3ZO1A

The synthesis and evaluation of diazaspirocyclic protein kinase inhibitors
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
GSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Synthesis and evaluation of heteroaryl substituted diazaspirocycles as scaffolds to probe the ATP-binding site of protein kinases.
pubmed doi rcsb
source organism Bos taurus
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zo1A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zo1A02
4U80A 3PJ1A 5AV3A 2I0YA 2UZVA 3ORIA 4PDOA 4BICA 4X2NA 4BZNA 1HCKA 1WBTA 3Q4TA 4ALWA 1Z57A 4JQ8A 4WRSA 4CLIA 4YJNA 3QRUA 2I1MA 2FSLX 3RZFA 4H1JA 2WQMA 1REKA 2XYUA 5D41A 1NVQA 4RJ3A 4CMTA 2OU7A 4USDA 4XP2A 5ANEA 1KE8A 5M44A 3H0YA 4UWCA 4CMOA 5HE1A 2V62A 3Q53A 4QPMA 1OMWA 4YJOA 3LJ0A 3RBWA 4Z7HA 2WQOA 3QKLA 2GNLA 2YISA 2HENA 2ZVAA 3G90X 3HRFA 3TXOA 3BU3A 1UU9A 3FSKA 4CRSA 4YHFA 3WIGA 4BIDA 4JR7A 1T46A 2RKUA 5AP6A 3SAYA 1YHWA 2ITVA 3ORKA 3Q5ZA 4IM3A 3DCVA 3R21A 5KZIA 4BTMA 3NUXA 2SRCA 3BHHA 3FAAA 3WZJA 4AS0A 5IZFA 1GNGA 5M09A 5HU3A 2C0TA 2XH5A 3PXZA 5JFVA 3T8OA 4ASXA 4JAIA 5IA5A 3U6JA 4ANSA 4EH8A 4IH8A 5A14A 2WPAA 3DZOA 3LIJA 3F5PA 3ODZX 4G6NA 4TT7A 4JQEA 1FVTA 1YOLA 2JAVA 1FINA 2VO7A 4HGLA 5I9XA 3MJ2A 2R3MA 5DE2A 5IMXA 2HK5A 1JBPE 4I23A 3RGFA 2YM7A 2B9JA 3A62A 2A19B 3ELJA 4PNIA 4U7ZA 3GVUA 1G5SA 4ERKA 1DS5A 4IC8A 3TT0A 5HEZA 2GSFA 2V55A 4ASZA 4XCUA 4ZY6A 3VIDA 2CNUA 3QTWA 3G9NA 1EH4A 5AM7A 3U9NA 4GRBA 3ZM9A 5B7VA 1XBAA 4S34A 4DA5A 1BMKA 2CGUA 4AZSA 2ONLA 4F99A 5CAQA 4WNPA 3Q2JA 3R2BA 5F20A 3UP7A 3E7OA 2HXLA 1Q61A 2ITOA 3HMOA 4PPBA 4XG6A 5HNIX 5M4UA 1LR4A 2FGIA 4KRCA 3B2TA 3WF5A 2X6DA 2J0LA 2W96B 3P7AA 3RMFA 3GU7A 3WI6A 3NLBA 1TQMA 4JL9A 1R39A 4FYOA 3SGCA 4C4GA 3DXQA 3SRVA 4MTAA 5KMNA 3TIYA 3TUCA 4FMQA 5IF1A 1XKKA 4BHNA 2XNMA 3TL8A 2WMUA 4IWDA 2V7AA 5DRBA 4UWBA 3KF7A 2H8HA 2R3PA 5L4QA 5AP4A 3V8TA 2XK7A 4L3JA 3HDNA 4DEEA 2JEDA 3CGOA 4JG7A 4RRVA 2O63A 5E8ZA 5KKRB 3KA0A 4EOQA 4EORA 4FUXA 4TZRA 5EQEA 2YDKA 1QPJA 2YM8A 5FQDC 2WFYA 3FC1X 3P86A 4QTBA 3EKNA 2YJSA 1OL7A 1V0BA 5GHVA 4X3FC 3D2KA 4AUAA 3ENMA 5CU3A 1JLUE 5FDXA 2YM6A 1FGKA 2XNNA 2BIYA 4GT5A 4MBIA 5FBOA 5LWMA 4AGDA 5AUUA 3C4ZA 4I0TA 4RWIA 2X0GA 3ORLA 4DBXA 3IGGA 2ZM4A 2R3NA 3QZHA 4YNEA 3PVGA 4I22A 4AACA 1W8CA 4XRJA 3DLSA 2WOUA 5IA1A 1G8AA 3RNIA 4FODA 2VGOA 4ZSJA 2V5QA 1UKHA 4FNXA 2C0IA 3MPTA 5DWRA 5BUIA 4JBOA 5IH6A 2VD5A 4PMMA 4LFIA 4KIKB 5AP5A 4EHVA 3C7QA 3ZHPC 3H9OA 4MHAA 4O6LA 3E8EA 4PTEA 3DBCA 3ZUUA 2PMIA 2BZHB 2QOLA 3AMBA 3BBTB 3EN9A 4NW6A 3VUGA 3QCYA 5I9YA 1GOLA 1H1PA 1WBVA 1YWVA 2BPMA 2OIDA 2VX1A 3VHKA 4EK6A 3QZGA 3ZUVA 4O0TA 3PYYA 5CNNA 4YHTA 3CPBA 1XO2B 3ZBXA 2OJ9A 3BYOA 1U5RA 3T3VA 5FEEA 4ALUA 3MSSA 4FKLA 4EOKA 3CQEA 4QMQA 4Y73A 5AUVA 2PULA 2QOQA 3QGYA 3QKKA 4MKCA 1GZ8A 3I60A 4U97A 4Y95A 4ANBA 4CT2A 3IOPA 2PUNA 3JPVA 4MWHA 2KULA 4EK3A 2I0EA 4TWOA 4UN0C 3GU4A 5AV4A 2BZIB 4CV9A 2R4BA 3BEGA 4CZUA 4KB8A 3CSVA 3UIUA 5EKOA 3A7IA 4XS2A 4FTNA 3GQIA 3VBQA 1H1WA 1KE5A 4Z7GA 3CLYA 5E8YA 1Q99A 4JG6A 3VHEA 3CS9A 2OH4A 3QCXA 4QP9A 4FKVA 1Y8YA 3MWUA 4FZ6A 4TWCA 4F9AA 3A7GA 4YHJA 4A9RA 5AR5A 3CC6A 4FTAA 4JBQA 3FZ1A 3AC4A 2ZV2A 2CGVA 3DA6A 1YVJA 3HECA 2OK1A 3DAEA 2P4IA 3H30A 5LVOA 2XK9A 4JAJA 4FGRA 4RX5A 3RAWA 3OXIA 1UWJA 4RIWA 4V0GB 3W16A 3ENHA 2C6TA 4DEBA 4LGHA 3FLYA 4PV0A 3BYVA 2E9UA 1ZOEA 4K2RA 4RFYA 2X4FA 4YC8A 3N4VA 2J7TA 1YQJA 3BLHA 4KIQA 5HG5A 5K0KA 4DEGA 1KV1A 3V3VA 2XIXA 3GNIB 2BUJA 3FQHA 4CG9A 3E88A 1L3RE 3DQWA 4LV8A 5M53A 3KFAA 4NU1A 3S00A 4RA4A 3AMYA 1M2PA 3PIYA 2CN5A 3LMGA 3F88A 4G34A 4I20A 5E4HA 2JBPA 2XK8A 4LUEA 1ZZ2A 2W06A 5LVLA 4RGJA 2J51A 3DXPA 2CJMA 3R8ZA 2UZWE 3D0EA 4I5PA 3F5XA 4EONA 4CFXA 3LLAA 4IXPA 4RIYB 4ZTNA 3ID6C 4DH8A 2ITXA 3PE1A 4NIFB 4BCQA 4IB1A 3BE9A 1Q8TA 1FGIA 5KMIA 4I0SA 2CHLA 4IAYA 4OBPA 4FKWA 5GJGA 5K9IA 4L46A 3DJ5A 2R3OA 3W33A 3M2WA 3GCQA 3TACA 5FWKK 5IA0A 2ZB1A 4LRJA 4DCAA 3I5ZA 1GJOA 2OZAB 3DTCA 3QTUA 4FVRA 3U6HA 1PYXA 2B53A 1NY3A 2HW6A 2WB8A 4HNFA 1I09A 3EN7A 4IZ7A 4Q5EA 5A54A 3COKA 5TT7A 3O96A 2QO2A 3SX9A 4Q5HA 5IQFA 2VTAA 4FT5A 4U3YA 3AD5A 4AOJA 3FL4A 3FI3A 3QXOA 3F6XA 4MNEB 2Q83A 4WT6A 4P90A 4AG8A 2PWLA 3ALOA 4O22A 1Q5KA 2P2HA 4X6QC 1OL2A 1J1BA 3BZ3A 3CP9A 1CTPE 4LG4A 1M14A 4RVLA 5DNRA 4ZK5A 5M4IA 2YIYA 4FC0A 4TW9A 2B9FA 5EM8A 3VRYA 2C68A 2GNFA 4IVBA 4FTKA 4NZWB 4BKJA 2WTWA 4GU6A 4YNOA 2HZ4A 3VAPA 4FK6A 2J0KA 4U0IA 4X3JA 3Q6UA 3DY7A 2XCKA 2W1CA 1V1KA 1JKLA 1WBOA 1PXOA 3D5XA 1JOWB 1NVRA 5A6OA 4YU2A 4ZS4A 4J99A 4S31A 1LEZA 5KX8A 4FTOA 3NIZA 2PVKA 3R83A 2C1BA 5L6PA 5CAPA 3GP0A 2UW9A 3KULA 2C4GA 3PTGA 4XNEA 3OCBA 5KO1A 1PRYA 5CAUA 4I5CA 2WU7A 2Z02A 2NRUA 1HCLA 5TR6A 3GQLA 2RFEA 4ZSGA 4E4NA 3CTQA 4CV8A 1YOMA 4FV3A 3BLRA 1URWA 3W32A 3VF8A 5ANKA 2HZNA 3R7IA 3W1FA 2B55A 4RA5A 2QG5A 4QP1A 4QYGA 5ANOA 5EDQA 4IZAA 2X8DA 4OUCA 3GEQA 2VO0A 4NEUA 5C26A 4EOLA 4C35A 5LMBA 5AP0A 1REJA 2XBAA 3V04A 3QRKA 5DEWA 4R3CA 3ZRKA 3LJ2A 5HBEA 2OZOA 4USEA 3MA3A 1O6YA 4E20A 4O7WA 5JQ8A 4C36A 4O7RA 1S9JA 2C3IB 3CQWA 3R73A 2VNWA 5CEQA 2ZV8A 2OG8A 5IDNA 2R64A 4U79A 4WA9A 3E87A 4YURA 5A4CA 4JQ7A 