3ZO1A

The synthesis and evaluation of diazaspirocyclic protein kinase inhibitors
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
GSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and evaluation of heteroaryl substituted diazaspirocycles as scaffolds to probe the ATP-binding site of protein kinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zo1A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zo1A02
1DM2A 1ZYJA 4KIOA 1M14A 4QP4A 3QX4A 4DE4A 3TNIA 3OUNB 3PXFA 4IWQA 2W1FA 3D83A 4QTEA 1TQPA 2Y6MA 4FV4A 5HBEA 4DFUA 5EOLA 3ELJA 3D2KA 3TEIA 4ZTNA 5AUTA 4UYAA 3ZRMA 1K3AA 3NUAA 2DYLA 3IOKA 3QTUA 3WYXA 4EZ3A 5A4CA 2B9FA 1BX6A 1NA7A 3PVUA 4ZIMA 3H4JA 4L01A 4Y8DA 2XIRA 4IC8A 4NFNA 4U43A 3EQCA 4W4YA 3F66A 4BCMA 1UU9A 5AR8A 1ZZ2A 2R3LA 4DTKA 1H1QA 4BBFA 3UYSA 4C8BA 3DXQA 3DBEA 4BWPA 2PVMA 2PL0A 3HUCA 4BHZA 3DKCA 3MJ1A 3U51A 4IBMA 2W1EA 4G5PA 1Q8YA 1NW1A 2J90A 4F7NA 5AP0A 4GUEA 3R1NA 4BCFA 2YCFA 2BDFA 3QFVA 4IIRA 4O0TA 4DH7A 4D9UA 4PMPA 5LXMA 1YKRA 3DFAA 5HLNA 3ZLXA 3B2WA 3EFKA 1ZYCA 1A9UA 4IX5A 3V5PA 5LWNA 2WMUA 2I7QA 1WBVA 2CDZA 2ERKA 4FSYA 4EHEA 2WGJA 2O64A 3FZTA 3PJ3A 4ITIA 3PRFA 2G15A 2GHGA 4HNIA 5CAVA 4F1MA 3GEQA 4UMUA 3COIA 4R77A 4UV0A 3DCVA 3F7WA 3UIBA 3U4WA 5AFVA 5AX9A 3BGZA 3RMFA 3ZSHA 1DS5A 4WUNA 3TV4A 3E7VA 3GVUA 4CFFA 1A48A 4FKPA 3ULIA 1H00A 2QU6A 4X2FA 5KMLA 4DN5A 1TQIA 3HMIA 3IK3A 4LUEA 5DR2A 4TW9A 1JWHA 5LVMA 2X7OA 2R7BA 3AOXA 5JZNA 4FTLA 5HGIA 3SOCA 4O6LA 5KMIA 5GIOE 4BTFA 4FG9A 5HBJA 4YJVA 4TY1A 1Q8TA 5ETAA 3LIJA 3U6JA 4DYMA 3NWWA 5J8IA 4FKVA 2BAKA 3AGLA 2QOLA 3KGAA 1H8FA 3GI3A 3RNYA 1G8AA 4ORKA 1PHKA 3OT3A 3OBJA 4RJ7A 5E90A 5AP4A 4Z55A 3ACJA 1YI6A 4JAJA 3F5GA 5KMMA 5DNRA 4ZZMA 2DQ7X 3BRBA 5T68A 3O23A 4AT4A 4E20A 3LMIA 3N4VA 3CQEA 2H96A 4Q2AA 3BWJA 4GMYA 2JKOA 1U5RA 5HVYA 3R7OA 1K2PA 4NT4A 1M2QA 5H8BA 3TZ9A 4MBJA 3QC4A 4II5A 2C5YA 5A9UA 1UV5A 3QRKA 3BU3A 4WUAA 4JX7A 5CI6A 2IW8A 5E4HA 5ACBC 3ZHPC 4DHFA 2WHBA 2IW9A 4GW8A 5EM5A 4PQNA 1OKZA 5JQ8A 2OF2A 4FKRA 2O63A 3E8NA 4L00A 3G33A 4PMTA 3BV2A 3BYOA 4X6QC 2EVAA 4OAUC 3AT2A 2YJRA 5DRBA 3JUHA 4KIKA 3CS9A 2YAKA 3UG1A 3VQHA 1OIYA 1YI4A 3R28A 4L8MA 4NWMA 4PNIA 5CU4A 3OF0A 2LGCA 3EN4A 4MD9E 2Q0BA 3UYTA 3ZLYA 2H9VA 3DPKA 1GIHA 3G6HA 1VJYA 4AE9A 3NIEA 3TZMA 4I20A 3B8QA 1YHVA 3C0GA 5DN3A 3ZU7A 2ZM3A 3FHIA 4FEQA 1IASA 3COHA 4IE9A 3VBTA 4AF3A 4BCKA 3LZBA 5IDNA 3KCKA 5J9ZA 4BYIA 4YC3A 3R2BA 3SDJA 4EKLA 3EN7A 4OTGA 1OL2A 2Y0AA 3PLAE 3VS7A 5JT2A 2VO6A 3UODA 4FZ7A 3RPYA 3WZJA 1G3NA 3S3IA 2RGPA 2C69A 1UU7A 2PVNA 5B7VA 4ZLOA 4FT0A 4L7FA 4QP1A 4YJNA 5A4QA 5E8UA 3LJ1A 5AUWA 3CGFA 3TNHA 4CCBA 3HA8A 3KMUA 5DE2A 3U9CA 4O7LA 4CV9A 2QKWB 3R9HA 3OEZA 3UPZA 5HCYA 3QHRA 4ZSEA 3R7IA 2EWAA 3BV3A 5AP2A 4RBLA 3KK8A 5CSHA 4BZOA 2QOBA 1VR2A 5H8GA 2O5KA 3LCKA 1YOJA 3UQGA 4R7BA 1U54B 5AUVA 3DB8A 4C4IA 1W82A 4JQ8A 4PMSA 2CKQA 4CG9A 3OC1A 4QYEA 3RALA 5KO1A 4DF3A 2WOUA 3QD4A 2VU3A 3EH9A 4EQCA 5LMKA 2R3PA 4FODA 3IOPA 2CGVA 2QC6A 3DT1A 4I93A 3PIYA 5AV3A 3D5VA 3L9LA 5IQIA 3EWHA 5EYCA 4O21A 3RNIA 5F9EA 2RSVA 4HNFA 5C8NA 4JX3A 1JKTA 4BN1A 2CLXA 4X3JA 5HBHA 5CEIA 3TCPA 3SD0A 4F0FA 3U55A 3G9NA 1U46A 2GS7A 5CQUA 3UIUA 4UWYA 5AR5A 4ZTMA 5I9ZA 3M11A 4I6HA 5HCZA 1OB3A 1URWA 4V04A 1E1XA 3K5UA 2GTMA 4QOXA 3D15A 3C1XA 2WIPA 3ZDUA 4G5JA 4RGJA 5EW8A 4E4XA 1ZY4A 4RFYA 1Y8GA 2C6EA 4W4VA 5LARA 3KULA 4H1MA 4DBNA 3CKWA 2F9GA 3NRMA 4Y72A 3RBWA 2BZHB 4NJ3A 2PE2A 4UEUA 5HG8A 5AR2A 4O7VA 4RIXB 3ZM4A 5M53A 5AUUA 4A9RA 4DH3A 5FRIA 5CZHA 2GTNA 4JRVA 4YNOA 3BLHA 1NY3A 1R78A 2EXCX 4TT7A 1FQ1B 5GJDA 3OZ6A 3QQUA 3VJNA 1KUTA 4JR7A 1WBNA 5CVHA 3MH3A 5HTBA 3CD8A 3P7BA 4L3PA 4EOKA 3FC2A 4AFJA 2VTOA 4FKWA 3ZOSA 3SVVA 3QCSA 3GCPA 1CKJA 2FA2A 2X2KA 1JKSA 2B9HA 5EHLA 5FEQA 2GNFA 4XRJA 2C6IA 2Y8OA 4HGTA 4BCNA 2C6DA 2WTDA 4FIHA 4QMOA 4IVAA 1XJDA 1NVSA 2NRYA 2GS6A 3RP9A 2FYSA 4IHPA 1WFCA 3O8TA 4NZWB 4PDSA 5AP1A 4FSMA 3R83A 3NUSA 3LJ2A 4QP2A 2QD9A 3EN5A 3I5NA 3C5IA 2PMLX 4F64A 2J9MA 3AC3A 5EKOA 2XP2A 2IW6A 5L2SA 3RTPA 4IH8A 1Z9XA 4WG4A 4PX6A 5LVLA 3NYXA 3R7GA 4LRJA 5EHOA 4BHNA 4ZTLA 3AD4A 4NCTA 2X8EA 4QMZA 2Q0NA 4J53A 4E6DA 3RM6A 3PPKA 2VTHA 4KBKA 4R7IA 4KUJA 2R2PA 3V04A 1ATPE 1HOWA 2WQOA 3PRIA 3DKFA 4F1TA 5A46A 5EYDA 2PMOX 3OHTA 5HD4A 3FEGA 3ERKA 4FGRA 3LLAA 4X3FA 4AP7A 5GZ9A 4RG0A 3VS5A 3ETAA 3FLWA 5JZJA 4I6BA 2XNNA 4RJ8A 4FEUA 4YTFA 3MSSA 5EI8A 5ETCA 3VUIA 3A8XA 4NUSA 4S34A 3DS6A 4XP3A 2WMVA 3I5ZA 3A8WA 1U59A 3F3WA 3C4EA 3HNGA 3N51A 3ZBFA 1W8CA 2C6KA 2XJ2A 4JT3A 4PMMA 2A2AA 1F5QA 4RPVA 5CZIA 1P2AA 3Q9XA 4CZTA 4BDHA 4C3RA 4HGSA 4BTKA 4ZJIA 4F9AA 1FOTA 4RLLA 2R64A 3MY1A 3VJOA 3GC8A 1L3RE 4M84A 2BTRA 2XKEA 3NR9A 4FIFA 4XUFA 3LFCA 1B39A 5HNGA 3VAPA 3HEGA 3MA6A 4K0YA 5ANGA 4ERKA 1H28A 3E93A 3LOKA 3NEWA 4G3CA 4K2RA 5DH3A 3V51A 4BCGA 4L9IA 4A07A 4O7RA 3VF9A 5AADA 3R2YA 4ASZA 3WILA 4KS8A 3DBFA 4LOOA 3VBXA 4EZ7A 3PPJA 5EH0A 2PVHA 5CX9A 4EOQA 2FVDA 3BEAA 2CNVA 3LM5A 4FKUA 4M12A 4R3CA 5IEYA 1SZMA 3VVHA 4BDGA 4HYIA 4DFLA 4KB8A 5IQHA 5AP5A 5IZFA 2YZLA 4WT6A 1AQ1A 4YPSA 3RCJA 3JXWA 4NKAA 5IDPA 5J5TA 4PL4A 1GZ8A 1H27A 2X4ZA 3PJ1A 