA 4NH1A 3IKAA 2PZ5A 4MF1A 5T3QA 1RE8A 5HTCA 5IA2A 1M2PA 3DK3A 3E8EA 3ZXZA 4ACMA 1O6KA 3NIEA 4AGUA 5KZ0A 4E8AA 4DLJA 3SXSA 1GZKA 4ZZNA 1GIJA 4NWMA 3F5PA 3QWJA 4BWXA 3C1XA 4XH6A 1ZYDA 2XK7A 3FHRA 3AC4A 3P7AA 3PZHA 1RQQA 4CNHA 2BZHB 2UW4A 1W8CA 4S2ZA 4GU9A 4XG3A 3PSCA 4M84A 2O65A 3UZPA 4BR3A 5LWNA 5HGIA 2R3QA 4DN5A 5CSPA 3WF5A 4RWIA 3V5PA 4PRJA 2W4OA 3OCGA 2BZIB 3EN4A 4YJSA 4K77A 1ZWSA 1VYWA 3F3ZA 2BUJA 2JITA 4KB8A 2JIUA 2WAJA 1XH9A 4AN3A 1XH7A 3AC5A 3G90X 3O2MA 4XNEA 4YJQA 2GSFA 4FT3A 3VQHA 2C6TA 1SYKA 2YCQA 3BZ3A 3MA3A 1O6YA 3QCXA 3KULA 5CU2A 5CTPA 4C36A 3VS0A 4IHPA 3PXZA 5HORA 5KMKA 5KMJA 4CT1A 5LMBA 1H28A 3CQEA 4FG7A 4LG4A 5B2KA 4O7NA 4RWJA 4QNAA 4L46A 2HWPA 2JC6A 3QD4A 3RK9A 3POZA 2I0EA 3ZLSA 4FSQA 4XP2A 5DIAA 1ZZLA 3S3IA 3DKOA 4YTHA 3RP9A 3BYMA 3V6RA 5T68A 5I3OA 3PY0A 4FK3A 2OICA 1Q24A 3FL4A 3WZKA 3PPKA 4BIDA 3DBEA 4XLVA 4TYEA 4TNBA 4BCGA 3SW7A 2C1BA 4ZOGA 2QOHA 4A9SA 3MGYA 3R73A 1UA2A 2J51A
chains in the Genus database with same CATH superfamily
4I5CA 3CGFA 4PP7A 3Q6UA 1YI4A 4C33A 3KQ7A 3LM5A 5DG5A 2V7OA 4DEBA 4L9IA 4G31A 3KRJA 4BVUA 5H3QA 5CEQA 4O83A 3GU6A 4YJOA 5FP5A 1YOMA 2W5AA 3KRLA 5L2QA 5LVMA 5M4UA 1A9UA 2R2PA 3F61A 4C3FA 2YIQA 2JD5A 4FVQA 3QQGA 2QOKA 4AXFA 4AZVA 3BEAA 3EWHA 3PVUA 4OTRA 5AA9A 3CQUA 3QZIA 2GQGA 3PUPA 4MUQA 3RNIA 4Z9LA 1PXMA 2OXYA 3LOKA 1XKKA 4GCJA 4AGCA 3PIZA 3A60A 3E88A 4G6NA 5BVWA 3DJ5A 4JRVA 4RC2A 3UDSA 4RG0A 4ENYA 4BJJA 4PDPA 3VS3A 2J5FA 2HW6A 1CKJA 4UYAA 4DBXA 4ACDA 3KIOC 3GOKA 1H1SA 4W4XA 3RVGA 1J91A 3OG7A 1WZYA 3UO5A 2X8DA 3QF9A 4RPVA 1H1WA 4I21A 4CMOA 5IA0A 1K9AA 1TKIA 2XARA 4M7IA 4BDFA 3C5UA 4A4OA 2XAOA 2GFCA 4ALWA 1H27A 4ZMEA 1E1VA 2GU8A 2J0KA 2VWIA 4FYNA 3G33A 5KE0A 4MBIA 2YM8A 5DRDA 5E8SA 3Q9ZA 5KUPA 3KKVA 3KFAA 5CF6A 5JGDA 3UG2A 3FQSA 3GCQA 4X3FB 1BYGA 3I5NA 3QCYA 4JXFA 