3NEWA

P38-alpha complexed with compound 10
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery and Characterization of Non-ATP Site Inhibitors of the Mitogen Activated Protein (MAP) Kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3newA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3newA01
5DG5A 1J7UA 3DBFA 3MB6A 2QOCA 4O7YA 2CN8A 3PSDA 5EH0A 4IX5A 1JKTA 2IO6A 3OC1A 3UQCA 3V5WA 1SNXA 4FL3A 5FGKA 5HIEA 4F6UA 1QPEA 4OTFA 2XH5A 3EN6A 3P78A 3KRJA 3C4FA 4YZBA 5E8VA 3RCJA 2XVDA 5HU9A 5I9ZA 3PA3A 3FL5A 3ZFXA 5IA5A 5K5NA 2CJMA 1XR1A 4KAOA 3V5PA 3AT2A 3ZHPC 4DEEA 3LXPA 1PXNA 5HORA 4GVAA 3E3BX 3L8VA 4GRBA 1UV5A 3C4WA 4L52A 4FT5A 3PG1A 4D4YA 2ITQA 5AAGA 3I60A 2OBJA 3L9LA 2PY3A 3UMXA 3I79A 2XK3A 4KKEA 3JYAA 4M7IA 3N4TA 3WZJA 2YCQA 3PJCA 1XH4A 3UTOA 5ANGA 3JY0A 4U7ZA 4UWBA 3ODZX 3R9RA 5A4LA 2J0LA 2C5XA 4FC0A 4GU6A 4FEVA 5IH4A 1H1QA 2XK7A 3ZM4A 4O81A 2X2MA 4G3GA 3D5WA 4CGAA 3R7OA 1DAYA 3NCGA 4LGDA 4UYAA 5LXMA 1PXIA 3BU5A 5ACKA 4ACHA 3DJ6A 4IFGA 4C2WA 4O1PA 3PY0A 4FYOA 2X7GA 3OCSA 3QRJA 4QMYA 4OLIA 2WD1A 4ERWA 4R78A 4BI0A 3VS7A 1GIIA 3QYWA 3B2TA 2GNLA 1F5QA 2PUUA 2XKDA 3U8WA 3HMIA 4QRCA 4WRGA 4YJQA 5EKNA 3AT4A 4E5BA 4IX6A 3TTJA 5L4QA 5IQAA 5HBJA 4O0YA 4YTCA 1G3NA 4FV9A 3WF6A 4EONA 3DBCA 5E8TA 3EQBA 3G9LX 5HE2A 2B9FA 2OG8A 2YACA 3IW8A 1IEPA 2XKFA 3GGFA 4KIOA 4Q2AA 4QPSA 5HIDA 3CS9A 3QXOA 2BVAA 3LOKA 4KIPA 2XRUA 4C4GA 2OFVA 3QD3A 5JRQA 5LVNA 3KN5A 4GJ2A 5E7RA 4R8QA 4IW0A 5FXSA 1B6CB 3UMWA 4X21A 2B53A 3KK9A 2PE0A 1Q8TA 3ZLYA 4BCQA 4FG8A 2XB7A 4FOBA 4WO5A 2WMVA 5I9VA 3CTQA 1G8AA 2R3KA 3CBLA 1OM1A 3EQFA 4ZSGA 4AUAA 4AX8A 1XH9A 5TOZA 3O8UA 1Q24A 4FSWA 2XBAA 3SV0A 4YBJA 4QMMA 2PL0A 1QL6A 2W4OA 5BVEA 4ZIMA 3QZIA 5IQGA 1FPUA 5A9UA 5HLNA 3A4OX 4I1ZA 3MIAA 4PMMA 4BZOA 3H4JA 4ZJIA 4DLIA 4FA2A 5AR3A 4AT4A 4XG3A 3NNWA 5KMKA 2R0IA 3P79A 3QD0A 2ZV7A 2VTRA 5M06A 3U9CA 5LMBA 4MXZA 3RP9A 4U45A 2C6DA 4F9CA 4O7SA 1UNGA 4G1WA 5KMLA 3O8PA 3QC9A 5CT0A 3DOGA 3QTRA 1OL2A 5HNBA 2PMLX 3A7IA 3C0IA 3Q53A 4LMUA 5FM2A 4NM0A 2X81A 5DMZA 3P7CA 4LGHA 5EFQA 5IH5A 3UVPA 3W8LA 4B0GA 2BIKB 3IDBA 3RPYA 5ANJA 4GL9A 3AQVA 4HVIA 4JDKA 4II5A 2J6MA 2VTPA 3EN5A 4OT5A 4AGWA 2J4ZA 4RX5A 3D14A 2X6DA 4K18A 4TYHB 5DE2A 1CKJA 2GSFA 3OCGA 3EQGA 5IMEA 4RJ8A 4NM5A 3ZO3A 2EXEA 4ALUA 3HGKA 4N6ZA 5FM3A 4RWIA 5EYDA 3C4EA 3U6JA 2C1AA 3FI8A 2BALA 3SG9A 2UZNA 4FZAB 4MWIA 4CMTA 4WG5A 4LGGA 2P55A 1HCKA 2O8YA 3SXFA 5KMOA 1EH4A 4W4VA 2XS0A 3P7AA 2GNGA 2X8IA 4UBAA 1VJYA 4X7QA 5E90A 3R71A 3VULA 2Z7LA 3GC0A 3HZTA 4A9YA 3D0EA 4DBNA 1ZMVA 4CRSA 4ANSA 2I6LA 2OXXA 3LCSA 5HD4A 1A9UA 2ITNA 2ZV8A 5HX6A 2YWVA 5DR9A 5BYLA 4NFMA 4MXOA 1Q41A 1BX6A 4LQMA 4TYEA 5C26A 2C0TA 4D1SA 5HD7A 4ASDA 2GCDA 2UZEA 4GH2A 2C69A 3PXRA 3DB8A 2NRYA 2R3LA 4R6VA 2E9OA 4USDA 3LCOA 4MD7E 3UO4A 3KA0A 3GEQA 1R39A 1XBCA 2WPAA 3ZO1A 5HZNA 4G16A 4FODA 3NX8A 4KWPA 3FI3A 4ZP5A 4BKZA 5HLWA 3DJ7A 4FT7A 4YUQA 3F88A 3PIYA 3QX2A 3DV3A 4MCVA 4FICA 1RW8A 2Z60A 4QP7A 3LCDA 1VR2A 3T9TA 3DKGA 1NXKA 3FQSA 4EOLA 1H08A 2YCFA 4O91A 2XK6A 2Z7SA 4XP3A 3AC3A 4TYHA 4L3JA 4D1ZA 1KWPA 4HCTA 4XOZA 3VS6A 4O7NA 4YJTA 3U87A 2WTCA 5ANDA 1YDTE 2XJ2A 4DE4A 3BQRA 2W1GA 4NUSA 1U54B 1OUYA 4JXFA 3KK8A 5AUVA 1V0BA 3ORKA 5ETIA 2OH4A 4CKJA 4DT8A 3CTHA 3FY0A 3O17A 4TYJA 5B2KA 5AAFA 4PP7A 5M4CA 2HY0A 2WAJA 3I4BA 1H1PA 1JSUA 3NPCA 3UYSA 3M11A 2IPXA 2YJRA 3R8VA 2QO7A 1ZMUA 3LM0A 3DZQA 2IW8A 3R28A 4ZXTA 2PVYA 1PMVA 5BVNA 4ZY4A 5CYIA 1MRUA 2F7EE 5L2SA 5GZ9A 3K5UA 4K0YA 2PULA 2VWWA 3BEAA 1ZARA 3PY3A 4XV3A 1ZYCA 3LQ5A 4RC3A 2B0QA 2I0VA 3KXNA 4LMNA 4MH7A 3Q5IA 4PQNA 4IEBA 3DK6A 3HUBA 3LFEA 5IZFA 2LAVA 4WUNA 4HVGA 5IF1A 2ITXA 4BIDA 4B4LA 3PXZA 3I7CA 4Y83A 2I1MA 1P5EA 3ACJA 3R21A 4ONAA 5DYJA 5FRIA 2C5OA 4TRLA 5DRDA 2PWLA 5AP6A 3ITZA 5GINE 1JAMA 1M2QA 3V5LA 3TUCA 2E9PA 3K5VA 4IC8A 5IU2A 4EH5A 3FJQE 2F2UA 3V51A 2VAGA 4X2FA 2R3QA 2Y7JA 1KE7A 2JIUA 2VNYA 3HX4A 4QMXA 2BFXA 4E20A 3G5DA 3NGAA 2GPHA 2I7QA 5IDNA 3PLAE 3A7GA 2HENA 3ULIA 4RIWA 4FK3A 3ZDIA 1UU3A 2QOLA 5E91A 2HWPA 4BTFA 4LOQA 3HDNA 3QQUA 3JR1A 3KXXA 3OXTA 3KRLA 4QP9A 1H00A 1MQ4A 3R8UA 2QCSA 3R6XA 4IM0A 3I6UA 4KABA 1U54A 4K2RA 4PPAA 2VO7A 2YDKA 4BIEA 3GC8A 4WD5A 4H58A 5LCJA 3QQKA 4R5YA 4RGJA 4YZCA 4TYGA 3UJGA 1YI3A 3NYOA 3A62A 2YA9A 3CQEA 4HZRA 4KIQA 1PYEA 4O0WA 2BKZA 5AP1A 3VJOA 2YM3A 4W4XA 3TIZA 4MX9A 2UW0A 5B0XA 4RSSA 4DH5A 3E92A 3P1AA 3OT3A 4U5JA 3VUKA 5HX8A 2ETMA 4WBOA 1FOTA 3OWKA 4H39A 4E1ZA 1Y6AA 4QQTA 1P14A 1OPKA 2BAQA 2YM7A 3OD6X 5FXQA 4EBWA 4RX9A 3QCXA 4Y5HA 3KULB 1OIYA 1A06A 2Z7RA 3A8XA 3FZSA 4J7BA 4R3RA 4Y72A 5D7VA 5IKWA 2JIVA 4FKLA 4XP0A 2XCKA 4GKIA 3OWPA 4AF3A 4RC4A 3IOKA 3E8CA 4HYUA 5FTQA 1GY3A 5IQDA 4RBLA 3Q60A 3R7EA 3FC1X 3LW0A 4UMQA 3FQEA 1ERKA 5CEKA 1BYGA 2JDSA 1PXMA 3FL4A 3OG7A 4WG4A 3GFEA 5BMSA 4ANQA 5CF4A 2GNHA 2YDJA 3CKWA 2HAKA 3D4QA 1DI8A 5A4CA 5JGBA 1U5RA 4GG7A 4FZFB 4HPUE 1QMZA 4WIHA 2UZVA 3VBVA 5IMXA 3UZTA 4R1YA 5AUYA 3UOHA 2BRHA 2GFCA 3UVQA 2UVYA 3T3VA 2WTVA 1SYKA 2WIHA 3UIMA 3EFLA 5KKRC 4EHVA 4UXQA 5AIRA 3UOKA 3DK3A 3MPAA 4NTTA 4E3CA 2ZMCA 3F3VA 4XLVA 2NO3A 3V3VA 