4MD8E 4F65A 3BU6A 3ZEPA 4BTKA 3LFSA 5F94A 3QTXA 4ZTQA 1XH6A 4FSUA 3UQGA 4BCNA 2PTKA 3PZHA 4OTHA 4DH3A 4N4SA 2DWBA 5H9BA 3LHJA 5EKNA 2J0JA 3QQJA 4X3FA 4ZIMA 3RPOA 1YXXA 3SQQA 4BDEA 4C2WA 2C6LA 3WF8A 3EQFA 2I7QA 2QHMA 2C5XA 5AA9A 3R8LA 3RINA 4F09A 4D2WA 2ITNA 5HZNA 2YIWA 2ZAZA 3FYJX 4EQMA 4C2VA 4PTGA 4X2KA 4KABA 3VUTA 4E4LA 4X0MA 1B6CB 3ZONA 2QNJA 3LXKA 4D2PA 4MF0A 3V5QA 2BHHA 4D9UA 4BGHA 5AUXA 4IWPA 4U40A 4YSJA 3F3TA 3NNXA 5JH6A 1JKTA 2YEXA 1KSWA 4F7LA 3VN9A 4CFUA 4I5MA 5J79A 5CT7A 2XM9A 4N57A 1UNLA 3FKOA 4ZSLA 3OWLA 4YO6A 4G3GA 4X6RA 4QP8A 3DV3A 5L2QA 4NW5A 4PMTA 5GIOE 4O7NA 3DFAA 3PIZA 3OY3A 4FZDB 5FM2A 4MAOA 5HD4A 3ZBFA 4OTDA 5M07A 3UO5A 4YLLA 5E8XA 3JY0A 3UOHA 3RPVA 4AFJA 4ZTLA 4BDIA 3TNPC 1R0EA 4C38A 3KRLA 4E8AA 3GU8A 3SKCA 5DT0A 3A8WA 4QMZA 5CWZA 5G6VA 2FVDA 3NDMA 1ZYLA 4M13A 4NTSA 4R7HA 3HGKA 1UNGA 2GQSA 2LGCA 3ODYX 4MBJA 3QRTA 3ZSGA 3QZFA 3MFSA 3QUPA 4BTJA 1YI6A 2ZM1A 4A9SA 5M57A 3NEWA 5EYCA 4C4HA 4EOMA 3FPQA 1BKXA 3FL5A 3L9MA 4DH5A 5BYZA 4X2GA 4F7NA 3EOCA 4FVQA 3R7GA 4J8NA 3G5DA 2ZV9A 4QT1A 5HVJA 4MXZA 1ZAOA 1UVRA 2B9HA 4J7BA 2ZYBA 2XCHA 3CJGA 3MTLA 3ANRA 5CSHA 2PSQA 5C8MA 3QQLA 5HTIA 4OLIA 1U54B 3E8DA 4M7IA 4O0XA 5CAVA 2QU6A 5HVYA 3O8PA 1MRVA 3KN5A 4X7QA 4ZZNA 4PTCA 2XJ1A 4IVAA 2RG6A 2IJMA 4GCJA 4G3DA 1YRPA 4TNBA 1DAWA 1XH9A 4Y5QA 5HI2A 5HO6A 3SXRA 3ZRMA 4G3FA 4TYIA 4WG4A 4ZY5A 2Q0BA 1W82A 2YWPA 1TKIA 3FYKX 3HYHA 5CYIA 5KZ0A 3PA5A 2V22A 3I7CA 3UG1A 4DGLC 4OAVB 2WQNA 4QMYA 4YJPA 4FSRA 3AC1A 3KK9A 1FBNA 4KKHA 3MPAA 5HLNA 4ZJJA 1H8FA 3C4CA 4UMQA 3D7TB 1HOWA 5T6KA 3A60A 3Q4ZA 4ZTHA 4FSTA 1SNXA 3LOKA 4N6ZA 1M17A 2GNJA 3OT3A 3VQUA 1J7IA 5M06A 4PL4A 5DHJA 3PRIA 5CXZA 3HV4A 4C58A 5KBQA 5HIDA 2NPQA 2PVMA 1UU8A 3P23A 4M8TA 4GIHA 5TO8A 3EFWA 2XK3A 4D2TA 4XG9A 2BDJA 3A61A 2ITTA 5KBRA 3MIYA 3CCNA 4E5AX 2BR1A 2C3LA 3HEGA 4UX9A 3R1YA 5BPYA 3HP5A 3FI8A 4GG7A 4GK2A 5K5XA 2C6MA 3DXNA 3IOKA 3NIEA 3SXSA 3A7HA 5HICA 3F3UA 4G6LA 2C6KA 4U5JA 3HAVA 4BC6A 5J9YA 3ACJA 3TZ7A 4R5SA 5AEPA 3D14A 2C6OA 2PYWA 4D1SA 2DYLA 3W10A 3FLQA 4DCEA 4IJ9A 4UALA 4O0WA 5DH3A 1URCA 5C8KA 3EYGA 2HZIA 4FEWA 4NH1A 4ANOA 4GUEA 4LYNA 4ACHA 3OBGA 2QOCA 4BCGA 4JJRA 4BCJA 4YTCA 3QQUA 3FI4A 3NNVA 3OVVA 3NAYA 1BI7A 1GZKA 4ZTSA 4O0RA 4RJ8A 5HD7A 3RVGA 3TNIA 3ORZA 3HV5A 3LCOA 1PW2A 4TY1A 3HMNA 3ZLWA 4BWKA 4O7SA 5LVPA 5HORA 1NXKA 4KIPA 1Y91A 4F63A 3BBWA 3KREA 4C61A 2JKQA 3D4QA 4GUBA 2OH0E 3SV0A 2W05A 3QD3A 3TG1A 4CNHA 5HCZA 2FA2A 1NA7A 3QKMA 1GZNA 2ITWA 4EWQA 5AUTA 1K3AA 3FHRA 1YI4A 5KMMA 2GCDA 4MD7E 5HO8A 3KXMA 2VWUA 4A4XA 3D83A 3R1SA 3IDPA 2IG7A 4ZMFA 3AC3A 3BYUA 4UBAA 2WEIA 4DLJA 2PUUA 3NS9A 4N6YA 3Q6WA 4E6AA 4L68A 1UU7A 1VYZA 5CVGA 4A4OA 5EDPA 4EH5A 3NNUA 4CTBA 5CSXA 2A4LA 3KU2A 3D2IA 4RG0A 4AP7A 2JAMA 5IQAA 3U9CA 4Y8DA 2YFXA 3KQ7A 1WBWA 2UW3A 2XNGA 3JYAA 4F64A 3NCGA 4NFNA 3DAJA 3DNEA 3EFJA 4XRLA 3RTPA 2YDIA 3TZ8A 3L8XA 4AAAA 5HG7A 4FNWA 3PIXA 4ZAUA 5BNJA 4EK8A 3LQ5A 4WRGA 3HA8A 1ZZLA 2HZ0A 3GFEA 3IGOA 4H1MA 2JDRA 3MY0A 3W2CA 4QYFA 1XBBA 4XLVA 3DDPA 1LEWA 3MBLA 3KRXA 4RIXA 5T3QA 2WELA 4M0YA 1E1VA 4J96A 5G1XA 2G01A 2Y4PA 3FDNA 3Q3BA 1W84A 5M51A 4IX4A 4M97A 3GC8A 3UPXA 4QMVA 2Y8OA 2HWOA 3MS9A 4HYUA 2WZJA 4D5HA 2QKWB 4U81A 4U6RA 4D4VA 2ITYA 4QMWA 4CFMA 3OHTA 2QO7A 4UZDA 4F7SA 3HMMA 4AW2A 2G2IA 2O64A 4U43A 5A4TA 2F57A 5AJQA 1A9UA 3E8NA 4FSYA 5CI6A 5GZ8A 5A6NA 3K3IA 4BCIA 4AZTA 3IW7A 2BRNA 3ZSIA 4MQ1A 3QZIA 4FV4A 4KINA 4YTIA 4YLJA 3FHIA 2ZMCA 3FZPA 4FV9A 4G3EA 4IBMA 4EZ5A 1ERKA 5J1WA 3VUKA 3RAIA 4Z55A 3EH9A 4YJQA 2C69A 5J9ZA 4NM3A 1Q97A 4FL2A 4U9AA 2YZAA 2QKRA 4PF4A 5K0XA 2WMSA 4FKOA 3TKUA 3L9LA 1OIQA 3FV8A 4MBLA 3CKXA 3EMGA 2O0UA 4IC7A 2VTIA 2FSMX 4ID7A 3LE6A 2BFYA 2GTNA 2R2PA 5CF5A 3R6XA 4MXAA 3CPCA 4CXAA 2OIBA 2PL0A 3FE3A 3DLZA 3HRBA 4IAAA 3Q52A 4M14A 4WHZA 3RWPA 5IH4A 1ZMUA 4YTHA 5IQHA 5EM7A 2YCQA 3D94A 2O2UA 2R3JA 2X7GA 3QYZA 4FTTA 4YZMA 3PLSA 4IDTA 3KXGA 3PA3A 4HYIA 1CMKE 3MTFA 2W5BA 5KMOA 2Y7JA 3UIBA 3CY3A 4WNKA 4HCTA 3C51A 4G3CA 3OT8A 3GT8A 2CKOA 3OOMA 3DK7A 4QMSA 5FDPA 4KUJA 3PE2A 2H6DA 4D4SA 4R6VA 2RG5A 3E8CA 4I93A 1IA8A 4BDAA 4K11A 4RJ6A 3C0HA 4ENXA 4USFA 4QP6A 1JSTA 4XX9A 3ERKA 1OIYA 3A4OX 2R3KA 5K3YA 3UOLA 2PVYA 4YUQA 4WNOA 4YTFA 5DYJA 2J5EA 3BIZA 3GCSA 3RM6A 4D55A 3DK6A 5CSVA 2CKEA 1H1SA 4DG0E 4ZLZA 3ZRLA 2C30A 3LMIA 4R7BA 3QQHA 2WMRA 4M69A 3P79A 1XHAA 3EFLA 4Z3VA 3HX4A 1ZOGA 3B8QA 4K77A 4MXYA 4XOZA 5J87A 3ZMMA 3L8SA 4FG8A 5LVMA 4XG7A 2FH9A 3W8QA 2ITZA 4B6LA 3KEXA 4BZOA 5BVKA 4RLLA 1OM1A 4Y46A 4YC3A 3BV3A 1WVWA 4BBFA 3IG7A 5IG1A 2JDSA 4IVDA 1LP4A 2E9NA 3HV6A 3PA4A 3TNQB 3RI1A 3UNJA 4C3FA 3TTJA 4UYAA 1DM2A 2GFSA 3R9OA 4J53A 3FMEA 4CG8A 3O23A 1E1XA 1PYEA 3H9RA 4HGTA 4YSMA 4WUAA 4ZJVA 2W9FB 2R7BA 5AP2A 4GKIA 2PVJA 4EJ7A 1XQZA 2OKRA 4R78A 4DFBA 3TV6A 5A46A 3DKOA 5LCJA 3FXXA 4RVMA 4YC6A 4A06A 5J5TA 2VTTA 3TCPA 4Q9SA 4DFLA 1Y6BA 2F49A 5LVNA 4CKJA 3Q96A 2C6IA 5CTPA 2X39A 4CKRA 3MFUA 3V6RA 5IUIA 2VTNA 4FKRA 3RHXA 3LFDA 4O6EA 2PVRA 4QO9A 3G9LX 5HU9A 4IB3A 4GFOA 2E9VA 1PXMA 4GU9A 3UIXA 4QYYA 4XV1A 4K33A 5EW8A 3ZDUA 4DYMA 3Q9YA 3QC4A 5I9ZA 2IZUA 3BE2A 2ZMDA 3MH3A 