3NEWA

P38-alpha complexed with compound 10
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
334
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery and Characterization of Non-ATP Site Inhibitors of the Mitogen Activated Protein (MAP) Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 103
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3newA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3newA01
4NKAA 4DFZE 2OF4A 1ZOEA 4FEVA 4F70A 3DBFA 3GCQA 5DR2A 4FIGA 5DT3A 2XS0A 4Z9LA 4EYMA 5AA8A 3TNQB 4OTGA 4E4LA 3TV4A 5I5ZA 4GKHA 4FT0A 3I7CA 4EJ7A 2VTMA 2R3KA 4O7NA 2VUWA 4M13A 4RX8A 1G8SA 2VO7A 4HJOA 4QTEA 2ERZE 3GCSA 3I6UA 3C4CA 4BYIA 5I9WA 4HCUA 4EBVA 4QP9A 5GZ9A 4QTCA 4QPSA 3ORLA 3AMBA 4FICA 5HO6A 2UVYA 4FNWA 1BX6A 4GW8A 5I3RA 3AMYA 3BGQA 2IVUA 3CJFA 3VN9A 3JR1A 2XEZA 3LXLA 3TDWA 2R3HA 5IISA 4CLIA 2EB3A 1OGUA 5ANGA 4AP7A 2F9GA 1E9HA 3A7GA 3JVRA 4V05A 4BCHA 1OKWA 2FSLX 3BE9A 5FDXA 3NYVA 4G2FA 1LEWA 2WMVA 3D5UA 5CF5A 3QKLA 3WF5A 4XV9A 3W32A 3R83A 5F4NA 4PNKA 3HYHA 4CMOA 2JKQA 5HE2A 3NUNA 3QHWA 4QQTA 5A6NA 5F1ZA 2C1AA 2WZJA 1PMUA 3ATSA 2BZHB 4FIEA 3FJQE 4IWOA 3TG1A 3KMWA 4QYEA 2V7AA 3ZBFA 4H36A 1SM2A 3PG3A 3TNHA 4AGCA 3F2RA 2OXXA 3SHEA 4L7SA 4QP4A 4YZBA 2HW7A 4HGSA 4MWIA 3FZ1A 5HU3A 3V5JA 4DT8A 2W1ZA 3VF8A 4BDCA 2GPHA 4F1TA 4F09A 1UWJA 2W1HA 4CQGA 3R8UA 3EH9A 1O6LA 3CGOA 4RWJA 4YTIA 1PXJA 2PE1A 1ZLTA 4CYIA 1ZRZA 3DCVA 5FG8A 5C8KA 2C6KA 4BC6A 4U42A 4YLKA 4R3RA 5FD2A 1K2PA 5AR4A 5AV3A 2GSFA 1OKVA 4FSTA 3QA0A 4C3PA 4RBLA 4TY1A 5LCKA 4RRVA 3CTHA 1CKIA 2ZAZA 3CKXA 3RCJA 5HKMA 5HVJA 3GB2A 3QLGA 2F2UA 5LCJA 2OGVA 2YISA 2YIXA 4I5CA 4ZSLA 3AC2A 3FL5A 1VZOA 5FBNC 4O6LA 2XIRA 2X2KA 3Q2MA 3THBA 2YIRA 4QP6A 2VTOA 3P1AA 4IZ7A 5ANJA 3CE3A 2NNWB 4G3CA 5HORA 5HGIA 3CY3A 3I79A 2IPXA 1NVQA 4WUNA 2BIYA 3A7JA 3QXOA 5ETAA 3G51A 2X2MA 3QF9A 3SRVA 4CFNA 3DQWA 4F9WA 3F5UA 4ASDA 4MK0A 2GHGA 4C33A 3LFBA 3GFWA 3A4OX 2VTRA 3QHRA 1G8AA 1YDRE 4FT3A 4XUFA 1DS5A 2YCFA 4U44A 4BGGA 3RZBA 4DG3E 5A6OA 2G2FA 4KBCA 3SA0A 5ANKA 5FM3A 5AX3A 3UIBA 4BCJA 5FP6A 4DLIA 3ZFMA 2RL5A 4ANQA 3HRBA 1QMZA 4G31A 4ZTSA 4RIWB 2DWBA 2XNOA 2ZB1A 4EH5A 1YKRA 4EH4A 2B54A 4J8MA 5CU0A 3KKVA 3EFLA 5EM5A 3TI1A 2OK1A 3ZLXA 1XH9A 3VULA 4W8EA 3Q6UA 3WYYA 1UVRA 3GCVA 4KAOA 3P23A 4EH3A 4TYHA 2QODA 2ITYA 4WO5A 2W1GA 1V0PA 2F49A 3NW6A 2PY3A 1YXVA 4CCUA 4XP3A 2F4JA 4NK9A 3COIA 3DDQA 4JG6A 3PSBA 4PMPA 2VO3A 2X6EA 3RAHA 3MVLA 2B55A 3OOGA 1PMNA 2VWBA 3E88A 2CGVA 3PPZA 2AUHA 3R1SA 1YRPA 4FKWA 4ITHA 4FVQA 3BBTB 3KC3A 4I41A 4JDHA 5EW8A 3MVJA 3P7BA 3FXZA 3FL4A 4NWMA 4XLVA 2IVVA 4EZ7A 4HPTE 5AWMA 4B8MA 5HU9A 4DFBA 1ZARA 3WF6A 4RQKA 5EYMA 5EOLA 3WOWA 2JIVA 5FTGA 3C7QA 4GUEA 4CFFA 2R7IA 4IM3A 4ACMA 4FBXA 4AS0A 4MAOA 1W83A 4Y5HA 4B6LA 3Q53A 2HZ0A 4FK6A 1P2AA 4S34A 3PJ3A 5KO1A 2JKMA 4APCA 4WSYA 4OTWA 4BDDA 5M08A 4AA5A 3F6XA 3F82A 3G9LX 4IHPA 4V0GB 3PLAE 4D4RA 1QCFA 4LGGA 4AGDA 1CMKE 1QPEA 2WOTA 1FMKA 2EWAA 1R0EA 3LXNA 1GIIA 4TWOA 1B6CB 1KE9A 5T3QA 4BTJA 3QTQA 4IZ5A 3UZTA 2VGOA 2VWUA 2XP2A 4BKJA 5IEXA 3PIZA 2C3IB 4G3EA 4NM7A 5EHOA 2E9VA 3GGFA 4R7BA 3DKCA 5IUHA 5CAUA 2UZUE 1YQJA 4N6ZA 3QX4A 3HVCA 3IW5A 4JX3A 1BYGA 2W17A 4AGUA 3MWUA 5CI7A 4O7ZA 4GIIA 3BLRA 4FSYA 4BZDA 3ZEPA 1YWRA 1K9AA 3E93A 5DN3A 4IFCA 5ACBC 4A4XA 5DI1A 5I9ZA 2PVFA 2Y8OA 3D14A 1Y91A 4JX7A 3FWQA 5CI6A 5H8GA 5HCXA 4NW5A 3ZRMA 4AT4A 4AWIA 4DC2A 1J7IA 4E4NA 4CKRA 1URWA 4LL5A 2GNFA 4I3ZA 3LLAA 3ANQA 1P4OA 1BL6A 2ZJWA 4MBLA 5DR6A 4HGTA 2C6OA 5DWRA 1OBGA 4BBMA 5HG9A 2OICA 2W9FB 3NNVA 3U6JA 4JXFA 4QP1A 4MNEB 3PY3A 4M97A 4IWPA 3I0QA 3WILA 4FOBA 2QU6A 2VTHA 4QD6A 2WTWA 3D7TB 5IDNA 2XIKA 4WIHA 3P78A 3HA8A 1JKSA 1OUKA 2CKOA 4FUXA 5E9EA 3N4UA 3R8ZA 3PA3A 4F08A 4JG7A 5CQUA 4YMJA 3H30A 4FE2A 2PK9A 2OZAB 3DT1A 5JGAA 3RPSA 4L6QA 4UN0C 1YI6A 3MYGA 5E8UA 1KE6A 3NLBA 5KMLA 3NNWA 3MH0A 2IN6A 2GCDA 4GRBA 4ALVA 3FKOA 3JY0A 2R3PA 4F99A 5EI8A 5IEVA 1V0BA 2W5BA 4IC7A 4FKSA 4P5QA 5LMBA 4S30A 2VN9A 2YCSA 2W9ZB 2JKKA 2VTIA 3CQWA 3NUYA 4JVGA 1GIHA 1K3AA 4L52A 4NT4A 4WNPA 5AJQA 3CJGA 3TIZA 4FA2A 4EORA 4USEA 4BI2A 2UW4A 4J53A 5EM6A 3RTPA 3QLFA 1P5EA 1SNXA 3EFWA 4M0ZA 2VGPA 1QPCA 5IQIA 2Z7SA 3QC4A 4FV3A 4N0SA 3E8NA 2BZJA 2WHBA 3BU5A 3I60A 4IZYA 4C58A 3SVVA 3BHYA 5E7RA 5CU4A 1BI7A 3MA3A 5CT0A 3PA5A 4N4SA 4O0WA 4A9RA 5KMKA 3U4UA 3KU2A 2HIWA 2VU3A 2WXVA 4FSQA 2C0OA 2NP8A 3BKBA 3HV6A 2Y0AA 4CTBA 3W1FA 2E9PA 4MXZA 3TACA 4A7CA 4YUQA 3OCTA 3HV4A 1UNHA 2XBAA 2OXDA 3OF0A 2XNGA 4WNOA 3UO4A 4RX5A 4DGMA 5FDPA 3TM0A 4EK5A 2CKEA 2W4OA 3IW7A 1XH6A 1DI9A 4LRMA 1JKKA 2YA9A 5AP6A 1O6KA 5FGKA 2I7QA 2OIDA 4KINA 4CEGA 4E7WA 2X7FA 1OITA 2UVZA 1BI8A 2GS6A 3NX8A 3ALNA 3E8EA 5CSVA 5D7AA 3JYAA 4ZSGA 5K4JA 2W4JA 3QD0A 4FTJA 3DFCB 1YHWA 4WG5A 4E4XA 4KKGA 4ENYA 4EOLA 5K4IA 5JSMA 3GC9A 3R8MA 4P90A 5DEYA 4ZTRA 1CSNA 5BMSA 3E7VA 3F5XA 2UZDA 3QALE 4MXOA 3QTIA 3JS2A 3KEXA 4GJ2A 3SXSA 2EU9A 5KKRB 4W8DA 4YC8A 1J3HA 3IW6A 2Y7JA 4JAIA 2IG7A 3FQHA 4FMQA 3NIZA 5AUXA 4TRLA 2XKDA 2FH9A 2WEVA 5M4FA 4KSQA 4DHFA 3AD5A 4X21A 3OWJA 3ZXZA 4NZWB 3ETAA 2QHNA 3F2AA 3O0GA 2XUUA 1AQ1A 4OBQA 2HWOA 4EONA 