2XK8A 5KCVA 2J5FA 3AGLA 3TKUA 3F2AA 3MVMA 4F0FA 3BI6A 2QU6A 3OXIA 2UZWE 4BCPA 3C0GA 3BZ3A 1R3CA 2WMAA 3AD5A 3EN9A 1M17A 4LOOA 5M4UA 4NW6A 4IVCA 5CU4A 1KV2A 4TL0A 3GT8A 4O21A 3ZZEA 2HWOA 3BU3A 5I3RA 2PUNA 4TXCA 2YLFA 3EYGA 4FKGA 3VBXA 3C5IA 3EFKA 3QZGA 1BL6A 4TWPA 2RG6A 4AZFA 1WBPA 2UZBA 3QKMA 4IDTA 4IC7A 4BDGA 5JFXA 5JGAA 4AU8A 5J95A 5LMKA 2XNGA 3RPRA 2VX1A 1HCLA 3D94A 3HMMA 5CZHA 3IONA 3OY3A 4GT4A 4CCUA 1YHSA 4TWNA 4R77A 3KULA 3KVXA 4LRKA 4YPSA 4FTOA 2YIRA 3KN6A 4I94A 5HEZA 5AUWA 4E4NA 4DTAA 5EI8A 5DOSA 2VGOA 3R01A 4V01A 3EB0A 2R2PA 5AUUA 2CHLA 3QTSA 4DYMA 5T3QA 2YM6A 4JRNA 5AV2A 2OJJA 3JS2A 2NPQA 4RQKA 4EH2A 2ERKA 3CCNA 2W1FA 3IDCA 4X2KA 4LRMA 2PMIA 4BDIA 1OBGA 4ZY5A 3MA3A 4C38A 4GYIA 1J1CA 3LQ3A 2OKRA 1YRPA 2OU7A 3MH2A 2VWBA 4OTGA 5TE0A 1PXJA 1DM2A 3UP7A 1NT2A 4ZMEA 3C13A 1PJKA 2ITPA 3G2FA 3LZBA 4NEUA 2DQ7X 4ARKA 3BYOA 1XH7A 3IO7A 4YNOA 2G1TA 3W8QA 3CTJA 3S00A 3S2PA 4C57A 2HYYA 2ZMDA 4FZ6A 4C33A 4YTHA 4EC9A 3MB7A 1VYWA 3MJ2A 3RMFA 4GU9A 4HVDA 2CNVA 4O7WA 2BPMA 2GU8A 3C0HA 3CY2A 4I20A 3PXFA 4AACA 2ETRA 3GNIB 4L44A 4QPAA 4FTTA 4XLIA 4YHTA 3OCBA 3D5UA 3MBLA 4NH1A 5CQUA 4EH4A 3FLWA 3KMWA 1CKPA 4YTIA 5CALA 5DGZA 5FLFA 2ZDTA 4OTHA 4Q5EA 1IAJA 3R30A 1PRYA 2QO2A 2P0CA 3T8OA 3BGPA 1A48A 3FMEA 3PSBA 5M4IA 3KREA 1UA2A 2QOHA 4I5CA 3H9RA 4EOPA 2WTDA 2J0MB 4G5PA 4F1TA 2VTJA 3ZLXA 4G6NA 4CQEA 5DEWA 4Z55A 4CCBA 5HVJA 2J90A 4XG2A 2OIQA 3UZPA 4G6LA 4M0YA 1JBPE 1PF8A 4U0IA 3FYKX 4FIFA 4I0RA 4UX9A 3QRUA 2C30A 3N4VA 3WZEA 2XJ1A 4IJPA 3LMHA 2UW9A 4C4FA 3CJGA 3DBQA 5H3QA 3R7UA 2QOQA 3W2CA 5E4HA 2XYUA 5CF5A 2VTMA 1PYXA 3UGCA 1Z5MA 4JIAA 4D0WA 3WZDA 1YWNA 2IW9A 4HJOA 3OVVA 1OECA 3REPA 3VF9A 1TKIA 3PVUA 2VRXA 3CD3A 4AW2A 4C59A 4EOOA 4ANBA 5E8YA 4C4IA 4BCKA 3Q4CA 2WQBA 2G15A 3HAMA 4CV8A 2AC5A 4N57A 3FBVA 4LUDA 4BGHA 2WTKB 1VEBA 2LGCA 5AP3A 5I9XA 3QTXA 4YO4A 3R9OA 4BR3A 1YOLA 3PYYA 2JBPA 4CEGA 4Z16A 3Q9WA 5CX9A 2GHMA 5JFWA 2PE2A 4N0SA 4GG5A 5HESA 4GIHA 3V6SA 4XCUA 5D12A 4MHAA 2PUIA 5J9YA 4EOJA 4RT7A 4WBBB 3UVRA 2BILB 1OKVA 3VNTA 3A8WA 5DIAA 3QUPA 3RINA 5CAQA 3M2WA 4HCVA 4OR5A 2REIA 1MP8A 3GQIA 5J5SA 3QZFA 2R5TA 3PJ8A 5BX0A 4FIIA 4L8MA 5L2WA 4S31A 3LLTA 4IX4A 4ZTHA 4FTKA 3BWFA 3ORXA 4D2WA 1PKGA 5DWRA 4OAUC 3FLYA 2WGJA 2PZRA 1PHKA 3PPJA 4DFXE 3EQCA 4YZ9A 1WAKA 4M69B 3ZO2A 2W99B 3Q4UA 3OOGA 3VRYA 4YSMA 1Q8YA 5AMNA 4ID7A 3IS5A 2RFDA 2W1ZA 4I21A 5KMIA 2X4FA 3QCSA 4W4YA 3LMIA 3SQQA 3TJDA 3Q5ZA 5D9HA 1KOBA 5M08A 3IW4A 3VBQA 4UMTA 4A4XA 3KMMA 3QC4A 5D11A 2W5HA 3GI3A 3QD2B 1AD5A 3H3CA 5BUJA 2VNWA 2X39A 1QPDA 4ZTLA 4YGAA 4RVLA 1M2RA 5I9YA 2A27A 4IADA 4GFGA 4D5HA 2HCKA 2Z8CA 3Q4TA 3FE3A 4OGRA 4U80A 4GT3A 3ZDUA 4U41A 5BUEA 2XBJA 4C8BA 3VS5A 2QKRA 3UQGA 4Z3VA 4D1XA 2VWIA 5K0KA 2XYNA 2FH9A 5EHLA 3HV7A 3R0TA 4EK5A 4A07A 1LEWA 4JQEA 4U3YA 4QMUA 4MD8E 2W4KA 3AC5A 4JBOA 2WQMA 1M7QA 4BRXA 2JAVA 5FD2A 5KHWA 3PSCA 5BQ0A 3RK9A 3GP0A 4O0SA 4AZVA 3R9NA 2VWYA 4XV2A 5JKGA 5CEIA 2B52A 2OO8X 4XP2A 5CSXA 5HICA 1R1WA 2B54A 2VTLA 4RFYA 4YZMA 2BCJA 3LJ0A 4EUUA 3VUHA 4E6DA 3TWJA 4D9TA 3NWWA 3SRVB 3DNDA 3OROA 4NKSA 3QQLA 4DTBA 3ANRA 3IG7A 4C4JA 5EM7A 5TF9A 5M4FA 5DEYA 3ETAA 2XP2A 3QCYA 3A4PA 2BRGA 4FZ7A 4XHKB 3ORNA 1ZMWA 3DS6A 3ZU7A 2VGPA 3ZTXA 4D28A 2G01A 4TW9A 3TNPC 3D5XA 3MTLA 2UUEA 4HCUA 4X3JA 5K3YA 4BDEA 1SMHA 4BDKA 4CMOA 1SNUA 5FEQA 5CQWA 5IDPA 4OTIA 4U9AA 2E9VA 3ZSGA 4W9WA 3UYTA 4BCHA 5EI2A 3DKOA 4AZSA 4DGGA 2V0DA 4TNDA 4IE9A 4J71A 4ACDA 2Y0AA 3PTGA 4QNAA 4WRSA 1ZZ2A 5EM6A 4FIEA 4D58A 5AM6A 4QTDA 3UG1A 1CTPE 1FVTA 3HDMA 4B9DA 1FVRA 5AP5A 3TZ9A 4BYJA 5KMJA 3ORTA 3DZOA 5K5XA 2GFSA 3HA8A 1RQQA 3CD8A 2GHGA 1NVSA 4IACA 4RWLA 2VUWA 4EORA 4C34A 5GIOE 4JDIA 5IUIA 5HTIA 5L2IA 2F4JA 1H27A 3MPTA 3PXKA 4B8MA 5G1XA 2PHKA 3QGYA 4DFUA 2PMOX 1NVRA 3KCKA 4QTAA 3DTWA 3RPVA 2PYWA 3MS9A 4FV7A 4PF4A 2IVSA 2ITVA 1CM8A 4FNZA 4CYJA 5AUTA 5HCZA 3BYUA 3KMUA 1WBNA 2BDFA 4QYGA 3R8LA 4ENXA 3MGYA 4ZS0A 4E4XA 4ANMA 3PXYA 5L2TA 4RLKA 3SRVA 3A61A 5C03A 4AP7A 4FKQA 5E1EA 4FT9A 2X8EA 2JDTA 5LJJA 4GFMA 4I23A 4PDSA 4KKGA 3TZMA 4IWDA 2RFEA 4Z9LA 3FHIA 3AD6A 3ID6C 5DT4A 2WB8A 3WF9A 1WCCA 2PMNX 3JXWA 2WMSA 3EQHA 5EM5A 3NW6A 1ZWSA 2GQSA 2C0OA 2C0IA 4KS7A 3Q6UA 4RWKA 3F7WA 5CNOA 5AR7A 4CMUA 5LQFA 5EDPA 2JITA 4QMLA 3ALOA 2BTSA 3HA6A 4O7VA 4RZWA 2R3OA 4UB7A 1Q3WA 2C47A 2NRUA 3GCUA 3MH0A 3RM7A 4JG7A 3O7LD 3ZRLA 1U46A 3DLZA 3MESA 2VTTA 4WG3A 4AQCA 1JVPP 2QLUA 4I6QA 4PTGA 4U40A 3RAWA 3UO6A 4BZDA 4DGMA 4F08A 2UVZA 4YJVA 5DRBA 5TR6A 4PDPA 3ZUVA 4RA4A 4I41A 3PIZA 3OXZA 3ZZWA 2PVFA 3I1AA 3PG3A 2UZLA 4FV0A 3RALA 3TIYA 3OW3A 5EYKA 1R0PA 3VHKA 4RPVA 5H8EA 4ZAUA 1WBOA 1OL6A 1H0VA 2UW4A 5JQ8A 2UW6A 4MXCA 5C8KA 4FZDB 2X2KA 4DC2A 4R7HA 3FI4A 2GHLA 4AE6A 3QTWA 3ROCA 1H4LA 2AUHA 2VN9A 3SLSA 4J95A 4BDJA 3SOAA 5GJFA 2R3MA 3TNQB 4B99A 3C4ZA 4E5WA 4W8DA 4NM7A 1J1BA 3H0YA 4F9WA 4TWOA 4L46A 2F7XE 2JD5A 4OTPA 3ALNA 2XMYA 3KY2A 5CVHA 4FVRA 3UPZA 2C6TA 3DTCA 3EZVA 3PE2A 3W2SA 3KQ7A 3R73A 4AS0A 4DN5A 5BUIA 2Y4IB 1FQ1B 4FF8A 1YXUA 1IRKA 4YC8A 4G3FA 5HNGA 4AOJA 2C3JA 2ZV9A 4GVJA 4B6LA 3QTQA 1XHAA 4WNKA 4ITJA 5C27A 4AGDA 