4JDIA 3M1SA 3PVUA 2W1DA 2GDOA 4EOPA 4GVAA 3ZDIA 2IW6A 4ZJIA 5DG5A 2VTPA 3KXHA 3IKAA 1Q8ZA 1JPAA 1YDTE 3PPZA 3E92A 3IDBA 2RFDA 3FWQA 4QMOA 5DPVA 4Q2AA 5LMAA 4GVJA 2IW8A 2PU8A 3ALNA 2YCFA 3C4WA 5E1EA 2QONA 2R3HA 4AN2A 5ETCA 1SYKA 4EOJA 3QXPA 3TZ9A 5A4LA 5LMKC 1KE9A 2XIRA 4WSQA 5EG3A 2EB2A 2E9PA 3AMAA 3QL8A 4A7CA 2XRUA 2HYYA 5HIBA 2DS1A 4AOTA 4YJRA 5A4QA 4FV7A 3ITZA 2XNPA 3R9HA 4BDKA 4AE9A 4NYEA 4HGSA 3TTIA 1ZYDA 1ZYCA 2NRYA 4WD5A 3AXWA 4E6QA 3EQDA 3QQGA 2ZM3A 5JT2A 2OF4A 2XM8A 3F3VA 3MH0A 1OKVA 1QMZA 3KRWA 4OBQA 3HLLA 5C8NA 3O2MA 3F61A 2J50A 4MQ2A 4UEUA 4ACCA 4FEXA 1PKDA 4O2ZA 4DGMA 2Y4IB 2VRXA 2EU9A 2ETMA 5E9EA 5CU0A 3QGWA 2ITUA 1WMKA 4FT0A 3QWJA 3EB0A 2HIWA 4PL5A 4B9DA 3CJFA 4F0IA 4TPTA 1YWRA 4O1PA 5GINE 1OGUA 5FRIA 4O7TA 5BMSA 1BYGA 1YW2A 2DQ7X 2VNYA 4MH7A 4IM0A 5CU6A 5J1VA 5ANDA 4ZMEA 4DGOA 4PWNA 4M84A 3DDQA 2RIOA 5D7AA 5EYDA 4AW5A 4BDDA 2YIRA 4HVIA 2OWBA 4NK9A 5D11A 3UQFA 1LPUA 2GPHA 3OCSA 1P14A 3E63A 3ZH8A 5AADA 3KK8A 3JS2A 4OW8A 4N70A 5ETIA 1E9HA 4J8MA 5DR2A 5M4FA 3FSFA 5JRQA 5M55A 1WVXA 3KRRA 4GS6A 5IQCA 5A3XA 3I7BA 5EI8A 3QU0A 4B99A 3NVKI 4HW7A 1H1QA 4D1XA 3H3CA 1YXSA 5GZAA 4BWPA 4RJ4A 2YLFA 4FIGA 4YZDA 3LLTA 4RBLA 4CTCA 1CDKA 2X7OA 3I81A 4R8QA 3B8RA 5GNKA 3FXZA 3PUPA 4GFMA 4RZVA 5FTOA 2OI4X 3C5UA 4BIEA 3SD0A 2HAKA 4OBOA 4BGGA 3PPKA 3FKNA 5E7RA 3TDVA 2UZBA 2OGVA 4XHKB 2W4JA 3GFWA 2X8IA 3LW0A 3U8WA 2GHGA 4JIKA 4D0XA 4WBOA 1FMOE 4G9CA 3WARA 3G33A 2I40A 1OZ1A 4YZBA 4E7WA 3UYTA 2X4ZA 2G15A 3RHKA 1QL6A 2CLXA 1H01A 3V5WA 2QOOA 4CRLA 4D4YA 3AG9A 3R30A 3BKBA 3GXLA 3MGYA 2PE0A 3VS4A 4BI2A 3QRIA 4YPDA 4JX3A 3WF6A 3DJ6A 5KHXA 2CKQA 1J1CA 1GAGA 2XEYA 3PVBA 3KMMA 4CT1A 3CR0A 4V05A 2X81A 4GT4A 4K0YA 3GOPA 3RKBA 4GFGA 5JZJA 4L7SA 3D5WA 4RT7A 3QC9A 4C4EA 4ERWA 4EQUA 4FEUA 3DKGA 4Y85A 1O6LA 2PZPA 3FMDA 3ORTA 4E1ZA 5KNJA 2YWVA 3C4XA 3QLGA 3F2AA 3G6GA 4RLKA 1SNUA 5I3RA 3P78A 2R3FA 5CEOA 5FP5A 5IA3A 4IFCA 4AA5A 4FV2A 3OF0A 4EH3A 3NAXA 1O9UA 1QPEA 4E73A 3PLAE 3VUMA 4IB5A 1V0PA 2Z2WA 3R1NA 4LL5A 1Y8GA 4ALVA 4UWYA 3LCSA 4AT4A 5H8GA 3LQ3A 4C34A 2EXCX 4WIHA 3QAME 3EFKA 4XP3A 2FSTX 4DH1A 2IO6A 3FMJA 3UC3A 2W0JA 4LM5A 3HUBA 2IVUA 4L9IA 4TYHB 5FD2A 4HYHA 3ATTA 1JSUA 5M4CA 3AQVA 3NPCA 5CAOA 1V0OA 2XIZA 3MY1A 2W5HA 3QHWA 4FGBA 4JXFA 5C4LA 1PXIA 4CZTA 5J5SA 1H26A 3F7ZA 2BROA 4YPSA 2WIPA 5KCVA 4FL1A 3R8PA 3VUHA 5I5ZA 5D12A 5CSWA 3Q9ZA 3S0OA 3EN6A 3PJCA 4E4XA 4F9BA 3OG7A 4QP7A 4WSYA 2Z7LA 4Z9LA 3KF4A 3NW7A 3UVPA 3S95A 4BYJA 5AFVA 3FI2A 4QTDA 3A8XA 3G2FA 4NJ3A 2WXVA 2W17A 2W1HA 3KMUA 4FF8A 1UKIA 4JS8A 4KIOA 2VTLA 2QO9A 5CZHA 4S33A 5E8SA 3ZLSA 4BTFA 1NVSA 5KKRC 2GS6A 2VTJA 3R9NA 4BDBA 5IUHA 5L6OA 4FV5A 1H00A 5AUZA 5CXHA 3WYXA 2JBOA 2PK9A 2XKFA 5AR3A 4IADA 4I6BA 3F2RA 3WZDA 3RAKA 4BI0A 3AC5A 1VZOA 1ZARA 3IQ7A 4FSWA 1PMEA 4J95A 4QPAA 4DLIA 1VJYA 2R3GA 4HJOA 4I4EA 4QMXA 3IO7A 4QQ5A 4ANNA 2OXXA 3LXNA 5IEXA 1WAKA 3G6HA 3NYVA 3HDMA 4QTCA 2WEVA 4E5BA 2QG7A 5L6WL 2WTCA 3JXWA 4ZY4A 4F70A 4NKSA 5DIAA 2XJ2A 3NUYA 4B4LA 4DEAA 2I6LA 3PXKA 4KS8A 5AP1A 1BL7A 4AGCA 2WMXA 2UW8A 4BCHA 4CFVA 4H58A 3QRJA 4FTRA 1PHKA 4EQCA 3SVVA 4ITIA 2B1PA 2IZTA 4O0VA 3MVJA 3MV5A 4D4RA 4EYMA 2R9SA 3VF9A 2WQEA 4QMMA 2UZLA 3TUDA 4CMUA 4DTBA 4MK0A 2BHEA 2CNVA 3MDYA 4L8MA 5KUPA 2WU6A 2PE1A 4ZS0A 2WIHA 1S9IA 2EUFB 3MESA 3P7CA 2ACXA 4UMTA 4HPTE 2QOIA 4L6QA 1FQ1B 3BCEA 3NGAA 5F1ZA 4EK4A 3VJOA 4AE6A 5LMKA 4RIOA 1H28A 1SVGA 3EL7A 2GNGA 3R7VA 3VNTA 4EUUA 2XEZA 4L01A 5HTBA 2YAKA 4M66A 2WOTA 1DI9A 3IK3A 4P4CA 1GY3A 4FIHA 3P5KA 3DK3A 4Q9ZA 3GU6A 4MXXA 4BB4A 1SM2A 2IN6A 2CCHA 3LVPA 3IW5A 4CZYB 3TDWA 4NKAA 3D15A 4DFUA 3OP5A 1WBPA 3H0ZA 4Y72A 4XH6A 4F0GA 4FR4A 3R8UA 1P4OA 1AD5A 5CS6A 3EJ1A 3PG3A 4A9UA 2E2BA 4IACA 4FV8A 4BIBA 4G16A 5D9HA 4EBVA 4QOXA 4U44A 4TWNA 4UYNA 3KGAA 1KV2A 2OO8X 4L45A 5B2LA 4QP4A 5L2WA 4RZWA 4FTCA 4AA0A 4D5KA 4CQEA 4RQKA 4C3RA 4G5JA 4JT3A 4WBBB 1FPUA 4YR8A 4MX9A 3S2PA 5JEBA 2DUVA 3LXLA 4FX3A 4FVPA 4OGRA 2AUHA 3SW4A 3P08A 4BKYA 2JKOA 4YZCA 4GEOA 1XH7A 2UZEA 3JR1A 3UOKA 5KMJA 4RX8A 4AW1A 5KMKA 2Y6OA 5C27A 3FY0A 5HCYA 4ACGA 4TL0A 2PUIA 3QD4A 4Y5HA 4BBEA 3LAUA 4D9TA 5CEIA 3PDTA 4JDKA 1B38A 4FKJA 4D28A 5CI7A 4CFNA 3EQHA 4BI1A 4CCBA 4E6CA 4CVAA 3HAMA 5HCXA 4YBJA 3L8VA 5AV2A 5CF4A 4GIIA 3D9VA 3VS3A 3NUAA 4RJ5A 2QD9A 2W1FA 2WMWA 2YHVA 2ZDUA 3DFCB 5FEDA 4G9RA 4D2SA 3QALE 4O7VA 1CKJA 4C0TA 2F7EE 3JUHA 3N9XA 2CPKE 4M67A 2W5AA 2QOHA 5HNBA 3NW5A 3R04A 5EYMA 2IWIA 4K1BA 1KOAA 2XMYA 2VWYA 2B0QA 5I4NA 4QD6A 2YLEA 3GC0A 3PZEA 1J3HA 2B9IA 4BRXA 3I6WA 3KY2A 5JGAA 5L3AA 1XH4A 2VO3A 2JDOA 4XEYA 4KNBA 2W99B 2W4OA 4XOYA 3ULZA 1J91A 3ETAA 4PL3A 5DLSA 1MRUA 4ZP5A 2VZ6A 5JFWA 4HYSA 4ZSEA 5DBXA 4EHZA 1NW1A 4IMYA 5CVHA 1OECA 4EWHA 2VTSA 2XUUA 3LFQA 3HKOA 5AR4A 4LOOA 4MEDA 2IZRA 4ASDA 3RWQA 5FXRA 3DKFA 1F5QA 1H0WA 2A27A 1PKGA 2Q0NA 2Y6MA 4UZHA 2Y9QA 1CM8A 5GIPE 2BMCA 1H27A 4FNYA 3TM0A 2GTMA 3IS5A 3JVSA 1IR3A 3TN8A 3FJQE 2YJRA 4PY1A 2H34A 3CBLA 4AZWA 3MH2A 3CEKA 4NCTC 5J95A 5CZIA 4AA4A 4ZSAA 3TUBA 3Q32A 4K18A 5HNGA 1WZYA 4CLJA 3C0IA 3QUEA 3KCKA 4W9WA 2YABA 4J1RA 3B2WA 2PVFA 2XIYA 3MVLA 1Q24A 2B4SB 5CU2A 