3WF9A 4O0SA 3UP2A 4BI0A 1BL7A 3P5KA 4O96A 5FEDA 3ZS5A 4YGAA 3A4PA 5G6VA 2WNTA 5HCZA 4RSSA 2E2BA 3SRVB 3TCPA 3QD4A 2CSNA 3KULA 2CKQA 3GU4A 1ND4A 2C47A 3EQPA 4AF3A 4AZEA 1Y6BA 4RFMA 1H28A 2IZSA 4LV8A 4OW8A 5CY3A 3R7UA 1RW8A 3UC3A 1REJA 4L3LA 3WZKA 2C6LA 2R3OA 3Q4UA 1MQ4A 4X7QA 4I23A 4ACGA 4BCMA 3LFQA 4RMZA 3ZLSA 3BQRA 1SMHA 3UDBA 3ZM9A 3IQ7A 4H39A 4P4CA 5DYJA 4AU8A 4HGLA 3RCDA 3FC1X 1UWHA 4CCBA 4D2PA 3DK6A 2O65A 5HG7A 5CAOA 1LR4A 4ID7A 5DHJA 4O7YA 2QC6A 2PL0A 3VS4A 4JBVA 1UA2A 3IS5A 5AUVA 4JG8A 5K9IA 5CAVA 3TNIA 3EQCA 4D0XA 2A27A 4UWYA 4L3PA 4DEDA 3PXZA 1E1VA 3L9LA 1TQIA 3SOCA 1Y8YA 1F0QA 3AT2A 4FV9A 2ITZA 4JRNA 5HICA 4AN2A 4O81A 4FSNA 3SG9A 2XBJA 3SXRA 3UO6A 3R9HA 2UW9A 4O38A 3PXKA 2OI4X 4EJNA 3KXZA 3U6IA 4ZJVA 2PVMA 3HV7A 3KRLA 5FXQA 5AAEA 4FL3A 3WARA 1HCKA 4BHNA 4JS8A 2QOHA 2VTQA 3RM6A 1A06A 3W16A 4ACDA 1XR1A 1OIRA 5FEEA 5HIBA 3UMXA 3GC0A 4QP8A 3ZO3A 2Z2WA 1EH4A 4GFGA 3MJ1A 2H96A 3O17A 5HD7A 3C5IA 4MD9E 4IEBA 5GJDA 3IDCA 3KQ7A 5HG5A 3MH1A 4EWQA 4ZMEA 2BRGA 3G5DA 2YZLA 1OL5A 2PZ5A 4KSPA 1DAWA 3ZONA 3C5UA 5LMKA 4AW2A 2CJMA 1OKZA 4UMPA 4ZY4A 5IMXA 4YJSA 3OW4A 3QQHA 4M8TA 2AC5A 4YZNA 1R3CA 2OIQA 3ORPA 5GZ8A 1XH8A 2XK9A 3BGPA 5M53A 3R1NA 2OXYA 4F64A 5JK3A 3NVMB 4F9YA 2HENA 5HBJA 4TW9A 2J50A 4RIYB 2ETKA 2Z8CA 2ITNA 1RDQE 5AIRA 4FV6A 2JDRA 3FZSA 4ZJJA 4DT9A 4XBUA 3VHKA 4GG5A 4U9AA 4OBPA 2OJJA 2GTMA 4YURA 4LYNA 5KNJA 2BAJA 1Q8WA 1YXXA 3TJDA 4ANMA 2G2HA 4ZY5A 5HTIA 2Y6MA 3AOXA 3OUKA 1SYKA 2X1NA 4DFXE 4BBEA 3LKMA 2O63A 5AUTA 4PDSA 5DMZA 2X6DA 3FZTA 4YP8A 5CANA 4IB3A 5HOAA 4FV2A 5KCVA 4QYHA 5H2UA 3R02A 4FNXA 4R5SA 3EL8A 4C57A 3KXNA 2UW3A 3FYKX 3PLSA 3R01A 3DBQA 3P7CA 4FZ6A 4TTHB 3W10A 4KABA 3UZRA 3CLYA 5M07A 4R1VA 3BX5A 1V0OA 1KSWA 2EVAA 2UZTA 3OY3A 4HCVA 3V01A 4IX4A 3DA6A 2RFNA 3PJ1A 3HL7A 3OVVA 3R2YA 2GHLA 5BVWA 4ZXTA 3P79A 1W98A 3BZ3A 2XEYA 4NUSA 3E7OA 3VBXA 4G3GA 1WVXA 1H1PA 1BMKA 5C27A 4RVTA 4RJ4A 2BRHA 3HECA 3OCBA 2R4BA 2QOQA 3UZPA 2O5KA 1OPLA 4L67A 3KF7A 4AZSA 2FA2A 1PY5A 3BEGA 2B7AA 2ZV7A 3KVWA 4H1JA 5HNBA 4D2SA 3IPHA 2YCQA 3RWQA 2UVXA 1APME 3EMGA 1GIJA 3Q5ZA 4RWIA 5M4CA 4FTRA 3F5GA 3BPRA 3ACJA 3ULZA 3VUIA 3REPA 3SOAA 2NO3A 3FAAA 2QU5A 3QX2A 4E6CA 5K5XA 5ANOA 3TV6A 2JDTA 3IKAA 3MPAA 4R7IA 4GIHA 2P55A 3DNEA 2X7OA 5DA3A 3AG9A 3V5TA 3Q3BA 5HD4A 5EDRA 3LJ1A 2CNVA 3KY2A 1YVJA 2BDJA 5TO8A 4PNIA 4C4HA 3QQLA 3SW4A 2QLQA 3HNGA 3VS6A 2WMSA 2XK4A 3MTFA 2B52A 2WMQA 4G17A 3TUDA 2PYWA 4O91A 2XYNA 4TNBA 3HMIA 4CV8A 3P9JA 5HLPA 3TL8A 3U87A 3LFNA 4EOSA 4P2KA 3M1SA 3P86A 2WD1A 4IVAA 4QPAA 4QMSA 5TR6A 3II5A 5FWKK 3SD0A 1Q3DA 3PP0A 3COMA 5H8BA 4F9BA 1OL6A 3TUBA 1S9IA 4RJ3A 4PMSA 1FGIA 3HLLA 4FV4A 3HDNA 4BIEA 3GU6A 2XA4A 4MNFA 4C4JA 2XRWA 4D4SA 3ZFXA 5AV1A 4NU1A 3RK9A 2Z7LA 3PJ8A 4IX3A 4J8NA 5JMSA 3RZFA 5GJFA 4TXCA 2QG7A 4PQNA 4EEVA 4FTTA 2ZYBA 3C1XA 3E5AA 3F2NA 1WFCA 2XKFA 4O82A 3P7AA 4NFNA 4DYMA 4FZ7A 1M2QA 4NCTA 5JQ5A 5A4EA 3UVRA 4YZMA 4JR3A 3EQGA 3UTOA 1GZOA 3MFSA 5CVHA 2J0MB 4FGBA 1R0PA 4GEOA 4WRGA 4QMQA 3FMMA 4KIKA 5EHYA 4YTCA 2J2IB 1PW2A 4EOIA 4IM0A 5DVRA 5HHWA 3LCDA 5HIEA 2CCHA 1T45A 3QCYA 5FBOA 4MBIA 2R3JA 3UBDA 3OXIA 4YJTA 4MXXA 3TWJA 3U4WA 5K5NA 3QUPA 3NRMA 5EH0A 4W4WA 3CC6A 3K5VA 1YHSA 3R63A 3ZLYA 4L45A 4U8ZA 2J51A 3DK3A 4DH1A 5CEOA 5CT7A 4ENXA 2CLQA 4O0TA 5HESA 4USDA 1WAKA 2PTKA 4YZDA 4NYEA 1PXMA 3IOKA 3KULB 3PZEA 3KGAA 3NUXA 5FP5A 1OI9A 4FTKA 4YLJA 4ZEGA 3FPQA 4K0YA 5L2QA 2R3MA 3FMNA 4IDTA 4IDVA 1U4DA 4BIBA 1BKXA 4EKKA 4BGQA 5JEBA 4M15A 3ORIA 3N9XA 2WO6A 4BI1A 4F65A 2CMWA 4BF2A 4WG3A 2WGJA 5JRSA 1CKJA 4ASXA 1OZ1A 2UZEA 5ITAA 2J9MA 3Q4TA 5EDPA 5IH4A 4PTEA 5L2IA 4R1YA 2JIIA 1Q8ZA 3D2KA 4XLIA 1ZY4A 2JBPA 2BILB 3HEGA 4FZFB 3NW5A 5E8TA 2VAGA 3RALA 3GU8A 3DFAA 3NUPA 5TKDA 3VC4A 4CXAA 5AR2A 5IDPA 4KIQA 3D4QA 4QTAA 2YM7A 1IAJA 2YN8A 4GSBA 4DTKA 2C5VA 4KUJA 1JSUA 5IF1A 4JT3A 2R3GA 4DAWA 3MB6A 4BIDA 2CGXA 4FT7A 3TKHA 5EQYA 4QQCA 5HX6A 3TEIA 2UZLA 1UNLA 3R1QA 4JOAA 4LRKA 5IQCA 4ZSJA 3OC1A 3ZRLA 4DE4A 4HZRA 4Q9ZA 3F9NA 3PJCA 2B9HA 2XNEA 4JDJA 4BWKA 1H1SA 5BVKA 3PXQA 1E1XA 1YXSA 4PUZA 4YNOA 2QO7A 3FMJA 3ZZEA 3L8XA 4B7TA 3QGYA 4MEDA 5BUEA 4M69A 5KMMA 2VX3A 1YOLA 2DYLA 2PE0A 2YITA 3EIDA 4QRCA 5ANDA 3CR0A 1WBPA 5BYZA 2UV2A 3PSDA 1AGWA 2FO0A 5CF4A 3PE1A 5J5SA 5ANEA 3R04A 4X2JA 4BTFA 4IQ6A 2YM8A 5LMKC 2C0IA 4ASEA 3KB7A 3O50A 4I0TA 5L8JA 5LARA 4I21A 2UZBA 2ERKA 1KE8A 5IEYA 4O83A 5EKOA 1H8FA 2VTJA 2XNPA 4F6UA 4MWHA 1R1WA 2WMXA 4BDAA 2R64A 4XG4A 4JDKA 2XK3A 2Y4PA 3AD6A 4FT9A 4ERKA 3D5XA 4XP0A 3FLYA 4RA4A 4D1XA 2HWPA 4IAAA 1PKDA 4WRSA 3BYMA 1J1BA 3QZHA 4GT4A 2PZIA 3COHA 5L2WA 4YJQA 5M4UA 1KUTA 1O9UA 4DTAA 3W8QA 1J91A 4YC3A 2H6DA 3LCKA 5CEMA 3OEZA 1A9UA 4FV5A 3EB0A 4IWQA 4YHTA 2C30A 3CCNA 1U46A 3D83A 2WMAA 5C8NA 2REIA 3LQ5A 3SXFA 5CSPA 3FMDA 4OGRA 4UB7A 3PWYA 2QCSA 2PVYA 4A06A 1OPKA 2A0CX 4C8BA 2X9EA 4IH8A 3QFVA 2YWPA 2ZB0A 4LI5A 1CKPA 3AD4A 4HOKA 2P3GX 3MVMA 5T68A 3ACKA 2P2HA 4RZWA 5CU6A 3IGOA 4KBKA 3VBTA 4D4YA 3CIKA 4C36A 4TYGA 3NUUA 2I0EA 4U5JA 3ORTA 3QRKA 4KRCA 4M66A 1FBNA 3LQ3A 3VS1A 5CX9A 4EHZA 4FG7A 2PMOX 2ETRA 3HUBA 3W55A 5E8YA 3PPKA 