3NRMA 3V01A 4BCJA 2UZNA 3RM6A 4GFOA 3VBVA 1JQHA 4RQKA 1YQJA 5FEEA 1F5QA 1GZOA 2E9UA 3W8LA 5M09A 4EOKA 4C2WA 5B0XA 5B2LA 5HVJA 3RPSA 3T9TA 2PU8A 3ULZA 2QR8A 4MBJA 4C58A 3CTHA 2CLXA 4EBVA 2ETKA 3HV5A 3ETAA 4BF2A 4QTDA 2BDWA 3C4XA 4RGJA 4MEDA 4XRJA 3W2PA 3F3TA 3Q52A 5IQAA 4EK8A 2FSOX 4QP8A 1OKZA 5AV0A 3UIBA 3BX5A 2WFYA 5I9VA 3VO3A 3FZOA 5CS6A 4ZS0A 5CASA 4AFJA 5KMLA 4YU2A 2XVDA 2BALA 2UW6A 4FSTA 4F7LA 3QKKA 5ACKA 3B2WA 2W5HA 3GU5A 4GJ2A 3NUNA 4EYMA 3NVMB 2VO6A 5K4JA 3SG8A 3MY5A 4FKPA 4JT3A 4C7TA 1UU7A 3EL8A 2GHLA 4DH1A 2OGVA 4FV7A 3KCKA 5CAOA 3ORKA 5HTBA 3SG9A 3V8WA 3OOGA 5CT7A 5AV1A 3W0RA 5TO8A 2QVSE 2PK9A 2QOIA 4M12A 2A27A 3A4OX 3TDVA 4LGDA 4MD9E 1JVPP 3HA6A 1XH5A 3I6UA 5A4EA 3RMFA 4K2RA 4YJNA 4LMNA 3BE9A 3P86A 5AR5A 3PVWA 5I5ZA 1BL6A 3Q96A 4IWOA 3FMJA 5HICA 1PMNA 2PYWA 5FEDA 4DGGA 2B4SB 1WBOA 4I20A 2IW9A 3BKBA 4JAIA 1JWHA 1Y6BA 5DR2A 3ATTA 1H00A 2VN9A 5DT4A 3FI3A 4DAWA 2GCDA 2UVYA 4QP7A 1UKIA 4APCA 4DEHA 5H8GA 2E9OA 5AP5A 4JR7A 2XEZA 3P7CA 2FA2A 4DFZE 1APME 3RK5A 4G9CA 3NW7A 3MESA 4FEQA 4ASEA 4M13A 3UVQA 4F0GA 2VZ6A 2XBAA 2UZLA 4FV6A 1S9IA 4ASZA 2VTPA 3PXYA 5BMSA 5J87A 4G6LA 4BL1A 4DG3E 4FKRA 5AUTA 3NX8A 3QZHA 2WTKB 3LCSA 5CVFA 1GY3A 3TV6A 4UWCA 5D7VA 4CCBA 2QU5A 4F9YA 4I5HA 4EOIA 4YTCA 4ORKA 2DQ7X 3WYYA 1M17A 2WD1A 2I0YA 4FK6A 3A7HA 4FV2A 4D0WA 2GDOA 2OXXA 5EDPA 4AW0A 4QP2A 2JKMA 4E1ZA 4OUCA 3SXRA 2VTRA 3MH2A 5AR8A 4A4LA 2G2FA 3F9NA 2XP2A 3QRJA 4QMTA 4ID7A 5A6OA 5IEVA 3FLYA 2JBOA 4XV1A 3U4WA 1YRPA 4RT7A 3FI8A 5ETFA 3PP1A 4FVRA 3ZHPC 4ZY5A 4O0UA 2WMAA 4N6ZA 2Y7JA 5CEKA 3RHKA 3HV7A 5HVKA 4O81A 4V05A 1IRKA 2YA9A 4XS2A 2P2IA 2RG6A 2XH5A 1WCCA 3Q53A 4RFZA 1UU3A 5HCXA 4AXDA 1ERKA 4WSYA 2VD5A 2AEGA 2PUUA 3VBYA 3CTQA 2PL0A 5IG1A 3BL9A 5IQCA 3ORPA 5F94A 4L3LA 5EQYA 4EQCA 5B7VA 3KK9A 2AC3A 3POOA 4HPUE 4CFMA 1OBDA 5LVLA 