3ZO1A

The synthesis and evaluation of diazaspirocyclic protein kinase inhibitors
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
GSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Synthesis and evaluation of heteroaryl substituted diazaspirocycles as scaffolds to probe the ATP-binding site of protein kinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zo1A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zo1A02
4ZTSA 1XHAA 4RFZA 2C5VA 4IMYA 2XRUA 4EH7A 4AF3A 3HAMA 3Q9ZA 2XIKA 3FKLA 5DN3A 3MH0A 4P4CA 1H01A 3DGKA 3QCXA 4LOPA 3QHWA 4G5JA 3BU5A 4ZLYA 5KHXA 3Q2JA 4NUSA 1FBNA 5LWMA 3BGPA 3ENMA 4FUYA 4BCOA 4C61A 3DT1A 5CU6A 3C0IA 1O6YA 2GDOA 1BL7A 4MKCA 4ACDA 4J8NA 1RQQA 2IN6A 3MVMA 5HBJA 4FIEA 4C4EA 1IRKA 2VTAA 3FKOA 1YRPA 4JDIA 3I1AA 4XBUA 3BE9A 5EHOA 3ROCA 3DY7A 3H0YA 1U4DA 3OHTA 2PVNA 3PXYA 4GJ3A 5HO8A 4BYJA 5HIEA 3FEGA 3R8UA 2V0DA 3C4ZA 3NVKI 3BQRA 4GT5A 4WBBB 3GU4A 3CQUA 3QFVA 4KINA 1JKTA 4RVLA 3AMYA 2R3FA 3BYVA 3NSZA 4QP2A 5FDPA 3OCGA 4I5PA 4BCHA 3EQCA 3AXWA 3HA6A 3PIXA 4JAJA 4BDFA 2RFEA 1KE8A 2XKFA 4IW0A 5TOZA 5HCXA 5EW9A 4DYMA 3U6IA 5LVPA 4ZXTA 4GKIA 4AQCA 4M66A 2BFXA 3WF6A 1KE5A 1SVEA 2QHMA 3ULIA 4RIWB 1UKHA 4QOXA 5HTIA 5HD4A 5AR7A 2EUFB 3KU2A 3L9PA 3NYOA 3PXFA 4WNMA 1YKRA 4QP1A 5D9HA 4TW9A 5K0XA 4IDVA 4I4EA 1YW2A 1LUFA 2EWAA 5ANOA 4AOIA 1E9HA 3AT4A 3MFSA 4HVHA 3A62A 3SHEA 2YAAA 3FKNA 4KNBA 4EOQA 4F09A 5AIRA 4G2FA 4BGGA 4M7IA 5IQDA 4XH6A 1APME 4LRKA 1GJOA 3KULA 2Z7LA 1NA7A 4I3ZA 2ZV9A 5JFXA 4IAAA 4AUAA 5CASA 4YUQA 2UUEA 2OK1A 5IISA 3NUXA 4F6SA 2O8YA 3NLBA 4FTCA 4EOOA 3BGQA 4F9BA 4AFJA 4I6FA 5HX8A 4JBOA 3GNIB 1XBAA 4I5MA 3LFSA 3NUNA 4E93A 1QCFA 5EKOA 4D1XA 3WZEA 3BHYA 3SVVA 4I4FA 4YJNA 3GU7A 5CXZA 3PJCA 3NNWA 3TIYA 2QHNA 3I4BA 4NKSA 2DWBA 4O2ZA 2YZLA 4XG2A 2FB8A 1H25A 2HY0A 4JDHA 3A4PA 4TT7A 1H0VA 2PVLA 4XG8A 1Q8ZA 2UW4A 3E8CA 2PK9A 3PDTA 4BCFA 3EZVA 3NCGA 2UZLA 4IFGA 4QQ5A 4OBQA 5DMZA 3FYKX 4IAFA 3DKFA 4EUUA 5HZNA 4L46A 5J1WA 2WQOA 3A8WA 5JRQA 5LVMA 3IECA 3VC4A 4O0TA 4XCUA 4D2WA 4EH3A 4P2KA 5IPJA 3LCTA 3IGOA 2PE0A 1MQ4A 2WPAA 2G2FA 2QI8A 5DNRA 1YQJA 4KKHA 2QNJA 1QPCA 3VUHA 4FA2A 3OXZA 2WIPA 1Z9XA 1JQHA 2A2AA 4EH9A 2V7AA 5DE2A 4DH8A 5KMIA 4MK0A 4CYIA 4NIFB 3L1SA 3ERKA 4QMMA 2DYLA 5HOAA 2HW7A 2C68A 4FNZA 5DEWA 3JVSA 2FSOX 3K54A 4WBOA 4FKRA 4FEVA 3E62A 2W7XA 3KCFA 4IHPA 2W1EA 2ITUA 3DFAA 2UVYA 3MJ1A 3U87A 3CTQA 5AAEA 4PDSA 3TV7A 4DGNA 2FSMX 3C4WA 4FTNA 2I1MA 3AMBA 4GYIA 4L44A 4IM3A 3RK7A 2B7AA 4E5BA 5LXMA 4XUFA 3RHXA 4ZAUA 5IQCA 5EOLA 4CT1A 3DU8A 4FVQA 3TT0A 4W4YA 2C6EA 2R3QA 4JDJA 3RALA 3NUSA 4W8DA 3T3UA 4DG0E 4EOIA 5CTPA 3RNIA 4DITA 4YLKA 2YM4A 3MA3A 3OW4A 4O0YA 2GQRA 5K0KA 5DT3A 4GS6A 4YC6A 3UG2A 3QLFA 3UJGA 3VUMA 4ZSEA 3LQ8A 4H1JA 4LRMA 2WTDA 3I7CA 4ZS4A 2QOBA 5ACBC 3QQGA 2R3GA 4ANBA 1F0QA 4CZTA 1DAWA 3BQCA 4QMVA 3VHKA 3OOMA 4FKTA 4TYGA 5AEPA 4BIEA 1Y8YA 3QAME 5BYZA 2JBPA 2ZV2A 2QD9A 3NNUA 1REJA 2CLXA 3FMLA 3QTXA 5HTCA 3AOXA 1WBPA 2GNLA 5HU3A 4OBPA 4UALA 2UVZA 3EMGA 1YHWA 1ZZ2A 3MH2A 4XHKB 4G9RA 2VV9A 4CMOA 5E4HA 1TVOA 2E2BA 4AN2A 5K5NA 5A4EA 4F1MA 5L8KA 1QPDA 4FV6A 3P08A 5CT0A 4EH8A 3ZUTA 4CMTA 2X39A 3UE4A 2X81A 3UIXA 2BTRA 1PRYA 5JEBA 3UP7A 4O7VA 1R1WA 5JGBA 5FXQA 4PNIA 2A0CX 3QC9A 4GRBA 4F7JA 2DQ7X 5LARA 3FZPA 5M55A 2W96B 4G6OA 4FIGA 3OMVA 4G6LA 4FTKA 4C35A 1V0BA 4K2RA 3SXSA 4YNOA 3QQFA 4CV8A 4AZWA 3PE2A 2ITQA 1GOLA 5HNIX 2WTKC 1Q99A 5HCZA 4BCQA 3Q2MA 3EN7A 2X8EA 5GZAA 4I92A 1UU8A 4QTCA 2BRNA 5CVFA 3RPVA 4G6NA 3KRRA 2OICA 3GCQA 3N9XA 4AZFA 4BZDA 3Q52A 3G6HA 4FGRA 4HYSA 4QMNA 5E8XA 3MIAA 4P90A 5HG9A 1PY5A 2ITPA 3LXPA 3BBWA 4JG8A 4EOKA 3UZRA 2X7FA 2JIIA 2XZSA 3I5ZA 4YJRA 4ANMA 3HP5A 4ERKA 1H1PA 3O8TA 5HE3A 3QL8A 2W1DA 2YERA 4I94A 3M11A 1CKIA 4FSZA 3R04A 3BWFA 3KK9A 4NTSA 4LI5A 1Y6BA 2IZUA 2JAVA 2QU6A 3CS9A 4MQ1A 3UVRA 4CZUA 1UWHA 2VTJA 2NP8A 3FLQA 3MY0A 4JR7A 2YM5A 4LMNA 4C57A 2BPMA 4HYHA 4PTEA 3RM7A 4LGDA 2GNHA 1UKIA 4AOJA 3HRFA 5DLSA 3F3WA 4FR4A 4LYNA 5A9UA 2CNQA 2R4BA 3S4QA 4OTIA 4AT5A 4F9WA 5LVLA 3NYNA 4B0GA 3NS9A 3HUBA 5J9ZA 3UODA 4PL3A 4TWCA 3RBWA 2CMWA 2X7OA 3C0HA 3O7LD 3QTIA 3HMPA 2A27A 4CV9A 2UZOA 4BVUA 2CKPA 3G6GA 3GU8A 2BKZA 2B9HA 1GZOA 3PSCA 3RPOA 3OP5A 3VF9A 4Z55A 4DAWA 5IUHA 4ZTNA 2F7EE 2XNOA 5IQAA 3DXPA 3FBVA 4EOLA 4ZLZA 3FQEA 2BCJA 5AP4A 4DINA 3JUHA 3PVBA 2ESMA 4WG3A 3LCOA 4Z7GA 5BUJA 3ET7A 4IX5A 5DRBA 2PMIA 3JY0A 1ERKA 2PZIA 4KIKB 4MEDA 3ZRMA 2NRUA 3ZDIA 3B8QA 3A7HA 2ACXA 4BCIA 4ZZMA 2WTJA 4TYEA 4TYIA 1PHKA 3ZLSA 4AA4A 5E9EA 4EK5A 3VF8A 5HVYA 1O6KA 2ITYA 4F08A 4D4SA 1VJYA 2R3JA 3LXLA 4JBVA 4TWPA 4PV0A 3BU3A 3NPCA 4RWIA 2NNWB 2G2IA 2IZSA 3LFCA 3IS5A 5DT4A 4AT3A 4FEUA 3SG8A 3T9IA 3AD5A 1XR1A 3A2CA 3QCSA 1UU7A 2O64A 4CFFA 3NUAA 2X9FA 3PLSA 1AGWA 1FMOE 1Q62A 4CEGA 2QODA 4I20A 5HIBA 5M4UA 3DZQA 1FVTA 2KULA 3FZ1A 5C1QB 2WQBA 3FHRA 3CIKA 4J52A 4JL9A 4AZSA 4RX9A 4C02A 4YTFA 3NMUF 3ZM4A 4O27B 4GSBA 4ZTQA 3UZPA 3ZH8A 2UZEA 3PG1A 2GPHA 3MVHA 3K5VA 2CCIA 3U6JA 1V1KA 2QR8A 1A06A 4XLVA 4NU1A 4RJ7A 3KQ7A 2XYNA 1ZY4A 4O0UA 4PRJA 4RMZA 1UV5A 5CSWA 3ZUUA 3QZHA 4S32A 4FTRA 2WGJA 4OBOA 2B53A 