4I4EA 2ITYA 4QMUA 4DEEA 5L8KA 4A9YA 1TKIA 4LI5A 4NJDA 4D1SA 2BHHA 3CJGA 3LW0A 4NIFA 4ZEGA 4F9YA 4RX7A 2YIYA 4MNFA 4GFGA 4PDOA 4BL1A 4YPDA 4AW2A 1OUKA 3SHEA 1XH6A 2I0EA 3KULB 3PJ8A 4EH6A 2GMXA 2HW6A 4WBBB 4LGGA 3ZSIA 3S1HA 4AW0A 3LHJA 2V0DA 1GOLA 3OOMA 2IZSA 2AC3A 4ENXA 2YA9A 4MTAA 4AN2A 2ETMA 3KKVA 4FTIA 4X2NA 4CFWA 4FUYA 4QT1A 4YZ9A 4ACGA 5GINE 4LV5A 2XBAA 3IW8A 3QUPA 4GIIA 3MS9A 3ALOA 3IS5A 5E8YA 5IQCA 4EZ5A 3E87A 2ITOA 3LXPA 4UZHA 4HCVA 3NUYA 5HE1A 1BMKA 3HMOA 1PKGA 4PY1A 5CEQA 4YBJA 4AT5A 4I5HA 2GQSA 3VS1A 2A4LA 3W2RA 4FKOA 3QGWA 5GNKA 2B4SB 5IMEA 3OXTA 3N4UA 3ODZX 3V3VA 1QPCA 2YEXA 3TG1A 3F5PA 2W1DA 3LE6A 3FQEA 3ORIA 4ZK5A 4LG4A 5L2WA 1CKIA 3FMNA 5HORA 2P3GX 5J5SA 5KE0A 2QOKA 5E92A 4ZTRA 1BL7A 5C9CA 3KA0A 2R3JA 5J9LA 2RL5A 4EOOA 5BUIA 1WVXA 4CMOA 4X21A 3BYMA 3F6XA 4OUCA 4YZBA 4MF1A 5ANOA 2HY81 4DG2E 4E5AX 4DCEA 4YR8A 3O71A 3UQFA 4QMSA 2PK9A 3O51A 2R3IA 3MTLA 4OTWA 1XWSA 4E5BA 4I6QA 2W5AA 2HXLA 3EFWA 3MVMA 4LOPA 1ZY5A 2XYUA 1XH5A 2AC5A 2VTSA 3JY9A 3NCGA 3IECA 4QMTA 5F4NA 4DEIA 4EOJA 4EYJA 4EWHA 3D7ZA 3CGOA 4QMWA 3QQFA 4ZSLA 3WZKA 4BDAA 4EOSA 5KKRB 4KRCA 2JGZA 3LAUA 4QQ5A 4I23A 1OIRA 2HXQA 3A7JA 2UZDA 3GC7A 5FEEA 5JKGA 3QHWA 3ORMA 4S33A 1VYWA 4MVFA 3P5KA 1P14A 3W8QA 3LFBA 3KY2A 4DGNA 2WOTA 5KHWA 3ANQA 4MKCA 4GV1A 2JDOA 4RWIA 1R1WA 4FNWA 2OF4A 3KN5A 4ZAUA 3KXNA 2UZLA 4NM0A 3PA4A 2B53A 4GUBA 2C3LA 4OBOA 4PRJA 5HKMA 3ZO4A 5L6WL 4EK5A 3Q6WA 4ZSGA 4CFNA 5D11A 3V6SA 2JC6A 3C13A 2REIA 2ZV9A 4GKHA 2ONLC 3VWAA 5FP5A 3FZPA 2WPAA 3COMA 3P0MA 5D12A 3D9VA 3WOWA 4APCA 1XR1A 5EG3A 2W1GA 4F9WA 2JKQA 2Y7JA 3KU2A 5FGKA 3E63A 5AX3A 5HG9A 3LMHA 2VO0A 1PXKA 2Y4IB 4BFMA 1OMWA 5AM7A 5BVDA 1CTPE 5D7VA 3Q52A 3RAWA 5FXRA 3U6HA 5D10A 3S0OA 2WEIA 3E5AA 2QOQA 4BTJA 3R9DA 4R5SA 1RW8A 2HIWA 4P5ZA 1KOBA 3MFTA 2OI4X 3D0EA 4QYFA 3JVRA 4WHZA 2B9JA 5HEZA 2W4JA 2VUWA 4P2KA 5HOAA 3TV7A 2RFEA 3A99A 4I3ZA 1G8SA 3FZOA 4AAAA 2XKFA 5HE3A 4BDBA 4PNKA 3REPA 4RJ6A 2Z7LA 3OCBA 3R7EA 3DGKA 4FEXA 1XO2B 4IDTA 1UWJA 4H36A 4J99A 3F2AA 5H9BA 2Z7SA 4EK3A 2W96B 2CN5A 4H39A 2B55A 4MD7E 4WBOA 2VRXA 1LR4A 2HWPA 3MN3A 4R1VA 3FC1X 4WSQA 5IKWA 3FLQA 4CFXA 4C34A 3AXWA 2R3KA 3GOPA 2P4IA 3PG3A 4MEDA 3VIDA 4XCUA 4EQMA 3NYVA 5AUYA 4FZ6A 4FF8A 2YM8A 4TYEA 4F1OA 5IQEA 4BZDA 4C3PA 1ZLTA 4O27B 3HLLA 4LL5A 5FXSA 1ND4A 5FWKK 4XV2A 4H3QA 4C2WA 4CD0A 4XLIA 3IO7A 5HNIX 5BNJA 2J50A 2YLFA 1OVEA 3A4OX 3BBWA 2YIRA 3EZRA 5I9YA 3LMGA 3PA5A 3RK9A 4QPSA 2PULA 4EH5A 1H08A 4RVKA 3Q60A 4BBMA 3NNVA 3HAVA 1OL7A 3CJFA 5JFWA 2OJGA 3DJ6A 5TKDA 4IEBA 3UVRA 4FZFB 3WZEA 3EFLA 4JBQA 3VNTA 5J9YA 2CCIA 3FHRA 4RIWA 3UTOA 3F5UA 4IAFA 2ACXA 4JL9A 3TJCA 3KRRA 3FI8A 2NP8A 5FBNC 5K5NA 3TTIA 4UALA 4FV0A 5AA8A 3O96A 4FE2A 1OBGA 5C4KA 3HP5A 3QD2B 3U9NA 4O7WA 3QC9A 5IA2A 4G3GA 5EYMA 1XHAA 2R3NA 3MB6A 3DK6A 4PTCA 3TXOA 3UPXA 2XKDA 5CANA 4GKIA 3FXXA 2GS2A 4Y5QA 2OGVA 3A7GA 3I4BA 4IZAA 4RVMA 4FKJA 3CE3A 3OW4A 4BB4A 4RQVA 2QU5A 3KRJA 3P79A 5HI2A 1PYEA 3R8ZA 3R9OA 4AOTA 4CMUA 4S2ZA 3EKKA 4MF0A 4DFNA 3ZFMA 4DTBA 4FL2A 3TWJA 2BROA 4A7CA 4ACCA 2WELA 2VGOA 2R0UA 4QTBA 4N57A 3IPHA 3KRXA 4ITHA 4M0ZA 4C0TA 4AT3A 1H01A 1Q3WA 2IJMA 2QURA 2R3QA 3QU0A 3R21A 1OL6A 4PDPA 2XRWA 3PP1A 3OP5A 1VYZA 2F7EE 3BBTB 3TUDA 3I1AA 4AWIA 5L6PA 3PLSA 4M68A 5HE0A 4CMTA 2OICA 1FGKA 3BGQA 4X0MA 5EK7A 5HIBA 4I1ZA 2R3RA 4FTTA 4C62A 4O0VA 1PXJA 2VTJA 2C5XA 2W7XA 3UZPA 3O0GA 4KWPA 5CAQA 2PMNX 4CZYB 2PUPA 4ZP5A 5M09A 1OKWA 1VEBA 2YM5A 3FYKX 5D7AA 4B7TA 5K4JA 5HCXA 2CGWA 2P55A 3DY7A 5HESA 3IDPA 4YC8A 2X9EA 3NUXA 1OKVA 2UZVA 4MXZA 5CASA 3MH2A 4JG7A 4KNBA 2PVRA 4FBXA 2WMAA 5D9HA 5KBRA 2CGUA 3HZTA 4HVHA 3ZMMA 3R8LA 2B7AA 3CR0A 4B8MA 1YDSE 2ITTA 2NPQA 4CGAA 3FAAA 2WXVA 3BKBA 3FMMA 3RPRA 4AA0A 5I3OA 2B52A 3ZCLA 1OL1A 3ZRLA 3DZQA 2F49A 1BL6A 3L8XA 4GG7A 3QAME 3VBWA 3Q5IA 3QXOA 4GT5A 3WE8A 3GOKA 5ETIA 4JDKA 4FSRA 4DEGA 3VW6A 1PRYA 4PDYA 5A3XA 3W33A 2R3GA 2UW4A 5FQDC 4O82A 1VZOA 4FT7A 3PTGA 3OWPA 4EK8A 3R02A 4K8AA 3UVPA 2VWZA 3FUPA 4J8MA 4E4NA 2QOFA 4XG9A 3UNZA 3ZEPA 4JDIA 4JBOA 5IEXA 3PJ2A 3PSDA 2OKRA 2FH9A 3NW7A 4RA4A 4O86A 4G6LA 2HYYA 2UW5A 3CTHA 4L43A 2W1CA 5BUEA 3LQ5A 5CNOA 3RGFA 3KXGA 2ZJWA 2EUFB 5CI7A 4Z9LA 3EFJA 3Q4CA 4GYIA 4DFYA 3OY3A 4B6LA 4UBAA 4BICA 3QGYA 4A9UA 5C01A 5CYIA 2CMWA 3KC3A 3C9WA 2V55A 3PWDA 2ZV8A 2NO3A 2VTPA 3BZ3A 3OEFX 4IQ6A 1ZYDA 4YTCA 1ZMUA 3F82A 4BRXA 2XCKA 3R00A 4IWPA 3UP2A 2UZNA 4AG8A 3RJCA 4PL3A 4ZOGA 1CKPA 3TKHA 3QZGA 3ALNA 4O7YA 3QD0A 3UE4A 5CEOA 2C68A 3CY2A 3ZZWA 1H1SA 3PSBA 4D9TA 3COKA 2J7TA 3EL8A 3VS4A 4LL0A 2JAVA 2HK5A 2VTQA 5IH6A 4GVAA 2XMYA 2YITA 4BDKA 3DZOA 4TNBA 3AC5A 4FKSA 3U6IA 5KMOA 4FV5A 4F63A 3TM0A 3NLBA 2IVSA 2IWIA 3I6WA 4O1PA 1JSTA 4ZSAA 4O7SA 1Y8YA 4RJ3A 3W2SA 3FWQA 4AGUA 3FI3A 3FV8A 4G3FA 5FM3A 4CTBA 4PTEA 4E7WA 3LFEA 3NUUA 2SRCA 4TWCA 4MHAA 3UNJA 4ZZNA 1APME 4E6QA 4CLJA 3P7CA 3QRIA 4O0UA 4RIYB 4XNEA 5L6OA 1O9UA 4TYHB 3RPOA 1Q8WA 5BVEA 4MXOA 3A4PA 2W1ZA 4IC7A 2P2HA 2QR8A 4FSQA 4J97A 4QMPA 4ZMEA 4Q5HA 5EHYA 2YCSA 3R1SA 4FT9A 2OO8X 3GXLA 3JS2A 4GU6A 2PVYA 3LJ0A 5ITAA 1FVTA 3A7FA 3H0YA 2YM7A 4MWHA 3FI2A 1OBDA 4U7ZA 