2X0GA 5AR4A 4BBMA 3KEXA 4IAKA 2QLQA 5HO6A 1WBSA 5FDPA 3OW4A 1Z9XA 2VX0A 1IA8A 4PTEA 4X0MA 3OBGA 4EKLA 4DH3A 2VO3A 4BTMA 1B39A 3E8EA 4BWPA 3LKMA 3R1NA 1OPLA 4EYJA 5D1JA 4V0GB 2UV2A 1PXPA 4QPMA 3AOXA 4FKVA 4NL0A 3CIKA 3HMNA 3NMUF 1STCE 4ZTMA 4DBXA 2ITWA 4YLKA 3BHVA 4MKCA 4XBUA 3MFRA 5AIKA 2CKEA 5CEPA 4CKRA 3O71A 2YIXA 4DG3E 2WKMA 2DWBA 2QQ7A 3DGKA 3HV3A 2P4IA 3LVPA 4S33A 5HOAA 5AV3A 2JKOA 1BI7A 3BHTA 3SD0A 1LEZA 1ZLTA 1FMKA 2WXVA 3A99A 2JKKA 4NFNA 2GS7A 4A4LA 3RAKA 4OBOA 4D2TA 4TZRA 2XKEA 3E8DA 5AR8A 4IZ7A 2BFYA 5C8NA 4O22A 1ZXEA 2YDIA 3VAPA 3NUPA 4ZJVA 2OI4X 5FXRA 4NKAA 2OXDA 2XUUA 3ERKA 4FKRA 4RX7A 3I7BA 2CMWA 3AC4A 3G33A 3P9JA 3F5XA 3W16A 3MYGA 5L2QA 4EOSA 4BWKA 2V5QA 3ELJA 3NNXA 4P5QA 4WUAA 5CZIA 4F0IA 4M97A 4J53A 3GFWA 2XJ0A 3LXLA 3QA0A 4I0TA 3FXXA 4EJ7A 2CGUA 4RMZA 1OKWA 3QQHA 3GQLA 3W2PA 4XNEA 5AUZA 5A3XA 3QRIA 4P4CA 2V7AA 3CJFA 4UEUA 4U3ZA 3UNJA 1L3RE 1H1RA 3OEFX 4JOAA 1SVHA 3C1XA 4Q5HA 5AP0A 1RE8A 3U51A 2VWUA 2RGPA 5HG9A 4D9UA 4CFUA 2EVAA 2ZYBA 1Q8WA 3LFBA 3BV2A 4RIYB 3F6XA 5CSVA 1URCA 4X2GA 3R04A 5HE0A 1K3AA 3LJ2A 4YC3A 3W2QA 5GZ8A 2P3GX 2IW6A 1H0WA 4V0GA 2DS1A 5CLPA 2G2HA 3UQFA 2UW7A 2BRBA 2OSCA 4BICA 5CI7A 1IG1A 5FP5A 3VN9A 3BLQA 5AP7A 2O64A 3FI2A 1YI4A 4PTCA 3SAYA 2C6IA 3OWLA 4G6OA 4EHZA 2CN5A 4LFIA 1H01A 2XNOA 5AUXA 3TXOA 2ZVAA 3CR0A 3POZA 4FI1A 4BBFA 4FK6A 4QTEA 4QOXA 2B7AA 3OHTA 3DXQA 4DG0E 2UZDA 4EQCA 5AWMA 5LMKC 2OH0E 4MQ1A 3JY9A 1ZOGA 2XCHA 3CKXA 3GU8A 4PNKA 4DCAA 3GVUA 4JG6A 4G2FA 4XH6A 2H96A 4L7SA 5C01A 4EZ5A 4USEA 2WMTA 4PMSA 4GMYA 1ZY4A 2GQRA 2W05A 1KE8A 3F5GA 3EMGA 3KXMA 3TEIA 3UOLA 3OWJA 2FSMX 2R0UA 5TO8A 4GYGA 4E6CA 3LJ1A 1V0PA 1E1VA 1ZOEA 2R4BA 3A2CA 2WO6A 3FY2A 4PNIA 4Y95A 4UN0C 4QQ5A 4M3QA 1QPJA 4JBPA 4O7ZA 3SA0A 2C5VA 2YAAA 3KVWA 3LPBA 5CU6A 4WSYA 1Q8ZA 2ITYA 3MH3A 4D4RA 4FEQA 4H36A 2XIXA 2Q83A 3QRTA 5GIPE 3HRBA 5FBNC 3FQHA 3W55A 4F0GA 4CLJA 3R63A 5CANA 2HW6A 2QG5A 3UIBA 4Y8DA 2CNUA 5A14A 2F49A 3LFQA 1REKA 2ITTA 5HG8A 5E92A 3RGFA 3GC7A 4FKIA 2XEZA 2XIRA 1Q5KA 2ZJWA 4HNFA 1LR4A 3UPXA 3VUGA 3NVKI 2UW3A 3U54A 3EH9A 3TV6A 3G9NA 4JBQA 1P4FA 4F4PA 4QMNA 1BLXA 3GU5A 4FTLA 2VX3A 2PVNA 3PUPA 3AC1A 4KD1A 5EHOA 5HGIA 4K11A 4M66A 3E7VA 3DCVA 2XKCA 4RVKA 4BCOA 5FP6A 2PVHA 4UXLA 5LARA 1ZZLA 4PV0A 3CGFA 2VTOA 3EN4A 4HZSA 4L7FA 4MNFA 3R9DA 2C5YA 2I0YA 3I0OA 3KRXA 3BYSA 1ZYDA 1U5QA 2E2BA 1XKKA 3FZPA 3MN3A 3ZH8A 3VS0A 5BVWA 1IAHA 3QLGA 3R7IA 2XRWA 4HYHA 4QP1A 4BDCA 3RWQA 3CE3A 5J9LA 2GNJA 2BUJA 3PJ3A 4CVAA 4LV5A 3Q04A 4Y5QA 4H05A 1W0XC 5IPJA 2FA2A 5EW9A 5C4KA 5EM8A 4IJ9A 4E6QA 4F1MA 2Z2WA 3WF8A 1WZYA 2EUFB 2XIZA 4NJ3A 1IA9A 3TZ8A 3G0EA 1ZRZA 1O9UA 1WBWA 2C4GA 4JIKA 3P7BA 3LLAA 3QHRA 4MNEB 5KO1A 4TPTA 3E93A 5HCXA 3ZCLA 5AAEA 1WVYA 1CKIA 5DPVA 3R83A 4ERKA 2XIYA 3F2RA 4CZYB 3MW1A 4IVDA 2YCRA 4I5HA 1W98A 3OS3A 4FVPA 2HIWA 4BDHA 4JLCA 4C35A 4EHGA 4DGLC 3RAHA 4OW8A 5T6KA 3MI9A 1W83A 4XG7A 4K6ZA 2PVKA 2WMUA 3UC4A 3NEWA 4NT4A 3DQXA 4D0XA 1OL1A 3ENHA 3H10A 2GS6A 5BVFA 3MVHA 4FGBA 1TQMA 5AV0A 2J0JA 3MVLA 2CKQA 4M14A 4FYNA 1GZ8A 4O0UA 4XBRA 3S1HA 3HNGA 2WTJA 5JGDA 4EQMA 3O7LB 4O84A 2GNIA 3PWYA 3JUHA 2BZJA 2PZPA 4YHFA 3SOCA 3ANQA 3P86A 4YO6A 2WFYA 3TV4A 3QUDA 2R3HA 3DNEA 1PXOA 4YZNA 5AA8A 2BMCA 3Q96A 2VWVA 3AMYA 3GENA 4I0SA 3V6RA 4M13A 4Z7HA 4CFNA 4I6BA 5ANKA 4FSYA 3ENMA 3QD4A 5BPYA 1OB3A 1YQJA 3QTIA 3EJ1A 4ACMA 3L8PA 3R9HA 5IUGA 5DT0A 2GMXA 4AZEA 4F09A 4QO9A 2C3KA 4PPBA 3WE8A 3F82A 3R2YA 4LV8A 4ENYA 3ORPA 3DBDA 5F4NA 3RVGA 1NA7A 4DEDA 3VJNA 4JJRA 3WBLA 4DTKA 4D2VA 1GIHA 3BWJA 4MNEA 5DI1A 4F1OA 4FIJA 2R3JA 2QO9A 4FTMA 2R7IA 3IGOA 5AV4A 3HV5A 4O2ZA 2H9VA 5HO7A 3OF0A 4EK3A 1SZMA 5J79A 2A0CX 2PZ5A 2YIWA 3VS4A 2Y6MA 4DITA 1JKKA 3KXGA 1YOMA 3BX5A 3BGQA 3EQPA 4FR4A 4ZTNA 4K8AA 4UWCA 3G90X 4BKYA 4MBJA 3WZKA 4YC6A 4G3EA 3FKLA 4H1MA 5CTPA 1U4DA 4AWIA 5M55A 1Q62A 1Y6BA 3QX4A 5DNRA 3RWPA 3WI6A 5A6NA 2A1AB 3K2LA 5DA3A 2QKWB 2QR8A 2CKPA 4YNEA 4CNHA 2WIPA 4IB5A 3BHUA 3EL7A 3PRIA 3KKVA 3F3TA 3TKIA 3UDBA 5CENA 1Q99A 2ZB0A 5CAPA 5IA1A 2CGVA 4PMTA 3F3ZA 2VTAA 4FKTA 3Q6WA 5ETAA 4MYGA 2XNPA 3Q2MA 4I4FA 1Q8UA 3CEKA 3PJ2A 2OJGA 2YERA 2IJMA 3HL7A 4FX3A 2YHVA 4FV2A 2PVJA 5F9EA 4I6FA 4M67A 3DJ5A 1AQ1A 3KL8A 3H30A 3C4XA 3ZFMA 4AW5A 4LI5A 2NNWB 4GUBA 2OW3A 2FSOX 1JQHA 3D83A 4O7RA 5AP4A 2ONLA 5D10A 4NU1A 5L8KA 3BHYA 4QD6A 4BCIA 1BL7A 1Q4LA 3MFSA 2QI8A 4DH1A 1WVWA 1JSTA 3NNVA 4IQ6A 2HY81 4RJ4A 2H8HA 4O96A 5M51A 5CF6A 2PVLA 3V04A 5K4JA 3V5QA 3VW6A 4L00A 5KE0A 2P33A 4FT0A 4WSQA 4RJ5A 4YJOA 4HYSA 2RFNA 4ITIA 3ZONA 4ACGA 3KXZA 2B9HA 5LWMA 3MVJA 4QNYA 3SHEA 4RG0A 3BYMA 3NUNA 3NUAA 1P4OA 3U6IA 3MV5A 1Y8YA 2UZOA 3I5NA 5CU3A 5CS6A 3P08A 4EJNA 4RVTA 1OBDA 3BGZA 3R2BA 3PWDA 4FGRA 4TNBA 4ANOA 4A06A 5AV1A 4GT5A 2W0JA 3QUEA 4DG2E 4TYIA 1MQBA 3TTIA 1WVXA 4AOIA 1Y8GA 4H3BA 2IVUA 2E9NA 2JC6A 4IVAA 3UBDA 1SVGA 2C68A 2QURA 3GXLA 3MJ1A 4NM3A 5CEMA 4M84A 3LXNA 4C3RA 3N51A 4FTRA 2F57A 3BELA 4IZ5A 2YABA 4ZK5A 3NUSA 5LCKA 4CFFA 3TDWA 2ESMA 3DK7A 3PPKA 3JVRA 4D4SA 3C4CA 2Y6OA 2WTWA 4F7SA 3KFAA 3KRRA 3SXRA 4PDYA 2O5KA 3KC3A 4W8EA 3FMDA 3MDYA 1RJBA 