1IEPA

Crystal structure of the c-abl kinase domain in complex with sti-571.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
MDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
publication title Crystal structures of the kinase domain of c-Abl in complex with the small molecule inhibitors PD173955 and imatinib (STI-571)
pubmed rcsb
source organism Mus musculus
molecule tags Transferase
total genus 86
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1iepA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1iepA01
5CAQA 2PVMA 3HMNA 3LFSA 4C59A 3MYGA 3UOKA 1Q62A 2B1PA 3CGOA 5JEBA 2OO8X 2PMNX 3L9LA 2W7XA 1SM2A 3FBVA 3ZFMA 5GHVA 3S1HA 1IG1A 4FIHA 4MH7A 3CEKA 4UWBA 1GZ8A 4ERKA 1E1VA 3E8EA 2WEVA 4QO9A 4G9RA 2C6OA 5E8WA 3VVHA 5TF9A 3F2NA 4EH3A 2HOGA 3NNUA 3EN9A 4YUQA 2R3NA 3KK8A 2I0HA 5AIRA 3TEIA 4PMMA 5AV2A 4FEVA 3HV7A 4RG0A 2XH5A 4H3BA 4FZDB 2F7ZE 3FI3A 3R7YA 4D1ZA 3UE4A 5E7RA 2PUPA 3FLWA 4Y83A 2YHVA 3DDQA 3VS2A 4JLCA 2YAAA 3KB7A 1BYGA 4GW8A 3C4FA 3UVQA 2W9ZB 4AU8A 4ZTHA 4FT5A 2AC5A 4BTFA 3BIZA 2VTAA 3SAYA 1XH8A 3UIUA 4F09A 2PUIA 1YWNA 2C5XA 4RMZA 5M09A 3K3IA 5D1JA 5D41A 4G3DA 3A7HA 3ZRMA 3IS5A 5CF4A 4S33A 4PDSA 3FZPA 3RAHA 3QWKA 3DKGA 3KN5A 3TZ7A 3F3WA 4WSYA 3P7BA 4YC8A 1URWA 2GNFA 3VC4A 2YACA 4CZUA 4XBRA 5CU3A 4M0ZA 3RI1A 2OXDA 4YJVA 4AOJA 4CYIA 5FWKK 4CQGA 3NPCA 4W8EA 1X8BA 4IZ5A 4APCA 3FMEA 3PG3A 4IHPA 4AZSA 4F9AA 4XEYA 4XHKB 2VWYA 4MYGA 1Q3DA 3FWQA 3MTFA 3BYVA 4ZSEA 2BRBA 4BCHA 3LFAA 4BHNA 1UNLA 5AR2A 1SVHA 4BTKA 4FGRA 4KSPA 3BZ3A 2IVTA 2VWBA 3NAYA 3HYHA 4GVAA 4H3QA 2VAGA 3Q6WA 3PZEA 2BDWA 3LCSA 1OECA 2WQMA 4G34A 5CF8A 4M13A 4WG4A 3EFKA 4XX9A 1BMKA 4IXPA 5JGDA 3QZFA 3KGAA 3MH2A 1FVRA 3DQXA 4NT4A 4O0WA 4QTEA 5BVWA 4EWQA 5CAPA 3LKMA 1BL6A 2OJIA 2W1CA 3MS9A 3GOPA 3BU6A 1J1BA 3AGLA 4C35A 3E63A 3D0EA 3MGYA 2XK9A 4HVHA 1VEBA 5AA9A 2PWLA 3EYGA 4EQUA 3GUBA 4EH6A 1JSTA 4CLJA 5AMNA 4D1XA 3REPA 5DVRA 3DXNA 2IW6A 4ASEA 5I0BA 1JKKA 2R5TA 5CVGA 4OGRA 4Y8DA 2WNTA 4ZXTA 1Y8GA 5B7VA 3NNWA 4J97A 1H0WA 3MJ2A 3GQLA 2IZTA 5AR4A 3DS6A 4ANQA 4P2KA 3HV5A 3K3JA 2PMOX 2WGJA 3LHJA 4HNIA 4IB5A 3VW6A 4TWPA 3U54A 4F70A 2CGXA 3Q4ZA 4FG7A 1HCLA 4F7LA 3FMDA 5L6PA 5EK7A 5IMXA 2BCJA 4TT7A 4YHFA 4JQEA 5E8VA 1V1KA 3UO6A 4O0UA 2JBPA 5I9ZA 5IH6A 5JQ8A 5J5SA 3DB8A 4FA2A 3Q32A 4G3CA 5F94A 4DBNA 3D7TB 3AOXA 4FKRA 4XMOA 4JG6A 3F2RA 1ZY4A 4R1YA 4M3QA 4UXLA 5HE0A 2O3PA 3SRVB 3ZC6A 4D2WA 3TJCA 5CZIA 4ERWA 1Q4LA 4EZ5A 3CP9A 4PTEA 4PUZA 4MD9E 4U0IA 1TQMA 4BCPA 3HA8A 4C62A 3W1FA 4L46A 4WD5A 4ZSGA 4KBAA 5IQEA 4JDJA 2XA4A 3CQUA 4D2SA 4CRLA 4FT3A 2F49A 4D2RA 2YA9A 5AUTA 4QMPA 2V55A 1REKA 3HKOA 1JKTA 1W83A 2JDTA 1SNXA 5EFQA 4AGUA 2RFNA 4XG2A 3RZFA 5CEPA 2F9GA 3EJ1A 3R02A 4FZFB 4DEBA 1W84A 3RGFA 4WO5A 3AT2A 2F7XE 5HLWA 3LCTA 4EORA 3TUBA 3BYOA 4X21A 2UW8A 3BEAA 4RIXA 4B9DA 3R30A 2ITYA 4ZMEA 3JS2A 4M69B 3DQWA 3NLBA 1JSUA 3UO5A 3WF8A 2B9JA 2VTQA 2ZDTA 4PPCA 3WZKA 5A4QA 5FP5A 4JBPA 4GFMA 4IVBA 2EXMA 3P7CA 5AUZA 3C5IA 3K54A 4J96A 4RQKA 2FSTX 4JS8A 3POOA 3R01A 4J1RA 4YNEA 1TVOA 4DHFA 5C8KA 1XQZA 2OF4A 3ZBXA 3I6WA 4O7WA 5K0KA 4IQ6A 4PP9A 4XCUA 3VQUA 3WYXA 4FV4A 3W55A 4FIJA 3WF5A 3FI8A 4FK6A 3R7IA 4QP4A 4BB4A 2VWVA 3BHTA 3PY0A 4FV2A 5I9YA 4BI1A 2V62A 3ENMA 1XWSA 3QX2A 3V6SA 4K33A 5FXSA 3PFQA 2GHGA 4YBJA 1M52A 2Y6OA 4J95A 1T46A 3BI6A 3IG7A 4E73A 2VO0A 3PG1A 4PDPA 4FE2A 2BZJA 1SNUA 1FGKA 4AOTA 2W1EA 1JBPE 2UW7A 5JGAA 4LL0A 4BL1A 3L1SA 1XR1A 5AP6A 5HG7A 2C5OA 3ZH8A 5B2KA 4APPA 2WZJA 2C3KA 2YM3A 3D5WA 4FTTA 1WVXA 4G2FA 1XH7A 4RX9A 3ZTXA 2VRXA 4I24A 3OZ6A 3EFJA 3IW6A 4YPDA 1B39A 2CKEA 2UW6A 2W1FA 3F61A 5H2UA 2E9NA 3ZO4A 4E4NA 3LFCA 3G5DA 4XV2A 3BLHA 4ANOA 3QL8A 4RX7A 4BIEA 4Y46A 2EB3A 5KKRC 4G6NA 3ACJA 3DCVA 2ETKA 4JAIA 4AW5A 1Q5KA 5B2LA 4ORKA 3TXOA 2OJ9A 2I7QA 1MUOA 4CXAA 4ZLOA 4XH6A 2XIKA 3ORIA 2R3OA 2C0TA 1H07A 4XG4A 2BKZA 4FTRA 4EOSA 5AP2A 3ORKA 4FL3A 2GCDA 3UODA 5BQ0A 1ZLTA 2BIKB 1I44A 3OS3A 4EYMA 4IX3A 4FTIA 3DLSA 4PL5A 4BIDA 4FKLA 5KMKA 3B2WA 3C13A 3PXFA 3KXHA 3QC9A 5KMMA 5EQEA 4S2ZA 3CPCA 4O84A 1FMOE 2W5AA 4J8NA 3BU5A 1WVYA 4JIAA 2X7OA 3ZLXA 4Q2AA 2UZEA 3FL5A 4AW1A 3I6UA 3HP2A 4EKLA 4O1OA 4MAOA 5D12A 3NVKI 4XV3A 3TDWA 5EI2A 4AP7A 2REIA 5IQHA 4O2PA 1XH6A 2HWOA 2YLEA 2V7AA 4TYHB 1MQBA 3LFQA 2WTVA 1ZWSA 2BRHA 3GCSA 3N51A 4L45A 3ETAA 1UKHA 4PNIA 2UW5A 3OEZA 4FEUA 3CSVA 3GU7A 2UW0A 3VRZA 5J1VA 3DAEA 3MIYA 1Y91A 1P4OA 3TJDA 4XRLA 3E93A 2W1DA 5T3QA 2OXXA 4JDKA 4BDCA 4WBOA 5FXRA 3R1NA 3BEGA 3QTRA 2Z02A 4N4SA 2P33A 2HXQA 4C3PA 5CAOA 5IG1A 3QHRA 5GJGA 5T68A 3D94A 4FTKA 3TV4A 4DINA 4FTAA 2VX1A 5DN3A 3UJGA 3UMWA 2B9IA 5FEQA 4G16A 5K3YA 1O6KA 3SXFA 1IAJA 3AMAA 2PMLX 3ACKA 5HX8A 4S30A 5D7VA 4KSQA 3ZO2A 5AP0A 4P5QA 4PMPA 5EM7A 1V0PA 5AFVA 1H0VA 1H1QA 3LLTA 4OBQA 3TNPC 2QOOA 5A46A 4AUAA 3KQ7A 1BX6A 3BX5A 5HVKA 4K77A 1H25A 3DGKA 3RCJA 3VS3A 4QMQA 1UVRA 3SLSA 4M84A 3R83A 2EXCX 4FTNA 4LI5A 3NNXA 5AUVA 4K11A 3B2TA 5IEVA 1YW2A 4DH1A 2B0QA 3PSCA 4QTAA 5L2SA 3ANRA 2J0KA 4EQMA 3FPMA 4A4OA 4R8QA 2BHHA 2Y9QA 3OROA 2SRCA 2HWPA 4P5ZA 4D1SA 4W8DA 3OY3A 4CCBA 5CT0A 1GIHA 5J5TA 2B9FA 4IWOA 3NNVA 