4FTQA 3FQEA 3LFAA 3V5PA 1WBSA 3HP2A 3NUSA 5KE0A 4DGNA 3FLWA 3MJ2A 5A4TA 3D0EA 4QYGA 3NYXA 3UG1A 4RZVA 2CN8A 2F57A 4DEEA 3Q9YA 5B7VA 3CQUA 3I6WA 2GS2A 1FOTA 4FR4A 3BIZA 4EOQA 3IDPA 3RNYA 2C3JA 2JDVA 1PXNA 2OG8A 4AW5A 2HCKA 2DUVA 3ODZX 4FYNA 2WTCA 4ALWA 4ANNA 4WNKA 1ZMVA 4DFYA 5L6PA 2YDIA 2JFMA 4IVCA 4G6OA 4ZTLA 3UIUA 1REKA 3C4ZA 2CN5A 3KRRA 4QP7A 4DH7A 4O7TA 4FZAB 4FV7A 5M4IA 2XIYA 3AXWA 5AR8A 2C6MA 5ETIA 4CFMA 2WFYA 3KCFA 4YJVA 3QUEA 3FLZA 2BTSA 2LGCA 2V0DA 2XJ0A 4OTQA 3DAEA 5DT0A 4HZSA 3S4QA 3FI2A 4OTIA 3BHHA 4FV0A 4KKHA 4TT7A 4FTNA 2G2IA 4S33A 3ID6C 4X3FB 4TPTA 3B2WA 3NVKI 2XK8A 4X3FC 1L8TA 2C1BA 3NNUA 3W33A 3OWLA 1Q62A 3F7WA 3VHEA 4I5HA 1U54A 4D55A 2XJ2A 2HOGA 5J1WA 3EQRA 4R3PA 3GOPA 3WYXA 1IASA 2WTVA 2ITPA 3HV5A 3OT3A 4IW0A 4PTCA 2PULA 3HRCA 3Q32A 5FM2A 2GS7A 3VS7A 5IH6A 3H9OA 4QMZA 3LHJA 3IGGA 5ACKA 3VS5A 3DS6A 2Z60A 4C59A 2G9XA 2C3LA 2WMBA 3QQGA 1OMWA 5EHLA 2W1CA 4GV1A 4E6DA 3OTVA 4QMTA 4FSWA 4F7NA 4ZSEA 4PY1A 2BROA 3FHRA 4A9TA 2PUPA 3KF4A 5JN2A 2WQNA 2IVTA 4I4FA 5CLPA 5BPYA 4DBXA 2KTYA 4EBWA 4W4YA 4L7FA 4U41A 2ZVAA 4P5ZA 3RPYA 4WT6A 4GCJA 4MHAA 4WUAA 4EWHA 2J5EA 4CT2A 3HMNA 3MH3A 3VUGA 5IH5A 1WCCA 3ORXA 4WHZA 5CEQA 3R9NA 4C7TA 4CFVA 2C6IA 3BYSA 3ZEWA 4HCTA 4E26A 2QOIA 4YLLA 5CNNA 5LVLA 4ERWA 1PYXA 3MB7A 2OIBA 3QKKA 1H1QA 2V7OA 2BHHA 4M7IA 1IRKA 5EFQA 2VTPA 3K2LA 1U5RA 3QRUA 1JLUE 3ODYX 4RC3A 5M56A 3OT8A 1ZAOA 4KS8A 1OIQA 5E90A 3NMUF 4AOTA 4IAYA 4NFMA 5E8XA 5M55A 2QOFA 3QXPA 4QO9A 1XKKA 3TT0A 4QP3A 1O6YA 3PVWA 5IA5A 4EC9A 4GT3A 3PIXA 4DFLA 3MPMA 3PSCA 4FV1A 1FVRA 2RKUA 4X2GA 2OLCA 5J8IA 2W5AA 2OFVA 5E1SA 3ET7A 3KN5A 4FV8A 4X6QC 4FEWA 4QYFA 3GCPA 2CHLA 3LCOA 2VRXA 3O23A 3Q9ZA 4PL3A 2GQSA 1WZYA 4YC6A 4EH2A 5EI6A 2OKRA 4USFA 4GH2A 2R3QA 2QOBA 3U8WA 3NCGA 5AP5A 2EB2A 4JL9A 1MUOA 3G6GA 4DBNA 4RJ6A 3SGCA 5E92A 5AUWA 1QL6A 4PRJA 4O7VA 3RI1A 2C68A 3RGFA 3PP1A 2HY0A 1UU3A 1G5SA 3WZUA 3CTQA 3L1SA 4ZTHA 5EM7A 3COKA 5HCYA 4S32A 4BB4A 2F7ZE 4BDJA 2RSVA 2J7TA 1H25A 3F3TA 2YJSA 2CCIA 3RPVA 5CALA 3TKUA 4O27B 3R6XA 4KKEA 3ROCA 4D2WA 4ZMFA 4B9DA 3LCTA 3R7EA 4C3RA 4G6NA 4AG8A 2NPQA 2VO6A 2IO6A 4FC0A 4FIHA 1WMKA 2XK6A 1LUFA 1XBCA 2QO9A 4QMOA 2WELA 4EI4A 4XEYA 2J4ZA 2YM6A 4D5HA 4DGLC 3TIYA 4WBOA 5HEZA 3DY7A 4QNAA 5D11A 3TZMA 4H05A 5JT2A 5HE3A 4PMTA 3MW1A 4CMUA 5A14A 3F3UA 5EYCA 4F1MA 2BZIB 4JBPA 4P7EA 4FL2A 4AA0A 4K2RA 3VO3A 2OBJA 5HO7A 1XBAA 4LG4A 3NR9A 4M69B 3MA6A 2ZMDA 3BE2A 4C2VA 2W1EA 3FUPA 3S3IA 5HLWA 2VTAA 2HXQA 2EUFB 3MSSA 4II5A 3OD6X 3DOGA 5LVOA 5C4LA 5HQ0A 3E92A 3VAPA 5HVKA 3UVQA 1ZOGA 4AE9A 2PVLA 5CF8A 4GK4A 5KZ0A 4BDIA 4XOYA 2JITA 3QZFA 1UU9A 2WQEA 3L8PA 3RWPA 1LPUA 2BFYA 2BR1A 2OH4A 4LV5A 4DEBA 3GT8A 3DKGA 1KE7A 1W82A 3ALOA 3LAUA 1FVTA 3WZEA 2UW0A 3F88A 4MX9A 3EQBA 4O0XA 3IECA 4TWPA 4PV0A 4AT5A 1JOWB 2CPKE 3E63A 5JQ8A 4RC4A 4OAVB 3W18A 3LW0A 4YPDA 4MF1A 3SG8A 4ANLA 2X7GA 4CKJA 3SX9A 1WVYA 2YIWA 3DBEA 4UEUA 3ZC5A 1SVHA 4DEIA 5IU2A 2R3NA 1WVWA 4FNZA 4O84A 3CQEA 3V5QA 4XG6A 3MBLA 4M14A 4TKSA 5CSHA 5KHWA 4FOCA 4IX6A 2JFLA 5EKNA 3S0OA 3S1HA 2VZ6A 2BAQA 4G34A 5AIKA 4PDYA 3Q2JA 3H0YA 4GYGA 4O7SA 3MV5A 5DH3A 4BCGA 5C03A 4DCEA 1PHKA 3GU7A 4OTFA 2WEIA 2XNBA 4RX7A 5I4NA 1GZKA 3R9DA 4Y73A 2PWLA 3K54A 1Q97A 2ONLA 4J52A 4WKQA 3Q9WA 2HZIA 4LUDA 4ZTQA 3UO5A 2PSQA 2RFEA 4ZSAA 4FIJA 2PUNA 4MQ1A 4EH7A 4O7WA 4L43A 5AP3A 3BGZA 2B1PA 4TL0A 1YHVA 4BWXA 5JRQA 4I4EA 3HUCA 4EH6A 2X39A 3A61A 3VRZA 4V01A 3I0OA 4F6SA 2QR8A 5J1VA 3IW8A 2R3RA 4GFMA 4K1BA 4E20A 5LQFA 3NAXA 3TZ9A 4O1PA 4XHKB 2Y6OA 4QMPA 3A7HA 1IA8A 3B8QA 3ZYAA 1JPAA 3NW7A 4I5MA 3RPOA 3BLQA 4AOIA 2OJIA 5FXSA 5JZNA 4ZLZA 4CG9A 2HELA 4AT3A 2FVDA 3A7FA 3PXFA 1ZYDA 3HP5A 5CENA 3OCGA 3R9OA 4C02A 2GNIA 3A62A 2ESMA 3TNPC 2DQ7X 2PMIA 3F3VA 3ZMMA 2VNYA 3EKKA 4OT6A 4GVJA 4YZCA 3FLQA 2VD5A 3AT3A 3QTWA 3R7OA 4QTBA 2YAKA 5I9VA 5IUIA 1FVVA 4GKIA 3S00A 2YFXA 3AC8A 3H3CA 4TYHB 4EK6A 4R5YA 4H1MA 3ZDIA 4F6WA 3F66A 3DTCA 3NEWA 4O1OA 4BCIA 1OB3A 2VX1A 3T9TA 5EQPA 4L68A 3RHXA 2UZVA 2W1DA 5J7BA 1CDKA 3BU6A 4AFJA 4BVUA 1U54B 4F7JA 3EFJA 3ZHPC 4E6AA 4IJ9A 4BDBA 4JAJA 3UMWA 4C0TA 1MRUA 4YSMA 5E8SA 3EN7A 3EYGA 4JBOA 4XG8A 1IG1A 5HG8A 4D9UA 3QCQA 2W7XA 3PJ2A 4TYIA 3FLNC 1HCLA 4DFUA 3QYZA 1ERKA 2HXLA 4APPA 2IW8A 4EHGA 5LVPA 4HYIA 2BKKA 1PXKA 3CBLA 3RAIA 3ZZWA 3GI3A 4LOQA 5FRIA 3G0FA 3UPXA 3ZUVA 4J7BA 1UU7A 4UMQA 4FKVA 4IZAA 4WBBB 5GHVA 2ITWA 4LRJA 3ZDUA 4EUTA 3TZ8A 3VRYA 3ZTXA 1PXPA 1FPUA 3RAWA 3UPZA 5AM6A 1H1WA 2X0GA 4F63A 4R78A 4XMOA 4XRLA 2I1MA 1XWSA 3OXTA 3DNDA 4UWCA 5DEWA 3VQUA 4CFUA 5CAPA 3KK8A 1ZOHA 3CEKA 4I5PA 1JNKA 3VBYA 5LJJA 3A60A 3BHUA 4A9YA 3W2OA 3ZFYA 4L3JA 4AX8A 3LMHA 3QQFA 4I6FA 1ZZLA 3POZA 4FUYA 2PUUA 4QPMA 3FPMA 5L4QA 3U9CA 1XH4A 4PTGA 2HW6A 4EKLA 1DM2A 1KWPA 4K9YA 1RE8A 4DG0E 2WU7A 4Z7HA 5BYYA 2WAJA 3RAKA 4EK3A 5D1JA 2BPMA 3ORZA 1FMOE 5C8MA 4PX6A 3WE8A 5BNJA 3HAMA 2BCJA 3ENHA 4YO4A 4O6EA 3ORKA 3DPKA 4DG2E 1PMVA 4B0GA 3ZSIA 4AZFA 1KE5A 3DQXA 4KA3A 4MXYA 5CVFA 5LWNA 4DA5A 1JKTA 3FKLA 5J5TA 3FXXA 5BVOA 1G3NA 2QR7A 1NT2A 3IO7A 2JDOA 4DITA 5EM8A 2UW6A 3DGKA 3ROYA 5LVNA 3DU8A 3FXWA 2BRBA 