4HGEA 4JR3A 3IK3A 4FYNA 2OFUA 3HA8A 3RK9A 4F9CA 5HTBA 3KK8A 5JFSA 1RW8A 3GBZA 1QPJA 1U5QA 2QOOA 3AT2A 3DLSA 4N6YA 3ZBFA 3F6XA 4G3FA 4ZSGA 5HO7A 3VS1A 3VS5A 5I9VA 3IQ7A 3QRIA 4FYOA 4IAIA 4ITHA 4J7BA 1H08A 4RGJA 2HIWA 5JGDA 2ZJWA 5CLPA 5AV2A 1YDTE 3FPQA 3R8PA 3UPZA 4QYFA 4H3QA 5JGAA 3R2YA 4M67A 3VULA 4R7BA 3JS2A 4QMTA 3G5DA 3LHJA 4GU6A 3HV4A 4RJ4A 3QX2A 4PL4A 4FE2A 1L8TA 4O86A 5AV4A 5C26A 4A4LA 2IZTA 2R3HA 2W1CA 2XCHA 2ZB0A 4M0YA 3R7EA 3R0TA 2UZWE 2OSCA 4RFYA 4DBXA 2OZAB 2I0HA 3LMHA 5C8NA 3DBQA 5FUTA 3GC7A 4DFUA 4LG4A 1OL2A 4JDKA 3OEZA 5FBNC 5E8UA 2QOHA 3GCVA 4E6AA 2R3IA 4WD5A 1XBCA 4PMMA 4X7QA 3HEGA 3ZONA 3MPMA 4U79A 2FSLX 4BDIA 4IWPA 5DGZA 3KXGA 4HYUA 4CCUA 3DBDA 5CAPA 3DAJA 4M13A 4W8EA 5BVKA 1ZMWA 4ZY5A 4NK9A 3FZOA 5AR8A 5EKNA 3U8WA 4MH7A 4FX3A 1OMWA 4GT3A 2B52A 2J0KA 3QALE 3RGFA 2PMOX 4IB3A 4K77A 4X3FA 4GFOA 4YPSA 5F95A 4YJQA 4L68A 5HBEA 4D58A 4ZK5A 4UMPA 5JMSA 2WMRA 4FTQA 2VTPA 3LW0A 3NZ0A 3UIUA 1Y91A 3F3TA 1EH4A 2BRHA 2WMAA 3MVJA 1W83A 4IB5A 4UX9A 4IZYA 3R8ZA 2Z8CA 3M1SA 4IACA 3R7YA 2I0EA 2C47A 5I9YA 5AP6A 3JY9A 1TQMA 2BZJA 3DK6A 2PZ5A 3WI6A 2CKEA 1TKIA 3LXNA 5LVNA 5H8GA 2PYWA 3QQLA 3HAVA 4IWDA 3EQPA 2W4OA 3C5UA 4QMLA 5L2IA 3QTRA 4DFZE 2CN5A 2XYUA 4D2PA 4H3BA 4U0IA 3DKGA 2Y6OA 4FV4A 3PG3A 1FOTA 2ITTA 5JQ8A 1RDQE 3VJOA 2QVSE 4X2JA 3FQSA 3FLYA 2NPQA 3H10A 2JFMA 2PUUA 4MYGA 5AADA 4O7WA 5I5ZA 4PMSA 4H05A 5JN2A 5IG1A 4IVDA 4BKJA 3Q4UA 4PP7A 3VRZA 4DEIA 4G3CA 2CNUA 4YZDA 3G9LX 5KMNA 3LM5A 2R2PA 4I41A 5DR6A 4ANSA 4ASDA 5I3RA 2QG5A 3CPBA 3R7IA 4CMUA 2JKKA 5L2WA 3BHUA 3EYGA 3NUPA 4Y46A 2VUWA 2X1NA 3QUDA 4TY1A 3KRLA 3EN4A 3W33A 4USFA 4IVBA 3LQ3A 2I0VA 5IQHA 4XG3A 1Q8TA 2FVDA 3ZSHA 3CTHA 4FZFB 5JFVA 4Z3VA 4PF4A 2OO8X 2R7IA 4FT5A 3QYWA 2XH5A 4WUAA 4YSMA 3PWYA 1Z5MA 3K3JA 4PTCA 1W98A 1OL7A 1FPUA 2C6IA 2VTMA 4IWOA 4MAOA 2YM6A 1YI6A 4HOKA 2GNIA 4BR3A 2C0TA 4IC8A 1W82A 4LMUA 5CS6A 5ETFA 4KIOA 3TNHA 3ZLXA 5DOSA 3ZRKA 5LCJA 4CKRA 3BLHA 1WVYA 4R3RA 1E1XA 5IMXA 4U5JA 5AA8A 4CFUA 5J1VA 3MWUA 4QQCA 2E9UA 5EQEA 2NO3A 2ZVAA 2J5EA 3FLZA 4U45A 4D2SA 4EC8A 2W1HA 3R1SA 5B2MA 5LMKA 3UNKA 3EQBA 4AW0A 4GG7A 2RL5A 3DB8A 3Q9WA 4ANNA 5FTGA 3B2TA 4D0XA 2VD5A 3ALOA 2VTOA 4UBAA 1M52A 4EYMA 3G33A 1UWJA 2PWLA 5EI8A 4KKGA 2YLEA 4AOTA 1WBSA 3QA0A 4OT6A 4RRVA 2JDSA 2YCQA 3BBTB 5J5SA 3JYAA 3UOKA 3CC6A 4E7WA 3D5XA 1YDSE 4TWOA 2XK9A 3NEWA 1OIUA 1DM2A 2UV2A 5AV1A 2IW9A 5K9IA 2W1IA 2CHLA 4L67A 4FKWA 2BZIB 2WB8A 2F2UA 2WEIA 1WVXA 4FI1A 1SNXA 5TT7A 2XM9A 2P2HA 2YDIA 3PY3A 5CENA 4GT4A 4FBXA 4ORKA 2W9FB 3L8XA 2J51A 4JVGA 4NM5A 3OD6X 3OXTA 4L7SA 3UO4A 3TCPA 5CEIA 4RQKA 3EKNA 4RIYA 3KMWA 3P5KA 2IJMA 3EQFA 3W2PA 3R22A 5T6KA 2PVYA 3UOLA 2VWZA 2G01A 3OROA 4ANQA 3PTGA 3GC0A 1ZOEA 2WMVA 3QD3A 4BN1A 1YVJA 3NYVA 4Q2AA 4M15A 2YDKA 4U42A 1ZZLA 1YXTA 3OUNB 3P7CA 3PXKA 3FY0A 4TYHB 3ZXZA 4BZNA 3BV3A 5CSHA 4FKVA 4IX6A 1TQIA 4FV9A 2BAKA 4MXZA 4N4SA 4UMQA 5M44A 4CRLA 4O83A 5DG5A 4QMQA 5DBXA 2F9GA 2GHGA 2JD5A 4FK3A 4AGWA 3GEQA 3QD0A 3UC3A 4AE9A 3F61A 4Y95A 4IEBA 1CTPE 3OBJA 5E8YA 3V5PA 4J71A 4EOJA 4QMPA 1CKPA 1QPEA 2EU9A 4Q5HA 2GMXA 4GFGA 2QKRA 4MWIA 4N6ZA 4Q5EA 4A9YA 4BL1A 4CKIA 5KCVA 3H9RA 4IVCA 4BB4A 4NH1A 1Y6AA 1YWNA 3I7BA 1BI8A 5GJFA 4JAIA 4X6QC 4PTGA 2XK3A 3QCQA 4QP3A 3IO7A 5B7VA 4HPUE 5IEVA 4ALWA 5IQEA 2XEZA 2HAKA 4N57A 4I6HA 4TPTA 5L3AA 4MNFA 4YZMA 3D7TB 4M84A 4WG4A 3FZRA 1PXNA 1ZWSA 4X2KA 4QNAA 4RIOA 4V04A 3E5AA 2F57A 5GJGA 3WILA 4DEAA 4E4LA 3UIMA 3BLRA 4FGBA 2WTVA 4Y72A 2GU8A 3LMGA 3THBA 4F6WA 3VW8A 1XKKA 3EWHA 4R3CA 3UMXA 4BBMA 3MB6A 4XV1A 3CBLA 2OH0E 4AU8A 2B55A 3PRIA 1PF8A 3O2MA 3S0OA 2VRXA 3EN6A 3ZLYA 5EDPA 4WNOA 5AFVA 3EQRA 1OUKA 4YO4A 3QQJA 3U6HA 4QTEA 2YACA 3LAUA 3GC9A 1YXSA 3QTQA 3OFMA 4TNDA 5CNOA 3ORKA 5HQ0A 4ID7A 4EK4A 2PPQA 3WZDA 1ZYLA 1UU3A 3NAYA 2XK7A 3O17A 2RG6A 4Y5QA 5G6VA 3KN5A 5D10A 3SQQA 2YHVA 1MRUA 3V5JA 2YIWA 5FM2A 2W17A 2BTSA 3F3ZA 4QTAA 3HV6A 3UG1A 5GIOE 5AP0A 4O2PA 3MFTA 5LCKA 2X0GA 3OW3A 2ZMCA 2ITOA 4MNEA 1LEZA 4PDYA 1OPKA 1WCCA 1NVSA 4EJ7A 5JQ5A 2Q83A 3QGYA 4YZ9A 3G51A 3UTOA 4LOQA 4XV3A 4BTJA 4FEQA 2W1FA 1HOWA 5EM8A 4NL0A 1KOBA 3TTIA 3U55A 5HLPA 3Q60A 3OTVA 4L00A 3EFKA 3ENHA 4FF8A 5DPVA 3DB6A 2UZVA 4JQ7A 5FP6A 5JFWA 4AN3A 2JKMA 3ATTA 1Q24A 2ITXA 4W4VA 4IZ5A 1Q8UA 1RE8A 2ETKA 3POOA 1PXIA 2A19B 4IJPA 1ZMVA 5DRDA 4EJNA 2JDVA 2XBAA 3LFEA 3ANRA 2QURA 2W9ZB 3BYSA 4PMTA 2PVRA 4FG9A 5AX3A 3QU0A 3LE6A 3CKWA 4OTHA 5DVRA 3W2RA 1XWSA 2CGUA 4O0SA 4C59A 1A9UA 1NVQA 3BE2A 2EXMA 4MVFA 2C5OA 4FZ7A 3BU6A 3PXZA 3AT3A 3R00A 3FMJA 2WQMA 3FMMA 3KGAA 3PY0A 4HGLA 4C36A 1NVRA 3DJ6A 3E8NA 3HLLA 4QYGA 2QOFA 3G9NA 1W8CA 4EQMA 2W1GA 2V5QA 3FHIA 4F9YA 4FTUA 5JZNA 4HVIA 3JPVA 2XNEA 4IVAA 5HU9A 5CQWA 3PVGA 4A9TA 2GFCA 4EI4A 4BWXA 3NW6A 2OXDA 4A9RA 3FDNA 3W1FA 3F5UA 4QMXA 2JDOA 2Y0AA 5A6OA 3UC4A 4CCBA 4K6ZA 5KUPA 1U54A 5HEZA 1Q8WA 5GZ9A 5D41A 3CLYA 3QCYA 4G3EA 4B8LA 1F5QA 4FSNA 3MB7A 2YCSA 4RC4A 4FV3A 4L6QA 5E8VA 5FDXA 2W06A 3DXQA 3BGZA 2RKUA 1JKLA 1PYEA 3BX5A 3R9RA 4XOZA 3O7LB 2OJJA 1ZYJA 3W8LA 3Q5IA 3R9NA 4IX4A 5AUZA 4CZYB 2XM8A 4PWNA 4BI1A 2VN9A 3GFEA 2VNWA 2JDTA 5BVDA 