3Q9XA 5TT7A 5CEOA 3HV6A 3LAUA 4I4EA 4GUEA 3VO3A 3AMBA 4IB1A 1O6LA 4AFJA 5FDXA 5JSMA 2YEXA 3IW7A 4E93A 4GW8A 1UKHA 1M52A 3FWQA 2Y4PA 3V8WA 1H24A 5CAVA 4OTDA 4U8ZA 4FKUA 4L53A 3SXSA 4BKJA 4Q9SA 2OZAB 3U9NA 4I5PA 5HHWA 1KUTA 2BZHB 1H07A 3Q52A 4EI4A 2OJFE 2I40A 2QOKA 5EDRA 4BCNA 2IVVA 4FOCA 5HQ0A 4PDOA 2O65A 5L6OA 4CQGA 2W9ZB 3VC4A 4C62A 1XO2B 2R3IA 3SG8A 3O51A 5IEYA 3V8SA 3I6WA 3FMKA 3NDMA 4O1OA 2IZRA 4X3FB 5CXHA 4MXYA 4MTAA 3VBYA 4S30A 5HKMA 4O6EA 2J51A 4DFBA 4ORKA 4FTJA 2XNBA 1K2PA 1WBTA 4WT6A 3VQHA 4A9UA 4CFXA 3TDVA 3MPMA 4AN9A 5GZAA 4EOMA 1MRVA 4XUFA 5ICPA 1OIRA 4LL5A 2X1NA 4NCTC 5EG3A 2BRMA 5FUTA 3OP5A 2A19B 4ZSLA 3V5JA 5A46A 4G34A 4UALA 3L8SA 4JBVA 4JNWA 3FMJA 4D2SA 5JK3A 5E8SA 3FC2A 2F9GA 4A9SA 4PWNA 3MY5A 1U59A 4L42A 4PP9A 5CY3A 1ZY5A 3VQUA 4ZS4A 4FKWA 1PKDA 4AXAA 4CT2A 4XMOA 4QP4A 4LL0A 5LVOA 5HBHA 2A4LA 5FTGA 2VD5A 5EYMA 1GIJA 3IKAA 3HP2A 1ZAOA 3R8ZA 3TI1A 4J52A 3ZEPA 2JDOA 2VTIA 3WOWA 5IQBA 4BCFA 3NAYA 1E1XA 4G5JA 3ZYAA 3ZXTA 2OZAA 3RCDA 3UOJA 3N9XA 3R1QA 5EW8A 4EYMA 3A7FA 1YWRA 4O7TA 5G6VA 4G9RA 5A4EA 3WYXA 3DXNA 4D2RA 4I3ZA 3KF4A 3RAIA 5AFVA 4TT7A 1XBAA 3JVSA 3UC3A 4KRCA 4C7TA 3EL8A 5ACBC 2PK9A 1PW2A 4CSVA 5LVMA 5HTCA 2R9SA 1PXKA 2YCSA 4FL1A 4G17A 1YOJA 4IIRA 3RK7A 4IBMA 3AC2A 3MSSA 4J8MA 4X3FA 3ZEWA 5GJDA 4QMVA 3V5TA 4CT1A 3EQDA 3Q9ZA 5CAOA 4RIXB 3UIXA 3ZUTA 4JAIA 3ZSHA 1XWSA 3ZXZA 5HCYA 5J1VA 1YXVA 2VTHA 3QU0A 2W1HA 4MF1A 2X7OA 3S4QA 2VU3A 4CG8A 2B9IA 3IQ7A 3ATTA 4ZLZA 3D9VA 2KTYA 2BIYA 2JKQA 4RJ3A 3RI1A 4YR8A 3QTUA 3DPKA 3WF7A 4BTJA 4M68A 2XM9A 1RDQE 2EU9A 3VS2A 2IN6A 2OFUA 4NK9A 4C36A 5KBRA 3C9WA 2CNQA 3NUXA 3BEGA 3W2RA 3L1SA 2YM5A 3LFDA 4L9IA 3A7HA 4M69A 4CFMA 5IISA 1M7NA 2YIYA 4QMOA 5I3OA 4FIHA 4HPTE 1JNKA 4KSPA 3GCSA 1KOAA 4HGSA 1UKIA 4KNBA 1YXXA 5A54A 3EIDA 5CWZA 3FLNC 2QNJA 4EOKA 2G9XA 4CTBA 4DFZE 2FGIA 4NIFB 4BI1A 3FZ1A 4ZSAA 4FNXA 2C6MA 4JR3A 4M0ZA 5HG7A 3F7ZA 4AW0A 3THBA 4E7WA 2CCIA 1F3MC 3QAME 4U6RA 2BRNA 3PP1A 5HE3A 3LQ8A 4FTUA 2ZM1A 3KF7A 4JX7A 2Y4IC 4BGGA 4UYNA 3BKBA 5M57A 2QOOA 3MY1A 5AX9A 4ZY6A 4J97A 5I0BA 3OOMA 2I0HA 5CEQA 4TN6A 5F94A 5LOHA 3WILA 3RBWA 4DEGA 4AN2A 3BHHA 3RHKA 3ATSA 5IQHA 4QT1A 4WNMA 4EL9A 1V0OA 4FTAA 4BHNA 3K3IA 3NZ0A 4JQ8A 4QMQA 1J7LA 2UVXA 4DT9A 2IZSA 4USFA 4U44A 4IDVA 4YPDA 3LFNA 4FT3A 4XJ0A 3HLLA 3PLSA 2X7FA 2X4ZA 4J1RA 5B7VA 4RIXA 3CPBA 3FEGA 2WNTA 1FVVA 5EW3A 2DYLA 4N4SA 4DGNA 3MY0A 4YJSA 4HW7A 2C6EA 4KKHA 3FXWA 4O0TA 4V04A 3OFMA 4JI9A 3QBNA 4DFYA 3EKNA 4JX3A 5E1SA 4DFNA 4PUZA 4RJ6A 3R22A 1F0QA 2ZB1A 3PZEA 5DR6A 4LUEA 3VUIA 3EFWA 2XEYA 1OITA 3ROYA 1ZOHA 2QONA 4FSZA 1T46A 3ULZA 2BAKA 4M15A 4F7JA 1S9JA 4FNWA 5L3AA 2C6OA 1FINA 1R0EA 4DAWA 1H25A 1V1KA 3KXHA 4NTSA 4ALVA 3QFVA 4PRJA 3HP5A 4E5AX 4HVHA 2YITA 3FMMA 5HIBA 4EWQA 1E9HA 3ZC5A 2R64A 5CSWA 4CYIA 3GC9A 3DDQA 4BDAA 3ACKA 4QMZA 3S95A 4J96A 4N6YA 4NIFA 2W9FB 1GAGA 3A60A 4RFMA 2OICA 2RG5A 2RL5A 3FSFA 5DH3A 4KUJA 4O86A 5KBQA 4G9CA 3W32A 4B7TA 2RIOA 3L9PA 2CGXA 3QYZA 4QTBA 4I92A 4RRVA 3DLSA 5JEBA 4FEUA 4F9YA 4TWCA 1ATPE 2Z02A 3ZFYA 3DAKA 5HBEA 4JAJA 3NW7A 4O38A 3EQRA 4CKIA 5M09A 4NJDA 2FO0A 3U4UA 4F70A 4FKJA 3FPMA 4WOVA 2VTQA 3E87A 4AW1A 4IAFA 4JR7A 4E73A 3T3UA 4GJ3A 4C4EA 4ANNA 2C6KA 2F7ZE 4U42A 1TQIA 4QYEA 3FMLA 3FMHA 3DDPA 3KRWA 3MFUA 3O8TA 5IUHA 4R3CA 3CQWA 1P2AA 3R02A 3RM6A 4NCTA 3QGWA 4F65A 4P90A 1UU8A 3EQIA 4IXPA 2QD9A 3L9MA 4FSMA 4FE2A 4BB4A 4DEIA 5HNIX 2HZ0A 5KZ0A 3VW8A 5HLPA 4NW5A 2BZKB 3BRBA 1DAWA 4QP8A 4IH8A 4AA0A 5BYZA 2Q0NA 3GCPA 4QMTA 2PVRA 1BMKA 3EFJA 3P23A 4ASZA 2VO6A 3TT0A 3UG2A 4F7LA 4DHFA 3MWUA 2B55A 4FSRA 3VS1A 5KNJA 3DT1A 5M53A 4FSQA 5JQ5A 2PVMA 3FHRA 1UNLA 3VUTA 2J0KA 4GV1A 4WNOA 1OL5A 4EQUA 3FSKA 1AGWA 1YVJA 2XIKA 5FWKK 2G2FA 5H9BA 2WEIA 4BHZA 3QHWA 2C3IB 1CDKA 5LWNA 4FKOA 3IW5A 3VBTA 4EH8A 2ZM3A 3ZLWA 5AEPA 3DKFA 1WBVA 4IAYA 3COMA 3NYNA 5E8UA 3SGCA 5J9ZA 5I9UA 2H34A 3CY3A 5HE1A 3T9IA 4A9TA 2CKOA 4YZDA 4EBVA 5B2LA 5ANIA 2WZJA 3FAAA 5IEVA 2SRCA 2JDRA 3RK5A 1PMUA 2W17A 1KE5A 3CP9A 2RF9A 5IH6A 3TCPA 4FV4A 3QF9A 1JSVA 2OF2A 4GK2A 4DINA 2JBOA 2R3NA 5HVKA 5EKOA 2PTKA 4EUTA 4IANA 4L01A 4C2VA 4HYIA 3OZ6A 5CVGA 1REJA 4MF0A 5TKDA 4IMYA 2WU6A 5DFPA 1IR3A 4KBKA 1G5SA 2CDZA 2CGWA 3AGMA 2YZAA 3DBEA 4U43A 4O0XA 3CXWA 4YP8A 4K1BA 4P7EA 3EN7A 3ZRKA 5K4IA 4I93A 4IAAA 2A2AA 5HI2A 4F9AA 4X6RA 4DEHA 5F95A 1W8CA 1XQZA 2UW8A 4PMPA 1KV1A 4DH7A 3OT8A 5B2MA 3VS3A 4EK4A 4CZUA 2ITOA 2C3LA 3EKKA 4JDJA 3VVHA 2WEVA 4FTCA 3E64A 2ZV2A 4RVMA 3CLYA 2J50A 1APME 3B8RA 3HUCA 2XNNA 3EYHA 4K33A 1Z57A 2J5EA 4MBIA 4UMPA 4BVUA 4O7LA 3OTVA 5ETCA 4KSQA 2JKMA 4DEAA 4Y46A 3ZMMA 4AN3A 3HRCA 5J7BA 5ETFA 1JLUE 2HOGA 2GS2A 5FEEA 4BCJA 5HU3A 2GNFA 3QKKA 3V8TA 2P2IA 5DT3A 4FEXA 5J87A 3U4WA 4KRDA 2HW7A 4I22A 2JFLA 3R1YA 5LVLA 4FNYA 3W18A 3KGAA 4DFLA 2P2HA 4EK8A 3HYHA 3WE4A 4QYFA 4FIGA 1H1WA 2XF0A 3E3PA 3E5AA 2HXQA 4GFOA 4BI2A 4BC6A 3QQJA 2UZTA 3ZM9A 3F3WA 1H28A 2WOTA 1DI9A 3S3IA 3AD4A 3AMAA 4XEYA 2FSLX 1ZYLA 2QOIA 3GBZA 4UZHA 3H9OA 4BDDA 3MFTA 2WHBA 1M2PA 4OBPA 1GOLA 5CSHA 3L8XA 4IWQA 2VWZA 4FKSA 4CV9A 3W10A 4D5KA 4FTNA 4KBAA 1PMEA 