2Z02A 4EZ5A 4W4XA 2OO8X 1ATPE 2FUMA 4LFIA 4CZTA 4O21A 3DB8A 4E3CA 4YSJA 4EZ3A 1MP8A 2ZOQA 2I0VA 4J95A 5AR5A 1WBNA 2E9OA 3CXWA 4RG0A 3UJGA 4ZIMA 3UG2A 3OROA 2JIUA 3CPCA 4FEXA 4AGWA 4QMMA 3P4KA 4X0MA 5HE1A 5KBQA 2QNJA 4L8MA 2ZDTA 3UQFA 3GC7A 5DOSA 5BUJA 5JH6A 4BFMA 3RP9A 5AR3A 4Y95A 4FKOA 4C4EA 5IQHA 4MD8E 3P08A 4OTHA 5EW3A 3W2PA 4G9RA 3KREA 1UNGA 2BTRA 5AV2A 2BIKB 4RLLA 3TJCA 3LXPA 3O51A 3UVPA 2JKOA 2GNHA 2H9VA 4JLCA 1SVGA 4F7LA 3KK9A 4BCNA 3TTJA 1H24A 4FX3A 2X8DA 4FKRA 4PPCA 1OM1A 3R73A 4UMTA 4QOXA 3HA6A 4GFOA 3UC4A 2BMCA 5JFVA 4Q2AA 2R3FA 3AC1A 1TKIA 4QMUA 2B9IA 5A3XA 5CEKA 4KIPA 4XS2A 2Q0NA 3POOA 2BRNA 4DGOA 3CY2A 3FI4A 2PVNA 3RM7A 3PDTA 4JI9A 4I6BA 5HNGA 5GNKA 1XBBA 4RFYA 4F4PA 5CF6A 3DZQA 4U81A 3EKNA 3IG7A 1OKYA 2QQ7A 3R1YA 4IAZA 4ITJA 2J0JA 5CYIA 5B2LA 5IQFA 5CXZA 1M14A 4YJOA 4E8AA 4CFWA 3DJ6A 3G2FA 4HGEA 4RIXA 1M7NA 3R7GA 4CGAA 4CNHA 3H0ZA 3VNTA 3FQSA 1H4LA 4KIOA 3G90X 1H0VA 3DAJA 1NVRA 4BCOA 3R30A 5BMMA 4L9IA 5KBRA 3VBVA 2GNLA 3QCSA 4E5WA 3LPBA 3SAYA 3LMIA 4EOMA 3R22A 4TWNA 4IJPA 3ZSHA 2XYUA 5J9LA 2YLFA 4FG9A 4BDEA 5M51A 5GINE 3DZOA 2HAKA 4RVKA 1KV1A 2XVDA 3V04A 5LVMA 4BDFA 4EH9A 3H9RA 1PMEA 2QOLA 5TE0A 3GU5A 2A2AA 2B4SB 4O7LA 2H34A 3HZTA 3PVGA 2ITUA 2BUJA 4K33A 3BU3A 4D0WA 5KX8A 5C26A 4FTOA 4C3FA 3LFSA 1DI8A 2CGUA 3FBVA 3HMPA 3QL8A 3QCXA 2BAKA 3LQ8A 3OP5A 4NKSA 4OT5A 4A07A 1XH7A 3V8WA 3IONA 4GU9A 3D15A 1IA9A 4JDIA 4BYJA 2YIYA 4XP2A 2XM8A 3FE3A 1YDTE 5IQAA 4Y72A 5IQBA 1R78A 1YI4A 5JGDA 3PVUA 1YXTA 1XJDA 3O71A 3ITZA 4J98A 4CMTA 4AACA 4L46A 1NXKA 4BCKA 1YWNA 5JZJA 1PKGA 5AMNA 1H00A 1Q41A 3C4WA 4V0GA 4XCUA 5DIAA 5B0XA 4BGHA 4YU2A 3BRBA 2GTNA 2XRUA 3DXPA 3FMKA 4CRLA 4YBJA 3OOMA 2OW3A 5BVFA 3U6HA 4IBMA 3R8PA 2E9NA 4IFGA 4NM3A 3EZRA 3GFEA 5EI2A 2ITXA 5D7VA 5M57A 2PU8A 1CM8A 3UGCA 3CPBA 2I0YA 4MXCA 3R7IA 2WKMA 3ZSGA 3AMAA 4GVAA 4BDGA 3DDPA 2EXEA 3AGMA 3LFEA 1YW2A 3VWAA 4PPAA 3C4FA 1FGKA 1PXOA 3NUAA 3EQHA 4EL9A 4QP2A 3R7YA 3N4VA 4AXAA 4QT1A 5IA4A 2CDZA 3C50A 5DRDA 2YLEA 1PXLA 3PUPA 3PXYA 5E91A 1OL1A 1H27A 3VIDA 1SZMA 4EOJA 1Z9XA 1ZMWA 2C69A 3MS9A 1M2RA 4XG9A 5F94A 4Q9SA 3L9MA 3O7LD 2X8EA 2RG6A 2I0HA 2J0IA 4O7RA 3BELA 4NJDA 5TOZA 3SLSA 4E4MA 4L00A 4LM5A 4IXPA 4AQCA 3WIKA 4G1WA 3ZCLA 1WBOA 3Q9XA 4XYFA 3VUDA 2AYPA 2R2PA 3PFQA 3Q4ZA 5TF9A 2V62A 4U80A 4DEAA 2QOKA 4CTCA 4UZDA 5ICPA 2I40A 4MD7E 3F69A 5DE2A 3D2IA 5AUZA 4LMNA 2UZWE 4IACA 1Z5MA 4RJ8A 3V8TA 3V5WA 5L8LA 2YWVA 3VF9A 4YJRA 4ACCA 2O2UA 3B8RA 4B99A 2OJ9A 3SKCA 4RFZA 3PIYA 4N6YA 3D7TA 4U3ZA 1IEPA 2GHMA 2ZMCA 3UYSA 4CV9A 4BHZA 2ZM4A 3OZ6A 1BLXA 4FEQA 5T6KA 2IJMA 4CZYB 3DK7A 2OZAA 2PMLX 3JUHA 4OTPA 3VBQA 5AEPA 4BY9E 5CQWA 1TQMA 1W8CA 3E3BX 4FG8A 4MTAA 2GQRA 1B38A 4OTDA 2R7BA 3SC1A 1Q3WA 4G5JA 4NW6A 4HVGA 2PZPA 4H3BA 2CNQA 1M52A 3BHTA 3OMVA 2LAVA 4I92A 3W2QA 4FODA 4W9XA 2O3PA 3R8VA 3LE6A 4KRDA 4YTFA 4ANSA 2UW5A 3GCUA 3VS2A 4XOZA 1OIUA 5H9BA 4U7ZA 5DBXA 5CEIA 1U5QA 2FB8A 5BUIA 2HK5A 2YAAA 2HYYA 1M17A 3LJ2A 5KMIA 4F0FA 4C4FA 2HY81 4BCQA 3DKFA 3MPTA 4IE9A 1IR3A 4JQ7A 4OBOA 4BWPA 1OUYA 3QYWA 1ZXEA 3UP7A 4A4LA 4I6HA 4D2VA 5EYDA 4M0YA 3MH2A 5JKGA 3I81A 4DN5A 3VQHA 1YOJA 1WBTA 3NSZA 5FXRA 5A4CA 2A19B 3GQLA 5CNOA 3EQFA 4KNBA 4DH3A 1Y57A 3G15A 4FVRA 3T9IA 2VNWA 4JIKA 1PYEA 4U45A 3QD2B 2RFDA 2ITOA 3DAKA 5I9YA 3E62A 3OEFX 4UBAA 2R9SA 3KXXA 4BTKA 3HRFA 4I0RA 5EG3A 3SV0A 3I1AA 5AV4A 3ZRKA 5J79A 1UKHA 2WB8A 3EN9A 3VUTA 4XBRA 4Y46A 5GIOE 3V8SA 4AAAA 1OL2A 4RA5A 5F9EA 2R3LA 3WZDA 3TNWA 4D1SA 3V3VA 3EOCA 3VW8A 2YM4A 5B2MA 2RFSA 3G0EA 3K5UA 3UNZA 4F0IA 5CZIA 5CAQA 2W5HA 5LXMA 4XG7A 2PVJA 3H4JA 1F3MC 4ZTMA 5AUYA 3W8LA 4AA4A 2XH5A 4XJ0A 4XRJA 4CRSA 1VYWA 3ZO1A 2Z7QA 3QWJA 2GNJA 2WPAA 5EDQA 4R3CA 2PZRA 3OG7A 2CGWA 2OJGA 2W06A 3QZIA 4C61A 3BCEA 4ZOGA 4YJNA 2EXMA 5EOBA 5M44A 2QKRA 5KUPA 2F2CB 3QUDA 1QPJA 3TN8A 4FKLA 1OVEA 3UQGA 4Q5HA 2WTJA 3FLSA 4ZAUA 3BWFA 3Q5IA 5AA9A 3RHKA 4MXAA 5CXHA 3FHIA 3BI6A 3PE2A 3F3WA 3FSKA 4MYGA 2G01A 3H10A 4AOJA 2GMXA 4QMVA 3M11A 2JC6A 4ZTNA 4U40A 3S2PA 3R8LA 4R6VA 5ETFA 3L9PA 4PF4A 3GP0A 2J0KA 5CU3A 5HO8A 1JVPP 5AUUA 4N70A 2NRUA 4FT5A 4I22A 3UOKA 4L01A 3ZUTA 1GOLA 1B39A 3O8TA 3ERKA 4RIXB 3DB6A 3FSFA 5J9YA 2CLXA 3AC5A 4AE6A 2IZRA 3KN6A 5C1QB 2SRCA 3R0TA 4ITIA 2GQGA 3ZUUA 2IW9A 3ZBXA 4X3JA 1RJBA 3GOKA 1H0WA 4HNFA 4UXLA 3EQIA 5FQDC 5K0XA 3MDYA 3RK7A 4UV0A 2PUIA 3IK3A 3NIEA 4XG2A 2PVHA 1JKLA 1YDSE 2W0JA 1WBWA 5A4QA 5A54A 4JR7A 2XF0A 5L8KA 4OAUC 5M06A 5GIPE 5IUGA 2IZTA 3CTJA 2XK7A 5HIDA 2JGZA 4IADA 3DXQA 1STCE 3LJ0A 3Q96A 3KRJA 4J71A 2FSOX 4NSTA 1MQBA 5A9UA 3QTSA 3BEAA 4QQ5A 5KHXA 2Q0BA 3QRJA 3OTUA 2B9JA 4QMWA 4ORKA 4QQJA 4RJ7A 2J90A 3WF8A 2OU7A 3FY2A 4FSRA 1XQZA 1GJOA 1ZWSA 2C4GA 2JLDA 4NCTC 1ZZ2A 4TNDA 2VV9A 2W99B 3ULIA 4IB0A 2C6TA 2ZV9A 3VS0A 4IAIA 2XMYA 3EN5A 5EW9A 4JQ8A 2BHEA 3BLHA 4KIKB 4BZOA 2BALA 3C4EA 3VW6A 3I5NA 3OWPA 2QO2A 1OECA 1KOBA 3IW4A 3MY0A 2H8HA 2BDFA 3PG1A 3PXRA 3QTZA 3QTXA 4IM2A 3UYTA 4AZVA 1RQQA 2I6LA 2NRYA 2WMUA 4FKGA 3L8VA 4RX9A 4GG7A 1UV5A 2QG5A 2R0IA 4DINA 5BVNA 3A8WA 3PRFA 3AC3A 4GT5A 4UWBA 2ITTA 4RT7A 2WQOA 3JPVA 3GXLA 2BRMA 2VWVA 5HLNA 