5LMAA 4QYYA 1ZXEA 4UWBA 4CFVA 1MRVA 4HJOA 2GNGA 4AA0A 2VO6A 5L2TA 3NX8A 4WSYA 4R6VA 2PUNA 4D9TA 4ZMEA 5EYCA 3E3PA 4PL5A 2WD1A 3UQCA 3HX4A 4K0YA 4V01A 5HLWA 5IZFA 5IQFA 4QQTA 4DCAA 2QOQA 3RKBA 4HCTA 3DK7A 3FYJX 3TDWA 2VX0A 5C03A 1JSVA 5M08A 2GNJA 1ZOHA 3FL4A 3R8LA 3N4UA 2UW0A 4F4PA 3Q53A 4KAOA 3MIYA 1ND4A 3OVVA 3CXWA 2RIOA 3ID6C 5KZ0A 2WMXA 4KBCA 3WZUA 3TKIA 2PVKA 2VWUA 1NXKA 4QPAA 3GCUA 4Y8DA 4BHZA 5LVOA 2VX3A 4XRLA 4R5SA 3VS6A 4U80A 4B6LA 3CJFA 2B9IA 1VYWA 1ZLTA 2R3RA 3L8SA 4RSSA 3F66A 3SXFA 1M2RA 2XIXA 2Y6MA 4OAUC 5GJDA 2O65A 3SW7A 2CKQA 5IQGA 2WFYA 5EHLA 4AAAA 5AUWA 2BDFA 2YITA 3VRYA 5M09A 4ACCA 2EB3A 3F5XA 5DT0A 4GV1A 2C6OA 2X4FA 3FZSA 4PUZA 2WQEA 3LCSA 2WHBA 3R9OA 2OF2A 4U41A 4U97A 3W18A 4ASXA 4ZSAA 1GNGA 3MW1A 4LRJA 5TR6A 3Q32A 3TZ7A 2FGIA 2R3NA 3EFWA 4FEWA 4FT3A 2VX1A 2CDZA 3VBTA 2GNFA 4TZRA 4U6RA 4YR8A 3PZEA 4J97A 4IQ6A 4NFMA 3RZBA 1FQ1B 2BROA 4FIIA 5BYLA 3MY1A 4M69A 4PX6A 4FVRA 3TNPC 2VGPA 5AR3A 4B4LA 3TUCA 4D1SA 2OF4A 3R9DA 4FTAA 4DTBA 2X8DA 4IC7A 5FQDC 5IA5A 1U59A 4TL0A 2BR1A 3AC8A 4FICA 3EZRA 2C0OA 3M2WA 4IBMA 5HIDA 5AP3A 2YJSA 4C3FA 4LGHA 1IASA 1CSNA 2ONLA 4LQMA 4QPMA 4OLIA 3RZFA 4S33A 4FKSA 4LUEA 3SX9A 5FEEA 1G8AA 4EHZA 3RAWA 4APPA 3D0EA 1XO2B 3G0EA 3LFBA 1DS5A 5L2QA 3VUKA 5DIAA 4AACA 5H3QA 3QHRA 2GTMA 3D14A 3VUGA 2VTNA 3II5A 4C3PA 4F65A 2ZB1A 1WAKA 5A3XA 5EI2A 1OL5A 1PMNA 3QTUA 4CQEA 4AA5A 3LM0A 4I22A 3QWJA 4I5HA 4X2NA 4I93A 5BVWA 1NW1A 4DLJA 2XB7A 5C4LA 4JI9A 3W8QA 3B2WA 3S1HA 3KULB 2PHKA 4MCVA 3NDMA 1VEBA 4RWJA 4A06A 4R7IA 4XJ0A 1K9AA 2C4GA 4PPBA 1Q8YA 3S3IA 3GI3A 5AV3A 4EEVA 1G8SA 4KRDA 4DH7A 3BHVA 3R7GA 3WE4A 2J0IA 3HV5A 3RMFA 4BCGA 2EXCX 3F5GA 4PDPA 3TI1A 2Y9QA 4BIDA 4RLKA 2A4LA 4USDA 2BDJA 3EL8A 5M56A 5CY3A 2XKCA 5F4NA 5E8SA 2QR7A 5J9YA 3NVMB 1UNGA 5I9WA 3IOKA 4KIKA 4F1TA 4FKGA 2XJ0A 5CWZA 4EBWA 5EG3A 4NZWB 2W4JA 4DT9A 1YXXA 2VO0A 2VWWA 5EYKA 2I40A 3NCZA 4EKKA 4TN6A 2OXXA 3QQKA 4YJSA 5J7BA 4O0XA 2H6DA 1S9IA 5AUXA 5GHVA 2WXVA 3D2IA 2YWVA 1P14A 4NSTA 3LJ2A 4XG7A 4EZ5A 5AA9A 4DN5A 3CCNA 4FG7A 4D2TA 3OWJA 2O0UA 4FSMA 2H96A 3AC2A 4NTTA 4MXOA 4CD0A 1BI7A 3AGLA 2ETRA 5KNJA 5L6OA 4BYIA 4ENXA 4O7LA 3QRJA 2J2IB 2W5AA 1GIJA 4EHEA 2R3MA 4DT8A 5D11A 2ITVA 5AUYA 1UU9A 3GOPA 1SNUA 1PMVA 2PE2A 4I23A 5AUVA 5BYYA 2YLFA 3MESA 3HDMA 3EN5A 2GTNA 3QQHA 3WIGA 5CVHA 3P23A 4F9AA 5LOHA 4AE6A 2PVJA 5CT7A 4AXAA 1P4FA 2JKQA 2YWPA 1PW2A 3VQHA 2YIRA 5EK7A 3RI1A 4U3ZA 4FV0A 4B99A 2OG8A 3I0OA 2Z2WA 5CZIA 3ORMA 1J91A 2C69A 2C3LA 4XNEA 4CNHA 4OTGA 3UGCA 4FSQA 1JBPE 1M14A 4BDGA 4C34A 2PZYA 4MD8E 4OW8A 5ANEA 2QCSA 5EW8A 5LQFA 1YXUA 3UMWA 4BHNA 4MXYA 4CFXA 3EOCA 4HNIA 2X2MA 4DEHA 3LJ1A 3PPZA 4FEXA 3I81A 5C8MA 2HZNA 3NUUA 4RLLA 3NRMA 3LFFA 3EYHA 2PUPA 3DBFA 4M12A 1URCA 4BTFA 1JAMA 2BZKB 5M4FA 3FE3A 3FZTA 4XS2A 4EOSA 3F2RA 1B6CB 4DGOA 2BIYA 5CAOA 1OIYA 1IA8A 3ETAA 1SYKA 3KXHA 3RCJA 4QMWA 3I6WA 3ZHPC 4F0GA 3MBLA 3QKKA 4FSRA 3BKBA 3QZIA 1WVWA 3AQVA 2HWPA 4GMYA 4UB7A 3R7VA 5IUIA 2GCDA 3IW7A 4L45A 5CANA 5FWKK 3ZDUA 4XP3A 3WF9A 4P7EA 4KUJA 2CGXA 5A6NA 2WKMA 3GCPA 1K2PA 3P78A 5K4JA 4A7CA 2RFDA 3CEKA 4RWKA 3KEXA 3LPBA 3HKOA 4Y5HA 1IEPA 3REPA 4RX5A 4ZJVA 2XUUA 1J3HA 4R78A 5FP5A 1OPLA 3SG9A 4KSQA 3WF7A 1KE6A 3HECA 4BCPA 4RG0A 4RVTA 5HGIA 3TM0A 5B0XA 2YM3A 4B8MA 2JFLA 4F63A 4YBKA 3MTLA 2V22A 5BVEA 5FRIA 1ZYCA 3LFNA 3VS3A 3K2LA 4YPDA 4O7NA 4FOCA 1OKWA 3KMUA 3CGFA 4NCTC 5EW3A 5HD7A 1WBTA 3BCEA 1X8BA 3R71A 3UO5A 3PIZA 4RIXA 4YBJA 3EL7A 5K4IA 2PZRA 2CGVA 3MVLA 5IDNA 2XK4A 1J1BA 4B9DA 1T45A 1IA9A 4XV2A 3DTCA 1SVHA 3S95A 2ZMDA 3HMIA 4WIHA 1H1RA 3QGWA 4O7TA 4J1RA 4NKAA 2HZ4A 2RF9A 1W0XC 1BMKA 3V51A 3P7AA 3WZJA 4J98A 2XK8A 4MBIA 2ERKA 5J8IA 4BRXA 3P9JA 1PMEA 4UMTA 4FL1A 4O82A 3SW4A 2OFVA 3IGGA 4FZDB 1MUOA 4D0WA 3FPMA 3FJQE 4L42A 4E20A 3KREA 3ORIA 5M53A 2GFSA 3KCKA 4NJDA 2YEXA 3V5TA 3ODYX 4EL9A 3SOCA 4F99A 4FV5A 4K33A 1ZAOA 3OOGA 4L3LA 4ZMFA 4G9CA 4I21A 5AIKA 3TXOA 4DFLA 5H2UA 5CF4A 4O7ZA 4RQVA 2C3IB 1H1WA 4U9AA 3IDPA 2J4ZA 2VWBA 3UNJA 5AP5A 2C3KA 3EFLA 3QD4A 4GW8A 3FLWA 5J95A 1OKYA 1WBVA 5FBOA 3ZUVA 4YP8A 1OBDA 4GUEA 3GUBA 2C30A 3CQEA 5CALA 3HMNA 4AGUA 2HCKA 4H1MA 4CFMA 4CT2A 2XF0A 4HZSA 5DEYA 4FNWA 3IPHA 3GOKA 3KVXA 3D2KA 1P5EA 4BDAA 1ZYSA 4HCVA 4KABA 3VBYA 3TUDA 4GKHA 4XYFA 4TKSA 2YA9A 1YOMA 2R9SA 4V0GA 1PXMA 2WU6A 3LCKA 5CNNA 2PU8A 2IW8A 4DFXE 4FKOA 3CD8A 4O7RA 2FH9A 3ZC5A 2JC6A 3LQ5A 2B1PA 3C4EA 3E7OA 3FSKA 2YIXA 5ITAA 1M17A 3V5WA 4UZDA 3UVPA 3NW5A 3HP2A 4CXAA 2P2IA 1ZYDA 1LR4A 3ZSIA 1REKA 2ZAZA 2C6KA 2OU7A 2BRMA 3M42A 4R1YA 3W16A 4EKLA 1ZY5A 2WTIA 4C3RA 1M7QA 2BRBA 2W0JA 3A7IA 1GAGA 4IX3A 3ZM9A 4LV8A 4E26A 2XA4A 4RWLA 4V05A 2GS2A 2DS1A 3N4VA 2J50A 3UIBA 4YJVA 2XIYA 4E5WA 2C5NA 4II5A 5T3QA 4FZAB 2YDJA 3OC1A 4JG6A 3SOAA 3VN9A 4CLIA 2R0IA 5B2LA 5AWMA 4C4FA 4DCEA 4DE4A 2BMCA 3U4UA 2NRYA 4ENYA 4IJ9A 3TNQB 1K3AA 4O38A 2FSTX 2ZM1A 4FKJA 4C7TA 4GL9A 1J7LA 3MA6A 4WT6A 4FV8A 4YTHA 5IUGA 4JRVA 2EVAA 3PVWA 1QL6A 2QOCA 3W55A 2C6DA 3ATSA 3ORTA 3RCDA 2YFXA 2VZ6A 4CQGA 1SMHA 2PVHA 3D7ZA 4AN9A 2OIQA 3DKCA 4HGSA 2UZUE 3W32A 4D55A 5IA2A 5IA4A 4E4MA 3C4FA 4H58A 