1BI7A 5DHJA 3NDMA 3QTZA 3VS4A 2JKKA 3OF0A 3PJ1A 2UVYA 3QKMA 3QZGA 2WO6A 4NJDA 3T8OA 4C57A 4GS6A 3KU2A 1PXMA 2BMCA 3E64A 3FC1X 3WIKA 4ZK5A 4Y73A 4OBPA 4B6LA 4BCNA 1XH5A 2ITQA 1H27A 3MB6A 2VTOA 4TYIA 1H26A 4YPSA 1U46A 1FVVA 5ACKA 5IQIA 3IGGA 4FSRA 5BX0A 1LPUA 3QUDA 3BHYA 4EHVA 2YJRA 4B99A 3FSKA 3NUYA 1UKIA 4F7SA 4YSJA 5J95A 4I92A 3COIA 3CLYA 5CEQA 2H6DA 2JLDA 4BTJA 4FV6A 4YR8A 1ZOEA 3HAVA 5L8LA 1YQJA 3RK9A 3R63A 5JT2A 3JY0A 2Q0NA 4OW8A 3P78A 3GNIB 3NVMB 4M8TA 5L8KA 3PIXA 3FC2A 1SZMA 1KWPA 3OY1A 2IWIA 4IAYA 3W2QA 1P2AA 1QPCA 3DBEA 2WOTA 3Q4UA 3EN5A 2GNLA 5LVMA 3KRXA 4GIIA 1PKGA 4NM7A 5JSMA 3MI9A 3BE2A 3Q9ZA 1FGIA 4AA5A 3MFUA 3PDTA 5BVOA 2XNNA 4IWDA 4RIWB 2GDOA 4RFMA 1G5SA 3IKAA 3KULA 2V5QA 3R22A 1UU3A 5E8TA 1IEPA 1YI4A 2PZPA 3COMA 4GT3A 4YMJA 5KBQA 3H4JA 4G6LA 4H36A 1GIJA 2BR1A 4HZSA 3I7CA 1ZYCA 4L8MA 4FG8A 2O0UA 4FIFA 4I1ZA 5IA1A 2IPXA 4Z7HA 2W4OA 4D9TA 4ASXA 5BUEA 1OKZA 4CKIA 4BDIA 4QMOA 4EOQA 2YERA 4FNYA 4YHTA 1P4FA 3L8SA 4X2KA 2W99B 3PJ8A 4CD0A 1OIUA 4NM0A 3IO7A 2X8EA 5HICA 5BMMA 4K18A 3TWJA 4YZBA 3R1QA 3O50A 5E91A 4FKUA 4FNWA 5K9IA 3V5JA 5I3RA 2R3MA 3ORLA 4HCUA 4OTDA 4CKRA 3BCEA 5CASA 4M97A 2PK9A 4XV9A 3SG8A 4FV0A 3PP0A 4EOOA 4FV8A 4EWHA 3C0IA 4X2JA 2YM5A 4GUEA 5FGKA 3WYYA 4DLIA 4EH8A 1Y8YA 5CAUA 5HG9A 2OH0E 2OW3A 3ZSHA 2C0IA 2J0LA 2Y4PA 3BQRA 3QCXA 5TR6A 3Q60A 3EQRA 4UMPA 4ANNA 4UZDA 4WG5A 4MXAA 3TI1A 4BI2A 4FTJA 5HEZA 2FUMA 3II5A 3UIMA 2RIOA 2YM6A 4PPAA 4W4VA 5AJQA 3LFNA 5D9HA 3A8XA 3A99A 1DAWA 3DV3A 5F4NA 2X6DA 5KBRA 2G15A 3UZRA 3I5ZA 5K5XA 3VBXA 5C1QB 3GI3A 4AW0A 4CTCA 3PVGA 5IQBA 3NEWA 3H10A 2QR8A 3F69A 2R0IA 3VUGA 4B8MA 2W17A 4AFEA 4IWQA 4RIYA 1R3CA 1JQHA 4OAVB 4GKIA 4GK3A 3SA0A 2HY0A 5FEDA 4AN9A 2FVDA 4AA0A 2ITNA 4FBXA 4CGAA 1W7HA 3S0OA 4HGSA 2YZLA 4IBMA 4O82A 4MTAA 4XP3A 5ANJA 3FXXA 2ZMCA 5M07A 5E8SA 2VTJA 3EMGA 3OTVA 3PA5A 4I20A 5DT0A 3CY3A 4E6CA 4YJNA 4G6OA 2XUUA 1FPUA 4YTHA 4OTQA 4IVAA 4DFNA 3FKLA 2JKQA 1OGUA 4AA4A 4IC7A 4CG8A 4TYEA 1NW1A 4W4YA 2ONLC 2ZB1A 4FIGA 1A48A 3E62A 4KABA 4PWNA 4XNEA 2O8YA 2BZHB 1KOBA 3NYNA 3O17A 2UZBA 4UV0A 5CT7A 2CLXA 4XV1A 4DN5A 4ZJJA 4LGGA 4OLIA 5CI7A 4IVDA 3KXXA 4UXQA 4PL3A 5CX9A 3ZM4A 4D2TA 4JRNA 4MF1A 4BDJA 3C5UA 4ZLZA 1J7UA 4RVLA 5G1XA 2GFCA 2HZIA 2OH4A 1Q8WA 3FJQE 3PXRA 4EHEA 3DOGA 5A9UA 2W1ZA 3WF6A 2RFDA 4NM5A 3DKFA 3E7VA 3TZMA 4BY9E 5DIAA 5IH4A 3R00A 3P1AA 4QP6A 4CZTA 5JRQA 5L8JA 1EH4A 3BHHA 4BYIA 3FQHA 4FT7A 1AD5A 2YCQA 5DE2A 3Q5ZA 5HKMA 5IA0A 3ALOA 4FSMA 3HLLA 5AM7A 4WNOA 4M15A 3RMFA 3VBTA 3UDBA 4P7EA 2WHBA 2WIHA 3IDCA 3OWPA 2QD9A 3VUIA 3LFBA 2DYLA 3MTLA 3NRMA 2YIXA 2QQ7A 3EKNA 1ZMWA 4Q9SA 3V8WA 1PY5A 2HXLA 3D5UA 4KRDA 3BHVA 3QWJA 3R1SA 3QYZA 2BUJA 4CLIA 5CU6A 3ZO3A 3OW3A 3CS9A 4JQ8A 2X9FA 4FI1A 4ACGA 4YJTA 1K9AA 3QD0A 3VUDA 1U59A 3U6JA 5C8NA 4AT4A 2Q83A 3NUAA 4YTFA 2RFSA 4L3PA 4C8BA 3UC4A 3ZEWA 2VTMA 5FM3A 5JN2A 3VNTA 2A27A 4RJ4A 5EOLA 5ANOA 1RDQE 3GU5A 1BI8A 2NP8A 3MFTA 3AT4A 1OL2A 3AD5A 4FSNA 4JBOA 4YJSA 4OTWA 4XUFA 2WD1A 3PRIA 4DGOA 2NNWB 4IAZA 3SKCA 1U54A 3CJGA 4FC0A 3TNHA 3VS7A 4AGWA 3OBJA 4FSWA 2CKOA 1ZOHA 3HL7A 1R0PA 4O27B 4BGGA 2PPQA 2UZOA 3LCDA 5CWZA 3NCGA 3KF7A 3VUHA 1Q8ZA 3E8DA 5L2WA 4DLJA 1H1SA 2WTCA 4GRBA 4F08A 3GFWA 3Q6UA 4K9YA 4NTTA 3RM6A 3R0TA 3TNIA 1R0EA 1YWVA 2CSNA 4A9RA 4UX9A 1SMHA 1WBPA 2GTMA 4Y72A 3IGOA 5HZNA 3D2IA 3FLYA 5AEPA 3F5GA 3CBLA 1UNHA 3GC9A 2BROA 4PP7A 5AADA 4EH5A 1O9UA 5HNGA 5CSPA 3CIKA 1OKVA 4DEAA 2FB8A 4CFUA 4E3CA 3DBCA 3R28A 4GK2A 4X2GA 4H1MA 3TZ8A 2GNGA 4FKGA 2W1IA 5AX3A 1YHWA 3SG9A 2NRUA 3PY1A 1J1CA 1Q41A 2X6EA 4GSBA 4QMMA 3N9XA 4EH2A 5HTBA 2IVVA 4UB7A 4R7BA 4QMSA 3QQKA 2XBJA 2X7GA 4LV8A 1ZMUA 3WIGA 3VS1A 5BPYA 4ZS0A 2YIYA 4QMTA 4QT1A 3FL4A 4B8LA 3UBDA 3FMKA 3F2AA 4PX6A 4ZJVA 2CGWA 4H58A 4JR7A 1LUFA 3HDNA 5EDQA 2R3QA 3C4ZA 3MA6A 3R7UA 3RALA 4KD1A 2G9XA 3QU0A 4CZYB 4DH8A 5BVEA 5IZFA 3LMIA 4L43A 5TT7A 5IA2A 4E4XA 3KXNA 2YITA 2C3JA 2XIRA 4UEUA 4DAWA 2WMUA 1YOMA 3DY7A 5FTQA 3COKA 3I0OA 2BTRA 4FL2A 5HD4A 5HNIX 3ORMA 3DJ5A 3EHAA 3Q4CA 2ITZA 2PVLA 5J9ZA 3GCUA 2Z7QA 1UNGA 3EYHA 5HVYA 1W82A 2WMQA 3Q9XA 2WMXA 4C02A 3TDVA 3ZS5A 2F2CB 4AZVA 3WF7A 2PHKA 4Y5QA 4CYJA 3ZLWA 3PA4A 2PULA 2GFSA 4YZDA 4F63A 5BNJA 5CEKA 3KKVA 3ROCA 3D4QA 1F0QA 4WOVA 3TT0A 3VBVA 4DFYA 3ENHA 4DFXE 2YJSA 4K1BA 4MQ1A 4K0YA 3D5XA 3ULZA 3OFMA 5E8ZA 3A2CA 3MPAA 4GL9A 2J0IA 4NU1A 5C9CA 3R9OA 3RAKA 3VBWA 4QP9A 4EZ7A 3BV2A 2YCSA 3LMHA 1Z5MA 1YHVA 2R3HA 4ZZOA 3E3BX 3DU8A 5EOBA 3VJNA 3G51A 4ALUA 1O6YA 5AP3A 1TQPA 3FY0A 4Y5HA 2ZM1A 4YHJA 4FKSA 2W05A 5IMEA 2OFVA 4WSQA 4BBEA 1Z9XA 3S95A 4DG0E 4IZ7A 2W5HA 4QMVA 4QYHA 1I09A 3Q52A 4FV9A 4IFCA 3QQHA 1OIYA 3EN7A 5F9EA 2G01A 3FHIA 3OCSA 3Q9YA 4MXOA 1NXKA 5E4HA 3TUCA 5HCXA 4YZ9A 3ORTA 3HP5A 1KE8A 3LOKA 5FD2A 5HORA 3V01A 2RSVA 2WMWA 3FE3A 3DAJA 1WBWA 4C3FA 4BCFA 3RBWA 4GKHA 4YLJA 2HW6A 4NZWB 1IA9A 3QXPA 1IASA 3Q2MA 3AD6A 4JX7A 4YZNA 5D7AA 3LM0A 5DLSA 4JRVA 3A60A 3CD8A 3FYJX 4O1PA 3EOCA 5ANEA 3ZLYA 4EH7A 5M08A 4HGEA 4J71A 4V04A 4EL9A 3P9JA 5C26A 2VTNA 2JEDA 4O91A 3FHRA 5BUJA 3NUUA 3PPJA 3QGWA 3TN8A 1Q3WA 4KBKA 2VGPA 4NCTA 5HBHA 2QVSE 4RZVA 3EKKA 3QTWA 