4FF8A 3G51A 3UO4A 3I79A 3WZEA 4O0WA 5L2WA 4DG0E 4WNMA 2ITUA 2IVUA 4AS0A 5AUUA 4FTNA 4HZRA 4NSTA 5HIBA 4BDCA 4ERKA 3ID6C 3QD0A 3P1AA 5JZJA 2ESMA 4O2ZA 4ANSA 3KXMA 1B39A 4JNWA 3ANRA 3DZQA 2C3LA 4FZ7A 5CI6A 4BWKA 4TT7A 3REPA 5CZHA 4I41A 3U8WA 2C47A 4W8EA 3ZM4A 3DBDA 4GT5A 3MB6A 2RGPA 5EDQA 5J9LA 4OR5A 3HYHA 4HNIA 1REJA 4NIFA 4CZTA 1O9UA 4DGNA 5IQBA 4L7FA 2UZEA 3PRIA 5L8KA 3AGLA 4G16A 4HCUA 3TTIA 4GJ3A 3KN5A 3NZ0A 1R1WA 3ROCA 2XNPA 1OVEA 2B9IA 5ETIA 4BKYA 5BUIA 5FD2A 4USDA 5CU6A 3LXNA 5EM5A 5HVYA 4BCIA 3EHAA 2WMSA 3PA3A 4FNYA 4FV1A 4G3CA 3RAKA 4FG9A 2PZYA 4DA5A 1G8AA 5H8EA 3GCSA 2BRNA 3QX2A 2ZFYA 1H0VA 4GFMA 3TIYA 2Z2WA 3OWJA 4YHTA 4FI1A 3VUGA 4DCEA 2JAMA 3ZC6A 3H9RA 1LUFA 4U40A 5CENA 1FGKA 5LARA 4A07A 4KIKB 4FKOA 4QQTA 3ZUTA 3VS4A 3E87A 3UZRA 2BKZA 3MPMA 2BIYA 2GNFA 2VWYA 3SHEA 2EU9A 1HCKA 2IW6A 1UWHA 5EQEA 2HZNA 2Z60A 4QT1A 4DITA 1XWSA 5AIKA 4ZSAA 2ONLC 4KS7A 2W1ZA 1R0PA 3RPVA 1SMHA 3SXFA 2C69A 2FUMA 4EH5A 2X39A 5BVDA 5I9XA 4NUSA 2X1NA 4FTOA 5HG9A 4FTUA 4XG9A 1JPAA 3L9PA 4EOQA 1OMWA 3ZCLA 3DKFA 3AGMA 2HIWA 1QPCA 2C5XA 2QD9A 2X9FA 3QTSA 5B2MA 3GC9A 4Y73A 1M2RA 5FWKK 4A9RA 5EYKA 1FVVA 2I0VA 3D5XA 2IEWA 1O6LA 4HGTA 4X2JA 3HMPA 3NNWA 3R1SA 4F0FA 3U54A 4BN1A 1ZYCA 2WTCA 2OFVA 4O0XA 4P90A 4I1ZA 3UE4A 4B9DA 2O2UA 2UW9A 2XBJA 3AT4A 4S32A 2ONLA 3ORMA 3BCEA 2GS7A 1TVOA 3DOGA 4FL1A 3HAVA 3D2IA 5HIEA 4QP4A 4F70A 5F95A 3RZBA 1BI7A 3K3JA 4IAKA 4UMTA 1XR1A 3VHEA 4RX5A 2BFXA 4FOCA 5HI2A 3DS6A 1GAGA 2Q0BA 4YLKA 1F0QA 3KA0A 4E6DA 1OIUA 4XG6A 2X4ZA 4IB5A 2OZOA 4IEBA 1XH6A 3HV4A 4EOLA 1WBNA 3PA4A 1KE7A 4XP0A 4BBEA 4DLIA 4IB3A 4FTJA 5E8YA 3HNGA 2GHMA 3MVJA 3W32A 4EOMA 4LRJA 5M44A 3F2AA 3FMMA 4RC4A 1P4FA 5JQ8A 2PE0A 2HZ0A 2XAMA 3NUXA 2BZJA 3KREA 3II5A 3OP5A 4ASDA 4U41A 4NM3A 4AZEA 4HGSA 1YHVA 4OTWA 4Y5HA 5CAVA 1URCA 3D94A 5FXRA 4FTQA 