3PYYA 1JOWB 4FOBA 2P3GX 5CI7A 4O22A 3BELA 3BEGA 4ZJIA 5I3OA 4TXCA 5KMKA 3QA8A 3ULZA 3LXKA 3QXPA 5E91A 2JAMA 4IAYA 3PFQA 4FIFA 3DJ7A 4LL0A 4C4HA 3LMIA 4RFMA 4QMZA 2XJ1A 3CJGA 2AUHA 3O8UA 3DQWA 3FWQA 4J95A 3RWQA 3QUEA 4GVJA 1O9UA 3A7GA 5L8JA 2OZOA 2WMSA 4NM7A 4X0MA 5IA3A 4L7FA 1OM1A 4QRCA 2R3PA 1OGUA 3OEFX 4O21A 5M51A 3PXQA 3GU5A 2JGZA 4EORA 2XK6A 3OWKA 4TWNA 1H24A 4YTCA 3OCTA 5CF5A 1MQBA 3FXXA 3AD4A 3RINA 4OTDA 3GQIA 2R5TA 3UQFA 5CXHA 3TZMA 2OLCA 4LOOA 4YZCA 4AGDA 2P4IA 3WF5A 4HYIA 3BYOA 3PJ1A 3P7BA 5J7HA 3EHAA 3D7TA 1WBNA 5I4NA 2WTWA 2CN8A 4YNEA 4KS7A 5ACKA 1J7UA 3CY2A 2UZNA 4NFNA 4FV2A 1IG1A 3LJ0A 3QXOA 4KKEA 1DAYA 2ZDUA 4KRCA 4QMYA 4BCKA 2C1BA 3H0ZA 4L52A 4H36A 5AJQA 3VBVA 3E87A 5IKWA 3IW6A 3QF9A 1J1CA 3QTZA 4JIKA 3ODZX 4HW7A 2BHHA 4IZ7A 3COIA 1GZ8A 4EC9A 4MXCA 2Q0NA 4F0IA 5DH3A 4CG9A 5IA0A 1AD5A 3SRVB 3COHA 2G9XA 4FTTA 3R21A 4EWQA 2WTCA 4NJ3A 5CQUA 3CPCA 2OJIA 3O8PA 4DH5A 5CEOA 3VS2A 4XG9A 5EQYA 5AR5A 2OI4X 4MD7E 3CD3A 3R8MA 3LFQA 1P2AA 2IW6A 2B9JA 4FTIA 5AR4A 4Y83A 2PVFA 4KIQA 5CU2A 3FMDA 5TE0A 2O3PA 5CU4A 3TJDA 3U4WA 4H39A 5DWRA 4QT1A 4D4RA 1JNKA 2QLUA 3C7QA 5GNKA 1G3NA 4OTFA 3OT3A 1W7HA 3EQHA 4I0RA 5HE1A 3T8OA 1H26A 4YSJA 1SZMA 2SRCA 3DAKA 5BUEA 4HVDA 1CDKA 2C6TA 4O0RA 3OCBA 3A60A 4J53A 3VW6A 3DDQA 4QYHA 4HVGA 4M14A 3K3IA 3PJ2A 2HK5A 3KB7A 4BIBA 4J99A 5GIPE 4EK3A 1YDRE 4KD1A 2UW8A 2XNBA 2ZM3A 5FXSA 2HXLA 4I5CA 4GFMA 5I0BA 3FL5A 4USEA 1A48A 2F7XE 3GU6A 5IQIA 2BDWA 2Z60A 3FXWA 3VBWA 4MBJA 3F3UA 4WNKA 4CSVA 2UW6A 1UNLA 2QONA 3FC1X 1GY3A 4OT5A 2ITZA 3KVWA 3TDVA 4UMRA 3F3VA 3LFAA 3ZOSA 1H28A 2UZBA 5IH6A 1IAJA 3E64A 2J0LA 3KC3A 3Q3BA 2P0CA 3C9WA 4J96A 4ZJJA 4WRGA 3W2CA 3ZCLA 3D9VA 4BZOA 2XNNA 3DS6A 3EIDA 3DJ5A 3QTSA 2VTRA 4WKQA 2OIDA 3RVGA 1JSUA 5EQPA 4BY9E 2QU5A 1H00A 2BAQA 4ZSJA 3D5UA 2YABA 3N51A 4NW5A 3ZO4A 4FKIA 1Q97A 1WZYA 4R5YA 3FUPA 3OTUA 2VO3A 3BWJA 4I6BA 3OBGA 3MFUA 2Q0BA 5EDRA 2X2KA 3DXNA 1KE9A 3RWPA 4HPTE 4ZTRA 4DFNA 4JJRA 4RC2A 4QP7A 5HVKA 3EB0A 4EH6A 4QMOA 2XIZA 2XNPA 5CZHA 2HZ0A 2ZV8A 4RIWA 1DI9A 2QOKA 3WBLA 4XG4A 3PSDA 2UW7A 5DR2A 1GZNA 3ZO3A 5C9CA 2EXEA 2GHMA 4FSUA 4RJ6A 3OCSA 2B54A 5I9ZA 3NR9A 3CQWA 3VIDA 4EZ3A 4E6CA 4WRSA 3VO3A 2PZPA 2JIVA 1VYZA 5B2KA 4BDEA 4O0WA 3HMOA 3LLAA 4UZHA 5AMNA 2YZAA 2QG7A 2HYYA 4DTKA 4YHJA 1PKGA 4FG8A 5FEQA 4D2RA 2HY81 2R7BA 4F70A 3DA6A 1SVGA 3Q04A 4AW5A 3MPTA 4YZNA 4MTAA 3E63A 5EI6A 1PXKA 4OGRA 2PUIA 2IVVA 1S9JA 3D83A 4RIYB 4GU9A 4B7TA 2OH4A 3O0GA 5JK3A 2GQSA 1BL6A 1Q41A 3ZTXA 3FMKA 3GB2A 4A9SA 4QP8A 5ICPA 2XVDA 3MV5A 5D7VA 4DEEA 2C5XA 4DHFA 2WOTA 5JH6A 5EM6A 4BDJA 3BRBA 4JBPA 2XP2A 4AS0A 4NW6A 3UP2A 4ARKA 4G31A 4NM3A 2W1ZA 3KN6A 4CTBA 3HL7A 4OTRA 3V8TA 4AT4A 5BX0A 2YIYA 4JLCA 3R28A 4GCJA 5CAVA 4P5ZA 3S00A 2VWVA 2UVXA 3DZOA 4HVSA 3H30A 3HRCA 1OVEA 3PUPA 5FG8A 1URWA 1B38A 2C6MA 3HNGA 4GEOA 3PVUA 1DI8A 3FC2A 4DFYA 3RM6A 3HV3A 2RFSA 4KWPA 4WG5A 1PXOA 2G15A 2VAGA 2XMYA 1R0PA 3ORPA 5K3YA 2HZIA 2FUMA 4AW1A 5CSPA 2BFYA 3PY1A 4MXAA 5HCYA 4R1VA 3R7OA 3G90X 2UW3A 4NIFA 3U9CA 4OUCA 5AX9A 1IAHA 3KXZA 3QRKA 5E8WA 3V5LA 3CTJA 3WYYA 3DTWA 1OUYA 3FMEA 2J7TA 4PDOA 3SDJA 2XKEA 3UYTA 5KHWA 5L8LA 1CKJA 4MBLA 4DGLC 2I0YA 5IDPA 2W05A 4UYAA 1T46A 4C0TA 3PP1A 4MXXA 1OKVA 4W4XA 3AD6A 1XH9A 4E73A 3AGMA 1M7NA 3FI3A 3KKVA 5AP1A 3PJ8A 3PA3A 4YTIA 3I6UA 2HENA 5E1SA 3POZA 3LKMA 4O91A 4ALVA 4ZIMA 1FVVA 5KBQA 1PXPA 3UNZA 3IONA 3JXWA 5IA1A 3OY1A 1IR3A 3V6RA 4QO9A 1R3CA 5KZIA 3ITZA 3V6SA 4QP6A 3C51A 5ANGA 3SC1A 3R30A 4G16A 3DAEA 4UY9A 4CRSA 4IAKA 4F7SA 4LGGA 3PZHA 3IDCA 2YAKA 3A4OX 4IDTA 1OBGA 4FT7A 4C62A 3E92A 4N0SA 4DG2E 4O1OA 4ANLA 5AM7A 3Q6UA 2OIBA 3DQXA 4FKQA 4RVKA 3TWJA 4BTMA 2E9VA 3R1NA 4X2FA 4RJ8A 5ANKA 3CR0A 4AFEA 5EM5A 2QLQA 3DBEA 5AM6A 4FIJA 2GS6A 3ZC6A 3QLGA 4U8ZA 3TEIA 3O96A 5I9UA 5HBHA 3ZS5A 5ANJA 3QRTA 5L6PA 2BIKB 2BALA 3FLNC 5CVGA 4GK2A 3R1YA 3N4TA 1W84A 4MNEB 4BTKA 3RNYA 3MH3A 4XMOA 3A7JA 1JPAA 3MJ2A 4OTQA 3ZEPA 3CP9A 5EM7A 4RT7A 1UVRA 4ZTHA 1YXVA 5CSXA 3ZXTA 2Z7SA 2ITNA 4ANOA 2QOLA 5E92A 4JS8A 2VTQA 4YHFA 4W9XA 1OL6A 4EONA 2X4ZA 4F64A 4AGCA 3MPAA 4O6LA 1XBBA 5HO6A 3V04A 3UO6A 3WYXA 5HG8A 4L3PA 1KUTA 3V3VA 3TV4A 1KOAA 4JOAA 4WO5A 4IXPA 4C4JA 4PNKA 3SGCA 2W99B 1JKKA 3GP0A 3L9NA 4JQEA 5GZ8A 4F7LA 4QTDA 3IW5A 4FC0A 1PMUA 2W5HA 1YHSA 2IVSA 2A1AB 3H4JA 3IDBA 5IH5A 4WOVA 4IE9A 4AX8A 3IW8A 5A14A 1UA2A 3C4XA 4P5QA 5TKDA 2ZOQA 4APCA 4EK6A 2PTKA 5BVFA 2VO7A 3CKXA 2KTYA 3D15A 2BILB 1WFCA 2WZJA 1U5RA 5A54A 2J6MA 2B4SB 2B9FA 4YO6A 4IWQA 3AC3A 3RP9A 2R3LA 4BDCA 2XCKA 5FXRA 3FY2A 2R64A 3MSSA 4K8AA 4L53A 5ANDA 1Q3DA 2HWOA 2YCFA 3WIKA 4BBFA 4W9WA 1NT2A 5CAUA 1Z57A 3F9NA 4IIRA 4ZEGA 3ZZEA 1U54B 2E9PA 4EOPA 1OPJA 5IH4A 3ZMMA 4O6EA 2ZDTA 4FKLA 5HG7A 3OUKA 5E1EA 5TO8A 3ROYA 4E8AA 2BAJA 2BUJA 3FAAA 3VBXA 3PXRA 3T9TA 4BKYA 3BI6A 1H07A 1OB3A 4FZ6A 4IAZA 4R3PA 3AMAA 2P33A 3KFAA 1XH7A 3L9LA 3MGYA 1GIIA 4YJPA 5BVOA 1ZRZA 2XEYA 2YISA 5KMJA 3VQUA 4CGAA 1E1VA 2XS0A 5CF8A 1J7IA 3I60A 4PPAA 3HYHA 4NEUA 1Q61A 3TIZA 3FI8A 1KE7A 5AV0A 3ZO2A 4UN0C 3GC8A 2GHLA 4U3YA 4E6QA 2V7OA 1R78A 4O7YA 1ZMUA 3F7WA 4Y85A 4YJTA 3Q5ZA 