1NA7A 2OF2A 4QRCA 2XNGA 1OL1A 3JR1A 3LE6A 5CU4A 1ERKA 3U55A 4UWYA 5HCZA 2GHLA 3HNGA 1M2RA 4Y85A 4NFMA 3A4OX 3QRIA 1PF8A 2ZVAA 3P7AA 4I6HA 3DBDA 4M66A 5JFSA 5AAGA 3IDPA 2XNMA 4I0TA 4L01A 4RJ6A 3F6XA 4L52A 4YLKA 2A4LA 1B38A 2R3JA 3QRUA 5KMLA 2ZV2A 1PMVA 3GP0A 2W96B 3S3IA 2BFXA 2DS1A 2B7AA 4IB3A 5E1EA 2X4FA 3KREA 3LAUA 4JNWA 3SGCA 4RVMA 1FMKA 4ZTQA 1PKDA 3ZU7A 4EK3A 4AE9A 3OWKA 3LPBA 4G5PA 3VS0A 3HMIA 2OU7A 4N6YA 4WA9A 3HMPA 4DFBA 3LXPA 3QA8A 4YJPA 4C0TA 3RP9A 3PIYA 4GCJA 3MY0A 5B0XA 1DI8A 5KE0A 2E2BA 5FDXA 5M55A 2BDJA 2JGZA 3GU4A 3O0GA 4FSUA 4YNOA 2YZAA 1MRVA 3SC1A 3TV7A 4L7SA 3V04A 4BGHA 2R3PA 3G9NA 5BVKA 1KV2A 4F64A 1M17A 5L2IA 3TZ9A 1L8TA 4C2VA 4CT2A 2JIUA 3PE1A 5FBOA 5I9XA 5K0XA 2CJMA 5BYZA 3P08A 3DBFA 3VAPA 1OPLA 5M4IA 4F7JA 3I1AA 3BBWA 3C1XA 5DPVA 3RWPA 4E93A 3L9NA 4EQCA 4HNFA 4KIKA 5CSWA 3PXYA 1NVQA 3R2BA 1QCFA 3UC3A 2R3RA 3QRJA 4W4WA 1H1PA 5DFPA 4A4LA 3PVUA 3D83A 2VGOA 3ZONA 3NYXA 4CG9A 1IRKA 3OXZA 5E8YA 2IW9A 3SOCA 3NIEA 3EWHA 3QLGA 1OMWA 4RQVA 5ETAA 4IMYA 1H1WA 4UALA 3ZZWA 3NW6A 4A9YA 2OXYA 2BIYA 5HESA 4PDYA 5JK3A 4FKOA 3VBYA 3VIDA 1J3HA 2BAKA 4OUCA 2VUWA 4WNPA 3EQDA 3W2OA 1G3NA 1ZXEA 3DK6A 4FV7A 2ACXA 1AGWA 5M53A 4YSMA 5IUGA 2O65A 1NVSA 3GT8A 3LJ1A 2ITWA 4KS7A 4U3YA 4MEDA 4I3ZA 4F4PA 3F82A 5ANKA 2QOIA 2PTKA 3HMMA 2RG6A 3PE2A 1P5EA 3WZEA 1G8AA 2OBJA 4B7TA 2QU5A 2QCSA 4RX8A 4JDHA 4ZP5A 4ZZNA 4F9YA 3ORNA 3CC6A 4DEIA 5HG5A 1GZKA 4Q9ZA 5DRBA 4FUXA 4GFGA 4IAIA 3UYTA 3I0QA 3OOMA 1OIRA 4MF0A 5AP7A 3QUEA 1CDKA 4QP3A 2WTKB 2ZV9A 1LR4A 4FR4A 4KAOA 1U4DA 4WRSA 2F57A 5CY3A 1YXTA 3V5PA 2XMYA 4OAUC 2YIQA 2OIBA 1UA2A 3S00A 2I0YA 2C3LA 2VTTA 3FSFA 4UMTA 4KKGA 4L68A 4UWCA 4V01A 4YP8A 3W2SA 3DAKA 3L8XA 1YWRA 4QNYA 2YABA 4RGJA 1O6LA 1Y57A 3OCBA 3OT3A 4KINA 4XG8A 4AF3A 4DTAA 3NCZA 2WELA 2EVAA 4F99A 2Z60A 4NIFA 4BZNA 2WOUA 5KMNA 2ETRA 4EK6A 1FVTA 3GC7A 5AP5A 3RVGA 4ARKA 4HYHA 5HVJA 2XK6A 4OT5A 4JIKA 2QOFA 1XBAA 4NW6A 3R8UA 4X3FA 3JXWA 4YGAA 3U87A 4F6SA 3V8TA 2VNYA 5GZAA 5EW8A 2XEZA 4BBFA 4ITHA 1JKLA 2R7IA 3F88A 5KO1A 5M4FA 2BTSA 3GC0A 5HO6A 3N4UA 4FZ6A 3G6GA 3PJ3A 5BYYA 5CSXA 3NMUF 4KBCA 4CFVA 3HGKA 3DK3A 1QPDA 3HX4A 4XLVA 1APME 4EI4A 4NSTA 4HW7A 4EOLA 4TPTA 3U6HA 2X81A 2C5VA 3FLZA 4A07A 3RNYA 3P23A 4L44A 4X7QA 2DWBA 5H3QA 3GCVA 3C0HA 4QNAA 1Q97A 4DGNA 4MCVA 4CFNA 3BYUA 4I23A 3KA0A 4HGTA 2GQRA 3C50A 4FSYA 2XM9A 4PNKA 5HU3A 3MH1A 5A4CA 4CNHA 1K3AA 3BYMA 5JGBA 3SW7A 2G2HA 4GVJA 4LMNA 4MHAA 5CANA 4JAJA 3ULIA 3ZC5A 3KXMA 3R04A 4RBLA 3KVXA 3N4TA 3UO4A 4TNDA 5HHWA 1JLUE 5EDPA 5EYMA 4TN6A 5FEEA 4F0GA 2QNJA 4XBUA 4BDAA 2YCRA 4C34A 3F66A 4BCIA 3CY2A 4ZLYA 3E92A 2YWVA 4FZ7A 1M14A 2B9HA 4R7IA 3CE3A 3BGQA 2WMVA 3WILA 5L2TA 3AC8A 5M06A 4M0YA 4I41A 4YZMA 3O8TA 3ZBFA 2IZSA 4W4XA 3L9PA 2IVSA 2GHMA 5J8IA 5AV4A 4XJ0A 4FVPA 3OVVA 5EKNA 4MXZA 3F3ZA 3PVBA 4F1OA 5GINE 1ZOGA 3R7VA 3G90X 4GYIA 3IW8A 3QC4A 4BC6A 4IAFA 4ENXA 3WARA 4HOKA 2CN8A 4FMQA 4W9XA 3Q4TA 3UGCA 2UZWE 2Z7LA 3OD6X 2VX0A 3QKLA 3VF8A 3HVCA 4DFUA 1WBSA 3V5LA 1IA8A 2XIZA 2PVNA 3PIZA 4BCQA 3W18A 2PVJA 1H24A 1R78A 1OB3A 3H0YA 3JVRA 3Q53A 5CNNA 4BDHA 4QMWA 2UVXA 4EBWA 5HBJA 2FH9A 2YM7A 3PVWA 4H1JA 4JG7A 4YU2A 4RWIA 3NYVA 4AG8A 4I5MA 2J5EA 4HVSA 3B8QA 2BRMA 2GS7A 4C33A 4CCUA 2CNVA 5H8BA 4EC8A 1W0XC 5M57A 3RM7A 1XBBA 2QOLA 2VTSA 2E9UA 3VW8A 5CZHA 4M68A 2I0VA 2VO7A 4R7HA 5A3XA 3QBNA 3RPYA 5L4QA 4O7LA 3EQIA 2WQOA 4D9UA 4D4RA 2BHEA 3DB6A 2W0JA 2XZSA 3QQJA 3FXWA 4MD8E 5EDRA 4CEGA 2I6LA 2IN6A 5ANDA 1W8CA 2NRYA 2XNPA 4IIRA 5AP4A 1OVEA 3PPKA 4G31A 2UZDA 1YVJA 2IVUA 2XNOA 4DA5A 4QMYA 5CVFA 2C5YA 4WUNA 1RE8A 4DH5A 3TNQB 2X39A 3CQEA 5M4UA 3ORPA 3R8PA 4NKSA 2W5BA 4DYMA 3UP2A 2JDRA 3GCQA 4UMQA 4O0SA 4C3RA 3F5UA 3SDJA 1PXIA 3Q5IA 2IO6A 4F9BA 2F7EE 4FODA 3MVHA 2C1BA 3F3VA 4TL0A 4CRSA 1WBOA 4IM0A 2GNIA 4QPMA 4J7BA 2UZUE 5EYCA 4A9TA 3QLFA 4R78A 5F1ZA 3CGFA 3R8LA 4BCJA 3RNIA 5H9BA 3EFLA 3LXLA 4TNBA 2A19B 4KWPA 1HCKA 4FICA 4E4LA 3C4WA 4TTHB 3GU6A 3G33A 3ORZA 3EQPA 3GEQA 4FVRA 4QMNA 1WZYA 4FTMA 4FV3A 3SXSA 2H96A 4BKZA 4I0RA 3V8SA 3BYSA 3AQVA 5JKGA 3DFCB 5DEYA 3OW4A 2J4ZA 4NUSA 2O63A 3H0ZA 5TE0A 4NM3A 5HO8A 3RPOA 4AFJA 1QPJA 3MY1A 5HLPA 3WE4A 3OWJA 5BVDA 5E8UA 4X3JA 2W4JA 3A62A 4QYGA 4E6AA 2ZYBA 4M7IA 3HUBA 4MNFA 5BUIA 4ZSJA 2RL5A 2LAVA 3V5QA 5IA4A 4FX3A 4J98A 3QTXA 1H00A 2YM8A 4FOBA 4HVGA 2J0MB 3I60A 4NW5A 2JFMA 3PY3A 4E8AA 2PUUA 4FKTA 3NUXA 3BGZA 3QUPA 4FGBA 1VR2A 4OTPA 5CQUA 5JZNA 3ZMMA 4BIBA 1LEZA 3T9TA 3DK7A 2OKRA 2CKQA 2AC3A 2JBOA 3T3UA 2CNQA 2X8IA 2XCHA 4AAAA 2QG5A 2UV2A 5LARA 3H30A 4IEBA 4O21A 2ZAZA 4RPVA 3HAMA 3EFWA 2R4BA 3PLSA 2PZIA 3BU3A 5EQYA 2ZV8A 3ET7A 1YI6A 4BHZA 2J2IB 2XKDA 2Y0AA 3CTQA 1PMNA 2UW3A 1MP8A 2B55A 2WIPA 3PA3A 2WKMA 4F9WA 2O5KA 4I4EA 3GENA 2V7OA 3G0EA 5L6WL 1ZAOA 4IM3A 4X6QC 1G8SA 2W1HA 2PUNA 2A1AB 4A4XA 2C3IB 2X7FA 4I22A 2QR7A 3GXLA 4U3ZA 3H9OA 4JBVA 3UNKA 3VO3A 3KRJA 3FLQA 4KUJA 3UQCA 4ZS4A 4MWHA 4FKPA 4AZFA 3LMGA 4IX6A 2R3KA 5CS6A 3CKXA 3BLRA 2J50A 1Y6BA 3KC3A 4O22A 4F0IA 4IX5A 5J79A 5L6OA 5LWNA 3MPTA 3ZDIA 2JIIA 4RT7A 2QOKA 5E8XA 3D15A 4DEHA 3LIJA 4HPTE 2FYSA 2YN8A 4IADA 5T6KA 3RKBA 3TTIA 