2WTVA 4IWOA 5ANGA 4O86A 2HY81 5IPJA 2UV2A 4EHGA 3W55A 3RK7A 1H07A 2JGZA 3M11A 4FG7A 3SRVB 2WGJA 5C03A 3FLWA 5C4KA 2PHKA 4OTRA 3DB6A 4RWJA 2Z7RA 4X2JA 4TNDA 2YDJA 2WD1A 3MVMA 3AT4A 1DAYA 5L2IA 3E3PA 4WO5A 2O5KA 4LL0A 4NUSA 5AUWA 4DEIA 4YP8A 3RCDA 3MB6A 4ONAA 1FVVA 4V01A 1XH8A 3BLQA 4ACDA 2R3LA 3QFVA 1YDRE 4FI1A 3MPMA 1FOTA 3EN5A 1QCFA 2J90A 2JIIA 2YM4A 4FKSA 2C0OA 3OWPA 4KD1A 2F4JA 4IHPA 4ARKA 3OS3A 5CEPA 3MN3A 3TNWA 4A9TA 3DZQA 5B2KA 4PMPA 3WYYA 2JFMA 2UUEA 4IX3A 5IKWA 4FYNA 4F08A 4DF3A 3RPSA 2OSCA 2EVAA 3ORXA 3BQRA 4UXQA 2YAAA 4QYHA 5ETAA 3VS6A 2C5NA 2OJIA 5IQGA 4CD0A 4UB7A 3R28A 4XG8A 5BVNA 2VWXA 2PPQA 4QNYA 4CEGA 4J98A 4W8DA 3W2PA 4C02A 1P2AA 2H9VA 3G51A 3MY5A 4OTPA 4KKEA 4KSQA 2BTRA 4QMPA 5DFPA 5HE3A 4BZDA 5K4IA 2CMWA 4IAZA 4KIKA 5CY3A 4C33A 1ZYJA 3UGCA 2X7FA 3OBJA 3NW6A 5M56A 5I9WA 4II5A 2WMQA 4ZXTA 2YERA 3QF9A 2E9OA 3RK9A 3F9NA 4DTKA 3KVWA 5CVFA 1Y57A 3ZO4A 3T3UA 5AWMA 3QTRA 2QR7A 4FKQA 2BRBA 4EH9A 4CQGA 5JK3A 3CIKA 4R1VA 4RWKA 2QOBA 1JVPP 5BX0A 3K3JA 2UZUE 5FP6A 4MWIA 5A4EA 4QQJA 1UU3A 1PMVA 4QMNA 4YJTA 1BLXA 2PMOX 3VRZA 2Z8CA 2QCSA 3RM7A 1Q8YA 2C6EA 4MVFA 4EUTA 1OBDA 5FUTA 3UOJA 5IA2A 4LQMA 4GT3A 3IW6A 3BYMA 4H3PA 3NZ0A 3OW3A 4L7FA 5BUEA 4G1WA 3NWWA 4OAUC 4O82A 4FTUA 2BKZA 3PWYA 4BCMA 3O17A 2HW7A 2VTQA 3OW4A 3ZC6A 3EQRA 5C01A 1OIRA 5FLFA 4FTMA 2OW3A 4HOKA 1PY5A 3ORPA 3DTWA 4AOIA 4JI9A 2G2HA 3II5A 3LFFA 2VTHA 3VS2A 3U6IA 2ETRA 4PPCA 1RQQA 1RE8A 4RIWB 5JFXA 2ONLC 4D1ZA 4MD9E 4DAWA 4XBUA 4OTFA 2LAVA 3HL7A 3ORNA 4FG9A 1RW8A 5CSPA 1TQIA 1H4LA 2WTKB 3VW8A 2VX0A 5AX3A 2UZOA 4IAFA 2ERZE 2J4ZA 3HP2A 4V0GA 4E6DA 1X8BA 2IVTA 1JNKA 3E5AA 5AR7A 1OIUA 1WFCA 2QLUA 3HNGA 4XYFA 5LCKA 4AFEA 5IQEA 4UV0A 2YM5A 3UYSA 4R3PA 2GQRA 3T9IA 4F1OA 1H25A 4NTTA 3AD6A 3BYSA 2X2MA 1KUTA 4FICA 4FIFA 4EH6A 2AC5A 5FM3A 3QA8A 5ACBC 4FZ7A 4AZFA 1L8TA 3RNYA 4FKUA 1PMUA 2X6EA 1H0VA 3O7LB 2BDFA 5LJJA 3OUKA 1RJBA 1TQPA 2B7AA 3NYXA 4I6HA 4KWPA 4I6FA 5JKGA 3ZZEA 1UV5A 1Y6AA 2FUMA 4RC4A 5CX9A 4PP9A 5DI1A 4FKGA 3NR9A 2CGWA 3BX5A 4G31A 3K5UA 3NSZA 3EZRA 2WMAA 4JX7A 3DU8A 4RX7A 4HCVA 4KBAA 4RIYA 3LM5A 3V5TA 4C4FA 4TWPA 3QTSA 4NIFA 3N4UA 4EI4A 4F9WA 2JKMA 2I0VA 2P0CA 3NX8A 2BILB 2UZDA 3I4BA 3EWHA 4YLKA 2J6MA 3QTZA 2UW7A 4H36A 4O83A 5GZ9A 4NSTA 2VV9A 1APME 3UZRA 5JGBA 2OZAA 4BN1A 5DT4A 5DA3A 1U59A 3VUDA 2XZSA 4BCKA 3POOA 5E8UA 4JLCA 4XV3A 4RC2A 3H10A 2X8EA 1Q8UA 3R22A 5EK7A 3D5VA 2XKEA 3R9DA 1SVHA 4LMUA 2R5TA 3OUNB 5IUGA 3F5GA 3UBDA 3VC4A 4MNEA 4YJSA 4UMRA 3EQCA 3FLNC 5JN2A 3SG9A 3COMA 2VWZA 3MFRA 2C3KA 1Z9XA 3K54A 5TF9A 4BCPA 4EBWA 3V8SA 3PXYA 2WQBA 4I4FA 2OFVA 3KL8A 3QBNA 3OFMA 4CFFA 4IQ6A 1CKPA 3CY2A 3FMNA 5HLPA 4E93A 3C4EA 5HHWA 2C5YA 3FZTA 3IW4A 4FEQA 1JKKA 3UMXA 4NL0A 4EH4A 3R1QA 3KULB 3I0OA 3VJNA 4AXAA 4KBCA 3E93A 3NUUA 3V51A 2XA4A 4DH7A 3SOAA 4JRNA 4R3RA 2XJ0A 3FBVA 2QOFA 3OMVA 3QYWA 3R8VA 4IANA 3R63A 4B0GA 4DG2E 4PDSA 1OPLA 3AGMA 3NUPA 3TEIA 3UP2A 3PP0A 3TKHA 3W2QA 3A4PA 1BUHA 4B8MA 2B54A 3RP9A 3DB8A 3R0TA 4EOSA 2WMBA 3NUNA 3ZEWA 3UE4A 4BDHA 2YN8A 1YXTA 2OXYA 3UNZA 2YA9A 2P55A 3PG1A 5BYYA 2JDTA 3VBVA 1DI8A 5DGZA 4GW8A 5EOBA 3R71A 4FKIA 3GB2A 3OTUA 1GZOA 3DAKA 4U3ZA 4DN5A 5HBJA 4GYIA 5EHOA 3OC1A 2BFXA 4EOIA 2Y0AA 2XIKA 1R1WA 1IRKA 4IWQA 3ZFYA 5K5NA 4YGAA 1CSNA 3BI6A 4X3FB 5EDRA 3P4KA 2BDWA 5L8LA 4FNZA 3I0QA 3CKWA 3DBEA 4M3QA 5CNOA 3O8UA 2J2IB 4KSPA 4U42A 4YZNA 2XKDA 1O6KA 4R5YA 1U5QA 2IVVA 4TYGA 5DR6A 1YOJA 4EOOA 5TOZA 5EI6A 1IEPA 3THBA 4QPSA 5IA4A 1UA2A 4PDPA 4HZRA 4I41A 2IZSA 2R3QA 5AR8A 4F0FA 3OD6X 4E5WA 3FZRA 4AQCA 4KBKA 4BHZA 2BVAA 3DBFA 5ICPA 2X1NA 5D1JA 4P7EA 2QOKA 4NM0A 4LV5A 3H9FA 3R01A 2O3PA 1K2PA 4H39A 4MYGA 1XWSA 4AZEA 2B52A 3S3IA 4TXCA 5IQBA 3W8LA 3WZKA 2W7XA 5BYLA 4PMSA 3BHVA 3F5UA 3SA0A 3KB7A 4LOQA 3AGLA 3TJCA 5BVFA 2UZNA 3LFNA 3OROA 4BVUA 2G9XA 1SZMA 3FMKA 4RFMA 4IAIA 2XF0A 3AD4A 4RJ7A 4FT7A 5D10A 3V5JA 4DITA 3QHRA 2JC6A 5H2UA 3UO4A 2GNIA 1PXNA 3BELA 2V7OA 4WUNA 5AIKA 4O7LA 2BAQA 3E62A 4BF2A 2JIUA 1OB3A 2J0IA 2R3IA 3F2NA 2XK6A 3I79A 4U45A 4ANMA 4C37A 2RSVA 2R0IA 1KWPA 3FLZA 3I5NA 4YJVA 4EHEA 5HQ0A 1OL5A 5HOAA 1JWHA 4U41A 2GU8A 2XNOA 4O38A 4QMTA 4C3PA 2PVHA 4GV1A 1W83A 4FUYA 2W1ZA 3HUCA 3ZO2A 3FPMA 3ZU7A 3EKKA 4WOVA 3IONA 3PFQA 2R0UA 2X2KA 3I1AA 4XBRA 2PMNX 3HV3A 3JY9A 3VW6A 4F1TA 5AV1A 3OY1A 5LWNA 1MQ4A 3P7BA 4BBMA 3VUIA 5DMZA 5AUYA 1YHVA 3Q9XA 3K5VA 4ANQA 4AW0A 5C1QB 2WKMA 4AT5A 3FLSA 3UDBA 4ZLOA 4X21A 4FZFB 4QQTA 4LUDA 5EH0A 4DGGA 3SDJA 5AP7A 3UG2A 4RFZA 3TI1A 1TVOA 2BIKB 1PXJA 1U54A 1OUYA 3OCGA 3P9JA 2ZDTA 4LRMA 5BMMA 2OIQA 2HY0A 3MIAA 4FBXA 4O91A 4PX6A 3QCSA 4BCFA 4O21A 1OKYA 3BWJA 4JIAA 1J7UA 1ZOHA 5BUJA 2X9FA 5IH5A 3EQGA 4BWXA 4FIJA 4I3ZA 5E92A 1XBCA 2CKPA 2AC3A 3HVCA 2PVLA 3QA0A 3VVHA 3BV2A 4FOBA 5BQ0A 3PWDA 5D7VA 4CKIA 2WTJA 2F2UA 3WF7A 4D0WA 1FVRA 2C5VA 3GI3A 1ZMVA 1LUFA 2BRMA 2F9GA 4BDCA 3D7TA 1R3CA 2O8YA 4IX6A 2XB7A 3FKLA 1BI8A 3ZSHA 5TE0A 3PY3A 3WBLA 3KRJA 4KA3A 5AX9A 3T9TA 3WOWA 5K4JA 4TYJA 4J71A 4QNAA 3ATSA 5JMSA 4WG5A 4OT6A 2CGXA 3COHA 3VO3A 2Z60A 3KN6A 3ZO1A 4GJ2A 1IA9A 3UIMA 2JIVA 3R2YA 3LFAA 5BVEA 4DINA 3QQKA 1GIJA 