2OSCA

Synthesis, structural analysis, and sar studies of triazine derivatives as potent, selective tie-2 inhibitors
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
255
Chain Sequence
QVLKARIMDAAIKRMKKDDHRDFAGELEVLCKLGHHPNIINLLGACEHYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Synthesis, structural analysis, and SAR studies of triazine derivatives as potent, selective Tie-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 255
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oscA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oscA01
4K1BA 3AQVA 1Y8YA 4C4FA 1OKVA 3E3BX 1IR3A 5E92A 2WMWA 3D7TA 5KZIA 4IE9A 5TE0A 3OF0A 5DVRA 3I0QA 4GJ2A 1GIHA 1VYWA 3D5XA 3UDBA 4XNEA 2A27A 4D4YA 2E9UA 2XEZA 4GU9A 3RK9A 2YJSA 2BAJA 4RLLA 4K9YA 3TI1A 3ID6C 3EN9A 3GGFA 1GIIA 3EQPA 3QXOA 4BDFA 4F7JA 2OKRA 2R4BA 2PUIA 2YM3A 1PYXA 4C4HA 3C9WA 3TIYA 4MK0A 4O6EA 1REJA 2B7AA 4MTAA 4HOKA 2JDTA 4PUZA 3WYXA 2R7IA 4DGLC 1MP8A 1OIQA 2VTQA 2W1IA 3HV7A 3KF4A 4FSTA 3LFAA 4WO5A 3FY2A 5DPVA 4C37A 4QMXA 3PZHA 3IW6A 4P7EA 4F0IA 5J9ZA 4O0VA 2RFDA 1M2RA 3BYOA 2A2AA 4UMTA 4ANMA 2W05A 4DEGA 4DH5A 3R9OA 4PPAA 2F57A 2WMTA 1DI8A 2HZNA 4F9BA 5E91A 3SVVA 3QD2B 3HMNA 4L9IA 2DWBA 3K54A 5AP6A 2C30A 4ASDA 2IPXA 3MFTA 2YDKA 3MB6A 4UV0A 3U9CA 5DOSA 4TRLA 4C4GA 2BRNA 2HW7A 4FBXA 2OI4X 5IH5A 4NTSA 3LCKA 4GCJA 1WBNA 2IW9A 3SKCA 4EOPA 4UWYA 3K5UA 5BVOA 5HX6A 2IVTA 3FV8A 4RJ6A 3RM7A 5L8LA 3BRBA 4RWKA 5J9LA 1IG1A 3DBEA 4O0SA 4RFZA 4UYNA 3RJCA 5IZFA 4ZY4A 4TKSA 5ACBC 2VD5A 5GINE 5IQEA 2BTRA 3A8XA 5CEKA 5LWNA 5FEDA 2QLQA 4RC3A 3NYVA 3UE4A 1Z57A 4AA5A 4MBJA 5EH0A 4BDJA 4QNYA 4DGNA 4IBMA 3UIMA 5AAGA 2KTYA 3KXHA 2YCRA 3BYVA 4FVRA 4BDIA 1OBDA 5AUZA 3D5WA 2R3QA 4YNEA 3IG7A 4FK3A 5I3OA 4I92A 4BDBA 4DGOA 3V3VA 2AC5A 4WOVA 5KZ0A 1GZOA 2VWVA 4H1MA 4IVBA 4MXAA 3RWQA 4WUAA 2YCSA 4QMLA 1PY5A 2E9VA 1LUFA 1OL2A 4TNDA 1PW2A 3R7UA 1ZOGA 3EFLA 4FODA 3F66A 3S4QA 4I6FA 4CZYB 2FSTX 2YM5A 5LWMA 5GZ8A 2J4ZA 3KULA 4RC4A 4ZXTA 4X0MA 4X2NA 5B2MA 5HX8A 4D1ZA 5HEZA 