5I4NA 4MXCA 4JL9A 2CHLA 4KIKB 4IH8A 4JQ7A 4PPBA 2XIXA 3I79A 4O81A 4O7SA 4G3FA 5AUWA 5CEMA 4KKEA 4WIHA 1J7IA 3OC1A 2OFUA 2X8DA 4KIQA 4L67A 4MX9A 4QMXA 4L3JA 2HENA 2VZ6A 4QYEA 4DFLA 5LVPA 4F7NA 4PMSA 4EOJA 5KMOA 4ALVA 3RZBA 1ZYDA 1MRUA 2J90A 4DE4A 5GJFA 3WZDA 2WTWA 3O96A 5I5ZA 4G9CA 4YTIA 1CKJA 3QZIA 5HU9A 3DNDA 3G0FA 3VBQA 3GFEA 3DJ6A 2XVDA 3HECA 4OTHA 2GSFA 2J0JA 5AAFA 3DA6A 1U5RA 3D7TA 3GC8A 3Q96A 5IQAA 2VO6A 3WBLA 3A7IA 4CFWA 4YLLA 1BKXA 2XP2A 4FTUA 3HMOA 3SRVA 4LOOA 2EB2A 4C4EA 4EJNA 4IB0A 2ITXA 4DGLC 4CSVA 2XIYA 2UW4A 2XBAA 4NFNA 5HIBA 4LG4A 4BKYA 2Y4IC 4EZ3A 3FPQA 3KXGA 4DFZE 4EHZA 1JOWB 2ZJWA 4D0XA 1YOLA 2Z7RA 3W33A 4RIXB 4ZTMA 4NL0A 3E7OA 4ACDA 3MH3A 3LCKA 3UQFA 2VTIA 4FF8A 3VUTA 4WBBB 3KEXA 3ZRKA 4FK3A 4QPAA 1WBTA 1JSVA 2C6MA 4UZHA 4JR3A 4C7TA 5AR8A 5C4KA 4FKJA 2R3LA 3KRWA 1E1XA 3Q04A 3CXWA 5IKWA 3THBA 3AD4A 3ZUUA 4CMOA 4DCEA 3QQFA 5HIDA 3QAME 4V05A 5DA3A 3U8WA 4AZEA 3EL7A 2UVZA 4FEXA 5CU2A 2QG7A 3MBLA 3PZHA 3E87A 1LEWA 4IVCA 4IW0A 4NIFB 4ZTLA 3TCPA 3RHKA 3UP7A 2BRNA 3UG2A 2QLQA 4FTCA 2WMTA 3AC4A 3O51A 1WVWA 3A4PA 3GB2A 4G5JA 4ID7A 1XHAA 4D2PA 4DEDA 2FO0A 5DMZA 4X3FB 2QKWB 4K2RA 4O0RA 3ZM9A 3MV5A 3C4EA 5DGZA 3OP5A 3BPRA 4QP1A 2RG5A 4GUBA 2XK3A 4ACHA 2YM4A 3D7ZA 4EHGA 2HCKA 3ZXTA 3OCTA 3FZSA 4TXCA 3G2FA 3BKBA 5DNRA 4EK8A 2QOHA 5DEWA 2PVRA 5GZ9A 3IDBA 1PXJA 2PMIA 3GGFA 5CU0A 3FAAA 4ZTRA 5AV0A 4ZIMA 4EBVA 3KY2A 3PJCA 5FXQA 3QGYA 4EOIA 4CFMA 4RA4A 1QL6A 2VD5A 1B6CB 3UNZA 1YXXA 3SXRA 3ODYX 2XKEA 5D10A 3N4VA 4RLLA 5C4LA 2H34A 3DBQA 3SX9A 3QXOA 3M11A 2CGVA 2B52A 3G15A 3MFSA 3EZRA 5IDPA 1VJYA 4F0FA 4WHZA 2XB7A 5HGIA 1NY3A 3EZVA 4Z7GA 2JITA 2XS0A 4E5BA 5L3AA 3RPSA 4O0TA 2WMAA 2OZAA 1U5QA 4QTCA 3FXZA 3E88A 2C0OA 2XYNA 3UG1A 4F1MA 2HY81 2P2HA 2Y4IB 4ONAA 2CN5A 3KF4A 5KUPA 4Q5HA 3TL8A 5I9VA 4RX5A 5J1WA 4QQ5A 3EL8A 4XYFA 3DXPA 2IJMA 3QRKA 3LJ0A 5FG8A 3TIZA 4M12A 2EXEA 4RFYA 2YLFA 5DBXA 2FSLX 3I7BA 4TWCA 3VS5A 4EYJA 2ZDUA 4II5A 4EJ7A 2GNHA 3A7FA 5DYJA 5CALA 5CVHA 2XK4A 2YWPA 4OBOA 5IUHA 1OUYA 3BELA 4I5PA 3FLSA 4FL1A 4L00A 5LQFA 1YI3A 1GJOA 3NR9A 3O7LD 4QOXA 4UN0C 1OL6A 3F9NA 1PMEA 2C6LA 4YTCA 4TWNA 4E6DA 2F4JA 3O2MA 3OUKA 5EM5A 3UIBA 4OTIA 1M7QA 4RJ8A 5LVLA 3MIAA 3QTUA 5KX8A 3Q9WA 3ZOSA 4C38A 4L42A 3ZFXA 1KE6A 3H9FA 2AYPA 1PXPA 2C68A 3A8WA 4BDBA 1OITA 1ZZLA 3ZUTA 5IA5A 1SYKA 3HRBA 3LFDA 4LUEA 4UYAA 3WF9A 4O7YA 3CTJA 4NTSA 4XOYA 1GAGA 1BUHA 5CF5A 3PWYA 2R64A 2PVFA 4N0SA 2BPMA 4GJ2A 2ITVA 3KVWA 5L2QA 4ACMA 2YCFA 3ALNA 1OPJA 1KOAA 1KSWA 2BZKB 3KXZA 3QTQA 1JKSA 3I81A 2Y7JA 1R39A 4ZTSA 3VQHA 1ZYSA 4TWOA 4DTKA 2X9EA 3BBTB 1DM2A 3DPKA 2PZRA 4ZJIA 3QQUA 2VWWA 3GQIA 2XF0A 5GNKA 3BE9A 4MBIA 5FP6A 5J9LA 2YIRA 4CMUA 3QTIA 4OTGA 5JFWA 5LOHA 3ZDUA 4ANBA 1T45A 5LMBA 2UZLA 3KCFA 3NAXA 1RJBA 5IA3A 5IQFA 4E20A 5F95A 2YEXA 2A2AA 2WTDA 2CMWA 4L6QA 3NS9A 3OCGA 5M51A 2PSQA 3FUPA 4HYUA 5DT4A 3SVVA 2W1GA 2ZOQA 2P4IA 3TIYA 2JD5A 4EH4A 3CD3A 2KTYA 3W8QA 5M4CA 3MVLA 4GMYA 3ERKA 3E5AA 4UMRA 4G3GA 3PSBA 1OL7A 4Y95A 4CFXA 2Y6MA 4DH3A 5A6OA 5K4IA 2HK5A 5E1SA 3K2LA 5AR7A 3U4WA 2QHNA 2ETMA 3BQCA 1Q8YA 5AA8A 4C4JA 5FRIA 5EHYA 3GOKA 4E4MA 2UUEA 3LQ8A 4OT6A 4RFZA 1XKKA 3VHEA 5HCYA 3WI6A 3GVUA 3AXWA 5LVNA 4RZWA 4BZDA 3C4CA 2XNBA 4CQEA 4FTLA 5DR2A 3E8NA 2BILB 4JXFA 2P2IA 2OICA 3I4BA 3T9IA 4IZYA 2WXVA 3GU8A 5C8MA 4EKKA 4GIHA 4E7WA 3HRCA 3POZA 4CTBA 3OHTA 2P3GX 2WEIA 3I5NA 4MK0A 2VN9A 1WFCA 4BDFA 3UZPA 4O96A 3R7GA 5EW9A 4GFOA 4PV0A 2XKCA 2JIVA 5EG3A 3G9LX 4C36A 3KULB 2RF9A 2WU6A 5A4EA 1SVGA 4BCGA 3A7GA 4EUUA 4DITA 2WTKC 4MNEA 3OT8A 3ITZA 4F6WA 3DLZA 2CCHA 3L8VA 3R2YA 3HA6A 4ZTNA 1OPKA 1VZOA 1S9JA 4FOCA 2W9FB 4GV1A 2IW8A 2JDSA 4RIWA 1W98A 4BDKA 4C37A 4EH9A 4HVIA 3QD3A 2WMSA 5ITAA 4EK4A 3R6XA 4MXXA 4KIPA 1ZZ2A 4UMUA 5KHWA 2IG7A 5EHLA 3NSZA 3QYWA 1NT2A 5LMKC 2OLCA 4I93A 4JT3A 3RPVA 1ND4A 4GK4A 4R77A 4IB1A 4XG7A 1Q99A 3NW7A 4RJ7A 5LCJA 3ORXA 2X2LA 5K5NA 4NEUA 4LGHA 4DH7A 2VV9A 3OG7A 3ATSA 1FINA 2UZNA 4RVKA 4CT1A 3CKWA 5ANGA 2JAMA 3V5TA 4BN1A 2Z2WA 5G6VA 2EUFB 1WMKA 4GU9A 5E9EA 3T3VA 2B54A 4AGCA 5HIEA 3DFAA 3FLNC 5DRDA 4Z3VA 4QD6A 4NJ3A 4IDVA 4XP2A 4AX8A 2X1NA 3QF9A 2J51A 5CEIA 5I9WA 3F5XA 3AGMA 2IZRA 2YIWA 5AUXA 2YDJA 4NH1A 5JFXA 1WAKA 2GS6A 2Z8CA 2OZOA 2JFLA 4U5JA 3A61A 5CXHA 4PTCA 2PE0A 4D5KA 2C6KA 4HVDA 1V0BA 2JAVA 1V0OA 4R5SA 2YAKA 5FQDC 5D11A 4C4GA 3IONA 3KN6A 4YJOA 4RIYB 3UZTA 4DF3A 3IK3A 1Q61A 5AIKA 3DDPA 4P90A 2GQGA 3OWLA 2CNUA 1XBCA 4H3PA 4IFGA 3F5PA 4O6EA 4ZSAA 4PDOA 3CPBA 4AN3A 1PXLA 5HD7A 1A06A 2QONA 5J9YA 3VUKA 3H9RA 4W9WA 3LJ2A 4GJ3A 4ZSLA 3F7WA 4BCOA 4J53A 4JVGA 3AT3A 3KMWA 3DT1A 3RAIA 5DH3A 1URCA 3C4XA 3PJ2A 2QURA 1VYZA 5HI2A 3BLQA 5LCKA 1MQ4A 3PTGA 3R8MA 3TTJA 4IC8A 3HV3A 3QTSA 3OTUA 4LFIA 3SW4A 3A7JA 3UTOA 5AP1A 1YDSE 5HOAA 4DGMA 1UU8A 2VWUA 2VWZA 3AC1A 4BGQA 2GPHA 3NUNA 3MA3A 2J6MA 2C6DA 3MY5A 4NKAA 3TV6A 4EEVA 2AUHA 3P86A 5HTCA 3R9HA 3BWJA 4RLKA 2C69A 3LVPA 4RWJA 5IH5A 1PJKA 3TKIA 4A7CA 2HZNA 2YDKA 4RC3A 5CQWA 2QI8A 4EOMA 3AMBA 3W16A 3C51A 4EK5A 5M56A 3QFVA 2F2UA 4QMLA 5ACBC 2QKRA 3FMHA 3R9DA 3RPRA 4G1WA 3V51A 2QO2A 2BZIB 3GBZA 4J52A 4E5WA 4R1VA 4LUDA 