2VGPA 1WBSA 5AP3A 3A7FA 1YKRA 4H05A 2FB8A 2YACA 4HVSA 5IQIA 3TNHA 2JITA 4O0UA 3UNKA 2BTSA 2BAKA 5FTQA 1OI9A 3O71A 2HELA 3NUSA 4LOPA 4NM7A 4APPA 5ACKA 5FEQA 3G0FA 3AT3A 2BZKB 4FIIA 3ZCLA 1P4FA 1VYWA 5I9UA 5EM5A 4NM5A 3FMLA 4B8LA 3PJ2A 4ZZMA 4FTQA 4D2RA 2I0HA 2J0MB 4GYGA 2CNQA 5ANJA 3VS0A 1H08A 3IW8A 3QLFA 1ATPE 4XG3A 4W4WA 3GCVA 5L8KA 4LGGA 1ZWSA 4IDVA 1PF8A 3EZVA 4FL3A 5DR9A 3TZMA 1XR1A 5KE0A 1KE7A 3UZPA 3REPA 2UVYA 3Q60A 2G2FA 2RFSA 3TJDA 4D2VA 4IW0A 5CEKA 2UW5A 3UODA 4K9YA 3F82A 1XJDA 2WAJA 4DBNA 4GMYA 4R1YA 5CASA 2UW0A 3GBZA 3KKVA 3Q04A 4I1ZA 4UY9A 4CYJA 3GCUA 4O81A 4KKGA 1SVEA 4N0SA 5JRSA 3NCZA 3O0GA 2OF2A 4IFGA 4F4PA 4P2KA 2W4KA 3DPKA 1BX6A 4LI5A 5HO7A 5AIRA 3C1XA 3NNWA 5CT0A 5JZNA 3BGQA 3MW1A 2XVDA 1MP8A 2XBJA 3W18A 4D58A 3MH1A 3U54A 3A99A 2NNWB 2P3GX 3RAHA 2VTOA 4AU8A 2Y4IC 4DC2A 3ZS5A 3DBDA 1W7HA 3NRMA 2WMTA 4YBKA 2R3RA 3C13A 4S32A 3E3BX 3MI9A 4IEBA 2UZTA 2WTDA 3DOGA 4ITJA 1J7LA 1NT2A 4L42A 5FXQA 2BALA 4E4MA 5LXMA 4H3BA 3TV4A 5HIEA 3PJ3A 2VTMA 4RIXB 4JDHA 5L2SA 4AGWA 4NJDA 3SOCA 3CD8A 5T68A 3UZTA 3U4UA 5EW3A 3WZUA 5AV0A 4MNFA 5CQWA 2PMLX 4FA2A 4I24A 4FKPA 4PUZA 2JLDA 4BDGA 3R02A 2GS2A 4WNMA 5DEYA 4PDYA 1OL1A 3OZ6A 2GHLA 3CE3A 3LJ1A 4OTQA 3TWJA 5LARA 1U46A 3KMWA 1PMNA 4I92A 1T45A 3WE8A 5BVOA 2QODA 3P0MA 4G2FA 4XP0A 4C7TA 1JAMA 4Y83A 3UVQA 3TKIA 4M68A 5IISA 1SMHA 5J7HA 4QTAA 2RFNA 4S2ZA 2VWIA 2NP8A 5JFSA 3AC2A 2GNHA 2RL5A 4OT5A 4PQNA 5CANA 3LMHA 1JKSA 4O96A 3BPRA 4E3CA 4F6SA 2C3JA 3BHYA 2QR8A 4YZ9A 4AGUA 5EHYA 3HV7A 3BU5A 3CTJA 3CGFA 4FZAB 3R7OA 1OKZA 3H4JA 2AYPA 3OCTA 3QX4A 3LCDA 3A2CA 3L8PA 4IIRA 5HE2A 3SLSA 5EQPA 2W9ZB 3PP1A 5FXSA 4FTIA 3GENA 5DT3A 4HCUA 4HVHA 5JGDA 3NVMB 2CDZA 1OVEA 3VS1A 3FQSA 4FSNA 3O7LD 3V6SA 3HMIA 5HTCA 2OJGA 3C4FA 4GSBA 2O65A 4O0YA 1R78A 3Q9WA 3ZTXA 4EK5A 1W0XC 3QTQA 3IDCA 3FEGA 4F9CA 3E64A 4W4YA 4CGAA 3F7WA 2QC6A 3N51A 4LGDA 3EQPA 4AX8A 4F9YA 1ZXEA 3MYGA 5E8VA 5IU2A 2CLQA 4L67A 2XNEA 4CFWA 1OL6A 3V5LA 3M42A 3OEZA 3QWKA 3UJGA 3ZFMA 3ZLXA 5AAFA 2QLQA 3GOKA 3QUDA 4MCVA 4RVKA 5HE0A 2W1EA 5LOHA 1PXLA 2YCSA 3EQBA 3OEFX 3FXWA 3MFTA 4M15A 4QYEA 4ANLA 4DFNA 3VBXA 2UW6A 5C9CA 4EH2A 5IMEA 2PUPA 2WHBA 4EEVA 3HZTA 3TIZA 3D7ZA 2C5OA 3C50A 5AA8A 1Q62A 2ITPA 4BY9E 2A1AB 4C4IA 4AF3A 4ZTMA 2BZJA 5EI2A 4NWMA 2KTYA 3L9PA 4JNWA 3FY2A 1ZY4A 2BCJA 4LRKA 4M69B 4A07A 2PZYA 4J52A 4RVTA 3R00A 3IPHA 3DT1A 3VS7A 1YXVA 4IE9A 4OTGA 2PVNA 2YITA 3SHEA 5J7BA 3UQCA 1IAHA 3SG8A 4EJNA 2R7IA 1OPKA 3A7JA 3QD0A 4RC3A 4F1MA 3GUBA 2QQ7A 3C0GA 4I6QA 3UC4A 2IW9A 1H1RA 5A9UA 1B39A 4IAKA 4BL1A 4MF1A 4GK4A 4DFYA 1Q41A 3EN4A 2XYNA 4EKLA 4DE4A 4HVGA 4ACMA 3V5PA 3POZA 3GCPA 3RPRA 3FC2A 4OTIA 3UTOA 4EC8A 1GIHA 4P5ZA 4QP3A 5GJDA 3K2LA 5EFQA 4ZEGA 5CF6A 1IG1A 3ZO3A 4FT3A 3ROCA 2ZV7A 3Q4UA 3FMMA 2QU5A 2X9EA 4L00A 1M2RA 2OBJA 3BWFA 2YIXA 4P5QA 1QPDA 3BQCA 1R0PA 5ITAA 2PE2A 5AAGA 4LMNA 3R9RA 3LPBA 2CN8A 2J9MA 2NO3A 3FZSA 4R7IA 4GH2A 2GMXA 1YDSE 3BGPA 4DEHA 4EKKA 5HX8A 4XLIA 4XV2A 1OPJA 4HPUE 2XS0A 5H8BA 4C62A 1OKWA 4DHFA 5H3QA 4Z16A 3LQ8A 4BCOA 4JBPA 3CXWA 3CD3A 1VR2A 3LFCA 5GJFA 3LZBA 4DG3E 3ULIA 3QTIA 3ZM4A 4ZZOA 3IECA 2RGPA 2G1TA 3JVRA 3VQHA 4W4VA 2A0CX 2XP2A 4XMOA 3VBYA 5HVKA 3R8MA 4EYJA 4G6OA 4BDFA 3S1HA 3COIA 3KXXA 1STCE 5KMLA 2ZB0A 5ETFA 5FG8A 5ANIA 2A2AA 1IAJA 4F6WA 4L52A 4YJUA 4FE2A 3R7EA 5L2TA 3RK5A 2PZIA 4EL9A 2JFLA 2UVZA 2ESMA 4BR3A 3MJ1A 4MXCA 4TTHB 3DKCA 2GFCA 3EYHA 3C5IA 5E1SA 3MB7A 3PVWA 1W98A 1ZY5A 2CSNA 2F2CB 2OICA 3O8TA 3PSCA 5B2MA 5JQ5A 3RCJA 3MVHA 1RDQE 5IEVA 1YXUA 3NMUF 5HGIA 4QP2A 2PY3A 4JBVA 3RALA 2GQGA 4W8EA 3EIDA 4O2PA 3F3ZA 2QVSE 1VEBA 5F9EA 1F3MC 1UNHA 4S30A 2ZOQA 1Z5MA 3U87A 3S4QA 4A9YA 4XG4A 3RPYA 4AN9A 4O84A 4OR5A 1XH5A 2BRGA 4RSSA 4FSQA 3SW7A 2OLCA 4DFXE 3VBTA 4FTLA 1A06A 4BFMA 2H96A 1KE6A 2C1AA 3PJ8A 4UMUA 3EQIA 5F95A 3KXNA 3UVRA 3W2SA 3EHAA 3DJ7A 4QQCA 5I3OA 3UMWA 4GG5A 2YCRA 2VO6A 2IPXA 5EYKA 2BKKA 3Q2MA 4ASEA 3ZLYA 5BVWA 3VS5A 4C57A 1F0QA 3R7YA 5JSMA 4IJPA 2VX3A 3FMHA 1PXKA 4RPVA 3L9NA 4DGNA 1OUKA 3U4WA 3U51A 2GS7A 3SC1A 1JSVA 1GIIA 4V04A 5HESA 5J8IA 3DBQA 3VWAA 4GKHA 1H24A 3WIKA 2JD5A 3RJCA 3G0EA 5E8TA 3F69A 5EQYA 4QRCA 2QHNA 2EWAA 2RF9A 4WKQA 4BYIA 4EC9A 4UMPA 1OBGA 4TN6A 4KRDA 1ZYSA 2FO0A 3GGFA 4L3PA 4O7ZA 3FUPA 4PP7A 3GU5A 5HX6A 4ZTRA 1JQHA 4IZ5A 5DVRA 1UWHA 5CQUA 1WVYA 2VWVA 4CCUA 1CKIA 4ZLYA 5HG9A 4ENYA 4BGQA 3CTHA 4L53A 4G17A 3PY1A 4FV1A 2OFUA 5AR2A 5BVDA 4UXLA 4CSVA 4EZ7A 3W2RA 4GL9A 4I21A 2JKKA 4RX9A 4U8ZA 4EH7A 3FQEA 3ZOSA 2UVXA 3LXPA 4JR3A 4XUFA 5B0XA 1K9AA 5IQDA 3ROYA 2VN9A 4K6ZA 3OWKA 4FIEA 5AMNA 1M7NA 4QMUA 4XG2A 3QX2A 4HZSA 4FEVA 3PY0A 5FGKA 4OTWA 5HLWA 4I5HA 3BHTA 4IZYA 4W4XA 2YZLA 2VWWA 4A4LA 5EW9A 4J97A 5I9VA 2HWPA 2OXDA 4HVDA 2X2LA 4TRLA 2BAJA 2FYSA 3LCTA 3ZXTA 3P1AA 1A48A 4O27B 2F7ZE 3RZBA 1U4DA 3LFEA 1G8SA 3GC7A 3QD2B 2EXMA 1PJKA 2UW4A 4PPAA 5CLPA 3V8WA 3WE4A 3ZFXA 4BDJA 3I6UA 1BL6A 1IASA 3Q5IA 5E90A 4X2FA 4C59A 1ND4A 3WILA 5EM6A 3E7VA 2OJFE 3LM0A 2W1GA 2XKCA 5HG8A 4MXOA 1PXPA 4FK3A 4JOAA 1M2QA 1KOBA 3NYNA 5CU4A 3SXFA 3BHUA 3HMPA 4DTAA 3DGKA 4IX5A 3CQUA 5DN3A 4YMJA 5E8WA 5IDPA 2QI8A 4B7TA 