2O0UA 4FV6A 4QMWA 4U97A 3HMPA 5J8IA 2WQOA 1XH6A 5JMSA 3GOPA 4O2PA 4Z7GA 5H2UA 3O23A 3PDTA 4YJUA 4ALWA 3IOPA 4FV8A 2ERZE 3KB7A 2PPQA 3FKOA 2VO0A 3LFSA 2OXYA 3RNYA 4CG9A 4FUXA 4JT3A 5HG5A 4HGLA 2J9MA 2QR7A 4XG4A 4NYEA 2NP8A 3LCKA 2OJ9A 2X8DA 4OTWA 2I0EA 5LVPA 4ZSJA 3FZTA 3LE6A 3C51A 2PUPA 1FBNA 3E62A 3M1SA 2OIBA 3NLBA 4KB8A 4L45A 3FPQA 4DF3A 4R7BA 4HOKA 3ORZA 3C50A 4PX6A 2EWAA 3GU6A 3NYVA 3FYJX 4JG8A 1FGIA 4EKKA 3QRKA 4P2KA 2V55A 3BU6A 5L6WL 2B9JA 4W4WA 3UE4A 4RIWB 3I0QA 2QHNA 3TACA 4O82A 5CI6A 4JQ7A 3CSVA 4FG9A 2UW5A 2ONLC 4PL3A 2RFSA 2JLDA 5DBXA 4OBQA 2O3PA 2Q0BA 4RZVA 5J1WA 3EWHA 4RIYA 3TUDA 2X9EA 1ND4A 2GDOA 4YURA 1LUFA 1LPUA 2VV9A 2FSTX 1O6YA 4BF2A 4BTKA 4EH7A 5DR2A 5AM7A 2ZOQA 4E26A 5IA4A 4WNPA 4OT6A 4EWHA 3COIA 3SC1A 4R1VA 5EQPA 4D55A 2QC6A 2YIQA 3E63A 3LFAA 2YM4A 3O96A 2EXMA 4UY9A 4ASXA 4C02A 1JKSA 3QQFA 2PZIA 5EDQA 1J3HA 3ZBFA 3ORMA 4X2NA 2CLQA 2J0IA 4R7IA 2W1DA 4S34A 4YJNA 4R3PA 5FTOA 3R8MA 4DEBA 4F9BA 3UZRA 2IVTA 3IK3A 3UODA 5CU0A 3SVVA 5IQCA 4RC2A 2JIIA 4EK6A 1OI9A 2JAMA 1KSWA 4QP2A 2XK4A 2V62A 3LXKA 1H26A 2UZUE 2XK9A 3NR9A 4AZWA 4BDBA 1G8SA 2R3PA 2WTIA 2B1PA 3MH1A 1B38A 5JFVA 4FSNA 4L68A 4WA9A 3KU2A 4AOTA 4Y73A 3IGGA 4RQVA 3TM0A 4YMJA 1KE6A 1JWHA 4FVQA 4QQJA 5DHJA 3QQGA 5A6OA 4BDFA 3BLHA 3FXZA 4IB3A 3NIZA 2X2LA 3FZOA 2WU7A 3D15A 3PPZA 4HNIA 4C3FA 2CSNA 5J7HA 3BPRA 1FMOE 5E8XA 3VRZA 1O6KA 2H6DA 2W4JA 3F5PA 1GZNA 1W84A 3PZHA 5T68A 4FTIA 3TNWA 1UVRA 4AT3A 4XOYA 3H0ZA 4RX8A 5I9WA 4L3PA 2XNEA 5C1QB 3SW4A 4P5ZA 4U79A 3KCFA 3FKNA 2G2IA 4JL9A 3TNHA 2OJIA 3B2WA 3HMOA 3W33A 5HTBA 3S0OA 3HV4A 4AZTA 1K9AA 3PJ1A 2BROA 3OUKA 4RWJA 4AE9A 5IA3A 5IA0A 4XRJA 3FV8A 2YN8A 3DFCB 4JDHA 4YHJA 3JPVA 3MTFA 4F7NA 2VWXA 5K9IA 3D7ZA 2QODA 3MIYA 4OTQA 2PE1A 4MQ2A 4RIOA 4GS6A 3WIKA 3WZUA 1JOWB 3B8QA 3CQUA 3NS9A 4IHPA 2GQGA 2XNMA 5I5ZA 4GSBA 4KIKB 3ORIA 2ITUA 3HEGA 4IAZA 4ZTQA 5A4TA 4YBKA 4EHEA 4PPCA 3VBWA 2CPKE 4ZLYA 1NY3A 2R3GA 3G0FA 1MUOA 3OEZA 4M12A 4NWMA 1L8TA 4O83A 1UNHA 3OMVA 2BKKA 1OGUA 4FL2A 1OIQA 4GCJA 2PZYA 1J91A 3HVCA 4G3DA 4JS8A 4YSJA 5CASA 3N4UA 4GKHA 4C58A 3V01A 1T45A 1I44A 1WFCA 1YXTA 3OUNB 5DLSA 5CF8A 2FB8A 4EC8A 2WELA 4CRLA 2JEDA 4OUCA 5D41A 5IQIA 3P4KA 5IA2A 2YWPA 5IG1A 5KMMA 4ZOGA 4AAAA 5GJGA 5E8ZA 1FGKA 2VTSA 3LCTA 3OBJA 4EH6A 4ANLA 1YI6A 4QP6A 3II5A 2JFMA 3PE1A 2XA4A 4A7CA 4CLIA 4FMQA 2JDVA 3QXPA 4YLLA 3Q4ZA 4XS2A 3C7QA 3ZS5A 2OF4A 3K54A 4C4HA 3F9NA 3PVBA 3RHXA 2V22A 3QWKA 4BY9E 4FG7A 5ANOA 2W7XA 2OWBA 3IDPA 3DB6A 2IG7A 2BHHA 4GK3A 4E4LA 1GZKA 3TUBA 4BCMA 4K77A 4QQCA 4GK4A 4I6HA 3ZUUA 4AA4A 2BAJA 3GUBA 4KS8A 5M44A 3DA6A 3ET7A 5AP2A 1PXLA 4ZTSA 2C1BA 3LIJA 2FVDA 2WTKC 4LRJA 4TKSA 3AXWA 3NCZA 4WKQA 4MEDA 4C61A 4DGOA 3P5KA 5BYYA 4GIIA 4IWPA 4MK0A 4ZZMA 2RSVA 3BQCA 2ETKA 3RKBA 2GTMA 4KIKA 1TQPA 3BCEA 5CSPA 5IEXA 3E7OA 3F66A 3ZBXA 3RTPA 1R78A 2W5AA 3R1SA 3UP2A 4APPA 4YTFA 4KBCA 3PVWA 4Y85A 2HZ4A 3PRFA 4X3FC 5EOBA 2QVSE 1VZOA 1UWHA 2B4SB 3ZOSA 4IM2A 4N70A 4BZNA 3UO5A 3DXPA 2IZUA 2VTNA 4DA5A 1Y91A 4APCA 2WMWA 4CD0A 3TG1A 4IX3A 4QYYA 3GB2A 4IZYA 2Z7QA 2YAKA 4CFVA 2R7BA 3PA4A 3DQWA 2EXCX 4X2JA 1Y57A 4BN1A 1YDSE 5DVRA 2W1EA 4LG4A 3Q9YA 3R7GA 3PIXA 4FV1A 2F2CB 2QHMA 3BE2A 2KULA 4IVBA 4K9YA 3UNKA 2O63A 4UWYA 4EH3A 4MD9E 5C8MA 1BKXA 5EYCA 2WMBA 5L6PA 4E8AA 2RKUA 4H1JA 4QYHA 1UWJA 4H3PA 3ZC6A 4MAOA 3LFFA 1LP4A 5BVDA 3M42A 3Q3BA 5ITAA 5BNJA 4DLJA 2HELA 4U81A 4I5MA 3VHEA 4L67A 1QPCA 3NUYA 4FSTA 3G6HA 3PP0A 2AYPA 4OTRA 3TJCA 2BDJA 4EEVA 2WOUA 3E88A 2OGVA 3D2KA 3MA6A 5KMNA 3POOA 3H9FA 2OZOA 4KINA 4NSTA 2Y8OA 4IB0A 4O27B 4QMPA 4YJRA 3BBWA 4UMUA 5FEDA 4F6WA 2PU8A 3BV3A 3DFAA 3QCQA 2DUVA 2FYSA 3RJCA 1H8FA 3WIGA 2X6EA 4UMRA 2J7TA 4YJPA 3BYVA 3RZFA 4YLJA 2OK1A 1PMNA 3ODYX 4LM5A 1BI8A 2WQNA 3PVGA 3ZO4A 3GU4A 4EOQA 3WYYA 3NIEA 5EI6A 4PL4A 5EQYA 5GHVA 4HGEA 1CSNA 4GEOA 1GZOA 5JZNA 4F64A 4FKPA 3CPCA 3EOCA 5FG8A 1CMKE 2E9UA 5HO8A 3TL8A 2WMRA 3PY1A 3FMNA 3QTZA 3NVMB 4ZMFA 3IPHA 3GU7A 1I09A 3K3JA 4LOPA 5IQEA 3WF5A 3IW6A 2R3RA 4UV0A 1BUHA 1OIUA 3C5UA 5KKRB 2BR1A 2ZDUA 3TV7A 2AC3A 2BDWA 5JFSA 2YM8A 1TVOA 3QKLA 1IASA 4O0VA 4PY1A 4TTHB 3RPSA 3D5VA 3L9NA 1ZYJA 2C6LA 3SW7A 3FUPA 1OPJA 1YHVA 1S9IA 2QOBA 4CTCA 4QTCA 3LFCA 3CGOA 4W9XA 2HZIA 3O2MA 2HXLA 1WMKA 4ZSEA 3Q32A 1GNGA 2QOFA 5CNNA 1URWA 4FTQA 2OLCA 4BL1A 2R3FA 1YKRA 3PFQA 2IWIA 4IM3A 3QWJA 4HVSA 3LHJA 4YU2A 5M56A 3LM5A 3UIUA 1OUKA 3W2OA 4Q9ZA 1Q61A 2EB3A 3AG9A 4ZJJA 3GCQA 2W96B 3D7TB 3Q2JA 3A7JA 3G6GA 4G3CA 3NNUA 3BIZA 4L6QA 5D7AA 2YISA 3U55A 4HGTA 3SDJA 3SX9A 3F69A 4IAIA 4MWHA 4WHZA 5AR2A 5AADA 2WMXA 3QA8A 1W7HA 1YDRE 3DAEA 3D2IA 3R8PA 2IZTA 3AC8A 3FLSA 1DS5A 1OMWA 3O0GA 5AR5A 4ASEA 4F99A 2CCHA 5CAUA 1XBBA 4RFZA 1VYZA 3HECA 3R7VA 3I81A 3ZSIA 5AA9A 5M07A 2BTRA 3COHA 5ANEA 3DAJA 3DY7A 2EB2A 2BHEA 4AT5A 4BYIA 4EZ7A 1OKZA 3TZ7A 3OTUA 5I4NA 3BE9A 4FV3A 5E8WA 5L8JA 4AGUA 4IZAA 5CT7A 5KHXA 3PXQA 3QL8A 1OVEA 4L3LA 4BGQA 5J5TA 4IWOA 3BLRA 3G15A 4F6SA 5HVYA 2FUMA 1NW1A 1Q97A 5A4QA 3WARA 3TKHA 2BZIB 5EQEA 3NW5A 3TN8A 1JKLA 3DU8A 3VF8A 5JN2A 1QCFA 3F3UA 2HZNA 5JZJA 1GJOA 2QG7A 5KZIA 