2VTTA 3LOKA 3BBWA 1GY3A 4PMMA 4HVDA 1NY3A 2JBOA 4GK3A 4RVMA 4HW7A 4ZZMA 5CTPA 5K0KA 3WZJA 4CVAA 3AC4A 4IMYA 3DLZA 1H07A 4B4LA 2YJRA 4ZLOA 4FI1A 5IA0A 4FIIA 3DJ5A 3CP9A 3ORNA 1J7LA 4BR3A 1YOMA 4K11A 4ACHA 5CS6A 3SW7A 2EXCX 2PVKA 2OJFE 4WA9A 4FSUA 5TT7A 3UE4A 5AX9A 3L9NA 4LOOA 5AAFA 4Y85A 3LFFA 5FLFA 3M2WA 3ZLWA 3HV3A 4NTTA 3UQCA 2VWYA 3LXKA 5E8WA 4RIYA 4FYOA 3JVSA 4GJ3A 3LLTA 5A4LA 4LQMA 2O0UA 4C38A 3BYOA 3TXOA 3AGLA 1W0XC 1Q99A 1ZYSA 2XIZA 4HPUE 3QBNA 3EQDA 3BQCA 3E8DA 3KXHA 4K18A 4ASZA 4DFNA 4LGHA 4NIFA 4Q5EA 1NW1A 3FZRA 4WD5A 3FDNA 4D28A 2UW8A 2YERA 4S2ZA 3B2TA 3NPCA 4U3YA 4BCPA 1KOAA 2WQMA 3OFMA 5DGZA 1JBPE 4NM5A 4F9CA 4FKTA 4ZK5A 2VO0A 1HOWA 2ZM1A 4NH1A 4WNMA 2JAMA 5F20A 4UZHA 5HI2A 2G15A 4RWKA 3I5ZA 4FKPA 4W4VA 5LWMA 1J7UA 2VWIA 3CD8A 5C9CA 3CSVA 3N51A 2JAVA 4E73A 1JQHA 5D10A 2X9FA 4QMXA 3DV3A 5IKWA 3C13A 1V1KA 2IVSA 1T46A 3P0MA 5ANIA 5ETCA 5I0BA 2WMTA 2CKPA 3LM5A 5BYLA 4DCAA 2P0CA 2PE2A 5BVEA 3TDVA 3NCZA 3G6HA 1QPDA 4YHJA 3A2CA 3GQIA 2UUEA 3HX4A 3RPRA 1ZYJA 2YCRA 5I9XA 5GZAA 5L6WL 5IA1A 2XCHA 2OH0E 3KMUA 4GS6A 4A9UA 3SDJA 4MCVA 2A4LA 1XH5A 3QWKA 4AN3A 1I09A 4YBKA 3FC2A 4GMYA 2YM5A 3OY1A 4KD1A 4D5KA 4CYJA 4YO6A 4IIRA 4C4IA 3HMMA 2FYSA 3BHVA 3O7LB 3ORMA 2JEDA 2P4IA 4MH7A 3PYYA 5D41A 3RINA 2X8IA 3FEGA 1MRYA 1A48A 1JSVA 2AC3A 5FTQA 5IA2A 3N4TA 3R21A 4HYUA 4R8QA 1S9JA 5KMJA 1H26A 2RIOA 4FKIA 3RBWA 3V5LA 3S95A 3AQVA 3PY0A 2VX0A 2OF2A 3GEQA 5CZHA 3KL8A 3QQUA 3FZOA 4R7HA 5IQGA 5FEQA 3ELJA 2VTLA 3FMLA 4FKJA 4O22A 4C2WA 4UX9A 3ZOSA 1NVSA 5CSXA 4FF8A 5C4KA 4YNEA 4FKUA 3MY1A 2G1TA 4UALA 3MN3A 4LOPA 4CLJA 1ZYCA 2YACA 2WOUA 3R2BA 4IWDA 4XV3A 3RKBA 3TKIA 2Q83A 4FKQA 2P2IA 3C0GA 5HBEA 2J5FA 4KWPA 3VUKA 4YJPA 5GJGA 4RQVA 5G1XA 1WBVA 4K8AA 2ETMA 3QQJA 4I94A 4YTHA 4FK3A 4S31A 3D94A 4ZS4A 5HTCA 5KZIA 4GU6A 4H3PA 4F0GA 3W2SA 2DS1A 3HDMA 5CVGA 1TQPA 4MQ2A 4K77A 3UOLA 4UMRA 2Z7RA 3QZGA 4JNWA 4TYJA 3EHAA 4OLIA 4O0RA 1ZMUA 3GENA 3QQKA 5DR9A 1J1CA 2XCKA 3RMFA 3TZ7A 4FSZA 4I93A 3QRIA 2VTNA 4C35A 2C5XA 3R28A 3FI3A 4BL1A 3PRIA 4O0YA 1LEZA 4ZJIA 4F1OA 4DF3A 3MTLA 4U43A 1Y6AA 5HBHA 4U0IA 4CG8A 2XB7A 3MY5A 4FTUA 4TZRA 1Q61A 1IAHA 2GFSA 3BYUA 3KXMA 4I1ZA 4Z7GA 2CNUA 3EZVA 2W1FA 2WMRA 2RG5A 3LCSA 1Q8YA 2R3IA 2VTSA 4WG4A 4DTBA 3PTGA 1GZNA 5FUTA 3NS9A 4BKYA 4HYSA 5H8EA 2QOCA 4DH8A 4C4GA 5JFXA 2PMNX 3EYHA 4CSVA 1VJYA 5A46A 2W4KA 2WTKB 3EFKA 4QMNA 4XH6A 2WTKC 4Z16A 3E3PA 5JFWA 2JDSA 1Q8TA 3O8PA 4HNIA 4A4OA 5HE0A 2J6MA 5DPVA 4D58A 4ZZOA 4NJ3A 1GNGA 3D7ZA 3NAYA 4U6RA 5AV0A 2IW6A 4BDKA 4D4VA 1L3RE 2OWBA 4EC8A 3KFAA 3FMEA 5KKRC 5CASA 1SVEA 2WTIA 2X81A 3FYJX 3O8UA 4IANA 5IQDA 3CS9A 4Y8DA 3VUHA 4UY9A 4G5PA 4FZDB 4ZP5A 5AP0A 5H3QA 4Z55A 2YABA 3NDMA 4YJUA 3ZO2A 3ZO4A 3HAVA 3EJ1A 5IQEA 2BFXA 2HZ4A 3AT4A 4XG3A 3UODA 5DG5A 5BX0A 3QA8A 3OBJA 4DH5A 3U55A 4IAFA 4J1RA 1W7HA 2ZDUA 1GAGA 2O8YA 4MF0A 1H01A 3HMOA 2XJ1A 1VYZA 3MGYA 1XHAA 3OW3A 4Y83A 4EOKA 1URCA 2C6DA 3FY0A 1Q24A 4PL5A 4JRVA 5K3YA 4E1ZA 1OBDA 1OPJA 3PZHA 3VS3A 4D9TA 4G16A 4BKZA 4WSQA 4CFXA 4FTMA 4M12A 5AP7A 5D9HA 2RF9A 3I4BA 4ZS0A 4G6LA 2PZYA 4UYNA 4N57A 4FTIA 5AP4A 3ZM4A 3IOPA 2XIXA 3Q60A 4ZY6A 3VUMA 1AD5A 4HVSA 4RWLA 5IA3A 5J87A 3TUCA 1Z57A 4XV1A 4GYIA 3FI8A 2F7EE 3OBGA 4HVIA 4ANOA 2J0LA 3LIJA 5AADA 1ZY5A 2PHKA 4AFEA 3E87A 2B9FA 4G9CA 3PY1A 5DLSA 5I3OA 1UKIA 5AP2A 2ZM3A 3R00A 1YXUA 5E8ZA 3MVHA 3TV7A 2ACXA 5HNIX 2WTDA 4PWNA 3RJCA 3ZH8A 2QHMA 3OHTA 3T8OA 3C0IA 2P33A 2VWZA 3DTWA 2XM9A 4CZUA 4AZTA 2X4ZA 3FMHA 4FSMA 3RNIA 4NL0A 4AW0A 5HTBA 2UZNA 3C9WA 4FVPA 5AFVA 4XV2A 5EK7A 4ZLYA 4Z3VA 3D5WA 4IB1A 1Q5KA 4FTLA 3QTRA 5JGBA 3HKOA 3QGWA 1H1RA 3LMGA 3ATTA 4X6RA 5J7HA 3ZU7A 3GVUA 4HVHA 3F3ZA 4ARKA 2IWIA 3C51A 3MFUA 2QVSE 4DLJA 3TTIA 5LMAA 3G9NA 3QU0A 2UZOA 3FV8A 3BV3A 3NZ0A 3PA4A 5C01A 4A9SA 4CQEA 2IZUA 4DEGA 4EK4A 5BVDA 5IPJA 2F7XE 2BVAA 5HZNA 4I24A 1XO2B 4GUBA 4NIFB 4AZWA 2YDJA 4NEUA 3WIGA 5HVYA 5IMEA 3LFDA 2YHVA 4PL4A 4AN9A 4E6QA 5KMNA 2YM3A 3QC9A 4JIAA 4O2PA 4FGRA 4RPVA 4EYJA 4EQMA 3W2RA 4X2KA 3KA0A 2UW7A 2WMWA 2XNNA 2C5NA 4F9AA 4M67A 3F61A 2B0QA 4J97A 3NYOA 3NGAA 2W1IA 3C0HA 5JFSA 3OUNB 4IVDA 4QYYA 5L2SA 3UIXA 1JWHA 4FEUA 2YIQA 5FTOA 4IC8A 4EOOA 3MIYA 4Y5QA 3Q52A 5D12A 2O64A 3NWWA 2C6EA 4L44A 4PP7A 3EN4A 3CD3A 3OS3A 1X8BA 4OR5A 3VBWA 3WBLA 4EH8A 5AAGA 3MI9A 4RIOA 1FINA 4ANBA 4YZ9A 5L2TA 1JSTA 5HX8A 2QD9A 4LGDA 5CEPA 3UOJA 2C5YA 5EQEA 1DAYA 1P14A 1YWVA 4X2FA 4NTSA 1GZ8A 2FGIA 3W2CA 2XKEA 4H58A 5CWZA 5DT4A 5EYKA 4E5AX 3WF7A 2W96B 3FZPA 4PDOA 2WU6A 3QRTA 4GL9A 1I44A 2X4FA 4J99A 4MBJA 4QMYA 4V04A 3VVHA 4GK2A 3UIMA 5J9ZA 3PVBA 4I20A 5M09A 2BDWA 2R5TA 3E64A 4QMLA 1CTPE 2V5QA 1M2PA 1VR2A 2GU8A 3KVXA 3NNXA 4D2RA 3LVPA 1FQ1B 4RIWA 2C5OA 4L42A 1LP4A 3DBDA 3LZBA 3JXWA 3QD3A 4PDPA 3IDBA 2ITQA 3A99A 3G33A 4CKIA 3DJ7A 4BDHA 1YI3A 5L6OA 4I0SA 1R39A 3DXNA 1UU8A 4C37A 4KB8A 3GUBA 4O2ZA 4ALUA 2A1AB 2GNGA 4D1ZA 5CSWA 4WOVA 3L8SA 3Q04A 5AP1A 3WE4A 1KV2A 2JD5A 4FIFA 4I6QA 4NM0A 4BN1A 4EUUA 4JQEA 2XKCA 4HYHA 3Q4CA 3VJOA 4F7SA 1NA7A 4MVFA 4YHFA 4X3FA 3U51A 1SNUA 4CD0A 5IG1A 2VWWA 3BYVA 2ZV2A 5AR7A 2B53A 3MFRA 4RC2A 3U54A 