5M08A 4H3QA 1M7QA 1G3NA 4FTJA 4TYHA 2P2IA 2CCIA 1OITA 2OJJA 3AC8A 3ET7A 3QCQA 1WCCA 5E91A 4AZVA 4F6UA 2QURA 4XV9A 4FV6A 5J9LA 3PXFA 4G5PA 2WNTA 4FSZA 4ITHA 4KAOA 5KHWA 4O7YA 5AM6A 3HA6A 4I0RA 4WG3A 3EL8A 3ORMA 4FSMA 2ERKA 4FOCA 5FBNC 5CALA 1YHSA 1Q3WA 3VULA 5IEYA 1MUOA 2YM3A 3KC3A 3ZC5A 3ZYAA 3F66A 5TKDA 2ETKA 3DNDA 3OXZA 5FTGA 4RMZA 2HOGA 5LQFA 4AN3A 4R77A 4L43A 3OOGA 2ZJWA 4BKZA 4DT9A 2WMVA 1MQBA 1Q8WA 4GJ3A 4IB0A 4HNIA 3Q4CA 2W1IA 4JDJA 3ANQA 2YIQA 4FV0A 1YWNA 4M0ZA 2C6DA 4JG8A 4E26A 4L44A 1AQ1A 3ACKA 4M12A 2GHMA 4RWLA 2VAGA 4GK3A 3VBWA 4O0SA 2EB3A 2PZRA 2XRWA 3AOXA 2BRHA 2JDVA 2J5FA 4NFMA 3LKMA 1Q4LA 2V0DA 4DEDA 2FSOX 3BEAA 1M52A 3OXTA 2XNBA 3W2OA 3QQFA 5HKMA 4FT9A 3WF9A 3R7UA 4ORKA 3F3WA 4DFZE 2WO6A 4APCA 1ZLTA 3PRFA 1MRYA 3GC9A 3LFBA 2C47A 4AWIA 4O1OA 5DOSA 3D5UA 5HBHA 3ZZWA 3DS6A 4K8AA 4KS7A 2REIA 5DRDA 3UPZA 4I94A 2Z7SA 4W9XA 1P5EA 1Q3DA 3ZUTA 2VU3A 4NCTA 4C8BA 2F7XE 1FMKA 2HXQA 3PSBA 2HCKA 5CENA 5EOLA 3C9WA 3LCKA 1ZRZA 3KXZA 3UO6A 2XK4A 3BGZA 2P33A 3PPJA 3O50A 4EZ3A 5L8JA 2IVSA 4TKSA 4IM2A 2PZ5A 4PNKA 3ZXZA 4F7JA 4QTEA 3NYOA 4QMLA 3PSDA 1I44A 3G15A 1ZMWA 4PRJA 4TYEA 4JRVA 2VWBA 3O51A 3AT2A 2Z7QA 3V01A 3PXRA 1QPCA 3BRBA 4C4JA 3OWJA 5CF8A 3MA6A 3WZEA 1AGWA 5I0BA 5F4NA 4XJ0A 4CYIA 3PXQA 2WTIA 3L1SA 4DT8A 3DQXA 4JVGA 1YI3A 4ZOGA 4AT3A 4NT4A 2EXEA 4RQVA 2VUWA 2VTRA 3FZOA 3KVXA 3U55A 4HGEA 4YO4A 4L3LA 5H8EA 2ITQA 4IVCA 5EHLA 3TV7A 3HRCA 1WBNA 5AAEA 3OTVA 5CEMA 4FKTA 3KCFA 2WTKC 3N4TA
chains in the Genus database with same CATH superfamily
4U80A 3PJ1A 5AV3A 2I0YA 2UZVA 3ORIA 4PDOA 4BICA 4X2NA 4BZNA 1HCKA 1WBTA 3Q4TA 4ALWA 1Z57A 4JQ8A 4WRSA 4CLIA 4YJNA 3QRUA 2I1MA 2FSLX 3RZFA 4H1JA 2WQMA 1REKA 2XYUA 5D41A 1NVQA 4RJ3A 4CMTA 2OU7A 4USDA 4XP2A 5ANEA 1KE8A 5M44A 3H0YA 4UWCA 4CMOA 5HE1A 2XALA 2V62A 3Q53A 4QPMA 1OMWA 4YJOA 3LJ0A 3RBWA 4Z7HA 2WQOA 3QKLA 2GNLA 2YISA 2HENA 2ZVAA 3G90X 3HRFA 3TXOA 3BU3A 1UU9A 3FSKA 4CRSA 4YHFA 3WIGA 4BIDA 4JR7A 1T46A 2RKUA 5AP6A 3SAYA 1YHWA 2ITVA 3ORKA 3Q5ZA 4IM3A 3DCVA 3R21A 5KZIA 4BTMA 3NUXA 2SRCA 3BHHA 3FAAA 3WZJA 4AS0A 5IZFA 1GNGA 5M09A 5HU3A 2C0TA 2XH5A 3PXZA 5JFVA 3T8OA 4ASXA 4JAIA 5IA5A 3U6JA 4ANSA 4EH8A 4IH8A 5A14A 2WPAA 3DZOA 3LIJA 3F5PA 3ODZX 4G6NA 4TT7A 4JQEA 1FVTA 1YOLA 2JAVA 1FINA 2VO7A 4HGLA 5I9XA 3MJ2A 2R3MA 5DE2A 5IMXA 2HK5A 1JBPE 4I23A 3RGFA 2YM7A 2B9JA 3A62A 2A19B 3ELJA 4PNIA 4U7ZA 3GVUA 1G5SA 4ERKA 1DS5A 4IC8A 3TT0A 5HEZA 2GSFA 2V55A 4ASZA 4XCUA 4ZY6A 3VIDA 2CNUA 1G8KA 3QTWA 3G9NA 1EH4A 5AM7A 3U9NA 4GRBA 3ZM9A 5B7VA 1XBAA 4S34A 4DA5A 1BMKA 2CGUA 4AZSA 2ONLA 4F99A 5CAQA 4WNPA 3Q2JA 3R2BA 5F20A 3UP7A 3E7OA 2HXLA 1Q61A 2ITOA 3HMOA 4PPBA 4XG6A 5HNIX 5M4UA 1LR4A 2FGIA 3PUFC 4KRCA 3B2TA 3WF5A 2X6DA 2J0LA 2W96B 3P7AA 3RMFA 3GU7A 3WI6A 3NLBA 1TQMA 4JL9A 1R39A 4FYOA 3SGCA 4C4GA 3DXQA 3SRVA 4MTAA 5KMNA 3TIYA 3TUCA 4FMQA 5IF1A 1XKKA 4BHNA 2XNMA 3TL8A 2WMUA 4IWDA 2V7AA 5DRBA 4UWBA 3KF7A 2H8HA 2R3PA 5L4QA 5AP4A 3V8TA 2XK7A 4L3JA 3HDNA 4DEEA 2JEDA 3CGOA 4JG7A 4RRVA 2O63A 5E8ZA 5KKRB 3KA0A 4EOQA 4EORA 4FUXA 4TZRA 5EQEA 2YDKA 1QPJA 2YM8A 5FQDC 2WFYA 3FC1X 3P86A 4QTBA 3EKNA 2YJSA 1OL7A 1V0BA 5GHVA 4X3FC 3D2KA 4AUAA 3ENMA 5CU3A 1JLUE 5FDXA 2YM6A 1FGKA 2XNNA 2BIYA 4GT5A 4MBIA 5FBOA 5LWMA 4AGDA 5AUUA 3C4ZA 4I0TA 4RWIA 2X0GA 3ORLA 4DBXA 3IGGA 2ZM4A 2R3NA 3QZHA 4YNEA 3PVGA 4I22A 4AACA 4DHJA 1W8CA 4XRJA 3DLSA 2WOUA 5IA1A 1G8AA 3RNIA 4FODA 2VGOA 4ZSJA 2V5QA 1UKHA 4FNXA 2C0IA 3MPTA 5DWRA 5BUIA 4JBOA 5IH6A 2VD5A 4PMMA 4LFIA 4KIKB 5AP5A 4EHVA 3C7QA 3ZHPC 3H9OA 4MHAA 4O6LA 3E8EA 4PTEA 3DBCA 3ZUUA 2PMIA 2BZHB 2QOLA 3AMBA 3BBTB 3EN9A 4NW6A 3VUGA 3QCYA 5I9YA 1GOLA 1H1PA 1WBVA 1YWVA 2BPMA 2OIDA 2VX1A 3VHKA 4EK6A 3QZGA 3ZUVA 4O0TA 3PYYA 5CNNA 4YHTA 3CPBA 1XO2B 3ZBXA 2OJ9A 3BYOA 1U5RA 3T3VA 5FEEA 4ALUA 3MSSA 4FKLA 4EOKA 3CQEA 4QMQA 4Y73A 5AUVA 2PULA 2QOQA 3QGYA 3QKKA 4MKCA 1GZ8A 3I60A 4U97A 4Y95A 4ANBA 4CT2A 3IOPA 2PUNA 3JPVA 4MWHA 2KULA 4EK3A 2I0EA 4TWOA 4UN0C 3GU4A 5AV4A 2BZIB 4CV9A 2R4BA 3BEGA 4CZUA 4KB8A 3CSVA 3UIUA 5EKOA 3A7IA 4XS2A 4FTNA 3GQIA 3VBQA 1H1WA 1KE5A 4Z7GA 3CLYA 5E8YA 1Q99A 4JG6A 3VHEA 3CS9A 2OH4A 3QCXA 4QP9A 4FKVA 1Y8YA 3MWUA 4FZ6A 4TWCA 4F9AA 3A7GA 4YHJA 4A9RA 5AR5A 3CC6A 4FTAA 4JBQA 3FZ1A 3AC4A 2ZV2A 2CGVA 3DA6A 1YVJA 3HECA 2OK1A 2IF8A 3DAEA 2P4IA 3H30A 4O4FA 5LVOA 2XAMA 2XK9A 4JAJA 4FGRA 4RX5A 4MUQA 3RAWA 3OXIA 1UWJA 4RIWA 4V0GB 3W16A 3ENHA 2C6TA 4DEBA 4LGHA 3FLYA 4PV0A 3BYVA 2E9UA 1ZOEA 4K2RA 4RFYA 2X4FA 4YC8A 3N4VA 2J7TA 1YQJA 3BLHA 4KIQA 5HG5A 5K0KA 4DEGA 1KV1A 3V3VA 2XIXA 3GNIB 2BUJA 3FQHA 4CG9A 3E88A 1L3RE 3DQWA 4LV8A 5M53A 3KFAA 4NU1A 3S00A 4RA4A 3AMYA 1M2PA 3PIYA 2CN5A 3LMGA 3F88A 4G34A 4I20A 5E4HA 2JBPA 2XK8A 4LUEA 1ZZ2A 2W06A 5LVLA 4RGJA 2J51A 3DXPA 2CJMA 3R8ZA 2UZWE 3D0EA 4I5PA 3F5XA 4EONA 4CFXA 3LLAA 4IXPA 4RIYB 4ZTNA 3ID6C 4DH8A 2ITXA 3PE1A 4NIFB 4BCQA 4IB1A 3BE9A 1Q8TA 1FGIA 5KMIA 4I0SA 2CHLA 4IAYA 4OBPA 4FKWA 5GJGA 5K9IA 4L46A 3DJ5A 2R3OA 3W33A 3M2WA 3GCQA 3TACA 5FWKK 5IA0A 2ZB1A 4LRJA 4DCAA 3I5ZA 1GJOA 2OZAB 3DTCA 3QTUA 4FVRA 3U6HA 1PYXA 2B53A 1NY3A 2HW6A 2WB8A 4HNFA 