1K9AA 1IRKA 3ENHA 4OTDA 3OUKA 4FKQA 3QQGA 4XG6A 4ANMA 4P7EA 2QO7A 4HCUA 5ANIA 3HRFA 3QD3A 3V8SA 4KAOA 2JDSA 4C61A 5ANJA 4IJ9A 4CXAA 2X9FA 4K33A 5AV1A 4F0IA 1Y6AA 3MPMA 1GIJA 3LFQA 5DRDA 5JH6A 4YSJA 4RWJA 2FO0A 3ATTA 3KF4A 3UNKA 5ETFA 2FSMX 3OBGA 2ZB0A 4YJPA 5JMSA 3LQ3A 3D7TA 3IONA 1YXUA 3K2LA 4U9AA 2BFYA 3Q4TA 4R3PA 4CYIA 1JNKA 3LM0A 2FB8A 5J7HA 2B0QA 3PSCA 2GNLA 3TUBA 4YUQA 4CLIA 4K1BA 3FL5A 3ENMA 4LV8A 3PVWA 1YWVA 4Y83A 1U54A 4AN3A 4D5KA 4HYUA 3TKUA 4YHFA 4I5MA 4AFEA 2G9XA 2XJ1A 2G2FA 2VO7A 4IVCA 5BPYA 3TZ7A 3EJ1A 2WMRA 2QQ7A 2XJ0A 4CFUA 2ZMDA 1YOLA 2XK6A 2BDJA 3HYHA 3NAYA 4HVIA 4KSPA 1W0XC 2X8IA 3BYUA 4K6ZA 4V0GB 2VWYA 2R3HA 3R7UA 3PJCA 1FPUA 1OECA 3MBLA 5JGBA 3D2IA 4IW0A 3VBYA 2WQBA 3Q5ZA 4RC3A 3SOAA 4AOIA 3BU6A 3VS2A 5LMBA 2BRMA 4D2RA 4CTCA 3N4TA 4L7SA 4EBVA 4EHGA 4G9RA 4YJSA 4IJPA 2WMTA 2O3PA 3BX5A 3HV7A 4NU1A 5FDPA 3KMMA 4GSBA 5E8VA 1E9HA 2QKRA 2BZIB 4E6CA 4FIGA 3NSZA 4U3YA 4MXCA 5CALA 2BIKB 3CQWA 4FSTA 4I0TA 4R5YA 1LPUA 1KV1A 4QMQA 3MVJA 3SV0A 4QMNA 2HENA 4H3BA 2PVKA 5HVJA 3L8VA 1MP8A 3ZO3A 2VTRA 1BLXA 3AT4A 4BWKA 4WKQA 2IG7A 2CN8A 3PY1A 4FKGA 4EWQA 5A4TA 3C0IA 4EQUA 2J0MB 3AGMA 3OOGA 2XM8A 4O83A 1GIIA 3ATSA 3FLSA 4IXPA 5C27A 3VRZA 2WU7A 3KQ7A 3L8SA 3PY3A 4JQEA 4EORA 5IU2A 1ZOGA 1OKYA 2OXYA 2ZVAA 1KOAA 4N0SA 4RVTA 2G01A 4CV8A 3ZXZA 5E7RA 4AW5A 2BTSA 3TN8A 4D1ZA 4JDHA 4F7LA 4D2PA 4BCOA 2PVFA 3C4ZA 4KABA 2B9IA 1GNGA 3DOGA 4A4XA 3FE3A 2DWBA 4RC4A 4V01A 3FXZA 4ZY5A 2W17A 5HO6A 4BWXA 5L4QA 5EQYA 2F2UA 4G6OA 2BHEA 3OTUA 4XG8A 3D5WA 3T3UA 2BRGA 4AX8A 4GH2A 2VV9A 5LCKA 4EC9A 5GHVA 1H26A 5KBQA 4PF4A 4QYYA 4IAIA 5EM7A 4IX4A 4EYMA 4PV0A 5KNJA 3ZFXA 2C30A 5AR7A 3UOHA 3DNEA 4PP9A 3ULZA 2OW3A 3HVCA 2C0IA 3PXQA 1A06A 3SXRA 1WBWA 3JVSA 2GFCA 1URCA 4FV6A 3D14A 5FUTA 2C0TA 2X2MA 5TR6A 2UV2A 1B6CB 4D2TA 4KBAA 5M08A 2GDOA 2A1AB 3RZFA 3GFEA 1PXMA 4GJ2A 4PTGA 4FTKA 2C1AA 3KVXA 1LEWA 3PG1A 4W8EA 4WOVA 5EDPA 4EBWA 4EC8A 4UMQA 1Z5MA 3BWFA 4ACHA 4H1JA 3AC4A 4YNEA 2WFYA 4EOLA 2C5OA 1RQQA 2WTKC 3QA8A 5L2IA 1Z57A 2NRUA 5I9UA 4BDJA 5I3RA 1JQHA 2C6TA 2WTCA 2PZPA 4YO6A 3OWKA 3VS6A 2JDVA 5HTIA 5FM2A 2RFNA 2XCHA 3D94A 4OTRA 3OWJA 3DKGA 4KS7A 3RVGA 1R39A 3IGGA 3EQGA 3ORPA 3Q9WA 2ZM4A 4J98A 2GQRA 2JDTA 1UKIA 3OW3A 5IQFA 4FTJA 1IR3A 3BHUA 4CT2A 2ERZE 5HVKA 5CSVA 5E91A 4Q9ZA 3FMJA 4YGAA 1H07A 2C3JA 3TKIA 2IZUA 2RIOA 4AGDA 3BQCA 3CQUA 2C3KA 1FMOE 3D4QA 1Q61A 4R1YA 3DAKA 3TNPC 4G1WA 5CEPA 2W0JA 3MVHA 3NUPA 5IA5A 4CNHA 4CKJA 2P0CA 3QTIA 2C5NA 2VWUA 4IAKA 2VO3A 5HHWA 5KZ0A 1V0OA 2XK3A 3V6RA 5KX8A 3TI1A 2OH0E 4G3DA 4UYNA 2YIWA 4RWLA 1OITA 2J4ZA 1T46A 4DGGA 4I5PA 5T6KA 2YN8A 4DCAA 1H0WA 3DAJA 4Q9SA 4AGWA 5IG1A 3ZC6A 1STCE 4MCVA 3PFQA 4P5QA 2ZV2A 5CU2A 4S32A 3Q4UA 3MIYA 4GT4A 2OG8A 2WEVA 3NMUF 5CEMA 3TIZA 1UVRA 4FK3A 4QPMA 2JKMA 3NIZA 3IGOA 3H9FA 4WO5A 3JR1A 2VWWA 2E9NA 2GU8A 5IH4A 5BVOA 2VWIA 4I4FA 4XBRA 5AR3A 3R8UA 4JDJA 1U5QA 3EYHA 5K5XA 2HZNA 5K3YA 5GIPE 4FKLA 5DR9A 2R4BA 2IVUA 3AQVA 5D1JA 2CGXA 2BKZA 4O7NA 3ODYX 1QL6A 1XKKA 2BZJA 1F3MC 3HDMA 3DTWA 2I40A 3KXXA 3NZ0A 2WIHA 3EQBA 4ZSJA 4ALWA 2F2CB 1UNLA 3OG7A 4XV3A 2FGIA 3VN9A 2QI8A 3CPBA 3OVVA 4IADA 4QPAA 2LAVA 3ACKA 4EUTA 5KHXA 4RIOA 1IAHA 3LXLA 3ZZEA 1J91A 2RF9A 1YOMA 2WKMA 2YERA 1JLUE 2VTMA 2W5HA 1H1WA 3Q53A 4RX9A 4RX8A 3PPZA 4FNZA 4O96A 3ZC5A 4RZVA 3KF7A 1W83A 3S95A 3G0FA 5EM8A 2UW7A 2Y6OA 3ZS5A 4BVUA 2VTTA 3C4CA 2YABA 4PPAA 4QMXA 2WTWA 4ZLZA 4C4GA 5CSPA 4IMYA 4L44A 3GNIB 3E3BX 4CRLA 4DFBA 3EQPA 5AM6A 3QX2A 4X2KA 4QNAA 3SGCA 4CKIA 2XNGA 2UZUE 5M56A 3HP2A 3GCVA 3VC4A 3P23A 3GFWA 4YZNA 3BQRA 3HECA 2XIXA 4XOYA 2X6EA 4QMVA 3RAKA 1WMKA 5JRQA 4KSQA 4UMRA 2XIYA 5KKRC 4IAYA 2X7FA 3CKXA 4I5CA 4F9CA 4O2PA 2BCJA 2RFDA 3PP0A 3NW5A 3UDBA 1LP4A 4DG0E 2DS1A 4XG7A 3SKCA 5GJGA 3MFRA 4JG8A 3BCEA 4MQ1A 2Z7QA 4C57A 4CKRA 1BKXA 3RHXA 5JEBA 3HAMA 3F5XA 2Y9QA 4KINA 1WAKA 4XS2A 2R3FA 2JLDA 2O2UA 3NCZA 3W2CA 3SC1A 4ALUA 4CFVA 4RRVA 1P4FA 2J5FA 5JFXA 4CRSA 5L8JA 3ZLSA 4V05A 2B54A 3UMWA 4E5WA 2CKPA 5DBXA 4N4SA 3VULA 4DEHA 2ETKA 3GCQA 4M67A 4NKSA 3VW8A 2JBOA 2VWBA 3OY1A 4U80A 5AWMA 2WMQA 3GC0A 3I81A 5M4UA 1V0BA 5A14A 1IG1A 3HUBA 4J7BA 2BAJA 5DWRA 2YCRA 5JFSA 5M51A 4FTCA 3SW4A 2OZAB 4UWCA 4FTAA 3G9LX 4USFA 3UMXA 3UOLA 4JBVA 4EONA 3V8WA 4EOMA 3R63A 4F08A 1MRUA 3MWUA 1B38A 3KB7A 3O7LB 3GBZA 4FOBA 4S31A 3GCSA 5IUGA 4BY9E 4D2WA 4XJ0A 4EI4A 3W1FA 3DTCA 4ASEA 4LM5A 4CG8A 2YIQA 3H3CA 3PUPA 5FTOA 3VS0A 2VTAA 3E64A 2EU9A 3FQSA 5AIRA 1UNGA 1KE7A 1ZWSA 2HZ4A 5TO8A 4YP8A 4DLIA 2J0JA 2R7IA 3QZFA 4O0XA 1YDTE 4YJTA 1H4LA 2OH4A 2GPHA 1PMUA 1SVEA 3IG7A 3OCGA 3PXKA 1IA8A 1P4OA 1O6LA 4FT5A 5CVFA 4IACA 4HVDA 2WQEA 3EN9A 2H8HA 3PZEA 4IFGA 4EH2A 5AAFA 2ITWA 2GSFA 2QVSE 4C58A 5CAOA 2P2IA 3QQKA 4IZ7A 4EHZA 4FT3A 3F2NA 2I1MA 4O0WA 4D2VA 2HWOA 3E8EA 5EQEA 3UP7A 5AIKA 1JKKA 4LRMA 4IZ5A 5B2KA 2XIKA 3C4FA 4MH7A 5HU3A 3BE2A 4F9BA 2G2IA 2Z60A 2YHVA 3AC8A 4XG4A 5JRSA 3KK9A 4F7JA 2WTKB 2B1PA 2W9ZB 3UIXA 4BKJA 4C4HA 3Q96A 2ITPA 2PMIA 3VUMA 5HIEA 5CENA 5KMJA 5DI1A 4OR5A 3Q6UA 2GHLA 4A4OA 3BYVA 2UZTA 4RIXA 3PVGA 2C47A 5M4FA 3KRLA 5CF6A 3Q3BA 3QRUA 4P4CA 