3Q2JA 4K6ZA 3F69A 2VWXA 3MA6A 2W1CA 2J50A 3LPBA 4PNKA 4FTMA 4QMVA 2B7AA 4BCHA 2YM7A 2X4FA 3KULB 5JFVA 4DH7A 3Q5IA 1VR2A 1IEPA 5IQEA 2Y4IB 1PY5A 3MTFA 5AX3A 3GUBA 3UP2A 3NSZA 2VWWA 3WBLA 3W0PA 3R1QA 4E73A 5AP0A 5EM7A 4R3CA 4JR3A 3BHTA 4I0TA 2B9FA 3KVXA 2OSCA 3A8WA 3OXZA 3C13A 4YC3A 2I40A 4F1TA 3AMBA 3MVMA 4QQCA 3FMLA 4Z16A 4E5BA 3CD3A 3KCFA 2E9NA 2O0UA 5E8XA 2CCIA 2XIZA 3VJOA 3FY2A 4DEDA 4II5A 3IPHA 4HOKA 4QMUA 3KU2A 4A7CA 2QQ7A 2YACA 2W1FA 5ANIA 2Z7SA 4KIQA 3PPZA 2OG8A 3CSVA 4F1MA 4IQ6A 4GH2A 3HRFA 1H24A 4UWYA 3R83A 3V5QA 4F9CA 2YZLA 3P08A 4QYHA 4BBFA 4DHIB 3ORIA 3OT8A 2R0UA 2QNJA 4AW2A 3NIZA 1J1BA 4EL9A 4OAVB 4TPTA 2BTRA 3PA5A 4CXAA 2X0PA 5AIRA 4LQMA 2PWLA 2EXMA 3R8LA 3QRKA 4XJ0A 3WOWA 2F49A 5J9YA 1OL1A 5CX9A 3UIMA 3VUMA 1PRYA 3GGFA 4EZ5A 4C4HA 5M51A 3AKLA 2Z8CA 3HP2A 4JVGA 2I1MA 3DU8A 2IZSA 3GC0A 3BYSA 4O0RA 1JKTA 3VNTA 4CSVA 4AG8A 4GIHA 5KKRB 1ZY4A 3MTLA 1MRVA 4MWHA 3I0QA 3TZ8A 3AT3A 3GVUA 3QQHA 2XZSA 1WVXA 4LGGA 2RL5A 5CAPA 1JLUE 4EK4A 5BV3A 3U9CA 4KKEA 3VHKA 3I6WA 3P5KA 3MB7A 2QOBA 4BYIA 3E93A 1ZYLA 4YHJA 4O1PA 3TNWA 4FKTA 4IW0A 1DI9A 5A6NA 3DZOA 2XS0A 3LCTA 3SD0A 3A7JA 3BE2A 3OW3A 3A7FA 4ZXTA 4FV0A 3VAPA 4AOJA 5A9UA 2IZRA 4GFGA 4TYJA 1BUHA 4YBJA 5FXSA 3UOJA 4MK0A 4R7BA 4AQKA 3TNQB 3O5AA 3TJDA 2XKDA 3AOXA 3WARA 2O64A 4G6OA 4BGQA 2BAQA 4JDIA 2GS2A 4KBCA 3GQIA 2BTSA 5HHWA 4UZHA 5C27A 3PSDA 1R78A 3QQUA 2FH9A 5CLPA 3R9NA 4EHZA 2VTOA 4RX7A 2PVMA 5HZNA 4LV7A 2QKWB 1RJBA 1KSWA 2XKFA 2C0OA 4D1SA 5CXZA 1JBPE 2YJSA 2VNWA 2UZVA 3WI6A 2QKRA 3F6XA 1U5RA 2VO7A 2WZJA 3GQLA 3HX4A 4O0YA 3S00A 1H8FA 1Q61A 5E92A 2EB2A 4RIOA 4IAAA 2BILB 3CGOA 4OBOA 4Q9SA 4DFYA 4HYHA 5L2TA 1BLXA 4FZDB 3LFQA 3JVRA 1NVRA 1E9HA 3LZBA 3U87A 3EIDA 3W0OA 1J1CA 3A61A 2CKOA 4WD5A 4BDHA 2XNGA 3O96A 4GRBA 4G5JA 3TI1A 3V8SA 3V5TA 4IMYA 3LJ1A 3RCJA 3NNXA 