5HE2A 2I0EA 2VX0A 4BI2A 3F5PA 4I4FA 5AR8A 3WE8A 1WVWA 1W0XC 1QL6A 3CY2A 3CC6A 1WBPA 5F1ZA 4ZTSA 5ETFA 1Q99A 1R0PA 2WO6A 3KVXA 5DRBA 3TDWA 2P2HA 3VS2A 4XOZA 4C0TA 4EC8A 3R7GA 3KC3A 4CFMA 4JJRA 4PL5A 5FXQA 1PMNA 1RQQA 5AUTA 3GC7A 3QQGA 4X6QC 4R5SA 4F1OA 4CFNA 1JSUA 2BCJA 4IZYA 4TTHB 2NNWB 3ERKA 5DR2A 2XKDA 2PY3A 3PVUA 2CHLA 3VNTA 3JR1A 1NVQA 2C68A 4WBOA 4FEWA 2C3IB 3EOCA 4ALVA 1Q61A 4ALWA 5E90A 3ULZA 2X4FA 2J0KA 2W5BA 4QP9A 4RA4A 1ZOEA 2UVZA 2YM7A 4L7SA 4LI5A 1VJYA 2UW8A 4E5BA 3GFEA 4D1SA 2Z8CA 4DCEA 3KB7A 1XH5A 3BEAA 2BAQA 3PZEA 3QC9A 4GJ3A 4YZCA 3ZBXA 3C4CA 2W9ZB 3ENMA 4HCUA 4PV0A 2Y4IC 1ZRZA 4FL3A 5IDNA 5C01A 3Q2JA 3CTHA 4FIGA 4GVAA 2E9PA 3AMAA 1UU8A 5LCJA 3QXPA 4OR5A 3LFNA 3SW7A 2BALA 4PRJA 2UZNA 2R2PA 3VUGA 4H3BA 3CXWA 1XH6A 5HGIA 2C69A 2X8EA 4CMTA 4RIWB 4UBAA 3TDVA 2W5AA 3LMGA 4OBQA 3PUPA 4BN1A 2OXXA 4A9RA 4LOPA 1IEPA 1OKYA 4QRCA 4YTHA 1Q5KA 1YWNA 2V7OA 3EKNA 3OEFX 4BGGA 2CGUA 4AE6A 5I9VA 3FKNA 4AN2A 2WQOA 4FSQA 4BKJA 1PRYA 4RT7A 3OT8A 3PJCA 5CU4A 3QUDA 3HDMA 4JX7A 5AV1A 4APPA 3UPZA 4PWNA 2HZIA 1M52A 4KIPA 4F6SA 4C3RA 3U51A 2CN5A 2R0UA 4YNOA 3NEWA 3DK7A 3HAVA 2HZ0A 4TYHA 2JIIA 3IGGA 5JMSA 3U54A 3HVCA 2G2FA 4Y5QA 4OTDA 4F64A 1M17A 5M4IA 3MPAA 2YIQA 2VGOA 5HD4A 4ZSJA 4ZTMA 3PLAE 4B99A 5KHXA 1JBPE 3QKKA 1FMOE 3QX2A 5KHWA 2XS0A 5IA1A 1M14A 1VYZA 4CT1A 2QCSA 4GT5A 1H1SA 2BUJA 3UC4A 2B9HA 4YC6A 3GXLA 4C38A 2KULA 4O83A 2J2IB 3QWJA 4QQ5A 4YHFA 4Y72A 4AX8A 3OW4A 2W4KA 4JVGA 3TUBA 3GC0A 4G6OA 3SW4A 1YDRE 2X6DA 3VIDA 3VW8A 4C35A 3KCFA 4FKSA 2BHHA 5DR6A 2VWZA 2IJMA 5ANGA 4AT3A 3LFSA 3NLBA 4J1RA 4LGDA 4FF8A 4OTWA 4FK6A 1YQJA 5C8MA 3HX4A 3K2LA 3EN6A 4EKLA 3CY3A 4WT6A 3KXMA 4MF1A 3BHTA 4KNBA 2WMSA 3V01A 4ZLYA 2YCQA 3HRBA 4DG2E 3DB8A 1PHKA 3HUBA 3SXRA 2Y7JA 4UWBA 5AP2A 2WHBA 3F5UA 2R3FA 3DKFA 1YXTA 3DJ6A 4DGGA 1O6KA 3P78A 3SAYA 3F2NA 5CF4A 3O50A 3ZSIA 2UZWE 2QOKA 3R7EA 4F99A 5A4LA 4FV4A 4QMSA 2WMRA 4K8AA 4MYGA 3OUNB 1YHVA 4YBKA 5HCZA 3ZUUA 4A4XA 4AU8A 4M69B 2BFYA 3AT4A 2H96A 2ERKA 2GTMA 3I79A 3JXWA 5FDPA 5JQ5A 3NX8A 