4U7ZA 4XP0A 4WRGA 3FDNA 2HW7A 4FYOA 4C4HA 4NK9A 4IJPA 3M1SA 1JAMA 3BWFA 1ZY5A 2RFEA 4ASDA 4USFA 3LFEA 1OUKA 4IWPA 1JVPP 2VNWA 2P55A 5EQPA 1YDRE 2BDFA 2PZYA 1PYXA 1OZ1A 4Z16A 3EN4A 3FYKX 1CSNA 1JPAA 2G1TA 3KK9A 4AZTA 5HBEA 4TYJA 2WQEA 4U43A 1J7LA 3EH9A 4YJQA 4I6BA 3FZTA 3COHA 2XJ2A 3W2RA 3MSSA 4AWIA 1BL7A 4ENYA 4DG3E 4AW2A 4R5YA 4AN2A 1M2QA 2UZVA 2YFXA 4ZOGA 2R0UA 5IQDA 5GJDA 5CTPA 5ICPA 4ASZA 4NWMA 5KNJA 5CLPA 5EI8A 3FZ1A 3OXTA 4DGGA 3FMJA 1PXKA 3M42A 3PXQA 3QZHA 2CKPA 1U54B 3ANQA 3PUPA 4O0VA 5TKDA 4BCMA 1XO2B 4X2FA 2R2PA 3EN6A 5KCVA 4LL5A 3LXKA 4QMUA 2ITPA 2X4ZA 1RQQA 1HOWA 4Z9LA 4I6QA 4AS0A 3LXNA 4FSTA 5FDPA 3O8UA 3PSDA 4MXYA 4BRXA 4ZAUA 4K6ZA 4QQCA 2PYWA 3MN3A 1WBNA 4DCAA 3ZSIA 3VN9A 1FBNA 2E9OA 4FKQA 1OL5A 2I1MA 3DKOA 2OZAB 1YXUA 5C03A 4R3PA 4O2ZA 3D5VA 3FQEA 1NVRA 5H8EA 4BF2A 4C2WA 4DEEA 1DS5A 3JY9A 5AR5A 2V0DA 2FSMX 4IDTA 1UU7A 4I94A 2JKOA 4EOKA 1F3MC 4A9UA 1ZARA 1GNGA 3HRFA 3P79A 3R21A 5FTOA 3MWUA 2XJ0A 4LGDA 4MKCA 3LCOA 2CPKE 3IPHA 4KRCA 2OIDA 2Z7SA 4BZOA 4O6LA 4IE9A 3QCSA 1PXNA 4ITIA 4DG2E 5IF1A 1FQ1B 3RK5A 2ZB0A 3DXQA 4NCTC 4CFFA 3MFRA 3UVRA 4UYNA 4N70A 5I9UA 3WE8A 4TZRA 2ZV7A 3LW0A 4RRVA 4PQNA 2WMRA 5IUIA 2GS2A 2C6EA 2WQNA 1J91A 1YDTE 2ONLA 4FSZA 4JBQA 4KKHA 2J5FA 3C9WA 4U45A 5IU2A 5HO7A 5JMSA 4XG6A 3F7ZA 3NGAA 4MVFA 3UYSA 4IJ9A 4RWKA 4LQMA 5BVFA 2BAQA 4GT5A 3ATTA 3NZ0A 4LRMA 3P5KA 4FV5A 3VJOA 3W10A 3W2CA 4S32A 3S2PA 5A4LA 2A0CX 4RVTA 4UBAA 2CGUA 3UIXA 4XLIA 2HYYA 2W06A 3ID6C 3OEFX 3WZJA 4KIOA 4FV1A 1ZYJA 5HLNA 3R71A 2DUVA 1LP4A 5LWMA 4AXAA 5KMIA 4JI9A 2OI4X 2QHMA 3JUHA 1GZOA 1XH4A 1E9HA 2QO9A 2OJJA 2XYUA 4GG5A 1UV5A 4I0SA 3U51A 4FEWA 2OWBA 3NX8A 3QA0A 4BDEA 2O2UA 3U6IA 3MH0A 1PRYA 3IOPA 3QCQA 4QP2A 2XEYA 1OBDA 4QQTA 3UQGA 4V0GA 1MRYA 2O64A 4JDIA 4CV9A 4BCKA 3ZXZA 4TKSA 1KV1A 4MQ2A 1YKRA 4L53A 3SHEA 5DR9A 4WNKA 3ZO1A 3W2PA 4YURA 2B4SB 4WNMA 4YBKA 4D0WA 5A6NA 4CVAA 3KFAA 4FG9A 4IM2A 4GEOA 3RJCA 1PW2A 4DEGA 1Q24A 4U97A 5GIPE 3UNJA 3IQ7A 5J7HA 5EI6A 1F5QA 2C47A 4ANMA 2IZUA 2VWIA 2HIWA 4RIOA 2BKKA 5BYLA 3R73A 2G2IA 5CYIA 3UOJA 4N6ZA 4E6QA 2C30A 4U6RA 4P4CA 5FUTA 2XRWA 3EQBA 4RC4A 4FSQA 4I4FA 1IAHA 3DZOA 3CTHA 5ETFA 5EHOA 5IPJA 1UWJA 3AMYA 3U9NA 2UZTA 4O83A 4F1TA 1GY3A 3FKNA 3QRTA 4X0MA 5HE2A 3RWQA 1ZYLA 5KKRB 5HX6A 4B0GA 2OIQA 4GT4A 4BI0A 1KE9A 1P14A 3PPZA 4QQJA 4YC3A 4ANLA 4D4YA 4F65A 3OXIA 1XH9A 3BHUA 1H01A 4M14A 3DTCA 4XRJA 5JFVA 4CKJA 3IW4A 2PE1A 3C7QA 4GU6A 3CJFA 4YJRA 3SD0A 2R7BA 2JDOA 1M2PA 4GH2A 2WU7A 4AQCA 2PVKA 2E9VA 3OOGA 4TRLA 4RJ3A 3HEGA 3HV6A 4YC6A 5CENA 3W32A 4O86A 3O71A 4EOPA 4AZWA 5CF6A 5HE3A 1CTPE 3MVMA 1CKIA 4AGDA 2R9SA 3R1YA 1QMZA 4AT5A 1IR3A 2X0GA 3NUPA 5AM6A 3FEGA 4YO4A 1L3RE 2XM8A 4LOPA 3FKOA 2BAJA 3AC5A 4G17A 3QQLA 3PYYA 4M67A 2XJ1A 4QYYA 5KHXA 5AAEA 4MD7E 2Q0BA 2BFYA 3CQWA 3LLAA 4MNEB 1WBVA 3TACA 2VU3A 4BR3A 1R1WA 1AQ1A 3NIZA 4FNZA 2WQBA 2XK7A 4UY9A 3C0GA 4D2VA 2WAJA 3R7OA 5HE1A 2R3GA 4ITJA 5DR6A 3QD2B 1YHSA 4BWXA 3MW1A 4AE6A 2QU6A 1Q8TA 2C6IA 5JQ5A 5A4TA 2JKMA 4X2NA 4L9IA 5DI1A 5EH0A 3R8VA 3EQHA 2FSOX 3SQQA 3P4KA 1JNKA 3PLAE 4NYEA 2C6TA 2OJFE 2EU9A 3EB0A 3PXKA 2OGVA 3RAWA 4O7RA 5FTGA 3FQSA 4FIEA 1TKIA 2VO3A 2CDZA 3TNWA 5A54A 3DTWA 4QYFA 4WT6A 4X3FC 4F9CA 3DZQA 4PTGA 4U41A 3H3CA 4QTBA 4YO6A 4BYJA 3OBGA 4BDDA 2CCIA 4BWKA 2GMXA 3ZZEA 4AT3A 3QQGA 3V3VA 3ROYA 4R6VA 3ZFYA 2Y8OA 4ZZMA 4B4LA 1STCE 4L3LA 5H8GA 4MBJA 3ZUVA 4I21A 4ZY6A 2HAKA 3JVSA 4N57A 3O23A 4LMUA 3RCDA 1BLXA 3KCKA 4J99A 4KB8A 3U9CA 4DBXA 4DT9A 4KNBA 3UOLA 3FY2A 3BRBA 3IOKA 4E26A 4FNXA 2QLUA 2I40A 4ZMFA 2QO7A 2G2FA 4EC9A 4PF4A 4DT8A 4AACA 4IAAA 4O7VA 3RINA 5EYDA 3TG1A 3RTPA 5IEXA 2VTHA 3R9RA 4BFMA 4IAKA 2QOBA 4GYGA 4YJUA 5A14A 4I6FA 4FT9A 3SV0A 2VWXA 3CCNA 3VWAA 4LYNA 2X2MA 5GIOE 4BBMA 2WB8A 4ZY4A 4CV8A 2GU8A 4D28A 5C27A 2OG8A 4FKWA 4ALWA 2QODA 4E1ZA 4QPSA 4OTFA 4HZRA 5IEYA 3ZYAA 3EQCA 4EUTA 4FUYA 3ZRLA 4LOQA 1CKPA 1DAYA 4HGLA 3TKHA 2GTNA 3AG9A 4XG9A 5EM8A 5KZ0A 4FIIA 4C4IA 5AUUA 1WCCA 4LRKA 5BMSA 4ZY5A 2WTIA 3DKCA 3QX4A 1GZNA 3VRYA 3DJ7A 1YOJA 3LZBA 1KE5A 3FZOA 4J8MA 5ANIA 5LMAA 5LXMA 5F20A 1PXOA 2VTLA 2KULA 2OK1A 3K5VA 3LQ5A 3VF9A 2C1AA 3G6HA 2HZ4A 2NPQA 2X2KA 4O7TA 3VHKA 4BTMA 4F6UA 4OTRA 5CAVA 1H28A 3LQ3A 4H05A 2PVYA 3K5UA 3KRLA 4JJRA 5CSVA 3GCPA 3FI4A 4FVQA 4S34A 4DC2A 5AWMA 5HQ0A 4HYIA 2QOQA 3QALE 5EYKA 3W8LA 3TM0A 2WTJA 2HZ0A 1JWHA 3FMLA 3PRFA 5IISA 5M44A 3ZSGA 2YDIA 3LFFA 4BVUA 5CXZA 3O7LB 3FZRA 2WFYA 4IANA 3F3TA 4M69A 4U80A 1OI9A 2GQSA 3HDMA 2ITTA 2XKFA 4BWPA 4JOAA 1S9IA 2CLQA 3PXZA 3L8PA 4U79A 3HV4A 3RHXA 3RK7A 3UPXA 4QP8A 3ZCLA 5CEOA 3QCYA 4O7NA 2H9VA 3L9MA 3UMXA 3OUNB 1PMUA 4GG7A 5IQGA 3JPVA 5DWRA 1YRPA 1GIIA 1OKYA 4R3CA 5AX9A 1H4LA 4XOZA 2OJGA 4Q5EA 5FLFA 2ITOA 5AV1A 5C01A 1CM8A 2PL0A 3FI2A 3QHWA 5I3OA 5LMKA 5HNBA 3MESA 5KMJA 4TW9A 5DOSA 1OIQA 3AC2A 3FV8A 2PU8A 1PHKA 2V22A 3E8CA 2C4GA 2FGIA 1CMKE 2P0CA 4K8AA 3OMVA 4WUAA 4G3EA 2FA2A 2UW9A 1VYWA 4Z55A 4RJ5A 3ODZX 5BVNA 4JX3A 4USEA 3R7EA 5KZIA 4IZAA 3WOWA 3ZLSA 2ITUA 5EM6A 1YXSA 3VUMA 3FMNA 3MDYA 1REJA 2XK8A 4HCVA 1ATPE 5LJJA 2PVHA 4IACA 1OKWA 1OBGA 2OSCA 1KE7A 3E3PA 5IQCA 