3E7VA 4XV9A 1XQZA 4D55A 2XK9A 5AMNA 4F65A 1IG1A 1OUYA 3MPTA 3LE6A 3OW4A 3FWQA 1IA9A 3F3VA 1UNGA 3BV2A 3R7IA 1YOJA 2RF9A 3FQEA 3V8TA 3GFEA 5C8NA 2OIBA 4IDVA 5CNOA 3RWQA 5JFSA 3L9NA 1YXSA 2IJMA 3MY0A 4H3PA 2XKCA 2W1IA 4EQUA 4TW9A 4X2KA 2RG5A 2JIVA 4ACHA 4JBVA 1QPEA 1MRYA 2ITZA 2OIQA 2QO9A 3EQFA 4FBXA 4EH8A 5ITAA 4M68A 3QHWA 4I24A 2VV9A 4NFNA 4ZTSA 4MNFA 1AQ1A 1W0XC 3RALA 2WMTA 4CRLA 3EKNA 4KSQA 2AUHA 4D2RA 4DG2E 4ZTQA 3CXWA 3NVKI 3TNIA 2GQSA 4FR4A 1WAKA 2IVVA 3R30A 1Q8UA 3DGKA 3VC4A 4QOXA 3VVHA 2X6DA 1QCFA 2NP8A 2OJIA 3DQXA 4IM3A 3ZH8A 5BYLA 4OTGA 2W7XA 3EKKA 5CALA 3QALE 2J90A 4B8MA 2CLQA 2OXDA 4RA4A 4E93A 3N4UA 4YC6A 4I6LA 2A2AA 3BLAA 3KGAA 2OH0E 3CJFA 2XNOA 1V0BA 3DXNA 3M2WA 4L68A 3OEFX 4UYNA 1RDQE 4J97A 3HV3A 2CDZA 1KV2A 2OJFE 1VEBA 2QHNA 3NWWA 3BBWA 4YC8A 4O4CA 4U97A 4M67A 1Z9XA 4YPSA 3H10A 3QC4A 3A62A 4Z3VA 4XG4A 1H1RA 4L67A 2A0CX 2WXVA 3ELJA 3RJCA 2Z7QA 3KXZA 4GYGA 5TOZA 3D9VA 2PZPA 4IX5A 4TXCA 4BZNA 5M57A 2F7EE 2X9EA 4J7BA 3U6IA 3UIUA 3UQGA 1ZOHA 4BCQA 2X7FA 5M53A 5ICPA 4E20A 2GPHA 3DDPA 4CLIA 3G15A 3JY9A 3IW8A 3ZRKA 3M42A 4FV5A 3OT3A 4M0ZA 3ZS5A 4NCTA 3MIAA 3FYJX 3U6JA 4EEVA 4J71A 3MJ1A 4UMPA 5JMSA 3ZBFA 5TKDA 4MXZA 5C8MA 4HYUA 4MD7E 1PW2A 4WUAA 4BKZA 4MCVA 4MVFA 2YLFA 3TZ9A 4XRLA 4XYFA 3ODYX 5HG7A 3RZFA 1U46A 2B1PA 4B8LA 4EWHA 3D5UA 2QODA 2ZVAA 4U79A 4XG7A 5DEYA 3E62A 4MNEA 3VBQA 4DH3A 3TYKA 3P79A 3CY3A 1R3CA 3VF9A 2QI8A 1OUKA 2JKQA 1XBAA 4FICA 4QYFA 3KF7A 3DB6A 3LFCA 3TNPC 3CIKA 3UC4A 3E7OA 4QP1A 3W0NA 4M66A 2P3GX 2BRHA 3FMKA 3FXWA 4GIIA 3SW4A 3T3UA 4TN6A 2F2UA 3SVVA 3Q9WA 3KF4A 3VUTA 1MRUA 2BVAA 3EYGA 4C4FA 3CPBA 3GU7A 1ATPE 2A98A 3WE4A 3WZJA 3AC2A 4H39A 4EH2A 5CEPA 1IAHA 2V55A 2J4ZA 4FL2A 4CKRA 2EWAA 3KMMA 2PVHA 4QMMA 5IUIA 2C6LA 5HESA 3UOKA 4U44A 1XO2B 5BX0A 2W05A 1OPJA 3M1SA 4DEGA 4I22A 5EHOA 5BVKA 