5D1JA 4DC2A 3OZ6A 1OL1A 4E4XA 5J5TA 2IPXA 5BUIA 1Q5KA 4CYJA 4D5HA 2RSVA 5HX6A 4EHVA 3FQHA 2VTTA 3KXXA 3EH9A 3P86A 4NCTA 4HGTA 3SLSA 2CNVA 2QO2A 4O7SA 3R01A 5F1ZA 4QNYA 4QYEA 2Y8OA 4FKUA 4RPVA 4CFNA 4X3JA 3OT8A 5H9BA 4IADA 4G34A 4DF3A 1OITA 3R73A 3RPRA 3NNVA 5BNJA 4RC3A 1PJKA 2WTKB 1Y8GA 3NIZA 3LCDA 4LV5A 4L3JA 3S2PA 4AZTA 1HCKA 2WMQA 3KF7A 4N70A 2R3OA 4CTCA 4FSWA 1R39A 2VTLA 4KBAA 3TZ8A 5KE0A 3VUDA 5F20A 5M06A 4LFIA 2XNMA 5CU3A 3TUBA 3CY3A 2LGCA 4C38A 2OW3A 2OXYA 1SM2A 3DPKA 4AW2A 1WBWA 3F69A 3NW7A 2OWBA 1H0WA 3C4CA 4XOYA 4ERWA 4DLIA 4BWKA 1OZ1A 3V01A 4BWPA 2GQGA 2H9VA 3FMNA 4LUDA 3DK3A 1U46A 3OWPA 1ZARA 3QZFA 4U40A 5FEDA 1WMKA 1H27A 3E3BX 3I0QA 4GYGA 1LP4A 4BFMA 2HELA 2JIUA 3H3CA 4WUNA 4E1ZA 1FINA 2WMUA 4DBNA 3QKMA 3WARA 3MI9A 4CVAA 4GVAA 5HESA 4RJ3A 5KKRB 3ZRLA 3OF0A 5ETAA 4M69B 4NM0A 4BDDA 3PPKA 2JBOA 5AR2A 4BCJA 5EH0A 2Y7JA 4RA5A 3TV6A 3WF8A 4FKPA 2JLDA 3HMMA 4JX3A 2WMWA 4YGAA 4AZVA 5IU2A 3O51A 4LL5A 4I0SA 4MD9E 3TN8A 3SAYA 5DHJA 3VWAA 5IMEA 4C8BA 3DV3A 4JQ8A 5FGKA 3SV0A 3ZFYA 4UWYA 2XRWA 3ZSGA 3MH1A 5JZJA 3BYMA 5ETIA 4Z7HA 4FT0A 2BVAA 3G0FA 3SA0A 3E93A 5FTQA 1L3RE 3TZ9A 1H4LA 2WMTA 5EOBA 2J9MA 4R7HA 4ZZNA 1I44A 3A7FA 3EFJA 5D7AA 4C33A 2W5BA 5E8ZA 1H8FA 4M97A 3VBQA 2IVTA 2BRGA 2XIRA 4ZOGA 5AAGA 4YU2A 1MRYA 4QMSA 4UV0A 2X7GA 3A99A 5HE0A 3HRBA 2FYSA 5HKMA 4K11A 3W2OA 4C2WA 4FK6A 3ACKA 4RZWA 4ZSLA 1YWRA 3R83A 3ACJA 4PQNA 4MQ2A 5KKRC 3Q9YA 5BPYA 3LZBA 3QWKA 3TACA 3RHKA 4O84A 2AYPA 3F2AA 1PXLA 4FTMA 4TNBA 4GUBA 4HZRA 3ZBXA 3IW4A 3QC4A 4QTBA 4BI2A 4BICA 2IWIA 3I5NA 4AG8A 4C37A 2F4JA 2OZAA 3EJ1A 5HNBA 3OXIA 2YM7A 4OAVB 4O96A 4ACMA 2O63A 3CE3A 2Z7QA 4K18A 4YLLA 3LOKA 2ONLC 5DR9A 3V5QA 4ITJA 4X6RA 3O71A 2J0MB 1LEWA 3QRUA 5F9EA 4G1WA 3QX4A 3VUTA 3UBDA 2X6DA 3GCSA 1BLXA 2XKDA 4XP2A 3LIJA 4BCMA 2RG5A 2X9EA 2G1TA 3O23A 2GSFA 2V62A 4FMQA 3TNIA 4ALUA 3OS3A 2YIQA 4RX8A 4KSPA 5EDQA 3VS0A 4BDBA 4WHZA 2WQNA 3QZGA 4FL2A 4BF2A 1G5SA 3LLTA 2JITA 4UXLA 2F49A 2JDRA 3H9FA 1VZOA 3Q96A 3UVQA 4RJ5A 2GS7A 4DA5A 3BHHA 4AWIA 2C3JA 3ZO1A 3ORLA 3PJ3A 3EQIA 3W10A 3QUPA 3ZLWA 2HW6A 2WELA 4DH1A 3V8WA 3NAXA 4RBLA 4O81A 2CLQA 2WAJA 1JWHA 5A4CA 3UOJA 4YC3A 3O50A 4JXFA 3EQGA 5CI6A 4S2ZA 1PYXA 1YOLA 1QMZA 4DG3E 2YM8A 4JNWA 4K9YA 5H8EA 4EWHA 3NWWA 3BYUA 3VVHA 1V0OA 1BUHA 2C6LA 2CCHA 3DLZA 5KMOA 2YJRA 3LVPA 4OR5A 1YOJA 2UZTA 4JIAA 4TRLA 4K1BA 3ORXA 2JEDA 1M2QA 4BBEA 3OY3A 3B8RA 4DGGA 3L8VA 1XH4A 2RFNA 4JX7A 5JRSA 3RAIA 2WO6A 4M8TA 5A46A 3ALNA 2IZRA 5KO1A 3QKLA 3P4KA 5A4LA 3Q6WA 5J79A 4QP9A 2WIHA 3C50A 5A4QA 3KA0A 3AC1A 1BX6A 3PRFA 3HUCA 3D5VA 1XQZA 3IKAA 4U81A 3JR1A 4DH3A 5D12A 3TKHA 4KIPA 3NGAA 3PPJA 3VAPA 4ZLOA 4F1OA 3W2SA 4Z9LA 2WEVA 3JVRA 3E8EA 3R63A 4ONAA 3GGFA 4TTHB 4ASEA 4C4GA 4QQJA 2BKKA 4M0ZA 3TL8A 5M57A 4S31A 1WBOA 1YI3A 3IG7A 4FNXA 3GXLA 3WZKA 3ZEWA 4DFBA 3C1XA 4WSQA 4D28A 4EBVA 4ACHA 4AP7A 5C01A 4D2VA 5LWNA 1KV1A 2JKOA 3P0MA 4FNYA 3GENA 4MWHA 4UMUA 2WOUA 5AP7A 5FLFA 1OECA 3BPRA 3SXRA 5BVNA 2VWYA 5CEMA 2J0JA 1XJDA 3ZZWA 3ORZA 5EYDA 5C8KA 4ZTMA 3Q4TA 4UYNA 3VUIA 1KWPA 1B39A 3AC5A 5FD2A 3FSFA 3U9NA 5GINE 2E9NA 4FSYA 4GIIA 3KRWA 3CGOA 3FV8A 4EZ7A 2VTSA 4DTAA 4O0VA 3MN3A 2VNYA 3BLQA 4S34A 3QD2B 2UZDA 3BZ3A 3GQLA 3MDYA 4RA4A 4MHAA 3DBCA 2O5KA 5DYJA 5FTOA 4G3GA 4L9IA 3MY5A 2UW9A 3OG7A 4FSTA 3U54A 2Y4PA 3R1QA 3FI2A 4G3DA 4XLIA 5ANIA 3FLSA 1JLUE 4RVMA 3Q4ZA 1YI4A 1OKZA 4RIXB 5CEKA 1I09A 4UWCA 3GVUA 5HHWA 5A4TA 1UNHA 5M4IA 2RGPA 5TF9A 2W4KA 1OIQA 4RZVA 4YC8A 3R9HA 3TG1A 1BYGA 4L43A 2ZM4A 3QBNA 5DFPA 2F2CB 2REIA 1YWVA 3OWLA 3SRVA 3WE8A 3COMA 3EKKA 4GK4A 4F6UA 5M07A 3IOPA 5I9XA 4OTPA 1KV2A 2VTIA 4IB0A 3UDBA 2Y4IB 4EQUA 2BZHB 4OTWA 1GIHA 1ZOGA 2XJ2A 2QQ7A 4NWMA 4CKJA 2I6LA 3MS9A 5CSVA 2CPKE 3ZU7A 4X2GA 5E90A 4KA3A 2V55A 3I79A 4TYHA 4HCUA 2C1AA 4IM0A 4CG8A 4IH8A 2HXQA 3AG9A 3R7UA 1XH8A 5JT2A 4D5KA 4XEYA 3DFCB 4PY1A 4IZAA 4ZS0A 4I0TA 4I24A 3SD0A 5CYIA 5CF6A 3ELJA 4D9UA 4A4OA 4Q9ZA 2R0UA 3CSVA 3HZTA 4FVPA 3KL8A 4MX9A 3BHTA 3C5IA 3R8VA 2IO6A 4RX7A 4YJOA 2YCRA 1JSTA 1KSWA 3MTFA 5J87A 3U51A 2O2UA 3PSBA 1FGKA 4XBRA 2VTHA 3KF4A 1CM8A 1R0EA 4BGHA 3A8XA 4CFWA 5CEPA 5AUTA 4F7NA 3PA4A 2Y4IC 3KY2A 5FM3A 2PMNX 3EN9A 4ZP5A 4BC6A 2EB2A 4FUXA 1TQPA 2ZV7A 4YZBA 2X8IA 3T3VA 3NUYA 2PE1A 3TTJA 2OGVA 4YURA 4IANA 4CLJA 4V0GB 2X6EA 3R02A 1HCLA 4WA9A 5KMMA 1NY3A 3R2BA 4EQCA 4ACGA 2QC6A 2QOIA 4FTJA 4YJUA 4XV9A 3F5PA 4A07A 3RJCA 4MF1A 3BV2A 3QYZA 4QD6A 3RPYA 3VJNA 3Q9XA 4ASZA 3ZFXA 5AAFA 2PL0A 3BIZA 5EHYA 1P4OA 5HORA 2PULA 4KS8A 4BCNA 3DKOA 4E5AX 2Z02A 4XRJA 4X3FB 2FO0A 2OJFE 4H3PA 2HOGA 4QMUA 2Z7RA 5G1XA 1XH6A 1Y57A 1FVRA 3DNEA 3C0GA 3PE1A 4IB1A 2WNTA 2PSQA 2LAVA 5AUUA 5EYMA 4EH5A 1VR2A 3G15A 3VS7A 3AC4A 3D5WA 4UXQA 3P1AA 3KRJA 4FTOA 4AZEA 4D1ZA 4DGMA 2E9OA 3QTWA 2C5YA 5AP2A 3A61A 4ZY6A 3F88A 4WNPA 2B0QA 3HVCA 4NYEA 3G2FA 2DUVA 3ZYAA 3DOGA 4Y73A 4DEGA 4QP4A 5K5XA 3E88A 2YN8A 4FV7A 4U44A 4ITIA 3KMMA 4EUTA 3SKCA 4M3QA 5EFQA 5F94A 3GFWA 4C58A 4JBQA 4LM5A 4PPCA 1O6LA 3DDPA 3PA5A 4Q9SA 2ETMA 3KXNA 4GIHA 5HLNA 3ORNA 2WU7A 2FA2A 1JKSA 4GH2A 3ANQA 5JSMA 1STCE 3W2QA 4XP0A 4IFCA 3UOHA 5C4KA 