1I09A 3EN7A 4IZ7A 4Q5EA 5A54A 3COKA 5TT7A 3O96A 2QO2A 3SX9A 4Q5HA 5IQFA 2VTAA 4FT5A 4U3YA 3AD5A 4AOJA 3FL4A 3FI3A 3QXOA 3F6XA 4MNEB 2Q83A 4WT6A 4P90A 4AG8A 2PWLA 3ALOA 4O22A 1Q5KA 2P2HA 4X6QC 1OL2A 1J1BA 3BZ3A 3CP9A 1CTPE 4LG4A 1M14A 4RVLA 5DNRA 4ZK5A 5M4IA 2YIYA 4FC0A 4TW9A 2B9FA 5EM8A 3VRYA 2C68A 2GNFA 4IVBA 4FTKA 3W0PA 4NZWB 4BKJA 2WTWA 4GU6A 4YNOA 2HZ4A 3VAPA 4FK6A 2J0KA 4U0IA 4X3JA 3Q6UA 3DY7A 2XCKA 2W1CA 1V1KA 1JKLA 1WBOA 1PXOA 3D5XA 1JOWB 1NVRA 5A6OA 4YU2A 4ZS4A 4J99A 4S31A 1LEZA 5KX8A 4LV7A 4FTOA 3NIZA 2PVKA 3R83A 2C1BA 5L6PA 5CAPA 3GP0A 2UW9A 3KULA 2C4GA 3PTGA 4XNEA 3OCBA 5KO1A 1PRYA 5CAUA 4I5CA 2WU7A 2Z02A 2NRUA 1HCLA 5TR6A 3GQLA 2RFEA 4ZSGA 4E4NA 3CTQA 4CV8A 1YOMA 4FV3A 3BLRA 1URWA 3W32A 3VF8A 5ANKA 2HZNA 3R7IA 3W1FA 2B55A 4RA5A 2QG5A 4QP1A 4QYGA 5ANOA 5EDQA 4IZAA 2X8DA 4OUCA 3GEQA 2VO0A 4NEUA 5C26A 4EOLA 4C35A 5LMBA 5AP0A 1REJA 2XBAA 3V04A 3QRKA 5DEWA 4R3CA 3ZRKA 3LJ2A 5HBEA 2OZOA 4USEA 3MA3A 1O6YA 4E20A 4O7WA 5JQ8A 4C36A 4O7RA 1S9JA 2C3IB 3CQWA 3R73A 2VNWA 5CEQA 2ZV8A 2OG8A 5IDNA 2R64A 4U79A 4WA9A 3E87A 4YURA 5A4CA 4JQ7A 4MD8E 4F65A 3BU6A 3ZEPA 4BTKA 3LFSA 5F94A 3QTXA 4ZTQA 1XH6A 4FSUA 3UQGA 4BCNA 2PTKA 3PZHA 4OTHA 4DH3A 4N4SA 2DWBA 5H9BA 3LHJA 5EKNA 2J0JA 3QQJA 4X3FA 4ZIMA 3RPOA 1YXXA 3SQQA 4BDEA 3UDTA 4C2WA 2C6LA 3WF8A 3EQFA 2I7QA 2QHMA 2C5XA 5AA9A 3R8LA 3RINA 4F09A 4D2WA 2ITNA 5HZNA 2YIWA 2ZAZA 3FYJX 4EQMA 4C2VA 4PTGA 4X2KA 4KABA 3VUTA 4E4LA 4X0MA 1B6CB 3ZONA 2QNJA 3LXKA 4D2PA 4MF0A 3V5QA 2BHHA 4D9UA 4BGHA 5AUXA 4IWPA 4U40A 4YSJA 3F3TA 3NNXA 5JH6A 1JKTA 2YEXA 1KSWA 4F7LA 3VN9A 4CFUA 4I5MA 5J79A 5CT7A 2XM9A 4N57A 1UNLA 3FKOA 4ZSLA 3OWLA 4YO6A 4G3GA 4X6RA 4QP8A 3DV3A 5L2QA 4NW5A 4PMTA 5GIOE 4O7NA 3DFAA 3PIZA 3OY3A 4FZDB 5FM2A 4MAOA 5HD4A 3ZBFA 4OTDA 2XANA 5M07A 3UO5A 4YLLA 5E8XA 3JY0A 3UOHA 3RPVA 4AFJA 4ZTLA 4BDIA 3TNPC 1R0EA 4C38A 3KRLA 4E8AA 3GU8A 3SKCA 5DT0A 3A8WA 4QMZA 5CWZA 5G6VA 2FVDA 3NDMA 1ZYLA 4M13A 4NTSA 4R7HA 3HGKA 1UNGA 2GQSA 2LGCA 3ODYX 4MBJA 4AXCA 3QRTA 3ZSGA 3QZFA 3MFSA 3QUPA 4BTJA 1YI6A 2ZM1A 4A9SA 5M57A 3NEWA 4DDIA 5EYCA 4C4HA 4EOMA 3FPQA 1BKXA 3FL5A 3L9MA 4DH5A 3AKLA 5BYZA 4X2GA 4F7NA 3EOCA 4FVQA 3R7GA 4DDGA 4J8NA 3G5DA 2ZV9A 4QT1A 5HVJA 4MXZA 1ZAOA 1UVRA 2B9HA 4J7BA 2ZYBA 2XCHA 3CJGA 3MTLA 3ANRA 5CSHA 2PSQA 5C8MA 3QQLA 5HTIA 4OLIA 1U54B 3E8DA 4M7IA 4O0XA 5CAVA 2QU6A 5HVYA 3O8PA 1MRVA 3KN5A 4X7QA 4ZZNA 4PTCA 2XJ1A 4IVAA 2RG6A 2IJMA 4GCJA 4G3DA 1YRPA 4TNBA 1DAWA 1XH9A 4Y5QA 5HI2A 5HO6A 3SXRA 3ZRMA 4G3FA 4TYIA 4WG4A 4ZY5A 2Q0BA 1W82A 2YWPA 1TKIA 3FYKX 3HYHA 5CYIA 5KZ0A 3PA5A 2V22A 3I7CA 3UG1A 4DGLC 4OAVB 2WQNA 4QMYA 4YJPA 4FSRA 3AC1A 3KK9A 1FBNA 4KKHA 3MPAA 5HLNA 4ZJJA 1H8FA 3C4CA 4UMQA 3D7TB 1HOWA 5T6KA 3A60A 3Q4ZA 4ZTHA 4FSTA 1SNXA 3LOKA 4N6ZA 1M17A 2GNJA 3OT3A 3VQUA 1J7IA 5M06A 4PL4A 5DHJA 3PRIA 5CXZA 3HV4A 4C58A 5KBQA 5HIDA 2NPQA 2PVMA 1UU8A 3P23A 4M8TA 4GIHA 5TO8A 3EFWA 2XK3A 4O4BB 4XG9A 2BDJA 4D2TA 3A61A 2ITTA 5KBRA 3MIYA 3CCNA 4E5AX 2BR1A 2C3LA 3HEGA 4UX9A 3R1YA 5BPYA 3HP5A 3FI8A 4GG7A 4GK2A 5K5XA 2C6MA 3DXNA 3IOKA 3NIEA 3SXSA 3A7HA 5HICA 3F3UA 4G6LA 2C6KA 4U5JA 3HAVA 4BC6A 5J9YA 3ACJA 3TZ7A 4R5SA 5AEPA 3D14A 2C6OA 2PYWA 4D1SA 2DYLA 3W10A 3FLQA 4DCEA 4IJ9A 4UALA 4O0WA 5DH3A 1URCA 5C8KA 3EYGA 2HZIA 4FEWA 4NH1A 4ANOA 4GUEA 4LYNA 4ACHA 3OBGA 2QOCA 4BCGA 4JJRA 4BCJA 4YTCA 3QQUA 3FI4A 3NNVA 3OVVA 3NAYA 1BI7A 1GZKA 4ZTSA 4O0RA 4RJ8A 5HD7A 3RVGA 3TNIA 3ORZA 3HV5A 3LCOA 1PW2A 4TY1A 3HMNA 3W0QA 3ZLWA 4BWKA 4O7SA 5LVPA 5HORA 1NXKA 4KIPA 1Y91A 4F63A 3BBWA 3KREA 4C61A 2JKQA 3D4QA 4GUBA 2OH0E 3SV0A 2W05A 3QD3A 3TG1A 4CNHA 5HCZA 2FA2A 1NA7A 3QKMA 1GZNA 2ITWA 4EWQA 5AUTA 1K3AA 3FHRA 1YI4A 5KMMA 1TFFA 2GCDA 4MD7E 5HO8A 3KXMA 2VWUA 4A4XA 3D83A 3R1SA 3IDPA 2IG7A 4ZMFA 3AC3A 3BYUA 4UBAA 2WEIA 4DLJA 2PUUA 3NS9A 4N6YA 3Q6WA 4E6AA 4L68A 1UU7A 1VYZA 5CVGA 4A4OA 5EDPA 4EH5A 3NNUA 4CTBA 5CSXA 2A4LA 3KU2A 3D2IA 4RG0A 4AP7A 2JAMA 5IQAA 3U9CA 4Y8DA 2YFXA 3KQ7A 1WBWA 2UW3A 2XNGA 3JYAA 4F64A 3NCGA 4NFNA 3DAJA 3DNEA 3EFJA 4XRLA 3RTPA 2YDIA 3TZ8A 3L8XA 4AAAA 5HG7A 4FNWA 3PIXA 4ZAUA 5BNJA 4EK8A 3LQ5A 4WRGA 3HA8A 1ZZLA 2HZ0A 3GFEA 3IGOA 4H1MA 2JDRA 3MY0A 3W2CA 4QYFA 1XBBA 4XLVA 3DDPA 3UDZA 1LEWA 3MBLA 3KRXA 4RIXA 5T3QA 2WELA 4M0YA 1E1VA 4J96A 5G1XA 2G01A 2Y4PA 3FDNA 3Q3BA 1W84A 5M51A 4IX4A 4M97A 3GC8A 3UPXA 4QMVA 2Y8OA 2HWOA 3MS9A 4HYUA 2WZJA 4D5HA 2QKWB 4U81A 4U6RA 4D4VA 2ITYA 4QMWA 4CFMA 3OHTA 2QO7A 4UZDA 4F7SA 3HMMA 4AW2A 2G2IA 2O64A 4U43A 5A4TA 2F57A 5AJQA 1A9UA 3E8NA 4FSYA 5CI6A 5GZ8A 5A6NA 3K3IA 4BCIA 4AZTA 3IW7A 2BRNA 3ZSIA 4MQ1A 3QZIA 4FV4A 4KINA 4YTIA 4YLJA 3FHIA 2ZMCA 3FZPA 4FV9A 4G3EA 4IBMA 4EZ5A 1ERKA 3W0NA 4FJVA 5J1WA 3VUKA 3RAIA 4Z55A 3EH9A 4YJQA 2C69A 5J9ZA 4NM3A 1Q97A 4FL2A 4U9AA 2YZAA 2QKRA 4PF4A 5K0XA 2WMSA 4FKOA 3TKUA 3L9LA 1OIQA 3FV8A 4MBLA 3CKXA 3EMGA 2O0UA 4IC7A 2VTIA 2FSMX 4ID7A 3LE6A 2BFYA 2GTNA 2R2PA 5CF5A 3R6XA 4MXAA 3CPCA 4CXAA 2OIBA 2PL0A 3FE3A 3DLZA 3HRBA 4IAAA 3Q52A 4M14A 4WHZA 3RWPA 5IH4A 1ZMUA 4YTHA 5IQHA 5EM7A 2YCQA 3D94A 2O2UA 2R3JA 2X7GA 3QYZA 4FTTA 4YZMA 3PLSA 4IDTA 3KXGA 3PA3A 4HYIA 