4I6BA 4EOOA 5A14A 2CN8A 3P4KA 1CDKA 3TT0A 2G15A 4M97A 3FKOA 3C4CA 3QCSA 2G2IA 3DJ6A 3PPJA 2YEXA 3LQ3A 3OWPA 3UP7A 2DUVA 5JZNA 4R1VA 2C68A 4IAZA 4WNKA 1MUOA 3DV3A 3SC1A 3QLFA 5J1VA 2HELA 4ANOA 3DY7A 3QUEA 4IH8A 4Q9ZA 4C2VA 3E63A 2HAKA 2HZIA 1XBBA 4NK9A 1NT2A 5J79A 3NR9A 2I0HA 1R0EA 3H9FA 3KRWA 1Y8GA 1DS5A 3O8TA 2YERA 4L42A 3R00A 4C0TA 1IAJA 3COHA 3FZSA 4E5AX 5A4TA 2C6EA 2CHLA 4KKHA 3RTPA 1KOAA 3NUYA 4JOAA 2WMQA 5EDRA 1TQIA 5AR2A 2Q0NA 4PMTA 5DMZA 5IA4A 3QBNA 2VRXA 3FLZA 4QMWA 5D9HA 5EOLA 1XMMA 4EOJA 5C26A 3FJQE 2YAKA 4GSBA 4IAFA 4ERWA 2PE1A 4X3JA 3BRBA 1PMVA 4I3ZA 3WF9A 2WEIA 4JRNA 2RFEA 3DTCA 4FTLA 5EI6A 3R8UA 4EYJA 3NYNA 3PWDA 4R5SA 3TTJA 1BL7A 3HGKA 3FZPA 4LM5A 4RVMA 3R21A 3NMUF 2R7IA 2OIDA 4L3PA 4U0IA 2J2IB 2V7AA 4ZJJA 4FVPA 4ALVA 3GCPA 2R3KA 4YTIA 3ZDUA 4CRSA 4HVSA 4PDOA 4YNOA 3R7EA 3WF8A 4LUDA 4DTAA 4FTCA 3S2PA 4RJ3A 4YUQA 1Q97A 4XV2A 1FPUA 5CQUA 5AUWA 4O96A 4J8MA 4JJRA 1G8KA 2XEYA 3CKXA 2QLQA 3TCPA 5KBQA 3L1SA 3QTQA 1MQBA 4CQGA 1YHWA 4R5YA 3BPRA 4TYHA 3O8PA 3UQCA 3W0QA 5LQFA 3BV3A 2C4GA 3GU4A 3VRYA 1CKPA 3DNEA 3VS2A 3GCVA 4PPCA 4BDEA 4K18A 3QQFA 4J98A 2UV2A 2XB7A 4UMRA 2JFLA 5GNKA 5KCVA 3ZO2A 3F66A 5ANOA 3MVLA 4FUXA 4E5WA 3MN3A 5JH6A 5CF5A 4RA5A 4UALA 5BVEA 3UNZA 3PXRA 4RVLA 3T8OA 1G5SA 3QX4A 4TWPA 4RVKA 3TNHA 4D2PA 3R02A 1OKWA 3DK6A 4JDKA 2C5NA 4RFYA 3HLLA 2RFNA 2YIWA 4BIBA 3AXWA 2ZM4A 4UN0C 4XMOA 4A9UA 3KXHA 4CMUA 4PMMA 3N51A 4MAOA 4N6YA 2VTIA 2R3JA 4RX8A 5HBHA 4GKIA 2XCKA 3LXLA 2BHHA 2C6DA 2W99B 3B8RA 4AUAA 4MH7A 4IACA 1MP8A 4MHAA 3Q5ZA 2OF2A 4JI9A 3UDBA 4U8ZA 4CYJA 3FMEA 5IEXA 3VBXA 3SOAA 4PTCA 4Y83A 2R5TA 2B55A 2GMXA 2VTMA 2W4JA 2XF0A 4FKUA 4V0GA 4WOVA 4CYIA 1BI8A 4FMQA 2W1HA 3QUDA 2XUUA 3FZRA 3ITZA 4MD8E 4BTMA 3ML1A 3ZO1A 2OLCA 2R3MA 2V62A 4M0YA 4EK3A 3G9NA 3VRZA 3NYVA 4FV9A 1H4LA 2WEVA 5CZIA 2HZ4A 