3GCUA 5CAPA 1QPJA 4FR4A 2OU7A 1PXPA 4EOIA 2A27A 3PIXA 5JFVA 1V1KA 5IQGA 3R6XA 4L52A 1SNUA 4U45A 4EH4A 4X2JA 2CJMA 2UVZA 3OTVA 3QKMA 1OM1A 2UW6A 2J0KA 3HA6A 4GVJA 5EOBA 4MBIA 3POOA 4J71A 4FTOA 4AW1A 4QQJA 5HLPA 3W2PA 4FX3A 3TT0A 1OGUA 1REJA 2VTNA 3KREA 4TXCA 5CS6A 4IAAA 4QP3A 4D2SA 3WF7A 4GYGA 3VUDA 3WIKA 1WCCA 3SX9A 1KSWA 4O91A 3NW6A 3SRVA 2QR7A 2O0UA 4J8NA 3CTJA 4ZXTA 1UNHA 4QRCA 4ZLYA 1LUFA 1MQBA 5K0XA 3S4QA 2ETRA 3LFSA 2YCQA 4ACDA 3MB7A 4TYHA 1FBNA 5CU6A 4O1OA 4IB5A 4FUXA 5CT0A 5I9XA 2W06A 4FV1A 3VF8A 3FLZA 3QTSA 4AACA 2JIIA 3TACA 2DUVA 1YVJA 4FC0A 2JFMA 4FL1A 3BPRA 4I6FA 4ASXA 4AZEA 3QCYA 4FKIA 2YM6A 4GK2A 3LCDA 3F3ZA 4ALVA 1BYGA 4L53A 2QCSA 1L8TA 4FSNA 3NUNA 4KD1A 4HVGA 4B9DA 2VN9A 1JOWB 3QZHA 2XK8A 3QTRA 3O8UA 4ZTQA 3FPMA 2E2BA 2XK4A 1E1VA 5LCJA 3LCTA 5LVOA 4RT7A 5ANKA 2BILB 3UC3A 5EKNA 2JAMA 4DT9A 3W18A 4NEUA 4QTCA 5E9EA 3SA0A 3R1YA 4L67A 2W4KA 4BKYA 5IA4A 4BKZA 3V01A 4BCJA 4BZNA 3ZBXA 4CT1A 4WG5A 2BRBA 3BHVA 5AV4A 1J1BA 3SRVB 4MAOA 4RMZA 4M14A 4TWOA 2ZMCA 4U79A 2BR1A 5J1VA 5IQAA 3SQQA 4XLVA 2BDWA 3WARA 4Z3VA 3AMAA 1W84A 3UC4A 4JJRA 3GP0A 4WNMA 4LGHA 1YWNA 4OTPA 4PL5A 4O2ZA 3ZH8A 1IA9A 1KV2A 5HQ0A 3R9NA 4BGQA 3C7QA 3MPAA 3HX4A 4E73A 2HCKA 3DXNA 1XH9A 1UU3A 2X8DA 4FIEA 1ZMVA 3R30A 4C33A 3OS3A 2WNTA 3KXHA 4XYFA 1W98A 4I24A 3V5WA 2OIQA 3KEXA 4H05A 3HMMA 3OMVA 5M4CA 4B0GA 5JGAA 4XG2A 4NSTA 2ITNA 3THBA 3OFMA 5F1ZA 1M2RA 2O65A 1YDRE 4IB1A 1J7LA 5C03A 1NXKA 2UUEA 3H10A 5CQWA 3F88A 2BRNA 4EH8A 1X8BA 2ITVA 2WU6A 3FXWA 1F0QA 4KIKB 3SAYA 2PUNA 3L9MA 3AMYA 2XNPA 4GL9A 4R7HA 2KTYA 4ENYA 2CKOA 4NTTA 1JKLA 1DI8A 2CPKE 3GU7A 4M66A 4QP7A 1XH8A 4M3QA 5TE0A 1YXSA 1JPAA 4HGEA 4E4MA 1GZKA 1RJBA 1ZXEA 2AUHA 2YZAA 2CHLA 3QQLA 4OT6A 3E88A 1HCKA 4DBXA 4NFMA 4CFMA 3QTZA 1ZZLA 3Q2MA 5BVFA 5J95A 4CEGA 4XHKB 5KCVA 5EW3A 2X1NA 4K18A 4BGHA 4F6WA 3P1AA 5DFPA 4WA9A 2XK9A 3HV4A 4FEVA 3W8LA 4ANBA 3V5TA 4Y46A 1CDKA 5M4IA 1YWRA 3G6GA 1JBPE 2UZEA 4CZUA 5C8KA 1PMEA 2OFUA 2XVDA 5DMZA 5J87A 2F7ZE 3ET7A 3CBLA 4EUUA 3VUTA 5AP3A 5M55A 3DB6A 2QG7A 3M1SA 2WTJA 1CMKE 3HL7A 4ACMA 3EKNA 3BHTA 1SYKA 4NCTC 2R5TA 3LXNA 2VX0A 4BCIA 2FSTX 3MY0A 4Z7GA 1FGIA 2FSLX 2VGPA 4N6ZA 4RJ4A 3NAXA 1PMNA 4RJ5A 4C35A 3GU8A 3K3JA 3KFAA 3DQXA 3PIZA 2PZYA 5FXQA 2EB3A 4LOQA 1OZ1A 3S2PA 3CY3A 4DGMA 5IH5A 3WBLA 5EQPA 4DA5A 2XEYA 4JXFA 5DYJA 2XYNA 4AZTA 4E1ZA 4I41A 5KZIA 2OJ9A 3HRBA 2PE1A 4DH1A 2YFXA 3AD5A 3Q32A 4ZJJA 3FQHA 3MY5A 3S00A 3V5LA 2QOCA 2C6OA 3W10A 3GC9A 3Q04A 3PYYA 5CSWA 4ANOA 4C36A 2HOGA 3GQLA 4IWDA 4EL9A 5HLWA 2W9FB 4Y5HA 3ORZA 1H1PA 3RZBA 5J79A 3PXYA 3O17A 5DGZA 4CSVA 4YJRA 4I0RA 3L8PA 3ZSGA 3GQIA 4OW8A 4AE6A 3FMDA 2I0HA 2CCHA 2ZV7A 2GHMA 5HX6A 5E1EA 3BLRA 4BIDA 4KKGA 3HMNA 4TWPA 4OBPA 5CU0A 5JGDA 3HKOA 2Z8CA 3GU5A 5DT4A 5I4NA 5BYLA 1KWPA 3KN6A 3R7VA 3VHKA 1YHSA 4C02A 4E8AA 2V22A 3QL8A 2CNQA 1DI9A 2VX3A 4IWOA 5HO7A 4Q5EA 5JK3A 3QWJA 1R0EA 3HDNA 2YJSA 4DFZE 4L3JA 3NYNA 2JIVA 4GT3A 1R3CA 3NDMA 1G5SA 4FSWA 2WZJA 4C4EA 4KKHA 2XBJA 4BDDA 2JDRA 4E4LA 3ZEWA 4NK9A 3WZUA 1OI9A 3QKKA 4RQKA 3ROCA 2WMBA 3F61A 2JITA 1MQ4A 1CSNA 3U8WA 1AD5A 2XNEA 3ZO2A 2PZIA 3W16A 4G34A 4PWNA 3EIDA 4I94A 2UZBA 1HCLA 4YZCA 5CLPA 4RC2A 4A06A 3IW5A 2XZSA 3K5VA 5ICPA 3LFDA 4ID7A 4O84A 1M52A 1QPDA 3Q9YA 1PXLA 1QCFA 4AZWA 3UZRA 2PE0A 2QHNA 3O7LD 4HJOA 4U41A 3NVMB 4AS0A 3T3VA 5J1WA 2QODA 4IX6A 4XX9A 4I92A 3KL8A 4GJ3A 4OGRA 5BYYA 2RG5A 4JOAA 4F7SA 3D5UA 4IFCA 2C3IB 3FSKA 2HZIA 3DJ7A 4QO9A 3AMBA 5A54A 5FLFA 4GK4A 4D0XA 4FVRA 4JG6A 5C26A 2BVAA 1YRPA 2ZYBA 2G1TA 3GU4A 4W4WA 5HNBA 5K4IA 1O6YA 4FG7A 4C4FA 3MH0A 4MNEB 3WYYA 1V0PA 4FNYA 4MXAA 4R6VA 4Y73A 5CTPA 1ZYSA 2GCDA 3SLSA 3PVBA 4I22A 4KA3A 3UVQA 5JSMA 3G5DA 1PXOA 3TJDA 3DXPA 3DAEA 3SXSA 1ZAOA 3F3TA 4B99A 4FSUA 4IM2A 5IQDA 4QD6A 3I0QA 4RFMA 1H0VA 3SW7A 4W4XA 4PP7A 3MPTA 1BI7A 5M44A 1AGWA 1O6KA 5A6OA 5CSXA 3ZUTA 4M8TA 3BGPA 4W8DA 5FDXA 5M06A 4RX5A 3TIYA 4DGLC 3VS3A 5BMMA 4AQCA 4EK6A 2PVLA 4J96A 1ZMWA 3PA3A 2OIDA 2UW9A 1ZOEA 3BI6A 1KE6A 4IVBA 4NW5A 3O8PA 3UGCA 5DR6A 4YURA 3FMLA 4TN6A 3RCDA 4USDA 2PVJA 4TL0A 1BUHA 2JFLA 2QG5A 4IVDA 5AP7A 2R3MA 4DEDA 4F99A 2ZB1A 3DA6A 4KIPA 3QXPA 4USEA 4UX9A 1IAJA 3CXWA 4QNYA 2EXMA 2OK1A 4YLKA 4EKKA 3LQ8A 4FYOA 3R22A 4H3PA 4M69A 5JQ5A 4QYGA 4GG5A 4AZSA 1Q8ZA 3LCOA 1WZYA 3G0EA 3HMPA 3G2FA 5L2TA 3WF9A 5BMSA 3PDTA 4ZMFA 4ITJA 3W2OA 2E9OA 2VAGA 3R0TA 4FI1A 2W1IA 3H30A 4XG3A 5GJFA 2PZ5A 1MRVA 4RIYA 4BGGA 4JBPA 4F6UA 3QQJA 3QTQA 4XV9A 1M17A 3D7TB 4LGDA 4NM3A 1XH7A 3I0OA 2ONLA 3ORTA 4PUZA 3N9XA 4CQGA 5G1XA 5E8ZA 2C6MA 3POZA 5H3QA 3R8VA 3WF8A 3LKMA 4UB7A 4Z7HA 2ITZA 3A2CA 3H0ZA 4NIFB 1GAGA 4CVAA 4FOCA 4U44A 3F3VA 3F2RA 3CPCA 3BYSA 4YTIA 4HW7A 1GZOA 3FKOA 2WAJA 3QWKA 3E8CA 4JLCA 2W5BA 2QONA 1JAMA 4U81A 2WO6A 2WQMA 4TZRA 4FL3A 4AA5A 4XRLA 3EZVA 2VTLA 2PTKA 4EH9A 3MH1A 2ZDTA 3EQIA 2YDKA 3F3UA 4APPA 5B2MA 3R8MA 1MUOA 3E8DA 5HO8A 4QMMA 4W9XA 5IISA 1OL5A 3TL8A 3JPVA 3NPCA 3DK3A 4FGBA 3GU6A 1PXNA 3TUCA 4EEVA 1KE5A 4YC6A 5I9WA 1R0PA 5CVGA 3UO6A 3EQRA 4E6AA 3DBQA 3WF6A 4AN9A 4YLLA 3G90X 2XRUA 3VUKA 4DGOA 2R0IA 3MW1A 4C37A 3MJ2A 5A6NA 4D55A 