1CMKE 3MTFA 2W5BA 5KMOA 2Y7JA 3UIBA 3CY3A 4WNKA 4HCTA 3C51A 4G3CA 3OT8A 3GT8A 2CKOA 3OOMA 3DK7A 4QMSA 5FDPA 4KUJA 3PE2A 2H6DA 4D4SA 4R6VA 2RG5A 3E8CA 4I93A 1IA8A 4BDAA 4K11A 4RJ6A 3C0HA 4ENXA 4USFA 4QP6A 1JSTA 4XX9A 3ERKA 1OIYA 3A4OX 2R3KA 5K3YA 3UOLA 2PVYA 4YUQA 4WNOA 4YTFA 5DYJA 2J5EA 3BIZA 3GCSA 3RM6A 4D55A 3DK6A 5CSVA 2CKEA 1H1SA 4DG0E 4ZLZA 3ZRLA 2C30A 3LMIA 4R7BA 3QQHA 2WMRA 4M69A 3P79A 1XHAA 3EFLA 4Z3VA 3HX4A 1ZOGA 3B8QA 4K77A 4MXYA 4XOZA 5J87A 3ZMMA 3L8SA 4FG8A 5LVMA 4XG7A 2FH9A 3W8QA 2ITZA 4B6LA 3KEXA 4BZOA 5BVKA 4RLLA 1OM1A 4Y46A 4YC3A 3BV3A 1WVWA 4BBFA 3IG7A 5IG1A 2JDSA 4IVDA 1LP4A 2E9NA 3HV6A 3PA4A 3TNQB 3RI1A 3UNJA 4C3FA 3TTJA 4UYAA 1DM2A 2GFSA 3R9OA 4J53A 3FMEA 4CG8A 3O23A 1E1XA 1PYEA 3H9RA 4HGTA 4YSMA 2AEGA 4WUAA 4ZJVA 2W9FB 2R7BA 5AP2A 4GKIA 2PVJA 4EJ7A 1XQZA 2OKRA 4R78A 4DFBA 3TV6A 5A46A 3DKOA 5LCJA 3FXXA 4RVMA 4YC6A 4A06A 5J5TA 2VTTA 3TCPA 4Q9SA 3AKKA 4DFLA 1Y6BA 2F49A 5LVNA 4CKJA 3O5AA 3Q96A 2C6IA 5CTPA 2X39A 4CKRA 3MFUA 3V6RA 5IUIA 2VTNA 4FKRA 3RHXA 3LFDA 4O6EA 2PVRA 4QO9A 3G9LX 5HU9A 4IB3A 4GFOA 2E9VA 1PXMA 4GU9A 3UIXA 4QYYA 4XV1A 4K33A 5EW8A 3ZDUA 4DYMA 3Q9YA 3QC4A 5I9ZA 2IZUA 3BE2A 2ZMDA 3MH3A 4JDIA 3M1SA 3PVUA 2W1DA 2GDOA 4O4CA 4GVAA 4EOPA 3ZDIA 2IW6A 4ZJIA 5DG5A 2VTPA 3KXHA 3IKAA 1Q8ZA 1JPAA 4F78A 1YDTE 3PPZA 3E92A 3IDBA 2RFDA 3FWQA 4QMOA 5DPVA 4Q2AA 5LMAA 4GVJA 2IW8A 2PU8A 3ALNA 2YCFA 3C4WA 5E1EA 2QONA 2R3HA 4AN2A 5ETCA 1SYKA 4EOJA 3QXPA 3TZ9A 5A4LA 5LMKC 1KE9A 2XIRA 4WSQA 5EG3A 2EB2A 2E9PA 3AMAA 3QL8A 4A7CA 2XRUA 2HYYA 5HIBA 2DS1A 4AOTA 4YJRA 5A4QA 4FV7A 3ITZA 2XNPA 3R9HA 4BDKA 4AE9A 4NYEA 4HGSA 3TTIA 1ZYDA 1ZYCA 2NRYA 4WD5A 3AXWA 4E6QA 3EQDA 3QQGA 2ZM3A 5JT2A 2OF4A 2XM8A 3F3VA 3MH0A 1OKVA 1QMZA 3KRWA 4OBQA 3HLLA 5C8NA 3O2MA 3F61A 2J50A 4MQ2A 4UEUA 4ACCA 4FEXA 1PKDA 4O2ZA 4DGMA 2Y4IB 2VRXA 2EU9A 2ETMA 5E9EA 5CU0A 3QGWA 2ITUA 1WMKA 4FT0A 3QWJA 3EB0A 2HIWA 4PL5A 4B9DA 3CJFA 4F0IA 4TPTA 1YWRA 4O1PA 5GINE 1OGUA 5FRIA 4O7TA 5BMSA 1BYGA 1YW2A 2DQ7X 2VNYA 4MH7A 4IM0A 5CU6A 5J1VA 5ANDA 4ZMEA 4DGOA 4PWNA 4M84A 3DDQA 2RIOA 5D7AA 5EYDA 4AW5A 4BDDA 2YIRA 4HVIA 2OWBA 4NK9A 5D11A 3UQFA 1LPUA 2GPHA 3OCSA 1P14A 3E63A 3ZH8A 5AADA 3KK8A 3JS2A 4OW8A 4N70A 5ETIA 1E9HA 4J8MA 5DR2A 5M4FA 3FSFA 5JRQA 5M55A 1WVXA 3KRRA 4GS6A 5IQCA 5A3XA 3I7BA 5EI8A 3QU0A 4B99A 3NVKI 4HW7A 1H1QA 4D1XA 3H3CA 1YXSA 5GZAA 4BWPA 4RJ4A 2YLFA 4FIGA 4YZDA 3LLTA 4RBLA 4CTCA 1CDKA 2X7OA 3I81A 4R8QA 3B8RA 5GNKA 3FXZA 3PUPA 4GFMA 4RZVA 5FTOA 2OI4X 3C5UA 4BIEA 3SD0A 2HAKA 4OBOA 4BGGA 3PPKA 3FKNA 5E7RA 3TDVA 2UZBA 2OGVA 4XHKB 2W4JA 3GFWA 2X8IA 3LW0A 3U8WA 2GHGA 4JIKA 4D0XA 4WBOA 1FMOE 4G9CA 3WARA 3G33A 2I40A 1OZ1A 4YZBA 4E7WA 3UYTA 2X4ZA 2G15A 3RHKA 1QL6A 2CLXA 1H01A 3V5WA 2QOOA 3BL9A 4CRLA 4D4YA 3AG9A 3R30A 3BKBA 3GXLA 3MGYA 2PE0A 3VS4A 4BI2A 3QRIA 4YPDA 4JX3A 3WF6A 3DJ6A 5KHXA 1VLRA 2CKQA 1J1CA 1GAGA 2XEYA 3PVBA 3KMMA 4CT1A 3CR0A 4V05A 2X81A 4GT4A 4K0YA 3GOPA 3RKBA 4GFGA 5JZJA 4L7SA 3D5WA 4RT7A 3QC9A 4C4EA 4ERWA 4EQUA 4FEUA 3DKGA 4Y85A 1O6LA 2PZPA 3FMDA 3ORTA 4E1ZA 5KNJA 2YWVA 3C4XA 3TYKA 3QLGA 3F2AA 3G6GA 4RLKA 1SNUA 5I3RA 3P78A 2R3FA 5CEOA 5FP5A 5IA3A 4IFCA 4AA5A 4FV2A 3OF0A 4EH3A 3NAXA 1O9UA 1QPEA 4E73A 3PLAE 3VUMA 4IB5A 1V0PA 2Z2WA 3R1NA 4LL5A 1Y8GA 4ALVA 4UWYA 3LCSA 4AT4A 5H8GA 3LQ3A 4C34A 4BJJB 2EXCX 4WIHA 3QAME 3EFKA 4XP3A 2FSTX 4DH1A 2IO6A 3FMJA 3UC3A 2W0JA 4LM5A 3HUBA 2IVUA 4L9IA 4TYHB 5FD2A 4HYHA 3ATTA 1JSUA 5M4CA 3AQVA 3NPCA 5CAOA 1V0OA 2XIZA 3MY1A 2W5HA 3QHWA 4FGBA 4JXFA 5C4LA 1PXIA 4CZTA 5J5SA 1H26A 3F7ZA 2BROA 4YPSA 2WIPA 5KCVA 4FL1A 3R8PA 3VUHA 5I5ZA 5D12A 5CSWA 3Q9ZA 3S0OA 3EN6A 3PJCA 4E4XA 4F9BA 3OG7A 4QP7A 4WSYA 2Z7LA 4Z9LA 3KF4A 3NW7A 3UVPA 3S95A 4BYJA 5AFVA 3FI2A 4QTDA 3A8XA 3G2FA 4NJ3A 2WXVA 2W17A 2W1HA 3KMUA 4FF8A 1UKIA 4JS8A 4KIOA 2VTLA 2QO9A 5CZHA 4S33A 5E8SA 3ZLSA 4BTFA 1NVSA 5KKRC 2GS6A 2VTJA 3R9NA 4BDBA 5IUHA 5L6OA 4FV5A 1H00A 5AUZA 5CXHA 3WYXA 2JBOA 2PK9A 2XKFA 5AR3A 4IADA 4I6BA 5BV3A 3F2RA 3WZDA 3RAKA 4BI0A 3AC5A 1VZOA 1ZARA 3IQ7A 4FSWA 1PMEA 4J95A 4QPAA 4DLIA 1VJYA 2R3GA 4HJOA 4I4EA 4QMXA 3IO7A 4QQ5A 4ANNA 2OXXA 3LXNA 5IEXA 1WAKA 3G6HA 3NYVA 3HDMA 4QTCA 2WEVA 2X0PA 4E5BA 2QG7A 5L6WL 2WTCA 3JXWA 4ZY4A 4F70A 4NKSA 5DIAA 2XJ2A 3NUYA 4B4LA 4DEAA 4DHZA 2I6LA 3PXKA 4KS8A 5AP1A 1BL7A 4AGCA 2WMXA 2UW8A 4BCHA 4CFVA 4H58A 3QRJA 4FTRA 1PHKA 4EQCA 3SVVA 4AXEA 4ITIA 2B1PA 2IZTA 4O0VA 3MVJA 3MV5A 4D4RA 4EYMA 2R9SA 3VF9A 2WQEA 4QMMA 2UZLA 3TUDA 4CMUA 4DTBA 4MK0A 2BHEA 2CNVA 3MDYA 4L8MA 5KUPA 2WU6A 2PE1A 4ZS0A 2WIHA 1S9IA 2EUFB 3MESA 3P7CA 2ACXA 4UMTA 4HPTE 2QOIA 4L6QA 1FQ1B 3BCEA 3NGAA 5F1ZA 4EK4A 3VJOA 4AE6A 5LMKA 4RIOA 1H28A 1SVGA 3EL7A 2GNGA 3R7VA 3VNTA 4EUUA 2XEZA 4L01A 5HTBA 2YAKA 4M66A 2WOTA 1DI9A 3IK3A 4P4CA 1GY3A 4FIHA 3P5KA 3DK3A 4Q9ZA 3GU6A 4MXXA 4BB4A 1SM2A 2IN6A 2CCHA 3UDSA 3LVPA 3IW5A 4CZYB 3TDWA 4NKAA 2XAOA 3D15A 4DFUA 3OP5A 1WBPA 3H0ZA 4Y72A 4XH6A 4F0GA 4FR4A 3R8UA 1P4OA 1AD5A 5CS6A 3EJ1A 3PG3A 4A9UA 2E2BA 4IACA 4FV8A 4BIBA 4G16A 5D9HA 4EBVA 4QOXA 4U44A 4TWNA 4UYNA 3KGAA 1KV2A 2OO8X 4L45A 5B2LA 4QP4A 5L2WA 4RZWA