3Q6WA 1BUHA 2W05A 3F5PA 3GNIB 2KULA 3PWDA 4UXQA 4XX9A 3H9FA 3K3JA 2QKWB 4C62A 3CKWA 3M42A 3SQQA 5IZFA 1H08A 4M68A 5DFPA 1W84A 3LM0A 2YDKA 1PF8A 4E93A 4ONAA 2ONLC 4RJ5A 4AW1A 3JY9A 3KMMA 3C4XA 4G3FA 4YR8A 3ANRA 4OTRA 3V51A 4IB5A 1F5QA 3FKNA 3EWHA 3QKMA 1TVOA 4U97A 4ZZNA 4M84A 2ZV8A 2BKZA 4TN6A 2QI8A 5I9UA 2WIHA 3PPJA 4E5BA 5DRBA 1MRVA 1Y8GA 4K6ZA 3CGFA 4FTAA 4BZNA 4UYAA 2BZKB 4FL1A 4H3QA 3ENMA 3LFCA 4J96A 4LMUA 3EL7A 2GDOA 4UMUA 3ZC6A 1Q8UA 2QURA 2XNMA 3U9NA 4KS7A 4RVLA 2YZAA 2FSMX 2YEXA 3DBCA 4O0VA 4FTCA 2X2LA 2GFCA 3A7IA 3A8XA 2OFUA 5F95A 4EOPA 4TYEA 4IVBA 3MESA 3NYNA 5LOHA 4DEHA 4MKCA 1VEBA 5KMOA 3BV2A 4JJRA 4D2TA 2PPQA 4QTDA 2PVRA 2C0TA 2ITVA 4LUEA 2Y4IB 5J95A 3GBZA 4L53A 4G3DA 4IX5A 4BTMA 2Y4IC 4EK8A 2QOOA 4O0UA 2RGPA 5E1EA 4EHEA 3E8CA 3RVGA 4EQCA 3KCKA 3K3IA 4PPBA 1PJKA 3R7VA 4B8LA 2WQBA 1OL7A 3UNKA 2QONA 1PXIA 1ZYLA 3VJNA 3EN6A 5E4HA 3DKOA 4R77A 2OZOA 4TWCA 4W9WA 3OWKA 3MIAA 3ZXTA 4DGGA 5L3AA 4BICA 1PRYA 4BRXA 4CT1A 4AUAA 3D5VA 4LL0A 5E8VA 5BQ0A 4XNEA 3WI6A 2V55A 3OCSA 3O96A 3QTUA 3GC8A 3O2MA 3UOHA 4QNYA 4X2NA 3F7ZA 3DLSA 4KBAA 2QLUA 3D9VA 1Q4LA 4O86A 2VWXA 4BBFA 4BCFA 3R9RA 2OSCA 3OXZA 4YPSA 3V6SA 4PP9A 4RLKA 1U59A 5AM7A 1JAMA 3KRWA 4MNEA 4C34A 4EQUA 1OIYA 4RGJA 2E9UA 3QAME 3RK5A 3UNJA 3V6RA 2R0UA 3BWJA 4JBQA 3T3VA 3MFTA 3HGKA 1P4FA 2HZNA 3KXGA 4EHVA 3R71A 2Y9QA 2C3KA 4IAKA 1M7QA 3I7BA 5DNRA 2V22A 2XZSA 4FNYA 2WIPA 4OUCA 2FSTX 3KRXA 5B2KA 4U79A 3T3UA 4M3QA 5CU2A
chains in the Genus database with same CATH superfamily
4NKAA 4DFZE 2OF4A 1ZOEA 4FEVA 4F70A 3DBFA 3GCQA 5DR2A 4FIGA 5DT3A 2XS0A 4Z9LA 4EYMA 5AA8A 3TNQB 4OTGA 4E4LA 3TV4A 5I5ZA 4GKHA 4FT0A 3I7CA 4EJ7A 2VTMA 2R3KA 4O7NA 2VUWA 4M13A 4RX8A 1G8SA 2VO7A 4HJOA 4QTEA 2ERZE 3GCSA 3I6UA 3C4CA 4BYIA 5I9WA 4HCUA 4EBVA 4QP9A 5GZ9A 4QTCA 4QPSA 3ORLA 3AMBA 4FICA 5HO6A 2UVYA 4FNWA 1BX6A 4GW8A 5I3RA 3AMYA 3BGQA 4O4BB 2IVUA 3CJFA 3VN9A 3JR1A 2XEZA 3LXLA 3TDWA 2R3HA 5IISA 4CLIA 2EB3A 1OGUA 5ANGA 4AP7A 2F9GA 1E9HA 3A7GA 3JVRA 4V05A 4BCHA 1OKWA 2FSLX 3BE9A 4JMQA 5FDXA 3NYVA 4G2FA 1LEWA 2WMVA 3D5UA 5CF5A 3QKLA 3WF5A 4XV9A 3W32A 3R83A 5F4NA 4PNKA 3HYHA 4CMOA 2JKQA 5HE2A 3NUNA 3QHWA 4QQTA 5A6NA 5F1ZA 2C1AA 2WZJA 1PMUA 3ATSA 2BZHB 4FIEA 3FJQE 4IWOA 3TG1A 3KMWA 4QYEA 2V7AA 3ZBFA 4H36A 1SM2A 3PG3A 3TNHA 4AGCA 3F2RA 2OXXA 3SHEA 4L7SA 4QP4A 4YZBA 2HW7A 4HGSA 4MWIA 3FZ1A 5HU3A 3V5JA 4DT8A 1VLRA 2W1ZA 4BJJB 3VF8A 4BDCA 2GPHA 4F1TA 4F09A 1UWJA 2W1HA 4CQGA 3R8UA 3EH9A 1O6LA 3CGOA 4RWJA 4YTIA 1PXJA 2PE1A 1ZLTA 4CYIA 1ZRZA 3DCVA 5FG8A 5C8KA 2C6KA 4BC6A 4U42A 4YLKA 4R3RA 5FD2A 1K2PA 5AR4A 5AV3A 2GSFA 1OKVA 4FSTA 3QA0A 4C3PA 4RBLA 4TY1A 5LCKA 4RRVA 3CTHA 1CKIA 2ZAZA 3CKXA 3RCJA 5HKMA 5HVJA 3GB2A 3QLGA 2F2UA 5LCJA 2OGVA 2YISA 2YIXA 4I5CA 4ZSLA 3AC2A 3FL5A 1VZOA 5FBNC 4O6LA 2XIRA 2X2KA 3Q2MA 3THBA 2YIRA 4QP6A 2VTOA 3P1AA 4IZ7A 5ANJA 3CE3A 2NNWB 4G3CA 5HORA 5HGIA 4LDTA 3CY3A 3I79A 2IPXA 1NVQA 4WUNA 2BIYA 3A7JA 3QXOA 5ETAA 3G51A 2X2MA 3QF9A 3SRVA 4CFNA 3DQWA 4F9WA 3F5UA 4ASDA 4MK0A 2GHGA 4C33A 3LFBA 3GFWA 3A4OX 2VTRA 3QHRA 1G8AA 2XALA 1YDRE 4FT3A 4XUFA 1DS5A 2YCFA 4U44A 4BGGA 3RZBA 4DG3E 5A6OA 2G2FA 4KBCA 3SA0A 5ANKA 5FM3A 5AX3A 3UIBA 4BCJA 5FP6A 4DLIA 3ZFMA 2RL5A 2XAOA 4ANQA 3HRBA 1QMZA 4G31A 4ZTSA 2ZFYA 4RIWB 2DWBA 2XNOA 2ZB1A 4EH5A 1YKRA 4EH4A 2B54A 4J8MA 5CU0A 3KKVA 3EFLA 5EM5A 3TI1A 2OK1A 3ZLXA 1XH9A 3VULA 4W8EA 3Q6UA 3WYYA 1UVRA 3GCVA 4KAOA 3P23A 4EH3A 4TYHA 2QODA 2ITYA 4WO5A 2W1GA 1V0PA 2F49A 3NW6A 2PY3A 1YXVA 4CCUA 4XP3A 2F4JA 4NK9A 3COIA 3DDQA 4JG6A 3PSBA 4PMPA 2VO3A 2X6EA 3RAHA 3MVLA 2B55A 3OOGA 1PMNA 2VWBA 3E88A 2CGVA 3PPZA 2AUHA 3R1SA 1YRPA 4FKWA 4ITHA 4FVQA 3BBTB 3KC3A 4I41A 4JDHA 5EW8A 3MVJA 3P7BA 3FXZA 3FL4A 4NWMA 4XLVA 2IVVA 4EZ7A 4HPTE 5AWMA 4B8MA 5HU9A 3P5JC 4DFBA 1ZARA 3WF6A 4RQKA 5EYMA 5EOLA 3WOWA 2JIVA 5FTGA 3C7QA 4GUEA 4CFFA 2R7IA 1G8JA 4IM3A 4ACMA 4FBXA 4AS0A 4MAOA 1W83A 4Y5HA 4B6LA 3Q53A 2HZ0A 4FK6A 1P2AA 4S34A 3PJ3A 5KO1A 2JKMA 4APCA 4WSYA 4OTWA 4BDDA 5M08A 4AA5A 3F6XA 3F82A 3G9LX 4IHPA 4V0GB 3PLAE 4D4RA 3VONA 1QCFA 4LGGA 4AGDA 1CMKE 1QPEA 2WOTA 1FMKA 2EWAA 1R0EA 3LXNA 3TMOA 1GIIA 4TWOA 1B6CB 1KE9A 5T3QA 4BTJA 3QTQA 4IZ5A 3UZTA 2VGOA 2VWUA 2XP2A 4BKJA 5IEXA 3PIZA 2C3IB 4G3EA 4NM7A 5EHOA 2E9VA 3GGFA 4R7BA 3DKCA 5IUHA 5CAUA 2UZUE 1YQJA 4N6ZA 3QX4A 3HVCA 3IW5A 4JX3A 4MUQA 1BYGA 2W17A 4AGUA 3MWUA 5CI7A 4O7ZA 4GIIA 3BLRA 4FSYA 4BZDA 3ZEPA 1YWRA 1K9AA 3E93A 5DN3A 4IFCA 5ACBC 4A4XA 5DI1A 5I9ZA 2PVFA 2Y8OA 3D14A 1Y91A 4JX7A 3FWQA 5CI6A 5H8GA 5HCXA 4NW5A 3ZRMA 4AT4A 4AWIA 4DC2A 1J7IA 4E4NA 4CKRA 1URWA 4LL5A 2GNFA 4I3ZA 3LLAA 3ANQA 1P4OA 1BL6A 2ZJWA 4MBLA 5DR6A 2NYAA 4HGTA 2C6OA 5DWRA 1OBGA 4BBMA 5HG9A 2OICA 2W9FB 3NNVA 3U6JA 4JXFA 4QP1A 4MNEB 3PY3A 4M97A 4IWPA 3I0QA 3WILA 4FOBA 2QU6A 2VTHA 4QD6A 2WTWA 3D7TB 5IDNA 2XIKA 4WIHA 3P78A 3HA8A 1JKSA 1OUKA 2CKOA 4FUXA 5E9EA 3N4UA 3R8ZA 3PA3A 4F08A 4JG7A 5CQUA 4YMJA 3H30A 4FE2A 2PK9A 2OZAB 3DT1A 5JGAA 3RPSA 4L6QA 4UN0C 1YI6A 3MYGA 5E8UA 1KE6A 3NLBA 5KMLA 3NNWA 3MH0A 2IN6A 2GCDA 4GRBA 4ALVA 3FKOA 3JY0A 2R3PA 4F99A 5EI8A 5IEVA 1V0BA 