4JNWA 1GZNA 3JY0A 4FV3A 3IW6A 3R8PA 3GT8A 2FUMA 3FDNA 2UZOA 4DEBA 4BI0A 4QQTA 3C4XA 2VX1A 3W55A 4WNKA 3UJGA 4IX3A 4KBCA 2QNJA 4L46A 5DT3A 3UOJA 2PY3A 3G51A 2YWPA 3DDQA 2C1BA 2WQNA 3FMEA 2NNWB 5BX0A 2I0VA 4RZWA 4U40A 2JBPA 3F7ZA 3ZDIA 5LVNA 2I6LA 5B0XA 2AYPA 4BDFA 3VRYA 4OTQA 1GY3A 3C4WA 4MBLA 2C0OA 4AZVA 4LMNA 5IA3A 1SNXA 3LCSA 1Y6BA 4PPCA 5CAUA 4XMOA 2OJIA 2E9VA 5LWMA 1I44A 4FTMA 1H24A 4JVGA 2OIBA 3GENA 2WMSA 3HV6A 1Q41A 3AC2A 4F0GA 4RFZA 4DLJA 4HZRA 4OAVB 4L45A 3CCNA 4EJNA 3FMKA 4ZS0A 4M69B 1YHWA 2ZDUA 4UMTA 2A19B 3DLZA 3CSVA 5CXZA 4L42A 4IB3A 1M2PA 3OROA 4UWBA 4FMQA 3E62A 4XP2A 4Y85A 2IZRA 4U97A 4WIHA 5AV0A 4LMUA 2JEDA 4ANNA 2PUIA 4HVSA 3ANRA 2XNMA 2VNWA 2H34A 3FI4A 4FYNA 4FSZA 5CT7A 3A60A 3OXZA 3UOKA 3VBVA 3PXZA 3V5QA 4YJOA 5DPVA 4BC6A 2UW0A 4HYSA 2C4GA 3CD3A 4NM5A 1PF8A 1Y91A 1JSUA 4JQ7A 1OIUA 2Z7RA 3QKLA 1UA2A 5LJJA 3FJQE 2JIUA 4XV1A 4UXLA 4IM0A 1WBTA 1KE8A 3MA3A 4JI9A 3R7YA 2Y4PA 2G2HA 3D5XA 4MK0A 4OTIA 3AD6A 3VQUA 4C3FA 4OBQA 2OZOA 3R71A 1ZYLA 4ANQA 4JR3A 5EW9A 3RPSA 4BCHA 3WZDA 3C0HA 3K3IA 3ZRKA 1H1RA 4U5JA 4MD8E 4FTUA 2I0YA 1YI3A 2J51A 3DU8A 3TDWA 2ITUA 1PYXA 1WBPA 2PZRA 4FVPA 3VO3A 1ZRZA 3IW7A 3QZIA 5E8WA 2XUUA 5T3QA 5L2QA 3DBDA 3P9JA 4YHJA 4TNDA 5EYKA 3QUEA 4YZMA 1XQZA 3V8TA 3JYAA 4HYHA 4XH6A 4FVQA 2O8YA 2OJJA 3FLYA 3PE2A 4FK6A 4ZTHA 4BCPA 4CCUA 4DH5A 1J7UA 2FSOX 5HX8A 3ORXA 3DBCA 4FV8A 5I0BA 3VUHA 1NVQA 3M42A 2OLCA 1QPEA 3FY2A 5H8EA 3MFUA 2PWLA 2WMXA 4NM7A 5CNNA 4F4PA 1NT2A 5A4EA 3Q2JA 3CEKA 2GNJA 4QMLA 4MXXA 3QQHA 4MQ2A 5AUXA 3QCQA 4ZS4A 2VTIA 2ZM1A 3A62A 3A7IA 3BE9A 4BBEA 3FY0A 1JSVA 3Q4ZA 4YHTA 1P5EA 5DOSA 4D0WA 5LQFA 2H6DA 5HTCA 2EB2A 4BYJA 1IEPA 4ZY4A 3ID6C 4EHVA 3FBVA 5TF9A 5AR4A 5JN2A 2XB7A 2J6MA 3FYJX 3KRWA 3OXIA 3UBDA 1M7NA 4BTMA 1JVPP 4AU8A 4B8LA 4RSSA 1I09A 2UVYA 4NW6A 2BALA 2HELA 5DIAA 3T8OA 4TWNA 3ZONA 4DC2A 5E8XA 4UY9A 5HG5A 3LFFA 3QBNA 4CQEA 2BUJA 2YDIA 3R9RA 2PHKA 3IW4A 2WTIA 4I21A 5CY3A 5E8TA 4ZTSA 4L68A 4U6RA 3W32A 3MVLA 3BU5A 4LYNA 4AUAA 4QYHA 5BVNA 5L3AA 1XBCA 1FVVA 5DLSA 2VWXA 4YJUA 4BDIA 2ZAZA 3QCXA 2P33A 3P4KA 4GEOA 3MESA 4FIIA 4AOJA 2ITXA 2JD5A 2UVXA 3CP9A 3P86A 3RWQA 4O7ZA 1WBSA 4DEAA 3P78A 4JIAA 3O2MA 2YLEA 2IO6A 3NNXA 2W05A 4O22A 4TYGA 2PYWA 3LFNA 2V5QA 3PE1A 1RE8A 4U3ZA 1NVRA 4D58A 3RPVA 2YM4A 3PZHA 4K77A 5I9VA 4M97A 3ORLA 2XKCA 4P90A 3UO5A 5BVKA 1Q24A 1T45A 2YDJA 3GGFA 3DNDA 5F94A 5CF5A 2PU8A 5DA3A 3ZUUA 4FTQA 1OIQA 4UMPA 4D5HA 3AT3A 5L8LA 2XNBA 3MDYA 3R04A 5LMKC 4HOKA 3OCTA 3IDBA 2GNGA 4G9CA 3FKNA 3F69A 4FV9A 1REKA 3GB2A 3G15A 2XA4A 5HIDA 3P7AA 2IVVA 4EK4A 2HW7A 3FKLA 4FICA 1PKDA 5KMNA 3HV5A 2KULA 4PPBA 4YZDA 5DVRA 3TNQB 5IF1A 2W1HA 5TOZA 4ANSA 1TVOA 4ZJVA 4O7TA 3DFCB 4QQCA 3KVWA 4O0YA 3TNWA 5E8SA 3FMHA 2PPQA 3ZLWA 3C50A 5IUHA 4MWIA 2XH5A 5AAEA 5EDQA 3NNWA 3KMWA 3U54A 1SVHA 3NYOA 1FINA 4GU9A 2C5VA 4BIBA 3ROYA 4DT8A 1ZARA 5AJQA 4FA2A 3BEGA 4BR3A 3B8RA 3B2TA 4GS6A 4A4LA 4BCQA 3WE4A 4DFXE 3MV5A 4G31A 4KIQA 2UZWE 4O0SA 4Y95A 4F70A 3HGKA 3NGAA 1XBAA 3RI1A 3Q9ZA 3C51A 3DJ5A 5D41A 2R3OA 4LUDA 5HU9A 5BVWA 4YLJA 4N6YA 3BHHA 3WF5A 1PMVA 5HICA 2JKKA 1U4DA 1LEZA 4BIEA 2QLQA 3FPQA 1RDQE 2E9PA 3V5JA 4TRLA 4J52A 2Y4IC 4MNEA 1FVRA 4BDEA 4H58A 3VHEA 4R78A 3FL4A 1TQMA 3NS9A 4AZFA 3UZTA 3QRTA 4WG3A 3NX8A 5HD7A 4D4YA 2RFSA 5GZAA 3QYZA 3QLGA 4FZAB 4WSYA 5AAGA 3A7HA 2BFXA 2XM9A 3CTQA 4XBUA 2UW8A 4AGCA 5IA1A 3A61A 5IA0A 2YWVA 4MYGA 2CNUA 1WBOA 3QTWA 4M0YA 4MX9A 1FMKA 3EN6A 5EM6A 3H9RA 3DV3A 4ONAA 3EL7A 4GFMA 5LOHA 3HRCA 3BLQA 4C59A 3UIMA 3UQCA 2IN6A 2IVTA 3QUDA 3I7CA 4F6SA 4OT5A 4HCTA 4FEWA 5IUIA 4J95A 1XH4A 4RVLA 3RK7A 4XP0A 4E93A 4YO4A 4YU2A 4U42A 2Q83A 2BMCA 1UU8A 5IQBA 3ZFYA 4DINA 2OXXA 4X6RA 4YSMA 4D4RA 2E9UA 3HV3A 4DTAA 3CC6A 2OWBA 2HZ0A 3UG2A 1DAWA 1EH4A 2OXDA 2QOOA 3PY0A 4AA4A 3BELA 3I7BA 3EQDA 2QLUA 5M07A 4IANA 2YISA 3LPBA 4UN0C 4QP8A 4X3FB 4FTNA 5CF8A 3AG9A 4WNOA 5B2LA 2X39A 4O6EA 3TTJA 2RG6A 2HY0A 4BI2A 1SM2A 2PUUA 2J2IB 2VZ6A 4RLKA 1J1CA 1CM8A 1Q97A 3DDPA 4GCJA 3DK7A 4U0IA 2Z02A 2X81A 3AC1A 1Q99A 3MI9A 3RWPA 5IPJA 4YJQA 3MGYA 5A4LA 2QHMA 4IAZA 3PXRA 4GK3A 4I0SA 3OT8A 2OJFE 5DEWA 3UO4A 4E3CA 2WB8A 1Q8UA 1YXXA 2PSQA 4HGLA 1UKHA 3R1QA 1J3HA 4C2VA 4DITA 4F65A 3C5UA 3FZSA 5EI2A 2HAKA 2OZAA 5DEYA 3RAHA 3EB0A 3QYWA 2Z2WA 4OTHA 4M15A 4QP6A 4GIHA 4JAIA 4QTAA 4BI1A 2CSNA 2V7OA 4IB0A 5C8MA 3E3PA 4C38A 1SVGA 3EYGA 4CYJA 5AEPA 5ANDA 2F57A 2WMWA 3F9NA 2CLQA 2VWVA 3I6UA 3W2QA 2WD1A 5GZ8A 1OPJA 2XNOA 4D4VA 5F20A 1XBBA 3LXKA 2VNYA 1S9IA 2YAAA 3RKBA 4XOZA 5AV2A 1J7IA 3GUBA 4K9YA 5ACKA 2X6DA 2F4JA 5CEKA 2QO2A 4HZSA 5FD2A 4D4SA 4WD5A 3ZXTA 3IKAA 4FV7A 4DG3E 3ORKA 4FKTA 3DKOA 3QF9A 1ZOHA 4E26A 4S30A 5LVPA 2BAQA 3MTFA 2XEZA 5HZNA 5IMXA 4TKSA 1UWHA 2V62A 3ZTXA 4A9TA 2YIXA 3PWYA 1OPKA 4FIJA 3ZO1A 4D28A 4BDCA 2ITQA 2OBJA 2RKUA 4IDVA 5K0KA 2GNHA 2W4OA 4L3LA 3L9NA 3P08A 4HPUE 5AUZA 4C4JA 3FLNC 4ZZOA 4U8ZA 3K54A 4OTFA 2J5EA 3BIZA 4NH1A 5HE2A 4X3FC 4KRDA 2XIZA 3ORNA 4FNXA 4FV2A 3RHKA 2OFVA 4ZY6A 3WI6A 4DAWA 1YW2A 4KKEA 4WRGA 4G17A 3EMGA 3DQWA 1W7HA 4F09A 1Q5KA 4J1RA 4AXAA 2IPXA 4V0GA 3QLFA 4GFOA 5J7BA 1YQJA 