5E7RA 5LJJA 4NT4A 4L01A 4MF0A 1GZKA 4X3FC 4I6QA 4FT9A 3KRXA 4FTLA 5DA3A 1FGIA 4EOMA 1H1QA 5HE2A 4GG5A 5LMBA 2PVMA 2CSNA 3C13A 3ZFMA 3V8SA 3UZTA 3PLAE 5CEQA 2XBJA 1XH5A 2PY3A 4TYJA 4L8MA 4ZY4A 4C4IA 2ZYBA 2QKWB 2UW5A 4Z16A 5T68A 3KXMA 3NIEA 2BHEA 5JKGA 2J5FA 4A9UA 1RJBA 4YLJA 3WOWA 5KBRA 5KX8A 3Q4CA 3VHEA 4ZZOA 5L4QA 1M2PA 2OJGA 2VU3A 3UYSA 1F3MC 3QQUA 3E7VA 5E8TA 4E4NA 4EYJA 4PMPA 2H8HA 3F82A 1PKDA 4M68A 5IF1A 2G2HA 4I1ZA 4FL3A 5CU0A 2X2LA 3HGKA 3P79A 1H1SA 1CMKE 5ETCA 2I7QA 4F0FA 3RK5A 4ZTLA 5L6WL 2AC5A 2H34A 4QPSA 4DEBA 5BQ0A 5IQBA 3TNWA 4U7ZA 1OIRA 1AQ1A 3FI4A 3NYXA 3RAKA 4BKZA 2R3KA 5CAQA 4A4XA 4X21A 4JG7A 2PMLX 4O1PA 5CX9A 4E3CA 4G17A 4YMJA 2QO7A 5HI2A 4UEUA 2WMBA 1PXJA 4BDKA 5KMLA 2OJ9A 5M4CA 4KB8A 2C0IA 5HVJA 4YHTA 5H8BA 4BGQA 1ATPE 4C2VA 3R6XA 4XG6A 5DI1A 4HNFA 4PP9A 5L2SA 2OKRA 5BMSA 5J9LA 3TKUA 1Q3WA 4E6DA 1V0PA 3K5UA 4KBKA 3DCVA 4XX9A 4W4WA 4EH4A 3MFRA 3HV7A 3GT8A 4BI0A 2XNGA 1YHVA 4R8QA 3RTPA 3NNXA 2AC3A 4GK3A 3F7ZA 4EHGA 3MYGA 2IG7A 3PP0A 2F7ZE 3BEAA 2IVUA 3H9OA 1Q4LA 1MP8A 4FIHA 4J8MA 3L9MA 5IEXA 5C27A 3FMHA 3LFDA 3UPXA 3TJCA 4JRNA 3DNDA 3UQGA 4DEDA 4R77A 3L8PA 2P55A 3PIYA 2CJMA 4JT3A 5BMMA 2CGWA 5LMKC 4FODA 2VWIA 3RAHA 4D4YA 5HNGA 5HICA 3RPSA 4EK8A 4IM2A 3VS4A 2CKOA 3FXZA 4S30A 2VGOA 4D4VA 4U43A 3PWDA 3F2NA 1JVPP 4GJ2A 3VNTA 3COKA 1BKXA 1OI9A 2OBJA 5IEYA 1FMKA 2J90A 3D94A 3HDNA 4BDHA 4EH2A 4G5PA 2ITWA 2QO9A 3E8DA 4FV1A 2ERZE 3D4QA 2VWXA 5HG5A 3EQDA 1LPUA
chains in the Genus database with same CATH superfamily
4ZTSA 1XHAA 4RFZA 2C5VA 4IMYA 2XRUA 4EH7A 4AF3A 3HAMA 3Q9ZA 2XIKA 3FKLA 5DN3A 3MH0A 4P4CA 1H01A 3DGKA 3QCXA 4LOPA 3QHWA 4G5JA 3BU5A 4ZLYA 5KHXA 3Q2JA 4NUSA 1FBNA 5LWMA 3BGPA 3ENMA 4FUYA 4BCOA 4C61A 3DT1A 5CU6A 3C0IA 1O6YA 2GDOA 1BL7A 4MKCA 4ACDA 4J8NA 1RQQA 2IN6A 3MVMA 5HBJA 4FIEA 4C4EA 1IRKA 2VTAA 3FKOA 1YRPA 4JDIA 3I1AA 4XBUA 3BE9A 5EHOA 3ROCA 3DY7A 3H0YA 1U4DA 3OHTA 2PVNA 3PXYA 4GJ3A 5HO8A 4BYJA 5HIEA 3FEGA 3R8UA 2V0DA 3C4ZA 3NVKI 3BQRA 4GT5A 4WBBB 4AAYA 3GU4A 3CQUA 3QFVA 4KINA 1JKTA 4RVLA 3AMYA 2R3FA 3BYVA 3NSZA 4QP2A 5FDPA 3OCGA 4I5PA 4BCHA 3EQCA 3AXWA 3HA6A 3PIXA 4JAJA 4BDFA 2RFEA 1KE8A 2XKFA 4IW0A 5TOZA 5HCXA 5EW9A 4DYMA 3U6IA 5LVPA 4ZXTA 4GKIA 4AQCA 4M66A 2BFXA 3WF6A 1KE5A 1SVEA 2QHMA 3ULIA 4RIWB 1UKHA 4QOXA 5HTIA 5HD4A 5AR7A 2EUFB 3KU2A 3L9PA 3NYOA 3PXFA 4WNMA 1YKRA 4QP1A 5D9HA 4TW9A 5K0XA 4IDVA 4I4EA 1YW2A 1LUFA 2EWAA 5ANOA 4AOIA 1E9HA 3AT4A 3MFSA 3W0PA 2X0PA 4HVHA 3A62A 3SHEA 2YAAA 3FKNA 4KNBA 4EOQA 4F09A 5AIRA 4G2FA 4BGGA 4M7IA 5IQDA 4XH6A 1APME 4LRKA 1GJOA 3KULA 2Z7LA 1NA7A 4I3ZA 2ZV9A 5JFXA 1XMLA 4IAAA 4AUAA 5CASA 4YUQA 2UUEA 2OK1A 5IISA 3NUXA 4F6SA 2O8YA 3NLBA 4FTCA 4EOOA 3BGQA 4F9BA 4JMQA 4AFJA 4I6FA 5HX8A 4JBOA 3GNIB 1XBAA 4I5MA 3LFSA 3NUNA 4E93A 1QCFA 5EKOA 4D1XA 3WZEA 3BHYA 3SVVA 4I4FA 4YJNA 3GU7A 5CXZA 3PJCA 3NNWA 3TIYA 2QHNA 3I4BA 4NKSA 2DWBA 4O2ZA 2YZLA 4AGWA 4XG2A 2FB8A 1H25A 2HY0A 4JDHA 3A4PA 4TT7A 1H0VA 2PVLA 4XG8A 1Q8ZA 2UW4A 3E8CA 2PK9A 3PDTA 4BCFA 3EZVA 3NCGA 2UZLA 4IFGA 4QQ5A 4OBQA 5DMZA 3FYKX 4IAFA 3DKFA 4EUUA 5HZNA 4L46A 5J1WA 2WQOA 3A8WA 5JRQA 5LVMA 3IECA 3VC4A 4O0TA 4XCUA 4D2WA 4EH3A 4P2KA 5IPJA 3LCTA 3IGOA 2PE0A 1MQ4A 2WPAA 2G2FA 2QI8A 4DHIB 5DNRA 1YQJA 4KKHA 2QNJA 1QPCA 3VUHA 4FA2A 3OXZA 2WIPA 1Z9XA 1JQHA 2A2AA 4EH9A 2V7AA 5DE2A 4DH8A 5KMIA 4MK0A 4CYIA 4NIFB 3L1SA 3ERKA 4QMMA 2DYLA 5HOAA 2HW7A 2C68A 4FNZA 5DEWA 3JVSA 2FSOX 3K54A 4WBOA 4FKRA 4FEVA 3E62A 2W7XA 3KCFA 4IHPA 2W1EA 2ITUA 3DFAA 2UVYA 3MJ1A 3U87A 3CTQA 5AAEA 4PDSA 3TV7A 4DGNA 2FSMX 3C4WA 4FTNA 2I1MA 3AMBA 4GYIA 4L44A 4IM3A 2XAOA 3RK7A 2B7AA 4E5BA 5LXMA 4XUFA 3RHXA 4ZAUA 5IQCA 5EOLA 4CT1A 3DU8A 4FVQA 3TT0A 4W4YA 2C6EA 2R3QA 4JDJA 3RALA 3NUSA 4W8DA 3T3UA 4DG0E 4EOIA 5CTPA 3RNIA 4DITA 4YLKA 2YM4A 3MA3A 3OW4A 4O0YA 2GQRA 5K0KA 5DT3A 4GS6A 4YC6A 3UG2A 3QLFA 3UJGA 3VUMA 4ZSEA 3LQ8A 4H1JA 4LRMA 2WTDA 3I7CA 4ZS4A 2QOBA 5ACBC 3QQGA 2R3GA 4ANBA 1F0QA 4CZTA 1DAWA 3BQCA 4QMVA 3VHKA 3OOMA 4FKTA 4TYGA 5AEPA 4F78A 4BIEA 1Y8YA 3QAME 5BYZA 2JBPA 2ZV2A 2QD9A 3NNUA 1REJA 2CLXA 3FMLA 3QTXA 5HTCA 3AOXA 1WBPA 2GNLA 5HU3A 4OBPA 4UALA 2UVZA 3EMGA 1YHWA 1ZZ2A 3MH2A 4XHKB 4G9RA 2VV9A 4CMOA 5E4HA 1TVOA 2E2BA 4AN2A 5K5NA 5A4EA 4F1MA 5L8KA 1QPDA 4FV6A 3P08A 5CT0A 4EH8A 3ZUTA 4CMTA 3W0QA 2X39A 3UE4A 2X81A 3UIXA 2BTRA 1PRYA 5JEBA 3UP7A 4O7VA 1R1WA 5JGBA 5FXQA 4PNIA 2A0CX 3QC9A 4GRBA 4F7JA 4LV7A 2DQ7X 5LARA 3FZPA 5M55A 2W96B 4G6OA 4FIGA 3OMVA 4G6LA 4FTKA 4C35A 1V0BA 4K2RA 3SXSA 4YNOA 3QQFA 4CV8A 4AZWA 3PE2A 2ITQA 1GOLA 5HNIX 2WTKC 1Q99A 5HCZA 4BCQA 3Q2MA 3EN7A 2X8EA 5GZAA 4I92A 1UU8A 4QTCA 2BRNA 5CVFA 3RPVA 4G6NA 3KRRA 2OICA 3GCQA 3N9XA 4AZFA 4BZDA 3Q52A 3G6HA 4FGRA 4HYSA 4QMNA 5E8XA 3MIAA 4P90A 5HG9A 1PY5A 2ITPA 3LXPA 3BBWA 4JG8A 4EOKA 1G8KA 3UZRA 2X7FA 4DDGA 2JIIA 2XZSA 3I5ZA 4YJRA 4ANMA 3HP5A 4ERKA 1H1PA 3O8TA 5HE3A 3QL8A 2W1DA 2YERA 4I94A 3M11A 1CKIA 4FSZA 3R04A 3BWFA 3KK9A 4NTSA 4LI5A 1Y6BA 2IZUA 2JAVA 2QU6A 3CS9A 4MQ1A 3UVRA 4CZUA 1UWHA 2VTJA 2NP8A 3FLQA 3MY0A 4JR7A 2YM5A 4LMNA 4C57A 2BPMA 4HYHA 4PTEA 3RM7A 4LGDA 2GNHA 