4AT5A 3RBWA 5A3XA 4GT3A 4BTJA 3DNDA 4AXAA 5LVNA 4O7YA 3BLQA 1I44A 2IZTA 3F5UA 3LXPA 1DAYA 1ZOGA 2UW5A 3EQIA 3ZRMA 4AGWA 4I93A 4OT5A 2ETMA 3LQ8A 3ZC5A 3FMNA 3IDBA 4DTBA 5I9ZA 4IFCA 4IWPA 4U5JA 5E4HA 3SGCA 5DT3A 4DEEA 3HV6A 3HMNA 1P4OA 1FMOE 5EYCA 4CTBA 4Q2AA 2QG7A 5I4NA 4FIFA 1G8SA 2VX1A 2J7TA 2PVRA 4ZEGA 1PXPA 3W16A 2UVZA 4GEOA 4M69A 4QO9A 3VULA 4FIJA 5CU3A 5EFQA 1BX6A 3I81A 5HE2A 2WTVA 5IMEA 5EQPA 2UZOA 5CY3A 2XJ1A 3NUPA 3RK7A 5CSXA 3LCDA 1ZRZA 4C4GA 5BUJA 3C0IA 4WUNA 5L6WL 2QU6A 3C51A 4AN2A 4IC8A 1YXUA 1ZMUA 3DFCB 4YJPA 3VF8A 2WMVA 3F3UA 3QQLA 5KHXA 4E3CA 4UX9A 3MBLA 1WBPA 2IN6A 5HEZA 4DH8A 4MTAA 2QC6A 4HVHA 4DFBA 3A7IA 1SZMA 1YDTE 3ZXTA 2V22A 2ITNA 3QL8A 1MQ4A 3GC7A 4X2GA 3HMIA 4NM7A 5GJFA 4LUEA 3UYTA 4K9YA 3QLGA 4WNOA 5M4IA 4O4BB 1TFFA 2PVJA 4IB1A 1M7NA 3SQQA 2RKUA 3EZVA 4QMQA 1UVRA 2GNJA 5IU2A 5DGZA 4LDTA 3FPMA 2OH4A 1Z57A 2LAVA 1WBWA 5BUEA 3EQPA 3R7VA 3I4BA 4FTRA 2VAGA 4ANMA 4ZTLA 1NVSA 2C0TA 3NS9A 1PMUA 4MXXA 4CLJA 3TM0A 4DT9A 2PVYA 3EFJA 5IPJA 1XMLA 3DT1A 4IADA 3RPYA 5GHVA 2OKRA 3L9MA 5E1EA 3FI2A 4IFGA 1WBTA 2YIXA 3PVGA 4FT0A 4AOIA 1Q62A 2Z7RA 1FMKA 4O38A 2R64A 3ACJA 4U45A 2W4KA 4L00A 3D4QA 4AU8A 4QDEA 3OC1A 3T9IA 4I6FA 3DXPA 4XX9A 5KBRA 4L43A 4QQ5A 3FPQA 1JKLA 4KRDA 4M14A 3SRVA 3JXWA 4P5QA 1XBCA 3WIKA 4IBMA 5CANA 1STCE 3OTVA 4PMPA 1ND4A 5LOHA 4HNFA 2PMNX 4BWPA 5EW3A 1NVQA 4OT6A 2BRBA 2H96A 1H01A 5FLFA 5TE0A 2F7ZE 2YLEA 5EHLA 3SLSA 4EJNA 4BDAA 4OTHA 4KUJA 4O84A 3AC3A 3ORTA 4YPDA 1OZ1A 3ZRLA 3VS1A 2YISA 1J7LA 3COMA 5JGBA 2BKKA 4USEA 5HIDA 4KABA 3EL7A 3EZRA 5GJDA 4IVCA 4BI1A 4FZAB 4MXOA 3FZTA 2RFSA 2VTSA 3HVCA 3IGGA 1Q8TA 2ZMCA 4GVAA 2OI4X 4KSPA 3R22A 5ACBC 3DB8A 5CQWA 3QRUA 4BDDA 5D1JA 4JG8A 4UBAA 3TZ7A 3PTGA 3AT2A 4HJOA 2CGVA 4XHKB 4YHFA 5CVHA 4RIYA 1BMKA 4IWDA 1OIRA 3DAEA 2XNNA 4UY9A 4O1OA 3RAWA 3W8QA 