5EFQA 4DH8A 1PY5A 1M7QA 4JS8A 4IM3A 4N70A 1WVWA 4TTHB 1PJKA 4W9WA 4LFIA 2QO9A 1Y57A 3RK5A 2QOHA 4B4LA 1Q3DA 4RIWB 3MYGA 5F95A 4HPTE 5AMNA 2YACA 4JRNA 2XF0A 4WRSA 3EOCA 1WVYA 2OSCA 4ANLA 2ZOQA 4ERWA 3ZM9A 4K11A 5CF4A 4NL0A 3U4UA 4G3EA 4UZDA 3VUGA 3NNUA 5C1QB 3L1SA 3E92A 1H25A 4JIKA 3VBQA 5BYZA 5FBOA 3TZ8A 4FG8A 4G6NA 5CWZA 3ITZA 5FP6A 1PXIA 4EH7A 1MRYA 4TPTA 3T9IA 1OUYA 3RAIA 2BPMA 4OLIA 3OCSA 4X2GA 3IDCA 3OD6X 4YTHA 2J0LA 3FZ1A 2GNIA 4BF2A 3M2WA 1YXTA 4R8QA 2X2LA 3I79A 3OWLA 3ZYAA 4Z16A 5DHJA 3KXMA 3QALE 5M57A 2C6LA 3QRJA 1PW2A 4QP9A 4YMJA 3DLSA 4LQMA 1BI8A 4MXYA 1GJOA 2VD5A 3QTXA 4FZDB 5EDRA 1ERKA 1Q4LA 1DAYA 3EQFA 4L6QA 4NTSA 4X7QA 1S9JA 4QTDA 3I60A 4M7IA 3MIAA 5C4LA 3IQ7A 3EHAA 3R73A 4EOPA 3TV6A 4EJ7A 3L9PA 3TDVA 4IZYA 3FSFA 2J0IA 5FEDA 4C7TA 5I5ZA 5FG8A 2V7AA 5BUJA 2UW3A 3RINA 2XK7A 4R3RA 2ESMA 5TT7A 5K9IA 5G6VA 4RA5A 3LLTA 5FTQA 5H2UA 5EI6A 4FTRA 4GRBA 3LVPA 3RM7A 4QMYA 4YBKA 3H9OA 4A9SA 3SG9A 2BRHA 2BZKB 2BKKA 4UXQA 3FZRA 1QMZA 3SG8A 2YM3A 4WNPA 3CIKA 4RWKA 3ZUVA 2X4FA 2GFSA 4G16A 2R9SA 4TYJA 5ANEA 2BIYA 2IZTA 5AP6A 3QA0A 3WIGA 1YXVA 3E7OA 4XEYA 3SXFA 3R01A 5FTGA 1KE9A 3KXZA 2EXEA 2GQGA 3EQHA 5AA9A 4ASDA 4NYEA 2QOIA 5KUPA 2X0GA 3NVKI 5E1SA 1OPLA 3BHYA 1SMHA 4LRKA 3U87A 3MFSA 2CKEA 4TYIA 3II5A 4O38A 2A0CX 4G2FA 4D1XA 3O50A 5DG5A 2X7GA 4EH3A 1Q62A 2XS0A 2W99B 4M13A 2F7XE 3T9TA 5CXHA 5BQ0A 5LMAA 2WTVA 4ARKA 4O81A 3KCFA 5IEVA 5CU3A 5DT0A 3LFAA 5HG7A 3CLYA 5KMKA 4O0RA
chains in the Genus database with same CATH superfamily
1DM2A 1ZYJA 4KIOA 1M14A 4QP4A 3QX4A 4DE4A 3TNIA 3OUNB 3PXFA 4IWQA 2W1FA 3D83A 4QTEA 1TQPA 2Y6MA 4FV4A 5HBEA 4DFUA 5EOLA 3ELJA 3D2KA 3TEIA 4ZTNA 5AUTA 4UYAA 3ZRMA 1K3AA 3NUAA 2DYLA 3IOKA 3QTUA 3WYXA 4EZ3A 5A4CA 2B9FA 1BX6A 1NA7A 3PVUA 4ZIMA 3H4JA 4L01A 4Y8DA 2A98A 2XIRA 4IC8A 4NFNA 4U43A 3EQCA 4W4YA 3F66A 4BCMA 1UU9A 5AR8A 1ZZ2A 2R3LA 4DTKA 1H1QA 4BBFA 3UYSA 4C8BA 3DXQA 3DBEA 4BWPA 2PVMA 2PL0A 3HUCA 4BHZA 3DKCA 2IF8A 3MJ1A 3U51A 4IBMA 2W1EA 4G5PA 1Q8YA 1NW1A 2J90A 4F7NA 5AP0A 4GUEA 3R1NA 4BCFA 2YCFA 2BDFA 3QFVA 4IIRA 4O0TA 4DH7A 4D9UA 4PMPA 5LXMA 1YKRA 3DFAA 5HLNA 4AXFA 3ZLXA 3B2WA 3EFKA 1ZYCA 1A9UA 4IX5A 3V5PA 5LWNA 2WMUA 2I7QA 1WBVA 2CDZA 4LV7A 2ERKA 4FSYA 4EHEA 2WGJA 2O64A 3FZTA 3PJ3A 4ITIA 3PRFA 2G15A 2GHGA 4HNIA 5CAVA 4F1MA 3GEQA 4UMUA 3COIA 4R77A 4UV0A 3DCVA 3F7WA 3UIBA 3U4WA 5AFVA 5AX9A 3BGZA 3RMFA 3ZSHA 1DS5A 4WUNA 3TV4A 3E7VA 3GVUA 4CFFA 1A48A 4FKPA 3ULIA 1H00A 2QU6A 4X2FA 5KMLA 4DN5A 1TQIA 3HMIA 3IK3A 4LUEA 5DR2A 4TW9A 1JWHA 5LVMA 2X7OA 2R7BA 3AOXA 5JZNA 4FTLA 5HGIA 3SOCA 4O6LA 5KMIA 5GIOE 4BTFA 4FG9A 5HBJA 4YJVA 4TY1A 1Q8TA 5ETAA 3LIJA 3U6JA 4DYMA 3NWWA 5J8IA 4FKVA 2BAKA 3AGLA 2QOLA 3KGAA 1H8FA 3GI3A 3RNYA 1G8AA 4ORKA 1PHKA 3OT3A 3OBJA 4RJ7A 5E90A 5AP4A 4Z55A 3ACJA 1YI6A 4JAJA 3F5GA 5KMMA 5DNRA 4ZZMA 2DQ7X 3BRBA 5T68A 3O23A 4AT4A 4E20A 3LMIA 3N4VA 3CQEA 2H96A 4Q2AA 3BWJA 4GMYA 2JKOA 1U5RA 5HVYA 3R7OA 4AQKA 1K2PA 4NT4A 1M2QA 5H8BA 3TZ9A 4MBJA 3QC4A 4II5A 2C5YA 5A9UA 1UV5A 1W2CA 3QRKA 3BU3A 4WUAA 4JX7A 5CI6A 2IW8A 5E4HA 5ACBC 3ZHPC 4DHFA 2WHBA 2IW9A 4GW8A 5EM5A 4PQNA 1OKZA 5JQ8A 4AXCA 2OF2A 4FKRA 2O63A 3E8NA 4L00A 3G33A 4PMTA 3BV2A 3BYOA 4X6QC 2EVAA 4OAUC 3AT2A 2YJRA 5DRBA 3JUHA 4KIKA 3CS9A 2YAKA 3UG1A 3VQHA 3W0RA 1OIYA 1YI4A 3R28A 4L8MA 4NWMA 4PNIA 5CU4A 3OF0A 2LGCA 3EN4A 4MD9E 2Q0BA 3UYTA 3ZLYA 2H9VA 3DPKA 1GIHA 3G6HA 1VJYA 4AE9A 3NIEA 3TZMA 4I20A 3B8QA 1YHVA 3C0GA 5DN3A 3ZU7A 2ZM3A 3FHIA 4FEQA 1IASA 3COHA 4IE9A 3VBTA 4AF3A 4BCKA 3LZBA 5IDNA 3KCKA 5J9ZA 4BYIA 4YC3A 3R2BA 3SDJA 4EKLA 3EN7A 4OTGA 1OL2A 2Y0AA 3PLAE 3VS7A 5JT2A 2VO6A 3UODA 4FZ7A 3RPYA 3WZJA 1G3NA 3S3IA 2RGPA 2C69A 1UU7A 2PVNA 5B7VA 4ZLOA 4FT0A 4L7FA 4QP1A 4YJNA 5A4QA 5E8UA 3LJ1A 5AUWA 3CGFA 3TNHA 4CCBA 3HA8A 3KMUA 5DE2A 3U9CA 4O7LA 4CV9A 2QKWB 3R9HA 3OEZA 3UPZA 5HCYA 3QHRA 4ZSEA 3R7IA 2EWAA 3BV3A 5AP2A 4RBLA 3KK8A 5CSHA 4BZOA 2QOBA 1VR2A 5H8GA 2O5KA 3LCKA 4FJVA 4QEBA 1YOJA 3UQGA 4R7BA 1U54B 5AUVA 3DB8A 4C4IA 1W82A 4JQ8A 4PMSA 4DCAA 2CKQA 4CG9A 3OC1A 4QYEA 3RALA 5KO1A 4DF3A 2WOUA 3QD4A 2VU3A 3EH9A 4EQCA 5LMKA 2R3PA 4FODA 3IOPA 2CGVA 2QC6A 3DT1A 4I93A 3PIYA 5AV3A 3D5VA 3L9LA 5IQIA 3EWHA 5EYCA 4O21A 3RNIA 5F9EA 2RSVA 4HNFA 5C8NA 4JX3A 1JKTA 4BN1A 2CLXA 4X3JA 5HBHA 5CEIA 3TCPA 3SD0A 4F0FA 3U55A 3G9NA 1U46A 2GS7A 5CQUA 3UIUA 4UWYA 5AR5A 4ZTMA 5I9ZA 3M11A 4I6HA 5HCZA 1OB3A 1URWA 4V04A 1E1XA 3K5UA 2GTMA 4QOXA 3D15A 3C1XA 2WIPA 3ZDUA 4G5JA 4RGJA 5EW8A 4E4XA 1ZY4A 4RFYA 1Y8GA 2C6EA 4W4VA 5LARA 3KULA 4H1MA 4DBNA 3CKWA 2F9GA 3NRMA 4Y72A 3RBWA 2BZHB 4NJ3A 2PE2A 4UEUA 5HG8A 5AR2A 4O7VA 4RIXB 3ZM4A 5M53A 5AUUA 4A9RA 4DH3A 5FRIA 5CZHA 2GTNA 4JRVA 4YNOA 4MUQA 3BLHA 1NY3A 1R78A 2EXCX 4TT7A 1FQ1B 5GJDA 3OZ6A 3QQUA 3VJNA 1KUTA 4JR7A 1WBNA 5CVHA 3MH3A 5HTBA 3CD8A 3P7BA 4L3PA 4EOKA 3FC2A 4AFJA 2VTOA 4FKWA 3ZOSA 3SVVA 3QCSA 3GCPA 1CKJA 2FA2A 2X2KA 1JKSA 2B9HA 5EHLA 5FEQA 2GNFA 4XRJA 2C6IA 2Y8OA 4HGTA 4BCNA 2C6DA 2WTDA 4FIHA 4QMOA 4IVAA 1XJDA 1NVSA 2NRYA 2GS6A 3RP9A 2FYSA 4IHPA 1WFCA 3O8TA 4NZWB 4PDSA 5AP1A 4FSMA 3R83A 3NUSA 3LJ2A 4QP2A 2QD9A 