2ERKA 2QC6A 5EKOA 1SVEA 3NWWA 4I5CA 1PYEA 3VS6A 4O7ZA 1DI9A 2EWAA 1TQIA 2WPAA 2ESMA 4QMZA 1YXVA 1XJDA 4MWIA 4U9AA 5AUYA 3KMMA 5E90A 5IDNA 4D58A 3QKKA 5FBNC 4U8ZA 2J9MA 2E9PA 1UWHA 3KRRA 3MVJA 3BV3A 3QD4A 5J87A 4MBLA 2R3FA 4ANSA 3D2KA 2WMBA 4FYNA 3TKUA 4C58A 2BALA 2BRGA 4D5HA 5JH6A 4FEQA 1A9UA 4WG3A 3ZEPA 4LV5A 2H8HA 3SOAA 3WZUA 3Q2JA 3M2WA 2VTRA 2ERZE 3EQFA 1Z57A 2I0EA 2RKUA 2ZMDA 4FKIA 5HTIA 4RWLA 5E92A 3ZHPC 2W4KA 1ZRZA 3U4UA 5GZ8A 4USDA 3ELJA 2HELA 4FT0A 4D4VA 1H1RA 3LM5A 4TYGA 2RGPA 4HYSA 4O0XA 4HCTA 3IW5A 4U42A 2R3IA 2QOCA 1H8FA 2BVAA 2XCKA 4O0YA 5JRSA 4C4FA 4D55A 3FMMA 5CNOA 3UVPA 1KUTA 2PZ5A 3MB7A 5B2MA 4E5AX 2JC6A 2YISA 4QTDA 4YZCA 5TO8A 3R8ZA 3V5WA 4A06A 3IECA 5HG8A 5EW3A 2B53A 3BGPA 3EQGA 2J7TA 4IX4A 4FKVA 1ZMVA 4TYHA 4BKJA 2ZM3A 4U40A 3R9NA 4HJOA 2XRUA 4ACCA 3F3UA 2PY3A 4U81A 4A9SA 1Q8UA 4X6RA 1FOTA 3VULA 3CR0A 4XS2A 2PE2A 2JDVA 4L7FA 5AR3A 4RA5A 2C5NA 3MJ1A 3MPMA 4H39A 4OR5A 1GOLA 5AV3A 5DT3A 4KS8A 1RW8A 3O8PA 3DNEA 5FM2A 4ZEGA 1M7NA 4LRJA 2GNJA 5CI6A 1H08A 3HZTA 3PP1A 2NO3A 4BICA 3HUCA 4I5HA 4PMTA 4RSSA 4U44A 3AC3A 1OM1A 5ETCA 1K2PA 3UOHA 5J7BA 2VX3A 2VTPA 4LM5A 4S31A 1UU9A 3KL8A 3EIDA 4PY1A 3TUDA 3B8RA 4QP7A 4AOIA 3Q3BA 3IW7A 4PRJA 3S4QA 2XNEA 3PWDA 4BDGA 5K4JA 5JZJA 3JYAA 3P0MA 4KA3A 4JG8A 3D14A 4V0GB 3NUSA 3D9VA 4C61A 5CSHA 4EONA 5DG5A 4WKQA 2ZM4A 2DQ7X 4FZAB 5TOZA 3UPZA 1QPEA 1Y6AA 3NW5A 4TY1A 4DTBA 4FTOA 3NYOA 4O38A 4PL4A 3KMUA 4CMTA 4FTQA 4RC2A 4XG3A 5ETIA 3V6RA 4R3RA 4D4SA 5LVOA 4HPUE 2LGCA
chains in the Genus database with same CATH superfamily
5CAQA 2PVMA 3HMNA 3LFSA 4C59A 3MYGA 3UOKA 1Q62A 2B1PA 3CGOA 5JEBA 2OO8X 2PMNX 3L9LA 2W7XA 1SM2A 3FBVA 3ZFMA 5GHVA 3S1HA 1IG1A 4FIHA 4MH7A 3CEKA 4UWBA 1GZ8A 4ERKA 1E1VA 3E8EA 2WEVA 4QO9A 4G9RA 2C6OA 5E8WA 3VVHA 5TF9A 3F2NA 3W0QA 4EH3A 2HOGA 3NNUA 3EN9A 4YUQA 2R3NA 3KK8A 2I0HA 5AIRA 3TEIA 4PMMA 5AV2A 4FEVA 3HV7A 4RG0A 2XH5A 4H3BA 4FZDB 2F7ZE 3FI3A 3R7YA 3KIOC 4D1ZA 3UE4A 5E7RA 2PUPA 3FLWA 4Y83A 2YHVA 3DDQA 3VS2A 4JLCA 2A98A 4I6LA 2YAAA 3KB7A 1BYGA 4GW8A 3C4FA 3UVQA 2W9ZB 4AU8A 4ZTHA 4FT5A 2AC5A 4BTFA 3BIZA 2VTAA 3SAYA 1XH8A 3UIUA 4F09A 2PUIA 3AKJA 1YWNA 2C5XA 4RMZA 5M09A 3K3IA 5D1JA 5D41A 4G3DA 3A7HA 3ZRMA 3IS5A 5CF4A 4S33A 4PDSA 3FZPA 3RAHA 3QWKA 3DKGA 3KN5A 3TZ7A 3F3WA 4WSYA 3P7BA 4YC8A 1URWA 2GNFA 3VC4A 2YACA 4CZUA 4XBRA 5CU3A 4M0ZA 3RI1A 2OXDA 4YJVA 4AOJA 4CYIA 5FWKK 4CQGA 3NPCA 4W8EA 1X8BA 4IZ5A 4APCA 3FMEA 3PG3A 4IHPA 4AZSA 4F9AA 4XEYA 4XHKB 2VWYA 4MYGA 1Q3DA 3FWQA 3MTFA 3BYVA 4ZSEA 2BRBA 4BCHA 3LFAA 4BHNA 1UNLA 5AR2A 1SVHA 4BTKA 4FGRA 4KSPA 3BZ3A 2IVTA 2VWBA 3NAYA 3HYHA 4GVAA 4H3QA 2VAGA 3Q6WA 3PZEA 2BDWA 3LCSA 1OECA 2WQMA 4G34A 5CF8A 4M13A 4WG4A 3EFKA 4XX9A 1BMKA 4IXPA 5JGDA 3QZFA 3KGAA 3MH2A 1FVRA 3DQXA 4NT4A 4O0WA 4QTEA 5BVWA 4EWQA 5CAPA 3LKMA 1BL6A 2OJIA 2W1CA 3MS9A 3GOPA 3BU6A 1J1BA 3AGLA 4C35A 3E63A 3D0EA 3MGYA 2XK9A 4HVHA 1VEBA 5AA9A 2PWLA 3EYGA 4EQUA 3GUBA 4EH6A 1JSTA 4CLJA 5AMNA 4D1XA 3REPA 5DVRA 1TFFA 3DXNA 2IW6A 4ASEA 5I0BA 1JKKA 2R5TA 5CVGA 4OGRA 4Y8DA 2WNTA 4ZXTA 1Y8GA 5B7VA 3NNWA 4J97A 1H0WA 3MJ2A 3GQLA 2IZTA 5AR4A 3DS6A 4ANQA 4P2KA 3HV5A 3K3JA 2PMOX 2WGJA 3LHJA 4HNIA 4IB5A 3VW6A 4TWPA 3U54A 4F70A 2CGXA 3Q4ZA 4FG7A 1HCLA 4F7LA 3FMDA 5L6PA 5EK7A 5IMXA 2BCJA 4TT7A 4YHFA 4JQEA 5E8VA 1V1KA 3UO6A 4O0UA 2JBPA 5I9ZA 5IH6A 5JQ8A 5J5SA 3DB8A 4FA2A 3Q32A 4G3CA 5F94A 4DBNA 3D7TB 3AOXA 4FKRA 4XMOA 4JG6A 3F2RA 1ZY4A 4R1YA 4M3QA 4UXLA 5HE0A 2O3PA 3SRVB 3ZC6A 4D2WA 3TJCA 5CZIA 4ERWA 1Q4LA 4EZ5A 3CP9A 4PTEA 4PUZA 4MD9E 4U0IA 1TQMA 4BCPA 3HA8A 4C62A 3W1FA 4L46A 4WD5A 3W0NA 4ZSGA 4KBAA 5IQEA 4JDJA 2XA4A 3CQUA 4D2SA 4CRLA 4FT3A 2F49A 4D2RA 2YA9A 5AUTA 4QMPA 2V55A 1REKA 3HKOA 1JKTA 1W83A 2JDTA 1SNXA 5EFQA 4AGUA 2RFNA 4XG2A 3RZFA 5CEPA 2F9GA 3EJ1A 3R02A 4FZFB 4DDGA 4DEBA 1W84A 3RGFA 4WO5A 3AT2A 2F7XE 5HLWA 3LCTA 4EORA 3TUBA 3BYOA 4X21A 2UW8A 3BEAA 4RIXA 4B9DA 3R30A 2ITYA 4ZMEA 3JS2A 4M69B 3DQWA 3NLBA 1JSUA 3UO5A 3WF8A 2B9JA 2VTQA 2ZDTA 4PPCA 3WZKA 5A4QA 5FP5A 4JBPA 4GFMA 4IVBA 2EXMA 3P7CA 5AUZA 3C5IA 3K54A 4J96A 4RQKA 2FSTX 4JS8A 3POOA 3R01A 4J1RA 4YNEA 1TVOA 4DHFA 5C8KA 1XQZA 2OF4A 3ZBXA 3I6WA 4O7WA 5K0KA 4IQ6A 4PP9A 4XCUA 3VQUA 3WYXA 4FV4A 3W55A 4FIJA 3WF5A 3FI8A 4FK6A 3R7IA 4QP4A 4BB4A 2VWVA 3BHTA 3PY0A 4FV2A 5I9YA 4BI1A 2V62A 3ENMA 1XWSA 3QX2A 3V6SA 4K33A 5FXSA 3PFQA 2GHGA 4YBJA 1M52A 2Y6OA 4J95A 1T46A 3BI6A 3IG7A 4E73A 2VO0A 3PG1A 4PDPA 4FE2A 2BZJA 1SNUA 1FGKA 4AOTA 2W1EA 1JBPE 2UW7A 5JGAA 4LL0A 4BL1A 3L1SA 1XR1A 5AP6A 5HG7A 2C5OA 3ZH8A 5B2KA 4APPA 2WZJA 2C3KA 2YM3A 3D5WA 4FTTA 1WVXA 4G2FA 1XH7A 4RX9A 3ZTXA 2VRXA 4I24A 3OZ6A 3EFJA 3IW6A 4YPDA 1B39A 2CKEA 2UW6A 2W1FA 3F61A 5H2UA 2E9NA 3ZO4A 4E4NA 3LFCA 3G5DA 4XV2A 3BLHA 4ANOA 3QL8A 4RX7A 4BIEA 1OGYA 4Y46A 2EB3A 5KKRC 4G6NA 3ACJA 3DCVA 2ETKA 4JAIA 4AW5A 1Q5KA 5B2LA 4ORKA 3TXOA 2OJ9A 2I7QA 1MUOA 4CXAA 4ZLOA 4XH6A 2XIKA 3ORIA 2R3OA 2C0TA 1H07A 4XG4A 2BKZA 4FTRA 4EOSA 5AP2A 3ORKA 4FL3A 2GCDA 3UODA 5BQ0A 1ZLTA 2BIKB 1I44A 3OS3A 4EYMA 4IX3A 4FTIA 3DLSA 4PL5A 4BIDA 4FKLA 5KMKA 3B2WA 3C13A 3PXFA 3KXHA 3QC9A 5KMMA 5EQEA 