3R9RA 4BDJA 3LIJA 3O17A 4FODA 5ETCA 2F4JA 2W9ZB 4LI5A 4LRKA 5HO7A 3RGFA 1Q8ZA 2VWVA 2R7BA 3EH9A 4NJ3A 2YDKA 4EOSA 2Y6MA 2ZJWA 3ZUUA 3D7ZA 3CQWA 4RIWA 3PY3A 3EYHA 5JRSA 4C59A 2B9JA 4NYEA 5IH4A 4ZTRA 2BZKB 5DN3A 3EQRA 2RFDA 5K0KA 5IUGA 5E8ZA 5E8WA 2GTNA 5EI2A 5IQDA 4QEBA 4GVJA 1ZMWA 4O0SA 3OMVA 4YZMA 3DJ7A 4U6RA 3H30A 1OB3A 3LFSA 4ZSGA 5KX8A 4CVAA 4L3JA 4Y5QA 4G3EA 3WYXA 4JMQA 1LEWA 4YLLA 2ZM3A 5DT0A 2XK8A 5AUZA 5IH6A 2VUWA 1U59A 2OK1A 4G17A 5L6PA 4W8DA 3FYKX 3KK8A 4A9TA 4ZZOA 3FLNC 3QTXA 4RMZA 2QG5A 1GOLA 4FIIA 4AXEA 2CGUA 2C5YA 4ZY4A 3UZTA 1JSUA 1H1PA 3EFKA 1Q3WA 3FXXA 3P23A 1RW8A 1P2AA 2PVFA 3D7TA 4FKWA 4U80A 2DS1A 3QTRA 4EH4A 2YCFA 4FJVA 5L8JA 4CQEA 4RVTA 3BWFA 1XHAA 1W98A 2C6OA 3MFRA 3OOMA 3Q4TA 3VW8A 4E26A 3ODZX 4PL4A 3UVRA 4GK2A 1UU8A 2KULA 3BGQA 4IVAA 4EC8A 5CSVA 5CU0A 3PUFC 3NEWA 3VN9A 3D14A 2WU7A 3U55A 4FEXA 5KZIA 4P2KA 3OHTA 4NEUA 3UMXA 5AX9A 3NCGA 4EJ7A 2BDFA 4J53A 1VZOA 1SVEA 5AR7A 4YR8A 3MH3A 5FDXA 2QR7A 3HRCA 3AD5A 2Z02A 4DFLA 5IQGA 4F7NA 5CVGA 1UV5A 3GU8A 3RKBA 4AGDA 3VUDA 3OS3A 5EKOA 3R8MA 4PUZA 3UTOA 2JDOA 2PSQA 4PTGA 4IAYA 4ZJIA 3FXZA 3OY3A 4YURA 5AADA 3SA0A 3W0SA 5J7BA 3MV5A 3LMHA 3ET7A 4ZK5A 4EWQA 1SNXA 4TY1A 3C0GA 1J7UA 5M08A 2B52A 3FDNA 3ROYA 4QMOA 4C57A 2IG7A 4LFIA 3PZEA 4JLCA 2I6LA 3NLBA 4D2VA 4YO4A 3DAJA 2YCRA 3R9DA 2AQXA 4JX7A 2F9GA 3H9OA 1YXVA 4BCOA 3FUPA 4OTIA 4RJ6A 2ZV2A 4XCUA 1ZARA 4EHGA 2P4IA 4FKVA 1DAWA 2G2HA 1YXXA 3QD2B 4R78A 2R9SA 4FKSA 1GZ8A 5HD7A 4WHZA 4JS8A 3PY1A 4OLIA 3U4UA 2Y0AA 3KXGA 2ETRA 3BELA 5DYJA 3TDWA 5C4KA 4HGEA 4KIPA 3LKMA 2PZIA 4PDSA 3GOPA 5JGAA 4EZ7A 3A7GA 2HK5A 3NCZA 1SM2A 4R7HA 5ANKA 3OZ6A 5FXQA 3TZMA 1W2CA 2XK4A 2ZAZA 4DEIA 4RWLA 4Y72A 3ZUVA 5EM6A 4EUUA 2VO3A 4C8BA 3CD8A 3CKWA 3KXXA 4NKAA 2VU3A 4ZZMA 4BCKA 4EBWA 4MF0A 2R4BA 3SOCA 5AV4A 4J1RA 1M52A 4I92A 5DFPA