3EN5A 3I5NA 3C5IA 2PMLX 4F64A 2J9MA 3AC3A 5EKOA 2XP2A 2IW6A 5L2SA 3RTPA 4IH8A 1Z9XA 4WG4A 4PX6A 5LVLA 3NYXA 3R7GA 4LRJA 5EHOA 4BHNA 4ZTLA 3AD4A 4NCTA 2X8EA 4QMZA 2Q0NA 4J53A 4E6DA 3RM6A 3PPKA 2VTHA 4KBKA 4R7IA 4KUJA 2R2PA 3V04A 1ATPE 1HOWA 2WQOA 3PRIA 3DKFA 4F1TA 5A46A 5EYDA 2PMOX 3OHTA 5HD4A 3FEGA 3ERKA 4FGRA 3LLAA 4X3FA 4AP7A 5GZ9A 4RG0A 3VS5A 3ETAA 3FLWA 5JZJA 4I6BA 2XNNA 4RJ8A 4FEUA 4YTFA 3MSSA 5EI8A 5ETCA 4O4DA 3VUIA 3A8XA 4NUSA 4S34A 3DS6A 4XP3A 2WMVA 3I5ZA 3A8WA 1U59A 3F3WA 3C4EA 3HNGA 3N51A 3ZBFA 1W8CA 2C6KA 2XJ2A 4JT3A 4PMMA 2A2AA 1F5QA 4RPVA 5CZIA 1P2AA 3Q9XA 4CZTA 4BDHA 4C3RA 4HGSA 4BTKA 4ZJIA 4F9AA 1FOTA 4RLLA 2R64A 3MY1A 3VJOA 3GC8A 1L3RE 4M84A 2BTRA 2XKEA 3NR9A 4FIFA 4XUFA 3LFCA 1B39A 5HNGA 3VAPA 3HEGA 3MA6A 4K0YA 5ANGA 4ERKA 1H28A 3E93A 3LOKA 3NEWA 4G3CA 4K2RA 5DH3A 3V51A 4BCGA 4L9IA 4A07A 4O7RA 3VF9A 5AADA 3R2YA 4ASZA 3WILA 4KS8A 3DBFA 4LOOA 3VBXA 4EZ7A 3PPJA 5EH0A 2PVHA 5CX9A 4EOQA 2FVDA 3BEAA 2CNVA 3LM5A 4FKUA 4M12A 4R3CA 5IEYA 1SZMA 3VVHA 4BDGA 4HYIA 4DFLA 4KB8A 5IQHA 5AP5A 5IZFA 2YZLA 4WT6A 1AQ1A 4YPSA 3RCJA 3JXWA 4NKAA 5IDPA 5J5TA 4PL4A 1GZ8A 1H27A 2X4ZA 3PJ1A 4I4EA 2ITYA 4QMUA 4DEEA 5L8KA 4A9YA 1TKIA 4LI5A 4NJDA 4D1SA 2BHHA 3CJGA 3LW0A 4NIFA 4ZEGA 4F9YA 4QDEA 4RX7A 2YIYA 4MNFA 4GFGA 4PDOA 4BL1A 4YPDA 4AW2A 1OUKA 3SHEA 1XH6A 2I0EA 3KULB 3PJ8A 4EH6A 2GMXA 2HW6A 4WBBB 4LGGA 3ZSIA 3S1HA 4AW0A 3LHJA 2V0DA 1GOLA 3OOMA 1ST0A 2IZSA 3AKKA 2AC3A 4ENXA 2YA9A 4MTAA 4AN2A 2ETMA 3KKVA 4FTIA 4X2NA 4CFWA 4FUYA 4QT1A 4YZ9A 4ACGA 5GINE 4LV5A 2XBAA 3IW8A 3QUPA 4GIIA 3MS9A 3ALOA 3IS5A 5E8YA 5IQCA 4EZ5A 3E87A 2ITOA 3LXPA 4UZHA 4HCVA 3NUYA 5HE1A 1BMKA 3HMOA 1PKGA 4PY1A 5CEQA 4YBJA 4AT5A 4I5HA 2GQSA 3VS1A 2A4LA 3W2RA 4FKOA 3QGWA 5GNKA 2B4SB 5IMEA 3OXTA 3N4UA 3ODZX 3V3VA 1QPCA 2YEXA 3TG1A 3F5PA 2W1DA 3LE6A 3FQEA 3ORIA 4ZK5A 4LG4A 5L2WA 1CKIA 3FMNA 5HORA 2P3GX 5J5SA 5KE0A 2QOKA 5E92A 4ZTRA 1BL7A 5C9CA 3KA0A 2R3JA 5J9LA 2RL5A 4EOOA 5BUIA 1WVXA 4CMOA 4X21A 3BYMA 3F6XA 4OUCA 4YZBA 4MF1A 5ANOA 2HY81 4DG2E 4E5AX 4DCEA 4YR8A 3O71A 3UQFA 4QMSA 2PK9A 3O51A 2R3IA 3MTLA 4OTWA 1XWSA 4E5BA 4I6QA 2W5AA 2HXLA 3EFWA 3MVMA 4LOPA 1ZY5A 2XYUA 1XH5A 2AC5A 2VTSA 3JY9A 3NCGA 3IECA 4QMTA 5F4NA 4DEIA 4EOJA 4EYJA 4EWHA 4JMQA 3D7ZA 3CGOA 4QMWA 3QQFA 4ZSLA 3WZKA 4BDAA 4EOSA 5KKRB 4KRCA 2JGZA 3LAUA 4QQ5A 4I23A 1OIRA 2HXQA 3A7JA 2UZDA 3GC7A 5FEEA 5JKGA 3QHWA 3ORMA 4S33A 1VYWA 4MVFA 3P5KA 1P14A 3W8QA 3LFBA 3KY2A 4DGNA 2WOTA 5KHWA 3ANQA 4MKCA 1ST4A 4GV1A 2JDOA 4RWIA 1R1WA 4FNWA 2OF4A 3KN5A 4ZAUA 3KXNA 2UZLA 4NM0A 3PA4A 2B53A 4GUBA 2C3LA 4OBOA 4PRJA 5HKMA 3ZO4A 5L6WL 4EK5A 3Q6WA 4ZSGA 4CFNA 5D11A 3V6SA 2JC6A 3C13A 2REIA 2ZV9A 4GKHA 2ONLC 3VWAA 5FP5A 3FZPA 2WPAA 3COMA 3P0MA 5D12A 3D9VA 3WOWA 4APCA 1XR1A 5EG3A 2W1GA 4F9WA 2JKQA 2Y7JA 3KU2A 5FGKA 3E63A 5AX3A 5HG9A 3LMHA 2VO0A 1PXKA 2Y4IB 4BFMA 1OMWA 5AM7A 5BVDA 1CTPE 5D7VA 3Q52A 3RAWA 5FXRA 3U6HA 5D10A 3S0OA 2WEIA 3E5AA 2QOQA 4BTJA 3R9DA 4R5SA 1RW8A 2HIWA 4P5ZA 1KOBA 3MFTA 2OI4X 3D0EA 4QYFA 3JVRA 4WHZA 2B9JA 5HEZA 2W4JA 2VUWA 4P2KA 5HOAA 3TV7A 2RFEA 3A99A 4I3ZA 1G8SA 3FZOA 4AAAA 2XKFA 5HE3A 4BDBA 4PNKA 3REPA 4RJ6A 2Z7LA 3OCBA 3R7EA 3DGKA 4FEXA 1XO2B 4IDTA 1UWJA 4H36A 4J99A 3F2AA 5H9BA 2Z7SA 4EK3A 2W96B 2XANA 2CN5A 4H39A 2B55A 4MD7E 4WBOA 2VRXA 1LR4A 2HWPA 3MN3A 4R1VA 3FC1X 4WSQA 5IKWA 3FLQA 4CFXA 4C34A 3AXWA 2R3KA 3GOPA 2P4IA 3PG3A 4MEDA 3VIDA 4XCUA 4EQMA 3NYVA 5AUYA 2XALA 4FZ6A 4FF8A 2YM8A 4TYEA 4F1OA 5IQEA 4BZDA 3BL7A 4C3PA 1ZLTA 4O27B 3HLLA 4LL5A 5FXSA 1ND4A 5FWKK 4XV2A 4H3QA 4C2WA 4CD0A 4XLIA 3IO7A 5HNIX 5BNJA 2J50A 2YLFA 1OVEA 4FRFA 3A4OX 3BBWA 2YIRA 3EZRA 5I9YA 3LMGA 3PA5A 3RK9A 4QPSA 2PULA 4EH5A 1H08A 4RVKA 2XAOA 3Q60A 4BBMA 3NNVA 3HAVA 1OL7A 3CJFA 5JFWA 2OJGA 3DJ6A 5TKDA 4IEBA 3UVRA 4FZFB 3WZEA 3EFLA 4JBQA 3VNTA 5J9YA 2CCIA 3FHRA 4RIWA 3UTOA 3F5UA 4IAFA 2ACXA 4JL9A 3TJCA 3KRRA 3FI8A 2NP8A 5FBNC 5K5NA 3TTIA 4UALA 4FV0A 5AA8A 3O96A 4FE2A 1OBGA 5C4KA 3HP5A 3QD2B 3U9NA 4O7WA 3QC9A 5IA2A 4G3GA 5EYMA 1XHAA 2R3NA 3MB6A 3DK6A 4PTCA 3TXOA 3UPXA 2XKDA 5CANA 4GKIA 3FXXA 2GS2A 4Y5QA 2OGVA 3A7GA 3I4BA 4IZAA 4RVMA 4FKJA 3CE3A 3OW4A 4BB4A 4RQVA 2QU5A 3KRJA 3P79A 5HI2A 1PYEA 3R8ZA 3R9OA 4AOTA 4CMUA 3KIOC 4S2ZA 3EKKA 4MF0A 4DFNA 3ZFMA 4DTBA 4FL2A 3TWJA 2BROA 4A7CA 4ACCA 2WELA 2VGOA 2R0UA 4QTBA 4N57A 3IPHA 3KRXA 4ITHA 4M0ZA 3UDZA 4C0TA 4AT3A 1H01A 1Q3WA 2IJMA 2QURA 2R3QA 3QU0A 3R21A 1OL6A 4PDPA 2XRWA 3PP1A 3OP5A 1VYZA 2F7EE 3BBTB 3TUDA 3I1AA 4AWIA 5L6PA 3PLSA 4M68A 5HE0A 4CMTA 2OICA 1OGYA 1FGKA 3BGQA 4X0MA 5EK7A 5HIBA 4I1ZA 2R3RA 4FTTA 4C62A 4O0VA 1PXJA 2VTJA 2C5XA 2W7XA 3W0SA 3UZPA 3O0GA 4KWPA 5CAQA 2PMNX 4CZYB 2PUPA 4ZP5A 5M09A 1OKWA 1VEBA 2YM5A 3FYKX 5D7AA 4B7TA 5K4JA 5HCXA 2CGWA 2P55A 3DY7A 5HESA 3IDPA 4YC8A 2X9EA 3NUXA 1OKVA 2UZVA 4MXZA 5CASA 3MH2A 2XARA 4JG7A 4KNBA 2PVRA 4FBXA 2WMAA 5D9HA 5KBRA 2CGUA 3HZTA 4HVHA 3ZMMA 3R8LA 2B7AA 3CR0A 4B8MA 1YDSE 2ITTA 2NPQA 4CGAA 3FAAA 2WXVA 3BKBA 3FMMA 3RPRA 4AA0A 5I3OA 2B52A 3ZCLA 1OL1A 3ZRLA 3DZQA 2F49A 1BL6A 3L8XA 4GG7A 3QAME 3VBWA 3Q5IA 3QXOA 4GT5A 3WE8A 3GOKA 