2W5BA 4IC7A 4FKSA 4P5QA 5LMBA 4S30A 2VN9A 2YCSA 2W9ZB 2JKKA 2VTIA 3CQWA 3NUYA 4JVGA 1GIHA 1K3AA 4L52A 4NT4A 4WNPA 5AJQA 3CJGA 3TIZA 4FA2A 4EORA 4USEA 4BI2A 2UW4A 4J53A 5EM6A 3RTPA 3QLFA 1P5EA 1SNXA 3EFWA 4M0ZA 2VGPA 1QPCA 5IQIA 2Z7SA 3QC4A 4FV3A 4N0SA 3E8NA 2BZJA 2WHBA 3BU5A 3I60A 4IZYA 4C58A 3SVVA 3BHYA 5E7RA 5CU4A 1BI7A 3MA3A 5CT0A 3PA5A 4N4SA 4O0WA 4A9RA 5KMKA 3U4UA 3KU2A 2HIWA 2VU3A 2WXVA 4FSQA 2C0OA 2NP8A 3BKBA 3HV6A 2Y0AA 4CTBA 2XARA 3W1FA 2E9PA 4MXZA 3TACA 4A7CA 4YUQA 3NFGB 3OCTA 3HV4A 1UNHA 2XBAA 2OXDA 3OF0A 2XNGA 4WNOA 3UO4A 4RX5A 4DGMA 5FDPA 3TM0A 4EK5A 2CKEA 2W4OA 3IW7A 3AKLA 1XH6A 1DI9A 4LRMA 1JKKA 2YA9A 5AP6A 1O6KA 5FGKA 2I7QA 2OIDA 4KINA 4CEGA 4E7WA 2X7FA 1OITA 2UVZA 1BI8A 2GS6A 3NX8A 3ALNA 3E8EA 5CSVA 5D7AA 3JYAA 4ZSGA 5K4JA 2W4JA 3QD0A 4FTJA 3DFCB 1YHWA 3O5AA 4WG5A 4E4XA 4KKGA 4ENYA 4EOLA 5K4IA 5JSMA 3GC9A 3R8MA 4P90A 5DEYA 4ZTRA 1CSNA 5BMSA 3E7VA 3F5XA 2UZDA 3QALE 4MXOA 3QTIA 3JS2A 3KEXA 4GJ2A 4AXCA 3SXSA 2EU9A 5KKRB 4W8DA 4YC8A 1J3HA 3IW6A 2Y7JA 4JAIA 2IG7A 3FQHA 4FMQA 3NIZA 5AUXA 4TRLA 2XKDA 2FH9A 2WEVA 5M4FA 4KSQA 4DHFA 3AD5A 4X21A 3OWJA 3ZXZA 4NZWB 3ETAA 2QHNA 3F2AA 3O0GA 2XUUA 1AQ1A 4OBQA 2HWOA 4EONA 3WF9A 4O0SA 3UP2A 4BI0A 1BL7A 3P5KA 4O96A 5FEDA 3ZS5A 4YGAA 3A4PA 5G6VA 2WNTA 1ST0A 5HCZA 4RSSA 2E2BA 3SRVB 3TCPA 3QD4A 2CSNA 3KULA 2CKQA 3GU4A 1ND4A 2C47A 3EQPA 4AF3A 4AZEA 1Y6BA 4RFMA 1H28A 2IZSA 4LV8A 4OW8A 5CY3A 3R7UA 1RW8A 3UC3A 1REJA 4L3LA 3WZKA 2C6LA 2R3OA 3Q4UA 1MQ4A 4X7QA 4I23A 4ACGA 4BCMA 3LFQA 4RMZA 3ZLSA 3BQRA 1SMHA 3UDBA 3ZM9A 3IQ7A 4H39A 4P4CA 5DYJA 4AU8A 4HGLA 3RCDA 3FC1X 1UWHA 4CCBA 4D2PA 3DK6A 2O65A 5HG7A 5CAOA 1LR4A 4ID7A 5DHJA 4O7YA 2QC6A 2PL0A 3VS4A 4JBVA 1UA2A 3IS5A 5AUVA 4JG8A 5K9IA 5CAVA 3TNIA 3W0NA 3EQCA 4D0XA 2A27A 4UWYA 4L3PA 4DEDA 3PXZA 1E1VA 3L9LA 1TQIA 3SOCA 1Y8YA 1F0QA 3AT2A 4FV9A 2ITZA 4JRNA 5HICA 4AN2A 4O81A 4FSNA 3SG9A 2XBJA 3SXRA 3UO6A 3R9HA 2UW9A 4O38A 3PXKA 2OI4X 4EJNA 3KXZA 3U6IA 4ZJVA 2PVMA 3HV7A 3KRLA 5FXQA 5AAEA 4FL3A 3WARA 1HCKA 4BHNA 4JS8A 2QOHA 2VTQA 3RM6A 1A06A 3W16A 4ACDA 1XR1A 2X0OA 1OIRA 5FEEA 5HIBA 3UMXA 3GC0A 4QP8A 3ZO3A 2Z2WA 1EH4A 4GFGA 3MJ1A 2H96A 3O17A 5HD7A 3C5IA 4MD9E 4IEBA 5GJDA 3IDCA 3KQ7A 5HG5A 3MH1A 4EWQA 4ZMEA 2BRGA 3G5DA 2YZLA 1OL5A 2PZ5A 4KSPA 1DAWA 3ZONA 3C5UA 5LMKA 3UDSA 4AW2A 2CJMA 1OKZA 4UMPA 4ZY4A 5IMXA 4YJSA 3OW4A 3QQHA 4M8TA 2AC5A 4YZNA 1R3CA 2OIQA 3ORPA 5GZ8A 1XH8A 2XK9A 3BGPA 5M53A 3R1NA 2OXYA 4F64A 5JK3A 3NVMB 4F9YA 2HENA 5HBJA 4TW9A 2J50A 4RIYB 2ETKA 2Z8CA 2ITNA 1RDQE 5AIRA 4FV6A 2JDRA 3FZSA 4ZJJA 4DT9A 4XBUA 3VHKA 4GG5A 4U9AA 4OBPA 2OJJA 2GTMA 4YURA 4LYNA 5KNJA 2BAJA 1Q8WA 1YXXA 3TJDA 4ANMA 2G2HA 4ZY5A 5HTIA 4AXFA 2Y6MA 3AOXA 3OUKA 1SYKA 2X1NA 4DFXE 4BBEA 3LKMA 2O63A 5AUTA 4PDSA 5DMZA 2X6DA 3FZTA 4YP8A 5CANA 4IB3A 5HOAA 4FV2A 5KCVA 4QYHA 5H2UA 3R02A 4FNXA 4R5SA 3EL8A 4C57A 3KXNA 2UW3A 3FYKX 3PLSA 3R01A 3DBQA 3P7CA 4FZ6A 4O4EA 4TTHB 3W10A 4KABA 3UZRA 3CLYA 5M07A 4R1VA 3BX5A 1V0OA 1KSWA 2EVAA 2UZTA 3OY3A 4HCVA 3V01A 4IX4A 3DA6A 2RFNA 3PJ1A 3HL7A 3OVVA 3R2YA 2GHLA 5BVWA 4ZXTA 3P79A 1W98A 3BZ3A 2XEYA 4NUSA 3E7OA 3VBXA 4G3GA 1WVXA 1H1PA 1BMKA 5C27A 4RVTA 4RJ4A 2BRHA 3HECA 3OCBA 2R4BA 1W2CA 2QOQA 2IF8A 3UZPA 2O5KA 1OPLA 4L67A 3KF7A 4AZSA 2FA2A 1PY5A 3BEGA 2B7AA 2ZV7A 3KVWA 4H1JA 5HNBA 4D2SA 3IPHA 2YCQA 3RWQA 2UVXA 1APME 3EMGA 1GIJA 3Q5ZA 4O4CA 4RWIA 5M4CA 4FTRA 3F5GA 3BPRA 3ACJA 3ULZA 3VUIA 3REPA 3SOAA 2NO3A 3FAAA 2QU5A 3QX2A 4E6CA 5K5XA 5ANOA 3TV6A 2JDTA 3IKAA 3MPAA 4R7IA 4GIHA 2P55A 3DNEA 2X7OA 5DA3A 3AG9A 4AQKA 3V5TA 3Q3BA 5HD4A 5EDRA 3LJ1A 2CNVA 3KY2A 1YVJA 2BDJA 5TO8A 4PNIA 4C4HA 3QQLA 3SW4A 2QLQA 3HNGA 3VS6A 2WMSA 2XK4A 3MTFA 2B52A 2WMQA 4G17A 3TUDA 2PYWA 4O91A 2XYNA 4TNBA 3HMIA 4CV8A 3P9JA 2X0QA 5HLPA 3TL8A 3U87A 3LFNA 4EOSA 4P2KA 3M1SA 3P86A 2WD1A 4IVAA 4QPAA 4QMSA 5TR6A 3II5A 5FWKK 3SD0A 1Q3DA 3PP0A 3COMA 5H8BA 4F9BA 1OL6A 3TUBA 1S9IA 4RJ3A 4PMSA 1FGIA 3HLLA 4FV4A 3HDNA 4BIEA 3GU6A 2XA4A 4MNFA 4C4JA 2XRWA 4D4SA 3ZFXA 5AV1A 4NU1A 3RK9A 2Z7LA 3PJ8A 4IX3A 4J8NA 5JMSA 3RZFA 5GJFA 4TXCA 2QG7A 4PQNA 4EEVA 4FTTA 2ZYBA 3C1XA 3E5AA 3F2NA 1WFCA 2XKFA 4O82A 3P7AA 4NFNA 4DYMA 4FZ7A 1M2QA 4NCTA 3W0PA 5JQ5A 5A4EA 3UVRA 4YZMA 4JR3A 3EQGA 3UTOA 1GZOA 3MFSA 5CVHA 2J0MB 4FGBA 1R0PA 4GEOA 4WRGA 4QMQA 3FMMA 4KIKA 5EHYA 4YTCA 2J2IB 1PW2A 4EOIA 4IM0A 5DVRA 5HHWA 3LCDA 5HIEA 2CCHA 1T45A 3QCYA 5FBOA 4MBIA 2R3JA 3UBDA 3OXIA 4YJTA 4MXXA 3TWJA 3U4WA 5K5NA 3QUPA 3NRMA 5EH0A 4W4WA 3CC6A 3K5VA 1YHSA 3R63A 3ZLYA 4L45A 4U8ZA 2J51A 3DK3A 4DH1A 5CEOA 5CT7A 4ENXA 2CLQA 4O0TA 5HESA 4USDA 1WAKA 2PTKA 4YZDA 4NYEA 1PXMA 3IOKA 3KULB 3PZEA 3KGAA 3NUXA 5FP5A 1OI9A 4FTKA 4YLJA 4ZEGA 3FPQA 4K0YA 5L2QA 2R3MA 3FMNA 4IDTA 4IDVA 1U4DA 4BIBA 1BKXA 4EKKA 4BGQA 5JEBA 4M15A 3ORIA 3N9XA 2WO6A 4BI1A 4F65A 2CMWA 4BF2A 2XAMA 4WG3A 3AKJA 2WGJA 5JRSA 3AKKA 1CKJA 4ASXA 1OZ1A 2UZEA 5ITAA 2J9MA 3Q4TA 5EDPA 5IH4A 4PTEA 5L2IA 4R1YA 2JIIA 1Q8ZA 3D2KA 4XLIA 1ZY4A 2JBPA 2BILB 3HEGA 4FZFB 3NW5A 5E8TA 2VAGA 3RALA 3GU8A 3DFAA 3NUPA 5TKDA 3VC4A 4CXAA 4DHIB 5AR2A 5IDPA 4KIQA 1W2FA 3D4QA 