4M8TA 2VZ6A 4XV9A 3RPOA 4EZ3A 2GTNA 4J98A 4FBXA 4AA5A 3HKOA 4A9RA 4DH8A 4FUYA 1JPAA 1W82A 4D2PA 3ORLA 4XG9A 4O6LA 5H8BA 2OIDA 1M14A 4RJ7A 5DN3A 4FEWA 4LYNA 5LMAA 5E9EA 4V05A 2JGZA 3FZRA 4E6AA 4BCGA 4H3QA 4MXAA 5FBOA 5AX3A 4XG8A 3QLFA 5CXZA 4ZLOA 5H8GA 3D7TA 3NYXA 3F61A 5KUPA 4ZTRA 3NAXA 4L43A 3DKCA 5FQDC 3BBTB 3RNIA 4BIBA 3COKA 4J99A 1XJDA 3OCTA 4AGCA 3HRFA 3EZRA 4CFWA 1Q3DA 5EOLA 4ACCA 4CZTA 4AFEA 5BVKA 4ITHA 4PL5A 3FDNA 1XH8A 3NSZA 4MVFA 4TY1A 4X6QC 2C5NA 4S32A 5F1ZA 4B8LA 4D4VA 1OKYA 3O50A 4I24A 1UU9A 2ITZA 4FV5A 1KE9A 1NVQA 4JRVA 4C37A 1YHWA 2YLEA 4C3PA 4G31A 5L8LA 2W06A 5CU2A 3E8NA 3GOKA 5GNKA 3F5UA 5JRSA 4E4MA 4ZZNA 4QMSA 2WMQA 1UU7A 3LMGA 4RLLA 4ZZOA 3HAVA 3F2NA 4FSUA 2X9FA 4R5SA 3G51A 4F63A 5AJQA 5CVFA 5EK7A 2XZSA 5BMMA 4XRLA 1J7IA 1SVEA 5K0XA 3GCVA 2PSQA 1SM2A 4CXAA 1PY5A 4XYFA 3TNIA 3ZRMA 1YW2A 2ACXA 5JH6A 3CC6A 4A4OA 3U6HA 4EH9A 2Y9QA 3IECA 2YJSA 4NZWB 4EOIA 2WQEA 1MRYA 2QU5A 3ZLSA 4BBEA 3NUUA 1OZ1A 2ZM4A 5JT2A 1YWVA 4UZDA 4RA5A 4MXXA 4J8NA 3SKCA 3I5ZA 1XH5A 4MBLA 4IFCA 3VWAA 1X8BA 4JVGA 3AT3A 2CLXA 4XG6A 4DCEA 3EHAA 4QP3A 2ZAZA 5F20A 1HOWA 3VIDA 2J2IB 3VUDA 5C4LA 3FLZA 3RZBA 3R00A 5EHYA 5KX8A 2YFXA 3QALE 2HK5A 4ZEGA 4BFMA 2W5BA 1ZYSA 2O2UA 2W1IA 2V7OA 4C0TA 4AG8A 2W1CA 3UNZA 1OL7A 3VUMA 1YXSA 2XM8A 3P0MA 4BWXA 3NRMA 3PA5A 4KA3A 4OAVB 3QZHA 4XX9A 4O0RA 2YZLA 5IQFA 1H1SA 4XV1A 5C9CA 3R7YA 3OY1A 5BVOA 3W1FA 4S2ZA 3FLQA
chains in the Genus database with same CATH superfamily
5DG5A 1J7UA 3DBFA 3MB6A 2QOCA 4O7YA 2CN8A 3PSDA 5EH0A 4IX5A 1JKTA 2IO6A 3OC1A 3UQCA 3UDZA 3V5WA 1SNXA 4FL3A 5FGKA 5HIEA 4F6UA 1QPEA 4OTFA 2XH5A 3EN6A 3P78A 3KRJA 3C4FA 4YZBA 5E8VA 3RCJA 2XVDA 5HU9A 5I9ZA 3PA3A 3FL5A 3ZFXA 5IA5A 5K5NA 2CJMA 1XR1A 4KAOA 3V5PA 3AT2A 3ZHPC 4DEEA 3LXPA 1PXNA 5HORA 4GVAA 3E3BX 3L8VA 4GRBA 1UV5A 3C4WA 4L52A 4FT5A 3PG1A 4D4YA 2ITQA 5AAGA 3I60A 2OBJA 3L9LA 2PY3A 3UMXA 3I79A 2XK3A 4KKEA 3JYAA 4M7IA 3N4TA 3WZJA 2YCQA 3PJCA 1XH4A 3UTOA 5ANGA 3JY0A 4U7ZA 4UWBA 2XANA 3ODZX 3R9RA 5A4LA 2J0LA 2C5XA 4FC0A 4GU6A 4FEVA 5IH4A 1H1QA 2XK7A 3ZM4A 4O81A 2X2MA 4G3GA 3D5WA 4CGAA 3R7OA 1DAYA 3NCGA 4LGDA 4UYAA 5LXMA 1PXIA 3BU5A 5ACKA 4ACHA 3DJ6A 4IFGA 4O4BB 4O1PA 4C2WA 3PY0A 4FYOA 2X7GA 3OCSA 3QRJA 4QMYA 4OLIA 2WD1A 4ERWA 4R78A 4BI0A 3VS7A 1GIIA 3QYWA 3B2TA 2GNLA 1F5QA 2PUUA 2XKDA 3U8WA 3HMIA 4QRCA 4WRGA 4YJQA 5EKNA 3AT4A 4E5BA 4IX6A 3TTJA 5L4QA 5IQAA 5HBJA 4O0YA 4YTCA 1G3NA 4FV9A 3WF6A 4EONA 3DBCA 5E8TA 3EQBA 3G9LX 5HE2A 2B9FA 2OG8A 2YACA 3IW8A 1IEPA 2XKFA 3GGFA 4KIOA 4Q2AA 4QPSA 5HIDA 3CS9A 3QXOA 2BVAA 3LOKA 4KIPA 2XRUA 4C4GA 2OFVA 3QD3A 5JRQA 5LVNA 3KN5A 4GJ2A 5E7RA 4R8QA 4IW0A 5FXSA 1B6CB 3UMWA 4X21A 2B53A 3KK9A 2PE0A 1Q8TA 3ZLYA 4BCQA 4FG8A 2XB7A 4FOBA 4WO5A 2WMVA 5I9VA 3CTQA 1G8AA 2R3KA 3CBLA 1OM1A 3EQFA 4ZSGA 4AUAA 4AX8A 1XH9A 5TOZA 3O8UA 1Q24A 2AEGA 4FSWA 2XBAA 3SV0A 4YBJA 4QMMA 2PL0A 1QL6A 2W4OA 5BVEA 4ZIMA 3QZIA 5IQGA 1FPUA 5A9UA 5HLNA 3A4OX 4I1ZA 3MIAA 4PMMA 4BZOA 3H4JA 4ZJIA 4DLIA 4FA2A 5AR3A 4AT4A 4XG3A 3NNWA 5KMKA 2R0IA 3P79A 3QD0A 2ZV7A 2VTRA 5M06A 3U9CA 5LMBA 4MXZA 3RP9A 4U45A 2C6DA 4F9CA 4O7SA 1UNGA 4G1WA 5KMLA 3UDTA 3O8PA 3QC9A 5CT0A 3DOGA 3QTRA 1OL2A 5HNBA 2PMLX 3A7IA 3C0IA 3Q53A 4LMUA 5FM2A 4NM0A 2X81A 5DMZA 3P7CA 4LGHA 5EFQA 5IH5A 3UVPA 3W8LA 4B0GA 2BIKB 3IDBA 3RPYA 5ANJA 4GL9A 3AQVA 4HVIA 4JDKA 4II5A 2J6MA 2VTPA 3EN5A 4OT5A 4AGWA 2J4ZA 4RX5A 3D14A 2X6DA 4K18A 4TYHB 5DE2A 1CKJA 2GSFA 3OCGA 3EQGA 5IMEA 4RJ8A 4NM5A 3ZO3A 2EXEA 4ALUA 3HGKA 4N6ZA 5FM3A 4RWIA 5EYDA 3C4EA 3U6JA 2C1AA 3FI8A 2BALA 3SG9A 2UZNA 4FZAB 4MWIA 4CMTA 4WG5A 4LGGA 2P55A 1HCKA 2O8YA 3SXFA 5KMOA 1EH4A 4W4VA 2XS0A 3P7AA 2GNGA 2X8IA 4UBAA 1VJYA 4X7QA 5E90A 3R71A 3VULA 3PUFC 2Z7LA 3GC0A 3HZTA 4A9YA 3D0EA 4DBNA 3AKKA 1ZMVA 4CRSA 4ANSA 2I6LA 2OXXA 3LCSA 5HD4A 1A9UA 2ITNA 2ZV8A 5HX6A 2YWVA 5DR9A 5BYLA 4NFMA 4MXOA 1Q41A 1BX6A 4LQMA 4TYEA 5C26A 2C0TA 4D1SA 5HD7A 4ASDA 2GCDA 2UZEA 4GH2A 3ML1A 2C69A 3PXRA 3DB8A 2NRYA 2R3LA 4R6VA 2E9OA 4USDA 3LCOA 4MD7E 3UO4A 3KA0A 3GEQA 1R39A 1XBCA 2WPAA 3ZO1A 5HZNA 4G16A 4FODA 3NX8A 4KWPA 3FI3A 4ZP5A 4BKZA 3W0RA 5HLWA 3DJ7A 4FT7A 4YUQA 3F88A 3PIYA 3QX2A 3DV3A 4MCVA 4FICA 1RW8A 2Z60A 4QP7A 3LCDA 1VR2A 3T9TA 3DKGA 1NXKA 3FQSA 4EOLA 1H08A 2YCFA 4O91A 2XK6A 2Z7SA 4XP3A 3AC3A 4TYHA 4L3JA 4D1ZA 1KWPA 4HCTA 4XOZA 3VS6A 4O7NA 4YJTA 3U87A 2WTCA 5ANDA 1YDTE 2XJ2A 4DE4A 3BQRA 2W1GA 4NUSA 1U54B 1OUYA 4JXFA 3KK8A 5AUVA 1V0BA 3ORKA 5ETIA 2OH4A 4CKJA 4DT8A 3CTHA 3FY0A 3O17A 4TYJA 5B2KA 5AAFA 4PP7A 5M4CA 2HY0A 2WAJA 3I4BA 1H1PA 1JSUA 3NPCA 3UYSA 3M11A 2IPXA 2YJRA 3R8VA 2QO7A 1ZMUA 3LM0A 3DZQA 2IW8A 3R28A 4ZXTA 2PVYA 1PMVA 5BVNA 4ZY4A 5CYIA 3UDSA 1MRUA 2F7EE 5L2SA 5GZ9A 3K5UA 4K0YA 2PULA 2VWWA 3BEAA 1ZARA 3PY3A 4XV3A 1ZYCA 3LQ5A 4RC3A 2B0QA 2I0VA 3KXNA 4LMNA 4MH7A 3Q5IA 4PQNA 4IEBA 1XMMA 3DK6A 3HUBA 3LFEA 5IZFA 2LAVA 4WUNA 4HVGA 5IF1A 2ITXA 4BIDA 4B4LA 3PXZA 3I7CA 4Y83A 2I1MA 1P5EA 3ACJA 3R21A 4ONAA 5DYJA 5FRIA 2C5OA 4TRLA 5DRDA 2PWLA 5AP6A 3ITZA 5GINE 1JAMA 1M2QA 3V5LA 3TUCA 2E9PA 3K5VA 4IC8A 5IU2A 4EH5A 3FJQE 2F2UA 3V51A 