5ETIA 4JDKA 4FSRA 4DEGA 3VW6A 1PRYA 4PDYA 5A3XA 3W33A 2R3GA 2UW4A 5FQDC 4O82A 1VZOA 4FT7A 3PTGA 3OWPA 4EK8A 3R02A 4K8AA 3UVPA 2VWZA 3FUPA 4J8MA 4E4NA 2QOFA 4XG9A 3UNZA 3ZEPA 4JDIA 4JBOA 1W2FA 5IEXA 3PJ2A 3PSDA 2OKRA 2FH9A 3NW7A 4RA4A 4O86A 2XAMA 4G6LA 2HYYA 2UW5A 3CTHA 4L43A 2W1CA 5BUEA 3LQ5A 5CNOA 3RGFA 3KXGA 2X0QA 2EUFB 2ZJWA 5CI7A 4Z9LA 3EFJA 3Q4CA 4GYIA 4DFYA 3OY3A 4B6LA 4UBAA 4BICA 3QGYA 4A9UA 5C01A 5CYIA 4BJJA 2CMWA 3KC3A 3C9WA 2V55A 3PWDA 2ZV8A 2NO3A 2VTPA 3BZ3A 3OEFX 4IQ6A 1ZYDA 4YTCA 1ZMUA 3F82A 4BRXA 2XCKA 3R00A 4IWPA 3UP2A 4DDGA 2UZNA 4AG8A 3RJCA 4PL3A 4ZOGA 1CKPA 3TKHA 3QZGA 3ALNA 4O7YA 3QD0A 3UE4A 5CEOA 2C68A 3CY2A 3ZZWA 1H1SA 3PSBA 4D9TA 3COKA 2J7TA 3EL8A 3VS4A 4LL0A 2JAVA 2HK5A 2VTQA 5IH6A 4GVAA 2XMYA 2YITA 4BDKA 3DZOA 4TNBA 3AC5A 4FKSA 3U6IA 5KMOA 4FV5A 4F63A 3TM0A 3NLBA 2IVSA 2IWIA 3I6WA 4O1PA 1JSTA 4ZSAA 4O7SA 1Y8YA 4RJ3A 3W2SA 3FWQA 4AGUA 3FI3A 3FV8A 4G3FA 5FM3A 4CTBA 4PTEA 4E7WA 3LFEA 3NUUA 2SRCA 4TWCA 4MHAA 3UNJA 4ZZNA 1APME 4E6QA 4CLJA 3P7CA 3QRIA 4O0UA 4RIYB 4XNEA 5L6OA 1O9UA 4TYHB 3RPOA 1Q8WA 5BVEA 4MXOA 3A4PA 2W1ZA 4IC7A 2P2HA 2QR8A 4FSQA 4J97A 4QMPA 4ZMEA 4Q5HA 5EHYA 2YCSA 3R1SA 4FT9A 2OO8X 3GXLA 3JS2A 4GU6A 2PVYA 3LJ0A 5ITAA 1FVTA 3A7FA 3H0YA 2YM7A 4MWHA 3FI2A 1OBDA 4U7ZA 1K9AA 1IRKA 3ENHA 4OTDA 3OUKA 4FKQA 3QQGA 4XG6A 4ANMA 4P7EA 2QO7A 4HCUA 5ANIA 3HRFA 3QD3A 3V8SA 4KAOA 2JDSA 4C61A 5ANJA 4IJ9A 4CXAA 2X9FA 4K33A 5AV1A 4F0IA 1Y6AA 3MPMA 1GIJA 3LFQA 5DRDA 5JH6A 4YSJA 4RWJA 2FO0A 3ATTA 3KF4A 3UNKA 5ETFA 2FSMX 3OBGA 2ZB0A 4YJPA 5JMSA 3LQ3A 3D7TA 3IONA 1YXUA 3K2LA 4U9AA 2BFYA 3Q4TA 4R3PA 4CYIA 1JNKA 3LM0A 2FB8A 5J7HA 2B0QA 3PSCA 2GNLA 3TUBA 4QDVA 4YUQA 4CLIA 4K1BA 3FL5A 3ENMA 4LV8A 3PVWA 1YWVA 4Y83A 1U54A 4AN3A 4D5KA 4HYUA 3TKUA 4YHFA 4I5MA 4AFEA 2G9XA 2XJ1A 2G2FA 2VO7A 4IVCA 5BPYA 3TZ7A 3EJ1A 2WMRA 2QQ7A 2XJ0A 4CFUA 2ZMDA 1YOLA 2XK6A 2BDJA 3HYHA 3NAYA 4HVIA 4KSPA 1W0XC 2X8IA 3BYUA 4K6ZA 4V0GB 2VWYA 2R3HA 3R7UA 3PJCA 1FPUA 1OECA 3MBLA 5JGBA 3D2IA 4IW0A 3VBYA 2WQBA 3Q5ZA 4RC3A 3SOAA 4AOIA 3BU6A 3VS2A 5LMBA 2BRMA 4D2RA 4CTCA 3N4TA 4L7SA 4EBVA 4EHGA 4G9RA 4YJSA 4IJPA 2WMTA 2O3PA 3BX5A 3HV7A 4NU1A 5FDPA 3KMMA 4GSBA 5E8VA 1E9HA 2QKRA 2BZIB 4E6CA 4FIGA 3NSZA 4U3YA 4MXCA 5CALA 2BIKB 3CQWA 4FSTA 4I0TA 4R5YA 1LPUA 1KV1A 4QMQA 3PFYA 3MVJA 3SV0A 4QMNA 2HENA 4H3BA 2PVKA 5HVJA 3L8VA 1MP8A 3ZO3A 2VTRA 1BLXA 3AT4A 4BWKA 4WKQA 2IG7A 2CN8A 3PY1A 4FKGA 4EWQA 5A4TA 3C0IA 4EQUA 2J0MB 3AGMA 3OOGA 2XM8A 4O83A 1GIIA 3ATSA 3FLSA 4IXPA 2IEWA 5C27A 3VRZA 2WU7A 3KQ7A 3L8SA 3PY3A 4JQEA 4EORA 5IU2A 1ZOGA 1OKYA 2OXYA 2ZVAA 1KOAA 4N0SA 4RVTA 2G01A 4CV8A 3ZXZA 5E7RA 2X0PA 4AW5A 2BTSA 3TN8A 4D1ZA 4JDHA 4F7LA 4D2PA 4BCOA 2PVFA 3C4ZA 4KABA 2B9IA 1GNGA 3DOGA 4A4XA 3FE3A 2DWBA 4RC4A 4V01A 3FXZA 4ZY5A 2W17A 5HO6A 4BWXA 5L4QA 5EQYA 2F2UA 4G6OA 2BHEA 3OTUA 4XG8A 3D5WA 3T3UA 2BRGA 4AX8A 4GH2A 2VV9A 5LCKA 4EC9A 5GHVA 1H26A 5KBQA 4PF4A 4BJJB 4QYYA 4IAIA 5EM7A 4IX4A 4EYMA 4PV0A 5KNJA 3ZFXA 2C30A 5AR7A 3UOHA 3DNEA 4PP9A 3ULZA 2OW3A 3HVCA 2C0IA 3PXQA 1A06A 3SXRA 1WBWA 3JVSA 2GFCA 1URCA 4FV6A 3D14A 5FUTA 2C0TA 2X2MA 5TR6A 2UV2A 1B6CB 4D2TA 4KBAA 5M08A 2GDOA 2A1AB 3RZFA 3GFEA 1PXMA 4GJ2A 4PTGA 4FTKA 2C1AA 3KVXA 1LEWA 3PG1A 4W8EA 4WOVA 5EDPA 4EBWA 4EC8A 4UMQA 1Z5MA 3BWFA 4ACHA 4H1JA 3AC4A 4YNEA 2WFYA 4EOLA 2C5OA 1RQQA 2WTKC 3QA8A 5L2IA 1Z57A 2NRUA 5I9UA 4BDJA 5I3RA 1JQHA 2C6TA 2WTCA 2PZPA 4YO6A 3OWKA 3VS6A 2JDVA 5HTIA 5FM2A 2RFNA 2XCHA 3D94A 4OTRA 3OWJA 3DKGA 4KS7A 3RVGA 1R39A 3IGGA 3EQGA 3ORPA 3Q9WA 2ZM4A 4J98A 2GQRA 2JDTA 1UKIA 3OW3A 2NYAA 5IQFA 4FTJA 1IR3A 3BHUA 4CT2A 2ERZE 5HVKA 5CSVA 5E91A 4Q9ZA 3FMJA 4YGAA 1H07A 2C3JA 3TKIA 2IZUA 2RIOA 4AGDA 3BQCA 3CQUA 2C3KA 1FMOE 3D4QA 1Q61A 4R1YA 3DAKA 3TNPC 4G1WA 5CEPA 2W0JA 3MVHA 3NUPA 5IA5A 4CNHA 4CKJA 3TYKA 2P0CA 3QTIA 2C5NA 2VWUA 4IAKA 2VO3A 5HHWA 5KZ0A 1V0OA 2XK3A 3V6RA 5KX8A 3TI1A 2OH0E 4G3DA 4UYNA 2YIWA 4RWLA 1OITA 2J4ZA 1T46A 4DGGA 4I5PA 5T6KA 2YN8A 4LDTA 1H0WA 3DAJA 4Q9SA 4AGWA 5IG1A 3ZC6A 1STCE 4MCVA 3PFQA 4P5QA 2ZV2A 5CU2A 4S32A 3Q4UA 3MIYA 4GT4A 2OG8A 2WEVA 3NMUF 5CEMA 3TIZA 1UVRA 4FK3A 4QPMA 2JKMA 3NIZA 3IGOA 3H9FA 4WO5A 3JR1A 2VWWA 2E9NA 2GU8A 5IH4A 5BVOA 2VWIA 4I4FA 4XBRA 5AR3A 4AXDA 3R8UA 4JDJA 1U5QA 3EYHA 5K5XA 2HZNA 5K3YA 5GIPE 4FKLA 5DR9A 2R4BA 2IVUA 3AQVA 5D1JA 2CGXA 2BKZA 4O7NA 3ODYX 1QL6A 1XKKA 2BZJA 1F3MC 3HDMA 3DTWA 2I40A 3KXXA 3NZ0A 2WIHA 3EQBA 4ZSJA 4DHJA 4ALWA 2F2CB 1UNLA 3OG7A 4XV3A 2FGIA 3VN9A 2AQXA 2QI8A 3CPBA 3OVVA 4IADA 4QPAA 2LAVA 3ACKA 4EUTA 5KHXA 4RIOA 1IAHA 3LXLA 3ZZEA 1J91A 2RF9A 1YOMA 2WKMA 2YERA 1JLUE 2VTMA 2W5HA 1H1WA 3Q53A 4RX9A 4RX8A 3PPZA 4FNZA 4O96A 3ZC5A 4RZVA 3KF7A 1W83A 3S95A 3G0FA 5EM8A 2UW7A 2Y6OA 3ZS5A 4BVUA 2VTTA 3C4CA 2YABA 4PPAA 4QMXA 2WTWA 4ZLZA 4C4GA 5CSPA 4IMYA 4L44A 3GNIB 3E3BX 4CRLA 4DFBA 3EQPA 5AM6A 3QX2A 4X2KA 4QNAA 3SGCA 4CKIA 2XNGA 2UZUE 5M56A 3HP2A 3GCVA 3VC4A 3P23A 3GFWA 4YZNA 3BQRA 3HECA 2XIXA 4XOYA 2X6EA 4QMVA 3RAKA 1WMKA 5JRQA 4KSQA 4UMRA 2XIYA 5KKRC 4IAYA 2X7FA 3CKXA 4I5CA 4F9CA 4O2PA 2BCJA 2RFDA 3PP0A 3NW5A 3UDBA 1LP4A 4DG0E