1UKIA 4AOJA 3HRFA 5DLSA 3F3WA 4FR4A 4LYNA 5A9UA 2CNQA 2R4BA 3S4QA 4OTIA 4AT5A 4F9WA 5LVLA 3NYNA 4B0GA 3NS9A 3HUBA 5J9ZA 3UODA 4PL3A 4TWCA 3RBWA 2CMWA 2X7OA 3C0HA 3O7LD 3QTIA 3HMPA 2A27A 4CV9A 2UZOA 4BVUA 2CKPA 3G6GA 4O4DA 3GU8A 2BKZA 2B9HA 1GZOA 3PSCA 3RPOA 3OP5A 3VF9A 4Z55A 4DAWA 5IUHA 4ZTNA 2F7EE 2XNOA 5IQAA 3DXPA 3FBVA 4EOLA 4ZLZA 3FQEA 2BCJA 5AP4A 4DINA 3JUHA 3PVBA 2ESMA 4WG3A 3LCOA 4Z7GA 5BUJA 3ET7A 4IX5A 5DRBA 3W0RA 2PMIA 1OGYA 3JY0A 1ERKA 2PZIA 4KIKB 4MEDA 3ZRMA 2NRUA 3ZDIA 3B8QA 3A7HA 2ACXA 4BCIA 4ZZMA 2WTJA 4TYEA 4TYIA 1PHKA 3ZLSA 4AA4A 5E9EA 4EK5A 3VF8A 5HVYA 1O6KA 2ITYA 4F08A 4D4SA 1VJYA 2R3JA 3LXLA 4JBVA 4TWPA 4PV0A 3BU3A 3NPCA 4RWIA 2NNWB 2G2IA 2IZSA 3LFCA 3IS5A 5DT4A 4AT3A 4FEUA 3SG8A 3T9IA 3AD5A 1XR1A 3A2CA 3QCSA 1UU7A 2O64A 4CFFA 3NUAA 2X9FA 1ST4A 3PLSA 1AGWA 1FMOE 1Q62A 4CEGA 2QODA 4I20A 5HIBA 5M4UA 3DZQA 1FVTA 2KULA 3FZ1A 5C1QB 2WQBA 3FHRA 3CIKA 4J52A 4JL9A 4AZSA 4RX9A 4C02A 4YTFA 3NMUF 3ZM4A 3TYKA 4O27B 4GSBA 4ZTQA 3UZPA 3ZH8A 2UZEA 3PG1A 2GPHA 3MVHA 3K5VA 2CCIA 3U6JA 1V1KA 2QR8A 1A06A 4XLVA 4NU1A 4RJ7A 3KQ7A 2XYNA 1ZY4A 4O0UA 4PRJA 4RMZA 1UV5A 5CSWA 3ZUUA 3QZHA 4S32A 4FTRA 2WGJA 4OBOA 2B53A 4HGEA 4JR3A 3IK3A 4FYNA 2OFUA 3HA8A 3RK9A 4F9CA 5HTBA 3KK8A 5JFSA 5BV3A 1RW8A 3GBZA 1QPJA 1VLRA 1U5QA 2QOOA 3AT2A 3DLSA 4N6YA 3ZBFA 3F6XA 4G3FA 4ZSGA 5HO7A 3VS1A 3VS5A 5I9VA 3IQ7A 3QRIA 4FYOA 4IAIA 4ITHA 4J7BA 1H08A 4RGJA 2HIWA 5JGDA 2ZJWA 5CLPA 5AV2A 1YDTE 3FPQA 3R8PA 3UPZA 4QYFA 4H3QA 5JGAA 3R2YA 4M67A 3VULA 4R7BA 3JS2A 4QMTA 3G5DA 3LHJA 4GU6A 3HV4A 4RJ4A 3QX2A 4PL4A 4FE2A 1L8TA 4O86A 5AV4A 5C26A 4A4LA 2IZTA 2R3HA 2W1CA 2XCHA 2ZB0A 4M0YA 3R7EA 3R0TA 2UZWE 2OSCA 4RFYA 1W2DA 4DBXA 2OZAB 2I0HA 3LMHA 5C8NA 3DBQA 5FUTA 3GC7A 4DFUA 4LG4A 1OL2A 4JDKA 3OEZA 5FBNC 5E8UA 2QOHA 3GCVA 4E6AA 2R3IA 4WD5A 1XBCA 4PMMA 4X7QA 3HEGA 3ZONA 3MPMA 4U79A 2FSLX 4BDIA 4IWPA 5DGZA 3KXGA 4HYUA 4CCUA 3DBDA 5CAPA 3DAJA 4M13A 4W8EA 5BVKA 1ZMWA 4ZY5A 4NK9A 3FZOA 5AR8A 5EKNA 3U8WA 4MH7A 4FX3A 1OMWA 4GT3A 2B52A 2J0KA 3QALE 3RGFA 2PMOX 4IB3A 4K77A 4X3FA 4GFOA 4YPSA 5F95A 4YJQA 4L68A 5HBEA 4D58A 4ZK5A 4UMPA 5JMSA 2WMRA 4FTQA 2VTPA 3LW0A 3NZ0A 3UIUA 1Y91A 3F3TA 1EH4A 2BRHA 2WMAA 3MVJA 1W83A 4IB5A 4UX9A 4IZYA 3R8ZA 2Z8CA 3M1SA 4IACA 3R7YA 2I0EA 2C47A 5I9YA 5AP6A 3JY9A 1TQMA 2BZJA 3DK6A 2PZ5A 3WI6A 2CKEA 1TKIA 3LXNA 5LVNA 5H8GA 2PYWA 3QQLA 3HAVA 4IWDA 3EQPA 2W4OA 3C5UA 4QMLA 5L2IA 3QTRA 4DFZE 2CN5A 2XYUA 4D2PA 4H3BA 4U0IA 3DKGA 2Y6OA 4FV4A 3PG3A 1FOTA 2ITTA 5JQ8A 1RDQE 3VJOA 2QVSE 4X2JA 3FQSA 3FLYA 2NPQA 3H10A 2JFMA 2PUUA 4MYGA 5AADA 4O7WA 5I5ZA 4PMSA 4H05A 5JN2A 5IG1A 4IVDA 4BKJA 3Q4UA 4PP7A 3VRZA 4DEIA 4AXFA 4G3CA 2CNUA 4YZDA 3G9LX 5KMNA 3LM5A 3AKJA 2R2PA 4I41A 5DR6A 4ANSA 4ASDA 5I3RA 2QG5A 3CPBA 3R7IA 4CMUA 2JKKA 5L2WA 3BHUA 3EYGA 3NUPA 4Y46A 2VUWA 2X1NA 3QUDA 4TY1A 3KRLA 3EN4A 3W33A 4USFA 4IVBA 3LQ3A 4O4CA 2I0VA 5IQHA 4XG3A 1Q8TA 2FVDA 3ZSHA 3CTHA 4FZFB 5JFVA 4Z3VA 4PF4A 2OO8X 2R7IA 4FT5A 3QYWA 2XH5A 4WUAA 4YSMA 3PWYA 1Z5MA 3K3JA 4PTCA 1W98A 1OL7A 1FPUA 2C6IA 2VTMA 4IWOA 4MAOA 2YM6A 1YI6A 4HOKA 2GNIA 4BR3A 2C0TA 4IC8A 1W82A 4LMUA 5CS6A 5ETFA 4AXDA 4KIOA 3TNHA 3ZLXA 5DOSA 3ZRKA 5LCJA 4CKRA 3BLHA 1WVYA 4R3RA 1E1XA 5IMXA 4U5JA 5AA8A 4CFUA 5J1VA 3BLAA 3MWUA 4QQCA 2E9UA 5EQEA 2NO3A 2ZVAA 2J5EA 3FLZA 4U45A 4D2SA 4EC8A 2W1HA 3R1SA 5B2MA 5LMKA 3UNKA 3EQBA 4AW0A 4GG7A 2RL5A 3DB8A 3Q9WA 4ANNA 5FTGA 3W0MA 3B2TA 4AXEA 4D0XA 2VD5A 3ALOA 2VTOA 4UBAA 1M52A 4EYMA 3G33A 2ZFYA 1UWJA 2PWLA 5EI8A 4KKGA 2YLEA 4AOTA 1WBSA 3QA0A 4OT6A 4RRVA 2JDSA 2YCQA 3BBTB 5J5SA 3JYAA 3UOKA 3CC6A 4E7WA 3D5XA 1YDSE 4TWOA 2XK9A 3NEWA 1OIUA 1DM2A 2UV2A 5AV1A 2IW9A 5K9IA 2W1IA 2CHLA 4L67A 4QDVA 4FKWA 2BZIB 2WB8A 2F2UA 2WEIA 1WVXA 4FI1A 1SNXA 5TT7A 2XM9A 2P2HA 2YDIA 3PY3A 5CENA 4GT4A 4FBXA 4ORKA 2W9FB 3L8XA 2J51A 4JVGA 4NM5A 3OD6X 3OXTA 4BJJB 4L7SA 3UO4A 3TCPA 5CEIA 4RQKA 3EKNA 4RIYA 3KMWA 3P5KA 2IJMA 3EQFA 3W2PA 3R22A 5T6KA 2PVYA 3UOLA 2VWZA 2G01A 3OROA 4ANQA 3PTGA 3GC0A 1ZOEA 2WMVA 3QD3A 4BN1A 1YVJA 3NYVA 4Q2AA 4M15A 2YDKA 4U42A 1ZZLA 1YXTA 3OUNB 3P7CA 3PXKA 3FY0A 4TYHB 3ZXZA 4BZNA 3BV3A 5CSHA 4FKVA 4IX6A 1TQIA 4FV9A 2BAKA 1TZDA 4MXZA 4N4SA 1ST0A 4UMQA 5M44A 4CRLA 4O83A 5DG5A 4QMQA 5DBXA 2F9GA 2GHGA 2IEWA 2JD5A 4FK3A 3GEQA 3QD0A 3UC3A 4AE9A 3F61A 4Y95A 3PFYA 4IEBA 1CTPE 3OBJA 5E8YA 3V5PA 4J71A 4EOJA 4QMPA 1CKPA 1QPEA 2EU9A 4Q5HA 2GMXA 4GFGA 2QKRA 4MWIA 4N6ZA 4Q5EA 4A9YA 4BL1A 4CKIA 5KCVA 3H9RA 4IVCA 4BB4A 4NH1A 1Y6AA 1YWNA 3I7BA 1BI8A 5GJFA 4JAIA 4X6QC 4PTGA 2XK3A 3QCQA 4QP3A 3IO7A 5B7VA 4HPUE 5IEVA 4ALWA 5IQEA 2XEZA 2HAKA 4N57A 4I6HA 4TPTA 5L3AA 4MNFA 4YZMA 3D7TB 4M84A 4WG4A 3FZRA 1PXNA 1ZWSA 4X2KA 4QNAA 4RIOA 4V04A 3E5AA 2F57A 5GJGA 3WILA 4DEAA 4E4LA 3UIMA 3BLRA 4FGBA 2WTVA 4Y72A 2GU8A 3LMGA 3THBA 4F6WA 3VW8A 1XKKA 3EWHA 4R3CA 3UMXA 4BBMA 3MB6A 4XV1A 3CBLA 2OH0E 4AU8A 2B55A 3PRIA 1PF8A 3O2MA 3S0OA 2VRXA 3EN6A 3ZLYA 5EDPA 4WNOA 3VONA 5AFVA 3EQRA 1OUKA 4DHJA 4YO4A 3QQJA 3U6HA 4QTEA 2YACA 3LAUA 3GC9A 1YXSA 3QTQA 3OFMA 4TNDA 5CNOA 3ORKA 5HQ0A 4AQKA 4ID7A 4EK4A 2PPQA 3WZDA 1ZYLA 1UU3A 