3N9XA 4EYJA 2UZVA 5J9YA 4W4WA 4BDAA 3V04A 4G3CA 2QI8A 3BKBA 2PZRA 2J5EA 1F0QA 3BI6A 2UZTA 5D7AA 4IMYA 3FLZA 3DKOA 2IZRA 2O5KA 4PTGA 2OSCA 4QQCA 5AV3A 4EC9A 5JEBA 1ZMUA 4W4YA 2B55A 3Q2MA 3CKXA 3ANQA 3ZUVA 1XO2B 1QCFA 3R1SA 4LFIA 3CJFA 2JDRA 4YTFA 3FUPA 4KIQA 3FQHA 3QD3A 4AFEA 3AGLA 4RZVA 4YZ9A 2YIWA 3S2PA 3TTIA 4CLIA 5AX3A 3IOKA 5E8WA 1H00A 5DE2A 1PF8A 1O6LA 3OG7A 2WNTA 4MWIA 5EKOA 4U6RA 3K3IA 3TL8A 2X39A 1W83A 3SRVB 1UU7A 2XCKA 1O6YA 3TZ9A 4ENXA 2ZB0A 4PTCA 2HY81 5H8GA 4ZZMA 4CYIA 3BYMA 3R1QA 5JRSA 1TKIA 1UV5A 3FZSA 4QTAA 3WF9A 3RCDA 3ORLA 4BKYA 5I9YA 2C6TA 3W2SA 1XR1A 3OHTA 1R0EA 4ONAA 1YVJA 4CGAA 4R8QA 3VWAA 4O1OA 4Y95A 3BELA 4Z7GA 5LOHA 1LPUA 4FTOA 4FTUA 2P33A 4KSPA 4P90A 4ASEA 1R1WA 1ZY4A 3UODA 1H07A 2BIYA 2B54A 2GQGA 5CI7A 2CMWA 2PZPA 4EQCA 3TT0A 1K3AA 3E62A 4O7WA 3FMNA 3N51A 4PP9A 5M06A 5EYDA 4EEVA 3PG3A 2VWIA 3AT3A 4PPCA 3Q4UA 4J7BA 4IVCA 3UO4A 1R39A 5E4HA 4QMNA 1H4LA 4LL0A 2OH4A 5CSVA 1BX6A 3GFWA 3VUKA 2QOOA 4RGJA 3IKAA 2GSFA 2X4ZA 1SVEA 2R5TA 5GIOE 2QHNA 3BCEA 3T8OA 3FMLA 2GQSA 4A9UA 1V1KA 2GS6A 4P2KA 5H8EA 2UV2A 2BDFA 2X2KA 2UW9A 3C4XA 4X3FB 3UOJA 4MAOA 2QOQA 5AEPA 2JKQA 2WMAA 2W0JA 4WKQA 5LVLA 4D55A 3LMIA 4BCJA 3ZLXA 2EXEA 3LW0A 1H25A 3IOPA 3KRJA 5CT7A 2HXLA 2IG7A 4DINA 4FTMA 2HW6A 2CNUA 1S9IA 4BYIA 4IX6A 5KUPA 3DZOA 3ROCA 3MY5A 1T46A 2QLUA 4R1VA 3T3UA 2PMIA 3H4JA 3W2CA 5FBOA 2OJGA 2JC6A 4C4IA 2ETMA 3FY0A 3AMYA 2ZDUA 5CAQA 2XM9A 3HYHA 3OT3A 4S30A 3M2WA 5AUWA 3V5JA 5LVMA 2F9GA 2VUWA 1JWHA 2QONA 3QHRA 3F82A 4DEDA 2C6IA 4PDPA 4AW5A 4CFUA 5CEMA 2XM8A 3D9VA 4GIIA 3E8CA 3KN6A 4QMOA 5CAPA 1QPJA 4FV9A 2FUMA 4O7YA 4ACCA 5EQYA 3HMPA 4ZIMA 3VS4A 4NUSA 3TEIA 1U54A 4DLJA 3P0MA 3BLHA 3KXZA 3GOPA 1OKWA 1ZZ2A 5HTIA 3MPMA 4WNKA 1J7LA 1JLUE 4HZRA 1UKIA 1YHSA 2GFCA 2QNJA 3KRRA 3PLSA 3UO6A 1UWJA 2VTMA 5H8BA 5AAFA 1NVSA 3NGAA 5A3XA 4QOXA 2W9FB 1H26A 3C13A 4DFNA 2R3HA 3DDQA 5DT4A 4HVIA 1OM1A 4G6NA 4BHNA 4Z55A 4GYGA 4K18A 2HELA 3QRIA 4EK5A 3TM0A 4QYEA 3Q3BA 4UMPA 4JLCA 5HBJA 5I9UA 1KV1A 4JBPA 1Q97A 4O7ZA 2XNMA 