2VAGA 4X2FA 3BLAA 2R3QA 2Y7JA 1KE7A 2JIUA 2VNYA 3HX4A 4QMXA 2BFXA 4E20A 3G5DA 3NGAA 2GPHA 2I7QA 5IDNA 3PLAE 3A7GA 2HENA 3ULIA 4RIWA 4FK3A 3ZDIA 1UU3A 2QOLA 5E91A 2HWPA 4BTFA 4LOQA 3HDNA 3QQUA 3JR1A 3KXXA 3OXTA 3KRLA 4QP9A 1H00A 1MQ4A 3R8UA 2QCSA 3R6XA 4IM0A 3I6UA 4KABA 1U54A 4K2RA 4PPAA 2VO7A 2YDKA 4BIEA 3GC8A 4WD5A 4H58A 5LCJA 3QQKA 4R5YA 4RGJA 4YZCA 4TYGA 2XAOA 3UJGA 1YI3A 3NYOA 3A62A 2YA9A 3CQEA 4HZRA 4KIQA 1PYEA 4O0WA 2BKZA 2X0OA 5AP1A 2YM3A 4W4XA 3TIZA 3VJOA 4MX9A 2UW0A 5B0XA 4RSSA 4DH5A 3E92A 3P1AA 3OT3A 4U5JA 3VUKA 5HX8A 2ETMA 4WBOA 1FOTA 3OWKA 4H39A 4E1ZA 1Y6AA 4QQTA 1P14A 1OPKA 2BAQA 2YM7A 3OD6X 5FXQA 4EBWA 4RX9A 3QCXA 4Y5HA 3KULB 1OIYA 1A06A 2Z7RA 3A8XA 3FZSA 4J7BA 4R3RA 4Y72A 5D7VA 5IKWA 2JIVA 4FKLA 4XP0A 2XCKA 4GKIA 3OWPA 4AF3A 4RC4A 3IOKA 3E8CA 4HYUA 5FTQA 1GY3A 5IQDA 4RBLA 3Q60A 3R7EA 3FC1X 3LW0A 4UMQA 3FQEA 1ERKA 5CEKA 1BYGA 2JDSA 1PXMA 3FL4A 3OG7A 4WG4A 3GFEA 5BMSA 4ANQA 5CF4A 2GNHA 2YDJA 3CKWA 2HAKA 3D4QA 1DI8A 5A4CA 5JGBA 1U5RA 4GG7A 4FZFB 4HPUE 1QMZA 4WIHA 2UZVA 3VBVA 5IMXA 3UZTA 4R1YA 5AUYA 3UOHA 2BRHA 2GFCA 3UVQA 2UVYA 3T3VA 2WTVA 1SYKA 2WIHA 3UIMA 3EFLA 5KKRC 4EHVA 4UXQA 5AIRA 3UOKA 3DK3A 3MPAA 4NTTA 4E3CA 2ZMCA 3F3VA 4XLVA 2NO3A 3V3VA 2XK8A 5KCVA 2J5FA 3AGLA 3TKUA 3F2AA 3MVMA 4F0FA 3BI6A 2QU6A 3OXIA 2UZWE 4BCPA 3C0GA 3BZ3A 1R3CA 2WMAA 3AD5A 3EN9A 1M17A 4LOOA 5M4UA 4NW6A 4IVCA 5CU4A 1KV2A 4TL0A 3GT8A 4O21A 3ZZEA 2HWOA 3BU3A 5I3RA 2PUNA 4TXCA 2YLFA 3EYGA 4FKGA 3VBXA 3C5IA 3EFKA 3QZGA 1BL6A 4TWPA 2RG6A 4AZFA 1WBPA 2UZBA 3QKMA 4IDTA 4IC7A 4BDGA 5JFXA 5JGAA 4AU8A 5J95A 5LMKA 2XNGA 3RPRA 2VX1A 1HCLA 3D94A 3HMMA 5CZHA 3IONA 3OY3A 4GT4A 4CCUA 1YHSA 4TWNA 4R77A 3KULA 3KVXA 4LRKA 4YPSA 4FTOA 2YIRA 3KN6A 4I94A 5HEZA 5AUWA 4E4NA 4DTAA 5EI8A 5DOSA 2VGOA 3R01A 4V01A 3EB0A 2R2PA 5AUUA 2CHLA 3QTSA 4DYMA 5T3QA 2YM6A 4JRNA 5AV2A 2OJJA 3JS2A 2NPQA 4RQKA 4EH2A 2ERKA 3CCNA 2W1FA 3IDCA 4X2KA 4LRMA 2PMIA 4BDIA 1OBGA 4ZY5A 3MA3A 4C38A 4GYIA 1J1CA 3LQ3A 2OKRA 1YRPA 2OU7A 3MH2A 2VWBA 4OTGA 5TE0A 1PXJA 1DM2A 3UP7A 1NT2A 4ZMEA 3C13A 1PJKA 2ITPA 3G2FA 3LZBA 4NEUA 2DQ7X 4ARKA 3BYOA 1XH7A 3IO7A 4YNOA 2G1TA 1XMLA 3W8QA 3CTJA 3S00A 3S2PA 4C57A 2HYYA 2ZMDA 4FZ6A 4C33A 4YTHA 4EC9A 3MB7A 1VYWA 3MJ2A 3RMFA 4GU9A 4HVDA 2CNVA 4O7WA 2BPMA 2GU8A 3C0HA 3CY2A 4I20A 3PXFA 4AACA 2ETRA 3GNIB 4L44A 4QPAA 4FTTA 4XLIA 4YHTA 3OCBA 3D5UA 3MBLA 4NH1A 5CQUA 4EH4A 3FLWA 3KMWA 1CKPA 4YTIA 5CALA 5DGZA 5FLFA 4QEBA 2ZDTA 4OTHA 4Q5EA 1IAJA 3R30A 1PRYA 2QO2A 2P0CA 3T8OA 4BJJB 3BGPA 1A48A 3FMEA 3PSBA 5M4IA 3KREA 1UA2A 2QOHA 4I5CA 3H9RA 4EOPA 2WTDA 4LDTA 2J0MB 4G5PA 4O4DA 4F1TA 2VTJA 3ZLXA 4G6NA 4CQEA 5DEWA 4Z55A 4CCBA 5HVJA 2J90A 4XG2A 2OIQA 3UZPA 5BV3A 4G6LA 4M0YA 1JBPE 1PF8A 4U0IA 3FYKX 4FIFA 4I0RA 4UX9A 3QRUA 2C30A 3N4VA 3WZEA 2XJ1A 4IJPA 3LMHA 2UW9A 4C4FA 3CJGA 3DBQA 5H3QA 3R7UA 2QOQA 3W2CA 5E4HA 2XYUA 5CF5A 2VTMA 1PYXA 1TZDA 3UGCA 1Z5MA 4JIAA 4D0WA 3WZDA 1YWNA 2IW9A 4HJOA 3OVVA 1OECA 3REPA 3VF9A 1TKIA 3PVUA 2VRXA 3CD3A 4AW2A 4C59A 4EOOA 4AXFA 4ANBA 5E8YA 4C4IA 4BCKA 3Q4CA 2WQBA 2G15A 3HAMA 4CV8A 2AC5A 4N57A 3FBVA 4LUDA 4BGHA 2WTKB 1VEBA 2LGCA 5AP3A 5I9XA 3QTXA 4YO4A 3R9OA 4BR3A 1YOLA 3PYYA 2JBPA 4CEGA 1ST4A 4Z16A 3Q9WA 5CX9A 2GHMA 5JFWA 2PE2A 2IEWA 4N0SA 4GG5A 5HESA 4GIHA 3V6SA 4XCUA 5D12A 4MHAA 2PUIA 5J9YA 4EOJA 4RT7A 4WBBB 4BJJA 3UVRA 2BILB 1OKVA 3VNTA 3A8WA 5DIAA 3QUPA 3RINA 5CAQA 3M2WA 4HCVA 4OR5A 2REIA 1MP8A 3GQIA 5J5SA 3QZFA 2R5TA 3PJ8A 5BX0A 4FIIA 4L8MA 5L2WA 4S31A 3LLTA 4IX4A 4ZTHA 4FTKA 3BWFA 3ORXA 4D2WA 1PKGA 5DWRA 4OAUC 3FLYA 2WGJA 2PZRA 1PHKA 3PPJA 4DFXE 3EQCA 4YZ9A 1WAKA 4M69B 3ZO2A 2W99B 3Q4UA 3OOGA 3VRYA 4YSMA 1Q8YA 5AMNA 4ID7A 3IS5A 2RFDA 2W1ZA 4I21A 5KMIA 2X4FA 3QCSA 4W4YA 3LMIA 3SQQA 3TJDA 3Q5ZA 5D9HA 1KOBA 5M08A 3IW4A 3VBQA 4UMTA 4A4XA 3KMMA 3QC4A 5D11A 2W5HA 3GI3A 3QD2B 1AD5A 3H3CA 5BUJA 2VNWA 2X39A 1QPDA 4ZTLA 4YGAA 4RVLA 1M2RA 5I9YA 2A27A 4IADA 4GFGA 4D5HA 2HCKA 2Z8CA 3Q4TA 1W2FA 3FE3A 4OGRA 4U80A 4GT3A 3ZDUA 4U41A 5BUEA 2XBJA 4C8BA 3VS5A 2QKRA 3UQGA 4Z3VA 4D1XA 3W0MA 2VWIA 5K0KA 2XYNA 2FH9A 5EHLA 3HV7A 3R0TA 4EK5A 4A07A 1LEWA 4JQEA 4U3YA 4QMUA 4MD8E 2W4KA 3AC5A 4JBOA 2WQMA 1M7QA 4BRXA 2JAVA 5FD2A 5KHWA 3PSCA 5BQ0A 3RK9A 3GP0A 4O0SA 4AZVA 3R9NA 2VWYA 4XV2A 5JKGA 5CEIA 2B52A 2OO8X 4XP2A 5CSXA 5HICA 1R1WA 2B54A 2VTLA 4RFYA 4YZMA 2BCJA 3LJ0A 4LV7A 4EUUA 3VUHA 1VLRA 4E6DA 3TWJA 4D9TA 3NWWA 3SRVB 3DNDA 3OROA 4NKSA 3QQLA 4DTBA 3ANRA 3IG7A 4C4JA 5EM7A 4F78A 5TF9A 5M4FA 1G8KA 5DEYA 3ETAA 2XP2A 1TFFA 3QCYA 3A4PA 2BRGA 4FZ7A 4XHKB 3ORNA 1ZMWA 3DS6A 3ZU7A 2VGPA 3ZTXA 4D28A 2G01A 4TW9A 3TNPC 3D5XA 3MTLA 2UUEA 1G8JA 4HCUA 4X3JA 5K3YA 4BDEA 1SMHA 4BDKA 4CMOA 1SNUA 5FEQA 5CQWA 5IDPA 4OTIA 4U9AA 2E9VA 3ZSGA 4W9WA 3UYTA 4BCHA 5EI2A 3DKOA 4AZSA 4DGGA 2V0DA 4TNDA 4IE9A 4J71A 4ACDA 2Y0AA 3PTGA 4QNAA 4WRSA 1ZZ2A 5EM6A 4FIEA 4D58A 5AM6A 4QTDA 3UG1A 4AXDA 1CTPE 1FVTA 3HDMA 4B9DA 1FVRA 5AP5A 3TZ9A 4BYJA 5KMJA 3ORTA 3DZOA 5K5XA 2GFSA 3HA8A 1RQQA 3CD8A 2GHGA 1NVSA 4IACA 4RWLA 2VUWA 4EORA 4C34A 5GIOE 4JDIA 5IUIA 5HTIA 5L2IA 2F4JA 