3NAYA 2XK7A 3O17A 2RG6A 4Y5QA 1W2FA 5G6VA 3KN5A 5D10A 3SQQA 2YHVA 1MRUA 3V5JA 2YIWA 5FM2A 2W17A 2BTSA 2IF8A 3F3ZA 4QTAA 3HV6A 3UG1A 5GIOE 5AP0A 4O2PA 3MFTA 5LCKA 2X0GA 3OW3A 2ZMCA 2ITOA 4MNEA 1LEZA 4PDYA 1OPKA 1WCCA 1NVSA 4EJ7A 5JQ5A 2Q83A 3QGYA 4YZ9A 3G51A 3UTOA 4LOQA 4XV3A 4BTJA 4FEQA 2W1FA 1HOWA 5EM8A 4NL0A 1KOBA 3TTIA 3U55A 5HLPA 3Q60A 3OTVA 4L00A 3EFKA 3ENHA 4FF8A 5DPVA 3DB6A 2UZVA 4JQ7A 5FP6A 5JFWA 4AN3A 2NYAA 2JKMA 3ATTA 1Q24A 2ITXA 4W4VA 4IZ5A 1Q8UA 1RE8A 2ETKA 3POOA 1PXIA 2A19B 4IJPA 1ZMVA 5DRDA 4EJNA 2JDVA 2XBAA 3LFEA 3ANRA 2QURA 2W9ZB 3BYSA 4PMTA 2PVRA 4FG9A 5AX3A 3QU0A 3LE6A 3CKWA 4OTHA 5DVRA 3W2RA 1XWSA 2CGUA 4O0SA 4C59A 1A9UA 1NVQA 3BE2A 2EXMA 4MVFA 2C5OA 4FZ7A 3BU6A 3PXZA 3AT3A 3R00A 3FMJA 2WQMA 3FMMA 3KGAA 3PY0A 4HGLA 4C36A 1NVRA 3DJ6A 3E8NA 3HLLA 4QYGA 2QOFA 3G9NA 1W8CA 4EQMA 2W1GA 2V5QA 3FHIA 4F9YA 4FTUA 5JZNA 4HVIA 3JPVA 2XNEA 4IVAA 5HU9A 5CQWA 3PVGA 4A9TA 2GFCA 4EI4A 4BWXA 3NW6A 2OXDA 4A9RA 3FDNA 3W1FA 3F5UA 4QMXA 2JDOA 2Y0AA 5A6OA 3UC4A 4CCBA 4K6ZA 5KUPA 1U54A 5HEZA 1Q8WA 5GZ9A 5D41A 3CLYA 3QCYA 4G3EA 4B8LA 1F5QA 4FSNA 3MB7A 2YCSA 4RC4A 4FV3A 4L6QA 5E8VA 5FDXA 2W06A 3DXQA 3BGZA 2RKUA 1JKLA 1PYEA 3BX5A 3R9RA 4XOZA 3O7LB 2OJJA 1ZYJA 3W8LA 3Q5IA 3R9NA 4IX4A 5AUZA 4CZYB 2XM8A 4PWNA 4BI1A 2VN9A 3GFEA 2VNWA 2JDTA 5BVDA 5LMAA 4QYYA 1ZXEA 4UWBA 4CFVA 4MUQA 1MRVA 4HJOA 2GNGA 4AA0A 2VO6A 5L2TA 3NX8A 4WSYA 4R6VA 2PUNA 4D9TA 4ZMEA 5EYCA 3E3PA 4PL5A 2WD1A 3UQCA 3HX4A 4K0YA 4V01A 5HLWA 5IZFA 5IQFA 4QQTA 4DCAA 2QOQA 3RKBA 4HCTA 3DK7A 3FYJX 3TDWA 2VX0A 4I6LA 5C03A 1JSVA 5M08A 2GNJA 1ZOHA 3FL4A 3R8LA 3N4UA 2UW0A 4F4PA 3Q53A 4KAOA 3MIYA 1ND4A 3OVVA 3CXWA 2RIOA 3ID6C 5KZ0A 2WMXA 4KBCA 3WZUA 3TKIA 2PVKA 2VWUA 1NXKA 4QPAA 3GCUA 4Y8DA 4BHZA 5LVOA 2VX3A 4XRLA 4R5SA 3VS6A 4U80A 4B6LA 3CJFA 2B9IA 1VYWA 1ZLTA 2R3RA 3L8SA 4RSSA 3F66A 3SXFA 1M2RA 2XIXA 2Y6MA 4OAUC 5GJDA 2O65A 3SW7A 2CKQA 5IQGA 2WFYA 5EHLA 4AAAA 5AUWA 2BDFA 2YITA 3VRYA 5M09A 4ACCA 2EB3A 3F5XA 5DT0A 4GV1A 2C6OA 2X4FA 3FZSA 4PUZA 2WQEA 3LCSA 2WHBA 3R9OA 2OF2A 4U41A 4U97A 3W18A 4ASXA 4ZSAA 1GNGA 3MW1A 4LRJA 5TR6A 3Q32A 3TZ7A 2FGIA 2R3NA 3EFWA 4FEWA 4FT3A 2VX1A 2CDZA 3VBTA 2GNFA 4TZRA 4U6RA 4YR8A 3PZEA 4J97A 4IQ6A 4NFMA 3RZBA 1FQ1B 2BROA 4FIIA 5BYLA 3MY1A 4M69A 4PX6A 4FVRA 3TNPC 2VGPA 5AR3A 4B4LA 3TUCA 4D1SA 4AXCA 2OF4A 3R9DA 4FTAA 4DTBA 2X8DA 4IC7A 5FQDC 5IA5A 1U59A 4TL0A 2BR1A 3AC8A 4FICA 3EZRA 2C0OA 3M2WA 4IBMA 5HIDA 5AP3A 2YJSA 4C3FA 4LGHA 1IASA 1CSNA 2ONLA 4LQMA 4QPMA 4OLIA 3RZFA 3W0SA 4S33A 4FKSA 4LUEA 3SX9A 5FEEA 1G8AA 3AKKA 4EHZA 3RAWA 4APPA 3D0EA 1XO2B 3G0EA 3LFBA 1DS5A 5L2QA 3VUKA 5DIAA 4AACA 5H3QA 3QHRA 2GTMA 3D14A 3VUGA 2VTNA 3II5A 4C3PA 4F65A 2ZB1A 1WAKA 5A3XA 5EI2A 1OL5A 1PMNA 3QTUA 4CQEA 4AA5A 3LM0A 4I22A 3QWJA 4I5HA 4X2NA 4I93A 5BVWA 1NW1A 4DLJA 2XB7A 5C4LA 4JI9A 3W8QA 3B2WA 3S1HA 3KULB 2PHKA 4MCVA 3NDMA 1VEBA 4RWJA 4A06A 4R7IA 4XJ0A 1K9AA 2C4GA 4PPBA 1Q8YA 3S3IA 3GI3A 5AV3A 4EEVA 1G8SA 4KRDA 4DH7A 3BHVA 3R7GA 3WE4A 2J0IA 3HV5A 3RMFA 4BCGA 2EXCX 3F5GA 4PDPA 3TI1A 2Y9QA 4BIDA 4RLKA 2A4LA 4USDA 2BDJA 3EL8A 5M56A 5CY3A 2XKCA 5F4NA 5E8SA 2QR7A 5J9YA 3NVMB 1UNGA 5I9WA 3IOKA 4KIKA 4F1TA 4FKGA 2XJ0A 5CWZA 4EBWA 5EG3A 4NZWB 2W4JA 4DT9A 1YXXA 2VO0A 2VWWA 5EYKA 2I40A 3NCZA 4EKKA 4TN6A 3NFGB 2OXXA 3QQKA 4YJSA 5J7BA 4O0XA 2H6DA 1S9IA 5AUXA 5GHVA 2WXVA 3D2IA 2YWVA 1P14A 4NSTA 3LJ2A 4XG7A 4EZ5A 5AA9A 4DN5A 3CCNA 4FG7A 4D2TA 3OWJA 2O0UA 4FSMA 2H96A 3AC2A 4NTTA 4MXOA 4CD0A 1BI7A 3AGLA 2ETRA 5KNJA 5L6OA 4BYIA 4ENXA 4O7LA 3QRJA 2J2IB 2W5AA 1GIJA 4EHEA 2R3MA 4DT8A 5D11A 2ITVA 5AUYA 1UU9A 3GOPA 1SNUA 1PMVA 2PE2A 4I23A 5AUVA 5BYYA 2YLFA 3MESA 3HDMA 3EN5A 2GTNA 3QQHA 3WIGA 5CVHA 3P23A 4F9AA 5LOHA 4AE6A 4QEBA 2PVJA 5CT7A 4AXAA 1P4FA 2JKQA 2YWPA 1PW2A 3VQHA 2YIRA 5EK7A 3RI1A 4U3ZA 4FV0A 4B99A 2OG8A 3I0OA 2Z2WA 5CZIA 3ORMA 1J91A 2C69A 2C3LA 4XNEA 4CNHA 4OTGA 3UGCA 4FSQA 1JBPE 1M14A 4BDGA 4C34A 2PZYA 4MD8E 4OW8A 5ANEA 2QCSA 5EW8A 5LQFA 1YXUA 3UMWA 4BHNA 4MXYA 4CFXA 3EOCA 4HNIA 2X2MA 4DEHA 3LJ1A 3PPZA 4FEXA 3I81A 5C8MA 2HZNA 3NUUA 4RLLA 3NRMA 3LFFA 3EYHA 2PUPA 3DBFA 4M12A 1URCA 4BTFA 1JAMA 2BZKB 1TFFA 4LDTA 5M4FA 3FE3A 3FZTA 4XS2A 4EOSA 3F2RA 1B6CB 4DGOA 2BIYA 5CAOA 1OIYA 1IA8A 3ETAA 1SYKA 3KXHA 3RCJA 4QMWA 3I6WA 3ZHPC 4F0GA 3MBLA 3QKKA 4FSRA 3BKBA 3QZIA 1WVWA 3AQVA 2HWPA 4GMYA 4UB7A 3R7VA 5IUIA 2GCDA 3IW7A 4L45A 5CANA 5FWKK 3ZDUA 4XP3A 3WF9A 4P7EA 4KUJA 2CGXA 5A6NA 2WKMA 3GCPA 1K2PA 3P78A 5K4JA 4A7CA 2RFDA 3CEKA 4RWKA 3KEXA 3LPBA 3HKOA 4Y5HA 1IEPA 3REPA 4RX5A 4ZJVA 2XUUA 1J3HA 4R78A 5FP5A 1OPLA 3SG9A 4KSQA 3WF7A 1KE6A 3HECA 4BCPA 4RG0A 4RVTA 5HGIA 3TM0A 5B0XA 2YM3A 4B8MA 2JFLA 4F63A 4YBKA 3MTLA 2V22A 5BVEA 5FRIA 1ZYCA 3LFNA 3VS3A 3K2LA 4YPDA 4O7NA 4FOCA 1OKWA 3KMUA 3CGFA 4NCTC 5EW3A 5HD7A 1WBTA 3BCEA 1X8BA 3R71A 3UO5A 3PIZA 4RIXA 4YBJA 3EL7A 5K4IA 2PZRA 2CGVA 3MVLA 5IDNA 2XK4A 1J1BA 4B9DA 1T45A 1IA9A 4XV2A 3DTCA 1SVHA 3S95A 2ZMDA 3HMIA 4WIHA 1H1RA 3QGWA 4O7TA 4J1RA 4NKAA 2HZ4A 2RF9A 1W0XC 1BMKA 3V51A 3P7AA 3WZJA 4J98A 2XK8A 4MBIA 2ERKA 5J8IA 4BRXA 3P9JA 1PMEA 4UMTA