4S2ZA 3CPCA 4O84A 1FMOE 2W5AA 4J8NA 3BU5A 1WVYA 4JIAA 2X7OA 3ZLXA 4Q2AA 2UZEA 3FL5A 4AW1A 3I6UA 3HP2A 4EKLA 4O1OA 4MAOA 5D12A 3NVKI 4XV3A 3TDWA 5EI2A 4AP7A 2REIA 2X0PA 5IQHA 4O2PA 1XH6A 2HWOA 2YLEA 2V7AA 4TYHB 1MQBA 3LFQA 1VLRA 2WTVA 1ZWSA 2BRHA 3GCSA 3N51A 4L45A 3ETAA 1UKHA 4PNIA 4MUQA 2UW5A 3OEZA 4FEUA 3CSVA 3GU7A 2UW0A 3VRZA 5J1VA 3DAEA 3MIYA 1Y91A 1P4OA 3TJDA 4XRLA 3E93A 2W1DA 5T3QA 2OXXA 4JDKA 4BDCA 4WBOA 5FXRA 3R1NA 3BEGA 3QTRA 2Z02A 4N4SA 2P33A 2HXQA 4C3PA 5CAOA 5IG1A 3QHRA 5GJGA 5T68A 3D94A 4FTKA 3TV4A 4DINA 4FTAA 2VX1A 5DN3A 3UJGA 3UMWA 2B9IA 5FEQA 4G16A 5K3YA 1O6KA 3SXFA 1IAJA 3AMAA 2PMLX 3ACKA 5HX8A 4S30A 5D7VA 4KSQA 3ZO2A 5AP0A 4P5QA 4PMPA 5EM7A 1V0PA 5AFVA 1H0VA 1H1QA 3LLTA 4OBQA 3TNPC 2QOOA 5A46A 4AUAA 3KQ7A 1BX6A 3BX5A 5HVKA 4K77A 1H25A 3DGKA 3RCJA 3VS3A 4QMQA 1UVRA 3SLSA 4M84A 3R83A 2EXCX 4FTNA 4LI5A 3NNXA 5AUVA 4K11A 3B2TA 5IEVA 1YW2A 4DH1A 2B0QA 3PSCA 4FJVA 4QTAA 5L2SA 3ANRA 2J0KA 4EQMA 3FPMA 4A4OA 4R8QA 2BHHA 2Y9QA 3OROA 2SRCA 2HWPA 4P5ZA 4D1SA 4W8DA 3OY3A 4CCBA 5CT0A 1GIHA 5J5TA 2B9FA 4IWOA 3NNVA 1BI7A 5DHJA 3NDMA 3QTZA 3VS4A 2JKKA 3OF0A 3PJ1A 2UVYA 3QKMA 3QZGA 2WO6A 4NJDA 3T8OA 4C57A 4GS6A 3KU2A 1PXMA 2BMCA 3E64A 3FC1X 3WIKA 4ZK5A 4Y73A 4OBPA 4B6LA 4BCNA 1XH5A 2ITQA 1H27A 3MB6A 2VTOA 4TYIA 1H26A 4YPSA 1U46A 1FVVA 5ACKA 5IQIA 3IGGA 4FSRA 5BX0A 1LPUA 3QUDA 3BHYA 4EHVA 2YJRA 4B99A 3FSKA 3NUYA 1UKIA 4F7SA 4YSJA 5J95A 4I92A 3COIA 3CLYA 5CEQA 2H6DA 2JLDA 4BTJA 4FV6A 4YR8A 1ZOEA 3HAVA 5L8LA 1YQJA 3RK9A 3R63A 5JT2A 3JY0A 2Q0NA 4OW8A 3P78A 3GNIB 3NVMB 4M8TA 5L8KA 3PIXA 3FC2A 1SZMA 1KWPA 3OY1A 2IWIA 4IAYA 3W2QA 1P2AA 1QPCA 3DBEA 2WOTA 3Q4UA 3EN5A 2GNLA 5LVMA 3KRXA 4GIIA 1PKGA 4NM7A 5JSMA 3MI9A 3BE2A 3Q9ZA 1FGIA 4AA5A 3MFUA 3PDTA 5BVOA 2XNNA 4IWDA 4RIWB 2GDOA 4RFMA 1G5SA 3IKAA 3KULA 2V5QA 3R22A 1UU3A 5E8TA 1IEPA 1YI4A 2PZPA 3COMA 4GT3A 4YMJA 5KBQA 3H4JA 4G6LA 4H36A 1GIJA 2BR1A 4HZSA 3I7CA 1ZYCA 4L8MA 4FG8A 2O0UA 4FIFA 4I1ZA 5IA1A 2IPXA 4Z7HA 2W4OA 4D9TA 4ASXA 5BUEA 1OKZA 4CKIA 4BDIA 4QMOA 4EOQA 2YERA 4FNYA 4YHTA 1P4FA 3L8SA 4X2KA 2W99B 3PJ8A 4CD0A 1OIUA 4NM0A 3IO7A 2X8EA 5HICA 5BMMA 4K18A 3TWJA 4YZBA 3R1QA 3O50A 5E91A 4FKUA 4FNWA 5K9IA 3V5JA 5I3RA 2R3MA 3ORLA 4HCUA 4OTDA 4CKRA 3BCEA 5CASA 4M97A 2PK9A 4XV9A 3SG8A 4FV0A 3PP0A 4EOOA 4FV8A 4EWHA 3C0IA 4X2JA 2YM5A 4GUEA 5FGKA 3WYYA 4DLIA 4EH8A 1Y8YA 5CAUA 5HG9A 2OH0E 2OW3A 2XAOA 3ZSHA 2C0IA 2J0LA 2Y4PA 3BQRA 3QCXA 5TR6A 3Q60A 3EQRA 4UMPA 4ANNA 3W0RA 4UZDA 4WG5A 4MXAA 3TI1A 4BI2A 4FTJA 5HEZA 2FUMA 3II5A 3UIMA 2RIOA 2YM6A 4PPAA 4W4VA 5AJQA 3LFNA 5D9HA 3A8XA 3A99A 1DAWA 3DV3A 5F4NA 2X6DA 5KBRA 2G15A 3UZRA 3I5ZA 5K5XA 3VBXA 5C1QB 3NFFB 3GI3A 3P5JC 1TZDA 4AW0A 4CTCA 3PVGA 5IQBA 3NEWA 4QDEA 3H10A 2QR8A 3F69A 2R0IA 3VUGA 4B8MA 2W17A 4AFEA 4IWQA 4RIYA 1R3CA 1JQHA 4OAVB 4GKIA 4GK3A 3SA0A 2HY0A 5FEDA 4AN9A 2FVDA 4AA0A 2ITNA 4FBXA 4CGAA 1W7HA 3S0OA 4HGSA 2YZLA 4IBMA 4O82A 4MTAA 4XP3A 5ANJA 3FXXA 2ZMCA 5M07A 5E8SA 2VTJA 3EMGA 3OTVA 3PA5A 4I20A 5DT0A 3CY3A 4E6CA 4YJNA 4G6OA 2XUUA 1FPUA 4YTHA 4OTQA 4IVAA 4DFNA 3FKLA 2JKQA 1OGUA 4AA4A 4IC7A 4CG8A 4TYEA 1NW1A 4W4YA 2ONLC 2ZB1A 4FIGA 1A48A 3E62A 4KABA 4PWNA 4XNEA 2O8YA 2BZHB 1KOBA 3NYNA 3O17A 2UZBA 4UV0A 5CT7A 2CLXA 4XV1A 4DN5A 4ZJJA 4LGGA 4OLIA 5CI7A 4IVDA 3KXXA 4UXQA 4PL3A 5CX9A 3ZM4A 4D2TA 4JRNA 4MF1A 4BDJA 3C5UA 4ZLZA 1J7UA 4RVLA 5G1XA 2GFCA 2HZIA 2OH4A 1Q8WA 3FJQE 3PXRA 4EHEA 3DOGA 5A9UA 2W1ZA 3WF6A 2RFDA 4NM5A 3DKFA 3E7VA 3TZMA 4BY9E 5DIAA 5IH4A 3R00A 3P1AA 4QP6A 4CZTA 5JRQA 5L8JA 1EH4A 3BHHA 4BYIA 3FQHA 4FT7A 1AD5A 2YCQA 5DE2A 3Q5ZA 5HKMA 5IA0A 3ALOA 4FSMA 3HLLA 5AM7A 4WNOA 4M15A 3RMFA 3VBTA 3UDBA 4P7EA 2WHBA 2WIHA 3IDCA 3OWPA 2QD9A 3VUIA 3LFBA 2DYLA 3MTLA 3NRMA 2YIXA 2QQ7A 3EKNA 1ZMWA 4Q9SA 3V8WA 1PY5A 2HXLA 3D5UA 4KRDA 3BHVA 3QWJA 3R1SA 3QYZA 2BUJA 4CLIA 5CU6A 3ZO3A 3OW3A 3CS9A 4JQ8A 2X9FA 4FI1A 4ACGA 4YJTA 1K9AA 3QD0A 3VUDA 1U59A 3U6JA 5C8NA 4AT4A 2Q83A 3NUAA 4YTFA 2RFSA 4L3PA 4C8BA 3UC4A 3ZEWA 2VTMA 5FM3A 5JN2A 3VNTA 2A27A 4RJ4A 5EOLA 5ANOA 1RDQE 3GU5A 1BI8A 2NP8A 3MFTA 3AT4A 1OL2A 3AD5A 4FSNA 4JBOA 4YJSA 4OTWA 4XUFA 2WD1A 3PRIA 4DGOA 2NNWB 4IAZA 3SKCA 1U54A 3CJGA 4FC0A 3TNHA 3VS7A 4AGWA 3OBJA 4FSWA 2CKOA 1ZOHA 3HL7A 1R0PA 4O27B 4BGGA 2PPQA 2UZOA 3LCDA 5CWZA 3NCGA 3KF7A 3VUHA 1Q8ZA 3E8DA 5L2WA 4DLJA 1H1SA 2WTCA 4GRBA 4F08A 3GFWA 3Q6UA 4K9YA 4NTTA 3RM6A 3R0TA 3TNIA 1R0EA 1YWVA 2CSNA 4A9RA 4UX9A 3O5AA 1SMHA 1WBPA 2GTMA 4Y72A 3IGOA 5HZNA 3D2IA 3FLYA 5AEPA 3F5GA 3CBLA 1UNHA 3GC9A 2BROA 4PP7A 5AADA 4EH5A 1O9UA 5HNGA 5CSPA 3CIKA 1OKVA 4DEAA 2FB8A 4CFUA 4E3CA 3DBCA 3R28A 4GK2A 4X2GA 4H1MA 3TZ8A 2GNGA 4FKGA 2W1IA 5AX3A 1YHWA 3SG9A 2NRUA 3PY1A 1J1CA 1Q41A 2X6EA 4GSBA 4QMMA 3N9XA 4EH2A 5HTBA 2IVVA 4UB7A 4R7BA 4AXDA 4QMSA 3QQKA 2XBJA 2X7GA 4LV8A 1ZMUA 3WIGA 3VS1A 5BPYA 4ZS0A 2YIYA 4QMTA 4QT1A 3FL4A 4B8LA 3UBDA 3FMKA 3F2AA 4PX6A 4ZJVA 2CGWA 4H58A 4JR7A 1LUFA 3HDNA 5EDQA 2R3QA 3C4ZA 3MA6A 3R7UA 3RALA 4KD1A 2G9XA 3QU0A 4CZYB 4DH8A 5BVEA 5IZFA 3LMIA 4L43A 5TT7A 5IA2A 4E4XA 3KXNA 2YITA 4BJJA 2C3JA 2XIRA 4UEUA 4DAWA 2WMUA 1YOMA 3DY7A 5FTQA 