4QTAA 2YM7A 2XANA 1IAJA 2YN8A 4GSBA 4DTKA 2C5VA 4KUJA 1JSUA 5IF1A 4JT3A 2R3GA 4DAWA 3MB6A 4BIDA 2CGXA 4FT7A 3TKHA 5EQYA 4QQCA 5HX6A 3TEIA 2UZLA 1UNLA 3R1QA 4JOAA 4LRKA 3KIOC 5IQCA 4ZSJA 3OC1A 3ZRLA 4DE4A 4HZRA 4Q9ZA 3F9NA 3PJCA 2B9HA 2XNEA 4JDJA 4BWKA 1H1SA 5BVKA 3PXQA 1E1XA 1YXSA 4PUZA 4YNOA 2QO7A 3FMJA 3ZZEA 3L8XA 4B7TA 3QGYA 4MEDA 5BUEA 4M69A 5KMMA 2VX3A 1YOLA 2DYLA 2PE0A 2YITA 3EIDA 4QRCA 5ANDA 3CR0A 1WBPA 5BYZA 2UV2A 3PSDA 1AGWA 2FO0A 5CF4A 3PE1A 5J5SA 5ANEA 3R04A 4X2JA 4BTFA 4IQ6A 2YM8A 5LMKC 2C0IA 4ASEA 3KB7A 3O50A 4I0TA 5L8JA 5LARA 4I21A 2UZBA 2ERKA 1KE8A 5IEYA 4O83A 5EKOA 1H8FA 2VTJA 2XNPA 4F6UA 4MWHA 1R1WA 2WMXA 4BDAA 2R64A 4XG4A 4JDKA 2XK3A 2Y4PA 3AD6A 4FT9A 4ERKA 3D5XA 4XP0A 3FLYA 4RA4A 4D1XA 2HWPA 4IAAA 1PKDA 4WRSA 3BYMA 1J1BA 3QZHA 4GT4A 2PZIA 3COHA 5L2WA 4YJQA 5M4UA 1KUTA 1O9UA 4DTAA 3W8QA 1J91A 4YC3A 2H6DA 3LCKA 5CEMA 3OEZA 1A9UA 4FV5A 3EB0A 4IWQA 4YHTA 2C30A 3CCNA 1U46A 3D83A 2WMAA 5C8NA 2REIA 3LQ5A 3SXFA 5CSPA 3FMDA 4OGRA 4UB7A 3PWYA 2QCSA 2PVYA 4A06A 1OPKA 2A0CX 4C8BA 2X9EA 4IH8A 3QFVA 2YWPA 2ZB0A 4LI5A 1CKPA 3AD4A 4HOKA 2P3GX 3MVMA 5T68A 3ACKA 2P2HA 4RZWA 5CU6A 3IGOA 4KBKA 3VBTA 4D4YA 3CIKA 4C36A 4TYGA 3NUUA 2I0EA 4U5JA 3ORTA 3QRKA 4KRCA 4M66A 1FBNA 3LQ3A 3VS1A 5CX9A 4EHZA 4FG7A 2PMOX 2ETRA 3HUBA 3W55A 5E8YA 3PPKA 4FRFA 3FQEA 4FTQA 3LFAA 3V5PA 1WBSA 3HP2A 3NUSA 5KE0A 4DGNA 3FLWA 3MJ2A 5A4TA 3D0EA 4QYGA 3NYXA 3UG1A 4RZVA 2CN8A 2F57A 4DEEA 3Q9YA 5B7VA 3CQUA 3I6WA 2GS2A 1FOTA 4FR4A 3BIZA 4EOQA 3IDPA 3RNYA 2C3JA 2JDVA 1PXNA 2OG8A 4AW5A 2HCKA 2DUVA 3ODZX 4FYNA 2WTCA 4ALWA 4ANNA 4WNKA 1ZMVA 4DFYA 5L6PA 2YDIA 2JFMA 4IVCA 4G6OA 4ZTLA 3UIUA 1REKA 3C4ZA 2CN5A 3KRRA 4QP7A 4DH7A 4O7TA 4FZAB 4FV7A 5M4IA 2XIYA 3AXWA 5AR8A 2C6MA 5ETIA 4CFMA 2WFYA 3KCFA 4YJVA 3QUEA 3FLZA 2BTSA 2LGCA 2V0DA 2XJ0A 4OTQA 3DAEA 5DT0A 4HZSA 3S4QA 3FI2A 4OTIA 3BHHA 4FV0A 4KKHA 4TT7A 4FTNA 2G2IA 4S33A 3ID6C 4X3FB 4TPTA 3B2WA 3NVKI 2XK8A 4X3FC 1L8TA 2C1BA 3NNUA 3W33A 3OWLA 1Q62A 3F7WA 3VHEA 4I5HA 1U54A 4D55A 2XJ2A 2HOGA 5J1WA 3EQRA 4R3PA 3GOPA 3WYXA 1IASA 2WTVA 2ITPA 3HV5A 3OT3A 4IW0A 4PTCA 2PULA 3HRCA 3Q32A 5FM2A 2GS7A 3VS7A 5IH6A 3H9OA 4QMZA 3LHJA 3IGGA 5ACKA 3VS5A 3DS6A 2Z60A 4C59A 2G9XA 2C3LA 2WMBA 3QQGA 1OMWA 5EHLA 2W1CA 4GV1A 4E6DA 3OTVA 4QMTA 3BL7A 4FSWA 4F7NA 4ZSEA 4PY1A 2BROA 3FHRA 4A9TA 2PUPA 3KF4A 5JN2A 2WQNA 2IVTA 4I4FA 5CLPA 5BPYA 4DBXA 2KTYA 4EBWA 4W4YA 4L7FA 4U41A 2ZVAA 4P5ZA 3RPYA 4WT6A 4GCJA 4MHAA 4WUAA 4EWHA 2J5EA 4CT2A 3HMNA 3MH3A 3VUGA 5IH5A 1WCCA 3ORXA 4WHZA 5CEQA 3R9NA 4C7TA 4CFVA 2C6IA 3BYSA 3ZEWA 4HCTA 4E26A 2QOIA 4YLLA 5CNNA 5LVLA 4ERWA 1PYXA 3MB7A 2OIBA 3QKKA 1H1QA 2V7OA 2BHHA 4M7IA 1IRKA 5EFQA 2VTPA 3K2LA 1U5RA 3QRUA 1JLUE 3ODYX 4RC3A 5M56A 3OT8A 1ZAOA 4KS8A 1OIQA 5E90A 3NMUF 4AOTA 4IAYA 4NFMA 5E8XA 5M55A 2QOFA 3QXPA 4QO9A 1XKKA 3TT0A 4QP3A 1O6YA 3PVWA 5IA5A 4EC9A 4GT3A 3PIXA 4DFLA 3MPMA 3PSCA 4FV1A 1FVRA 2RKUA 4X2GA 2OLCA 5J8IA 2W5AA 2OFVA 5E1SA 3ET7A 3KN5A 4FV8A 4X6QC 4FEWA 4QYFA 3GCPA 2CHLA 3LCOA 2VRXA 3O23A 3Q9ZA 4O4FA 4PL3A 2GQSA 1WZYA 4YC6A 4DDGA 4EH2A 5EI6A 2OKRA 4USFA 4GH2A 2R3QA 2QOBA 3U8WA 3NCGA 5AP5A 2EB2A 4JL9A 1MUOA 3G6GA 4DBNA 4RJ6A 3SGCA 5E92A 5AUWA 1QL6A 4PRJA 4O7VA 3RI1A 2C68A 3RGFA 3PP1A 2HY0A 1UU3A 1G5SA 3WZUA 3CTQA 3L1SA 4ZTHA 5EM7A 3COKA 5HCYA 4S32A 4BB4A 2F7ZE 4BDJA 2RSVA 2J7TA 1H25A 3F3TA 2YJSA 2CCIA 3RPVA 5CALA 3TKUA 4O27B 3R6XA 4KKEA 3ROCA 4D2WA 4ZMFA 4B9DA 3LCTA 3R7EA 4C3RA 4G6NA 4AG8A 2NPQA 2VO6A 2IO6A 4FC0A 4FIHA 1WMKA 2XK6A 1LUFA 2AEGA 1XBCA 2QO9A 4QMOA 2WELA 4EI4A 4XEYA 2J4ZA 2YM6A 4D5HA 4DGLC 3TIYA 4WBOA 5HEZA 3DY7A 4QNAA 5D11A 3TZMA 4H05A 5JT2A 5HE3A 4PMTA 3MW1A 4CMUA 1XMLA 5A14A 3F3UA 5EYCA 4F1MA 2BZIB 4JBPA 4P7EA 4FL2A 4AA0A 4K2RA 3VO3A 2OBJA 5HO7A 1XBAA 4LG4A 3NR9A 4M69B 3MA6A 2ZMDA 3BE2A 4C2VA 2W1EA 3FUPA 3S3IA 5HLWA 2VTAA 2HXQA 2EUFB 3MSSA 4II5A 3OD6X 3DOGA 5LVOA 5C4LA 5HQ0A 3E92A 3VAPA 5HVKA 3UVQA 1ZOGA 4AE9A 2PVLA 5CF8A 4GK4A 5KZ0A 4BDIA 4XOYA 2JITA 3QZFA 1UU9A 2WQEA 3L8PA 3RWPA 1LPUA 2BFYA 2BR1A 2OH4A 4LV5A 4DEBA 3GT8A 3DKGA 1KE7A 1W82A 3ALOA 3LAUA 1FVTA 3WZEA 2UW0A 3F88A 4MX9A 3EQBA 4O0XA 3IECA 4TWPA 4PV0A 4AT5A 1JOWB 2CPKE 3E63A 5JQ8A 4RC4A 4OAVB 3W18A 3LW0A 4YPDA 4MF1A 3SG8A 4ANLA 2X7GA 4CKJA 3SX9A 1WVYA 2YIWA 3DBEA 4UEUA 3ZC5A 1SVHA 4DEIA 5IU2A 2R3NA 1WVWA 4FNZA 4O84A 3CQEA 3V5QA 4XG6A 3MBLA 4AXEA 4M14A 4TKSA 5CSHA 5KHWA 4FOCA 4IX6A 2JFLA 5EKNA 3S0OA 3S1HA 2VZ6A 2BAQA 4G34A 5AIKA 4PDYA 3Q2JA 3H0YA 4GYGA 4O7SA 3MV5A 5DH3A 4BCGA 5C03A 4DCEA 1PHKA 3GU7A 4OTFA 2WEIA 2XNBA 4RX7A 5I4NA 1GZKA 3R9DA 4Y73A 2PWLA 3K54A 3BLAA 1Q97A 2ONLA 4J52A 4WKQA 3Q9WA 2HZIA 4LUDA 4ZTQA 3UO5A 2PSQA 2RFEA 4ZSAA 4FIJA 2PUNA 4MQ1A 4EH7A 4O7WA 4L43A 5AP3A 3BGZA 2B1PA 4TL0A 1YHVA 4BWXA 5JRQA 4I4EA 3HUCA 4EH6A 2X39A 3A61A 3VRZA 4V01A 3I0OA 4F6SA 2QR8A 5J1VA 3IW8A 2R3RA 4GFMA 4K1BA 4E20A 5LQFA 3NAXA 3TZ9A 4O1PA 4XHKB 2Y6OA 4QMPA 3A7HA 1IA8A 3B8QA 3ZYAA 1JPAA 3NW7A 4I5MA 3RPOA 3PFYA 3BLQA 4AOIA 2OJIA 5FXSA 5JZNA 4ZLZA 4CG9A 2HELA 4AT3A 2FVDA 3A7FA 3PXFA 1ZYDA 3HP5A 5CENA 3OCGA 3R9OA 4C02A 2GNIA