1H27A 3MPTA 3PXKA 4B8MA 5G1XA 2PHKA 3QGYA 4DFUA 2PMOX 1NVRA 3KCKA 4QTAA 3DTWA 3RPVA 2PYWA 3MS9A 4FV7A 4PF4A 2IVSA 2ITVA 1CM8A 4FNZA 4CYJA 5AUTA 5HCZA 3BYUA 3KMUA 1WBNA 2BDFA 4QYGA 3R8LA 4ENXA 3MGYA 4ZS0A 4E4XA 4ANMA 3PXYA 5L2TA 4RLKA 3SRVA 3A61A 5C03A 4AP7A 4FKQA 5E1EA 4FT9A 2X8EA 2JDTA 5LJJA 4GFMA 4I23A 4PDSA 4KKGA 3TZMA 4IWDA 2RFEA 4Z9LA 3FHIA 3AD6A 3ID6C 5DT4A 2WB8A 3WF9A 1WCCA 2PMNX 3JXWA 2WMSA 3EQHA 5EM5A 3NW6A 1ZWSA 2GQSA 2C0OA 2C0IA 4KS7A 3Q6UA 4RWKA 3F7WA 5CNOA 5AR7A 4CMUA 5LQFA 5EDPA 2JITA 4QMLA 3ALOA 2BTSA 3HA6A 4O7VA 4RZWA 2R3OA 4UB7A 1Q3WA 2C47A 2NRUA 3GCUA 3MH0A 3RM7A 4JG7A 3O7LD 3ZRLA 1U46A 3DLZA 3MESA 2VTTA 4WG3A 4AQCA 1JVPP 2QLUA 4I6QA 4PTGA 4U40A 3RAWA 3UO6A 4BZDA 4DGMA 4F08A 3KIOC 3PFYA 2UVZA 4YJVA 5DRBA 5TR6A 4PDPA 3ZUVA 4RA4A 4I41A 3PIZA 3OXZA 3ZZWA 2PVFA 3I1AA 3PG3A 2UZLA 4FV0A 3RALA 3TIYA 3OW3A 5EYKA 1R0PA 3VHKA 4RPVA 5H8EA 4ZAUA 1WBOA 1OL6A 1H0VA 2UW4A 5JQ8A 2UW6A 4MXCA 5C8KA 4FZDB 2X2KA 4DC2A 4R7HA 3FI4A 2GHLA 4AE6A 3QTWA 3ROCA 1H4LA 2AUHA 2VN9A 3SLSA 4J95A 4BDJA 3SOAA 5GJFA 2R3MA 3TNQB 4B99A 3C4ZA 4E5WA 4W8DA 4NM7A 1J1BA 3H0YA 4F9WA 4TWOA 4L46A 2F7XE 2JD5A 4OTPA 3ALNA 2XMYA 3KY2A 5CVHA 4FVRA 3UPZA 2C6TA 3DTCA 3EZVA 3PE2A 3W2SA 3KQ7A 3R73A 4AS0A 4DN5A 5BUIA 2Y4IB 1FQ1B 4FF8A 1YXUA 1IRKA 4YC8A 4G3FA 5HNGA 4AOJA 2C3JA 2ZV9A 4GVJA 4B6LA 3QTQA 1XHAA 4WNKA 4ITJA 5C27A 4AGDA 3W0NA 2X0GA 5AR4A 4BBMA 3KEXA 4IAKA 2QLQA 5HO6A 1WBSA 5FDPA 3OW4A 1Z9XA 2VX0A 3NFGB 1IA8A 4PTEA 4X0MA 3OBGA 4EKLA 4DH3A 2VO3A 4BTMA 1B39A 3E8EA 4BWPA 3LKMA 3R1NA 1OPLA 4EYJA 5D1JA 4V0GB 2UV2A 1PXPA 4QPMA 3AOXA 4FKVA 4NL0A 3CIKA 3HMNA 3NMUF 1STCE 4ZTMA 4DBXA 2ITWA 4YLKA 3BHVA 4MKCA 4XBUA 3MFRA 5AIKA 2CKEA 5CEPA 4CKRA 3O71A 2YIXA 4DG3E 2WKMA 2DWBA 2QQ7A 3DGKA 3HV3A 2P4IA 3LVPA 4S33A 5HOAA 5AV3A 2JKOA 1BI7A 3BHTA 3SD0A 1LEZA 1ZLTA 1FMKA 2WXVA 3A99A 2JKKA 4NFNA 2GS7A 4A4LA 3RAKA 4OBOA 4D2TA 4TZRA 2XKEA 3E8DA 5AR8A 4IZ7A 2BFYA 5C8NA 4O22A 1ZXEA 2YDIA 3VAPA 3NUPA 4ZJVA 2OI4X 5FXRA 4NKAA 2OXDA 2XUUA 3ERKA 4FKRA 4RX7A 3I7BA 2CMWA 3AC4A 3G33A 3P9JA 3F5XA 3W16A 3MYGA 5L2QA 4EOSA 4BWKA 2V5QA 3ELJA 3NNXA 4P5QA 4WUAA 5CZIA 4F0IA 4M97A 4J53A 3GFWA 2XJ0A 3LXLA 3QA0A 4I0TA 3FXXA 4EJ7A 2CGUA 4RMZA 1OKWA 3QQHA 3GQLA 3W2PA 4XNEA 5AUZA 5A3XA 3QRIA 4P4CA 2V7AA 3CJFA 4UEUA 4U3ZA 3UNJA 1L3RE 1H1RA 3OEFX 4JOAA 1SVHA 3C1XA 4Q5HA 5AP0A 1RE8A 3U51A 2VWUA 2RGPA 5HG9A 4D9UA 4CFUA 2EVAA 2ZYBA 1Q8WA 3LFBA 3BV2A 4RIYB 3F6XA 5CSVA 1URCA 4X2GA 3R04A 5HE0A 1K3AA 3LJ2A 4YC3A 3W2QA 5GZ8A 2P3GX 2IW6A 1H0WA 4V0GA 2DS1A 5CLPA 2G2HA 3UQFA 2UW7A 2BRBA 2OSCA 4BICA 5CI7A 1IG1A 5FP5A 3VN9A 3BLQA 5AP7A 2O64A 3FI2A 1YI4A 4PTCA 3SAYA 2C6IA 3OWLA 4G6OA 4EHZA 2CN5A 4LFIA 1H01A 2XNOA 5AUXA 3TXOA 2ZVAA 3CR0A 3POZA 4FI1A 4BBFA 4FK6A 4QTEA 4QOXA 2B7AA 3OHTA 3DXQA 4DG0E 2UZDA 4EQCA 5AWMA 5LMKC 2OH0E 4MQ1A 3JY9A 1ZOGA 2XCHA 3CKXA 3GU8A 4PNKA 4DCAA 3GVUA 4JG6A 4G2FA 4XH6A 2H96A 4L7SA 5C01A 4EZ5A 4USEA 2WMTA 4PMSA 4GMYA 1ZY4A 2GQRA 2W05A 1KE8A 3F5GA 3EMGA 3KXMA 3TEIA 3UOLA 3OWJA 2FSMX 2R0UA 5TO8A 4GYGA 4E6CA 3LJ1A 1V0PA 1E1VA 1ZOEA 2R4BA 3A2CA 2WO6A 3FY2A 4PNIA 4Y95A 4UN0C 4QQ5A 4M3QA 1QPJA 4JBPA 3VONA 4DDIA 4O7ZA 3SA0A 2C5VA 2YAAA 3KVWA 3LPBA 5CU6A 4WSYA 1Q8ZA 2ITYA 3MH3A 4D4RA 4FEQA 4H36A 2XIXA 2Q83A 3QRTA 5GIPE 3HRBA 5FBNC 3FQHA 3W55A 4F0GA 4CLJA 3R63A 5CANA 2HW6A 2QG5A 3UIBA 4Y8DA 2CNUA 5A14A 4FJVA 2F49A 3LFQA 1REKA 2ITTA 5HG8A 5E92A 3RGFA 3GC7A 4FKIA 2XEZA 2XIRA 1Q5KA 2ZJWA 4HNFA 1LR4A 3UPXA 3VUGA 3NVKI 2UW3A 3U54A 3EH9A 3TV6A 3G9NA 4JBQA 1P4FA 4F4PA 4QMNA 1BLXA 3GU5A 4FTLA 2VX3A 2PVNA 3PUPA 3AC1A 4KD1A 5EHOA 5HGIA 4K11A 4M66A 3E7VA 3DCVA 2XKCA 4RVKA 4BCOA 5FP6A 2PVHA 4UXLA 5LARA 1ZZLA 4PV0A 3CGFA 2VTOA 3EN4A 4HZSA 4L7FA 4MNFA 3R9DA 2C5YA 2I0YA 3I0OA 3KRXA 3BYSA 1ZYDA 1U5QA 2E2BA 1XKKA 3FZPA 3MN3A 3ZH8A 3VS0A 5BVWA 1IAHA 3QLGA 3R7IA 2XRWA 4HYHA 4O4EA 4QP1A 4BDCA 3RWQA 3CE3A 5J9LA 2GNJA 2BUJA 3PJ3A 4CVAA 4LV5A 3Q04A 4Y5QA 4H05A 1W0XC 5IPJA 2FA2A 5EW9A 5C4KA 5EM8A 4IJ9A 4E6QA 4F1MA 2Z2WA 3WF8A 1WZYA 2EUFB 2XIZA 4NJ3A 1IA9A 3TZ8A 3G0EA 1ZRZA 1O9UA 1WBWA 2C4GA 4JIKA 3P7BA 3LLAA 3QHRA 4MNEB 5KO1A 4TPTA 3E93A 5HCXA 3ZCLA 5AAEA 1WVYA 1CKIA 5DPVA 3R83A 4ERKA 2XIYA 3F2RA 1W2DA 3MW1A 4CZYB 4IVDA 2YCRA 4I5HA 1W98A 3OS3A 4FVPA 2HIWA 4BDHA 4JLCA 4C35A 4EHGA 4DGLC 3RAHA 4OW8A 5T6KA 3MI9A 1W83A 4XG7A 4K6ZA 2PVKA 2WMUA 3UC4A 3NEWA 4NT4A 3DQXA 4D0XA 1OL1A 3ENHA 3H10A 2GS6A 5BVFA 3MVHA 4FGBA 1TQMA 5AV0A 2J0JA 3MVLA 2CKQA 4M14A 4FYNA 1GZ8A 4O0UA 4XBRA 3S1HA 3HNGA 2WTJA 5JGDA 4EQMA 3O7LB 4O84A 2GNIA 3PWYA 3JUHA 2BZJA 2PZPA 4YHFA 3SOCA 3ANQA 3P86A 4YO6A 2WFYA 3TV4A 3QUDA 4AQKA 2R3HA 3DNEA 1PXOA 4YZNA 5AA8A 2BMCA 3Q96A 2VWVA 3AMYA 3GENA 4I0SA 3V6RA 4M13A 4Z7HA 4CFNA 4I6BA 5ANKA 4FSYA 3ENMA 3QD4A 5BPYA 1OB3A 1YQJA 3QTIA 3EJ1A 4ACMA 3L8PA 3W0OA 3R9HA 5IUGA 5DT0A 2GMXA 4AZEA 4F09A 4QO9A 2C3KA 4PPBA 3WE8A 3F82A 2IF8A 3R2YA 4LV8A 4ENYA 3ORPA 3DBDA 5F4NA 3RVGA 1NA7A 4DEDA 3VJNA 4JJRA 3WBLA 4DTKA 4D2VA 1GIHA 3BWJA 4MNEA 5DI1A 4F1OA 4FIJA 2R3JA 2QO9A 4FTMA 2R7IA 3IGOA 5AV4A 3HV5A 4O2ZA 2H9VA