3COKA 3I0OA 2BTRA 4FL2A 5HD4A 3BL7A 5HNIX 3ORMA 3DJ5A 3EHAA 3Q4CA 2ITZA 2PVLA 5J9ZA 3GCUA 2Z7QA 1UNGA 3EYHA 5HVYA 1W82A 2WMQA 3Q9XA 2WMXA 4C02A 3TDVA 3ZS5A 2F2CB 4AZVA 3WF7A 2PHKA 4Y5QA 4CYJA 3ZLWA 3PA4A 3AKKA 2PULA 2GFSA 4YZDA 4F63A 5BNJA 5CEKA 3KKVA 3ROCA 3D4QA 1F0QA 4WOVA 3TT0A 3VBVA 2X0QA 3ENHA 4DFYA 4DFXE 2YJSA 4K1BA 4MQ1A 4K0YA 3D5XA 3ULZA 3OFMA 5E8ZA 3A2CA 3MPAA 4GL9A 2J0IA 4NU1A 5C9CA 3R9OA 3RAKA 3VBWA 4QP9A 4EZ7A 3BV2A 2YCSA 3LMHA 1Z5MA 1YHVA 2R3HA 4ZZOA 3E3BX 3DU8A 5EOBA 3VJNA 3G51A 4ALUA 1O6YA 5AP3A 1TQPA 3FY0A 4Y5HA 2ZM1A 4YHJA 4FKSA 2W05A 5IMEA 2OFVA 4WSQA 4BBEA 1Z9XA 3S95A 4DG0E 4IZ7A 2W5HA 4QMVA 4QYHA 1I09A 3Q52A 4FV9A 4IFCA 3QQHA 1OIYA 3EN7A 5F9EA 2G01A 3FHIA 3OCSA 3Q9YA 4MXOA 1NXKA 5E4HA 3TUCA 5HCXA 4YZ9A 3ORTA 3HP5A 1KE8A 3LOKA 5FD2A 5HORA 3V01A 2RSVA 2WMWA 3FE3A 3DAJA 1WBWA 4C3FA 4BCFA 3RBWA 4GKHA 4YLJA 2HW6A 1W2CA 4NZWB 1IA9A 3QXPA 1IASA 3Q2MA 3AD6A 4JX7A 4YZNA 5D7AA 3LM0A 5DLSA 4JRVA 3A60A 3CD8A 3FYJX 4O1PA 3EOCA 5ANEA 3ZLYA 4EH7A 5M08A 4HGEA 4J71A 4V04A 4EL9A 3P9JA 5C26A 2VTNA 2JEDA 4O91A 3FHRA 5BUJA 3NUUA 3PPJA 3QGWA 3TN8A 1Q3WA 4KBKA 2VGPA 4NCTA 5HBHA 2QVSE 4RZVA 3EKKA 3QTWA 1NA7A 2OF2A 4QRCA 2XNGA 1OL1A 3JR1A 3LE6A 5CU4A 1ERKA 3U55A 4UWYA 5HCZA 2GHLA 3HNGA 1M2RA 4Y85A 4NFMA 3W0MA 3A4OX 3QRIA 3ML1A 1PF8A 2ZVAA 3P7AA 4I6HA 3DBDA 4M66A 5JFSA 4FRFA 5AAGA 3IDPA 2XNMA 4I0TA 4L01A 4RJ6A 3F6XA 4L52A 4YLKA 2A4LA 1B38A 2R3JA 3QRUA 5KMLA 2ZV2A 1PMVA 3GP0A 2W96B 3S3IA 2BFXA 2DS1A 2B7AA 4IB3A 5E1EA 2X4FA 3KREA 3LAUA 4JNWA 3SGCA 4RVMA 1FMKA 4ZTQA 1PKDA 3ZU7A 4EK3A 4AE9A 3OWKA 3LPBA 4G5PA 3VS0A 3HMIA 2OU7A 4N6YA 4WA9A 3HMPA 4DFBA 3LXPA 3QA8A 4YJPA 4C0TA 3RP9A 3PIYA 4GCJA 3MY0A 5B0XA 1DI8A 5KE0A 1XMMA 2E2BA 5FDXA 5M55A 2BDJA 2JGZA 3GU4A 3O0GA 4FSUA 4YNOA 2YZAA 1MRVA 3SC1A 3TV7A 4L7SA 3V04A 4BGHA 2R3PA 3G9NA 5BVKA 1KV2A 4F64A 1M17A 5L2IA 3TZ9A 1L8TA 2AEGA 4C2VA 4CT2A 2JIUA 3PE1A 5FBOA 5I9XA 5K0XA 2CJMA 5BYZA 3P08A 3DBFA 3VAPA 1OPLA 5M4IA 4F7JA 3I1AA 3BBWA 3C1XA 5DPVA 3RWPA 4E93A 3L9NA 4EQCA 4HNFA 4KIKA 5CSWA 3PXYA 1NVQA 3R2BA 1QCFA 3UC3A 2R3RA 3QRJA 4W4WA 1H1PA 5DFPA 4A4LA 3PVUA 3D83A 2VGOA 3ZONA 3NYXA 4CG9A 1IRKA 3OXZA 5E8YA 2IW9A 3SOCA 3NIEA 3EWHA 3QLGA 1OMWA 4RQVA 5ETAA 4IMYA 1H1WA 4UALA 3ZZWA 3NW6A 4A9YA 2OXYA 2BIYA 5HESA 4PDYA 5JK3A 4FKOA 3VBYA 3VIDA 1J3HA 2BAKA 4OUCA 2VUWA 4WNPA 3EQDA 3W2OA 1G3NA 1ZXEA 3DK6A 4FV7A 2ACXA 1AGWA 5M53A 4YSMA 5IUGA 2O65A 1NVSA 3GT8A 3LJ1A 2ITWA 4KS7A 4U3YA 4MEDA 4I3ZA 4F4PA 3F82A 5ANKA 2QOIA 2PTKA 3HMMA 2RG6A 3PE2A 1P5EA 3WZEA 1G8AA 2OBJA 4B7TA 2QU5A 2QCSA 4RX8A 4JDHA 4ZP5A 4ZZNA 4F9YA 3ORNA 3CC6A 4DEIA 5HG5A 1GZKA 4Q9ZA 5DRBA 4FUXA 4GFGA 4IAIA 3UYTA 3I0QA 3OOMA 1OIRA 4MF0A 5AP7A 3QUEA 1CDKA 4QP3A 2WTKB 2ZV9A 1LR4A 4FR4A 4KAOA 1U4DA 4WRSA 2F57A 5CY3A 1YXTA 3V5PA 2XMYA 4OAUC 2YIQA 2OIBA 1UA2A 3S00A 2I0YA 3NFGB 2C3LA 2VTTA 2ZFYA 3FSFA 4UMTA 4KKGA 4L68A 4UWCA 4V01A 4YP8A 3W2SA 3DAKA 3L8XA 1YWRA 4QNYA 2YABA 4RGJA 1O6LA 1Y57A 3OCBA 3OT3A 4KINA 4XG8A 4AF3A 4DTAA 3NCZA 2WELA 2EVAA 4F99A 2Z60A 4NIFA 4BZNA 2WOUA 5KMNA 2ETRA 4EK6A 1FVTA 3GC7A 5AP5A 3RVGA 4ARKA 4HYHA 5HVJA 2XK6A 4OT5A 4JIKA 2QOFA 1XBAA 4NW6A 3R8UA 4X3FA 3JXWA 4YGAA 3U87A 4F6SA 3V8TA 2VNYA 5GZAA 5EW8A 2XEZA 4BBFA 4ITHA 1JKLA 2R7IA 3F88A 5KO1A 5M4FA 2BTSA 3GC0A 5HO6A 3N4UA 4FZ6A 3G6GA 3PJ3A 5BYYA 5CSXA 3NMUF 4KBCA 4CFVA 3HGKA 3DK3A 1QPDA 3HX4A 4XLVA 1APME 4EI4A 4NSTA 4HW7A 4EOLA 4TPTA 3U6HA 2X81A 2C5VA 3FLZA 4A07A 3RNYA 3P23A 4L44A 4X7QA 3UDTA 2DWBA 5H3QA 3GCVA 3C0HA 4QNAA 1Q97A 4DGNA 4MCVA 4CFNA 3BYUA 4I23A 3KA0A 4HGTA 2GQRA 3C50A 4FSYA 2XM9A 4PNKA 5HU3A 3MH1A 5A4CA 4CNHA 1K3AA 3BYMA 5JGBA 3SW7A 2G2HA 4GVJA 4LMNA 4MHAA 5CANA 4JAJA 3ULIA 3ZC5A 3KXMA 3R04A 4RBLA 3KVXA 3N4TA 3UO4A 4TNDA 5HHWA 1JLUE 5EDPA 5EYMA 4TN6A 5FEEA 4F0GA 3BLAA 2QNJA 4XBUA 4BDAA 2YCRA 4C34A 3F66A 4BCIA 3CY2A 4ZLYA 3E92A 2YWVA 4FZ7A 1M14A 2B9HA 4R7IA 3CE3A 3BGQA 2WMVA 3WILA 5L2TA 4DHIB 3AC8A 5M06A 4M0YA 4I41A 4YZMA 3O8TA 3ZBFA 2IZSA 4W4XA 3L9PA 2IVSA 2GHMA 5J8IA 5AV4A 4XJ0A 4FVPA 3OVVA 5EKNA 4MXZA 3F3ZA 3PVBA 4F1OA 5GINE 1ZOGA 3R7VA 3G90X 4GYIA 3IW8A 3QC4A 4BC6A 4IAFA 4ENXA 3WARA 4HOKA 2CN8A 4FMQA 4W9XA 3Q4TA 3UGCA 2UZWE 2Z7LA 3OD6X 2VX0A 3QKLA 3VF8A 3HVCA 4DFUA 1WBSA 3V5LA 1IA8A 2XIZA 2PVNA 3PIZA 4BCQA 3W18A 2PVJA 1H24A 1R78A 1OB3A 3H0YA 3JVRA 3Q53A 5CNNA 4BDHA 4QMWA 2UVXA 4EBWA 5HBJA 2FH9A 2YM7A 3PVWA 4H1JA 4JG7A 4YU2A 4RWIA 3NYVA 4AG8A 4I5MA 2J5EA 4HVSA 3B8QA 2BRMA 2GS7A 4C33A 4CCUA 2CNVA 5H8BA 4EC8A 1W0XC 5M57A 3RM7A 1XBBA 2QOLA 2VTSA 2E9UA 3VW8A 5CZHA 4M68A 2I0VA 2VO7A 4R7HA 5A3XA 3QBNA 3RPYA 5L4QA 4O7LA 3EQIA 2WQOA 4D9UA 4D4RA 2BHEA 1W2DA 3DB6A 2W0JA 2XZSA 3QQJA 3FXWA 4MD8E 5EDRA 4CEGA 2I6LA 2IN6A 5ANDA 1W8CA 2NRYA 2XNPA 4IIRA 5AP4A 1OVEA 3PPKA 4G31A 2UZDA 1YVJA 2IVUA 2XNOA 4DA5A 4QMYA 5CVFA 2C5YA 4WUNA 1RE8A 4DH5A 3TNQB 2X39A 3CQEA 5M4UA 3ORPA 3R8PA 4NKSA 2W5BA 4DYMA 3UP2A 2JDRA 3PUFC 3GCQA 4UMQA 4O0SA 4C3RA 3F5UA 3SDJA 1PXIA 3Q5IA 2IO6A 4F9BA 2F7EE 4FODA 3MVHA 2C1BA 3F3VA 4TL0A 4CRSA 1WBOA 4IM0A 2GNIA 4QPMA 4J7BA 2UZUE 5EYCA 4A9TA 3QLFA 4R78A 5F1ZA