4R3PA 2WELA 3OWJA 4R7BA 4QMPA 2CCHA 2R3IA 1OITA 3EL8A 3QQFA 5FQDC 3LFDA 2X8DA 3UTOA 4YJPA 1B38A 3E93A 2XRUA 3I81A 4FIEA 3DU8A 2PMNX 1YOLA 3CD8A 4DT9A 4FKIA 5DNRA 5HBEA 3NYOA 2WGJA 3ZEPA 4BIDA 4D2VA 2EWAA 3QZGA 5LJJA 1YOJA 5CU6A 1OPJA 3H9OA 1Z9XA 2VTRA 4YZDA 2Q83A 2ZMCA 3I7BA 5F95A 3WBLA 4ZSLA 4CT2A 5HU9A 5IEYA 2O3PA 4EOJA 4USFA 4FOCA 3UP2A 1KE5A 4HCTA 4M15A 2C0OA 4ANQA 5FM2A 1YXVA 5AA9A 4I22A 3VW6A 3KA0A 5IA3A 3PJ8A 2ETRA 4PNIA 5C8KA 4IVDA 5DYJA 3ORNA 4PL4A 3WYYA 4AN9A 2RG5A 4C02A 4EOLA 3OMVA 4BWKA 2WAJA 2B52A 2XEYA 5EHOA 3W2PA 4FZ7A 4O96A 5K5NA 3DPKA 2W96B 3ORPA 2FH9A 3WIGA 2B1PA 1GY3A 3MWUA 3NR9A 3PSDA 4BDGA 2HAKA 3A2CA 4HVDA 3UPXA 4ZS0A 1PXOA 4JXFA 3QTWA 4OW8A 3ENHA 2O8YA 3C50A 3QTRA 4P5ZA 4QP6A 1U4DA 3PVWA 4IB0A 5EW9A 2ITOA 3I6WA 2UW4A 4FT0A 1R78A 4JBVA 2IZUA 4EORA 1WVXA 3DJ7A 4MKCA 4MXOA 1OI9A 2OFVA 3VO3A 3ORZA 4C34A 3ZLYA 5E7RA 3WZUA 3AT2A 5EQEA 5E8YA 5HIEA 4NTTA 2OJJA 4OBOA 3EQBA 3VBVA 1FVVA 4CFFA 4FV2A 3GP0A 4QP4A 1OPKA 3HAMA 4KRDA 5IH4A 1GZ8A 4YTCA 2H6DA 3TKUA 3TZ8A 4OLIA 3MH1A 5CAOA 2C0TA 2VO0A 3LQ5A 2UZBA 3QHWA 1P5EA 1H27A 3OP5A 3P9JA 3NSZA 5EHYA 4AN3A 2YM4A 3JY9A 1A48A 3R73A 1JKTA 2J51A 3FQEA 5I9XA 1IASA 4NKAA 3FKOA 4RJ7A 3V6RA 4Q5EA 5M08A 1SYKA 3HGKA 4DFLA 5FDXA 3RNYA 3ACJA 5A54A 4QP7A 2YIYA 4BYJA 5J7BA 3L8XA 1SNUA 2XKFA 3PY3A 1GZKA 1MQ4A 4D9UA 5KMIA 5L2IA 5J8IA 4TZRA 2DUVA 2ITZA 2J50A 1BI7A 2W1DA 3QU0A 2BRBA 2F2UA 3IECA 4IX3A 2YEXA 4UMRA 5E9EA 4PTEA 2XIKA 3GCSA 5A46A 4J95A 4GRBA 2CGVA 3PE2A 3T9TA 4Z3VA 4QTEA 4FVPA 3OXTA 1FQ1B 2HOGA 1HOWA 2BZIB 4WG4A 5K0KA 4FA2A 2JIVA 3EN7A 4U45A 2GFSA 4FGBA 4S31A 3TG1A 5FG8A 1OGUA 3UBDA 1YXSA 2PMLX 4NU1A 3DNEA 3R8ZA 2VV9A 2RGPA 5D10A 2IZSA 2QU6A 5CF5A 2OW3A 3BBWA 5HLPA 2PVNA 3FI4A 2V0DA 4FG7A 4WG3A 4TL0A 3KRLA 4A4LA 3ET7A 4FSRA 2PE2A 3SHEA 2BRHA 4YLLA 3TNWA 1URCA 2HWOA 4BRXA 4MNFA 4LV5A 4O0WA 4IADA 4G5PA 3BIZA 1OL1A 4KB8A 3NYNA 4Q9SA 4FT9A 4CTBA 5CF8A 2EB2A 5BVEA 4EYMA 5HTCA 3DK6A 5CENA 2RL5A 5J95A 2CKPA 3F5GA 4BTMA 2W1CA 1OIYA 4YUQA 3DJ5A 4FC0A 1SNXA 4PL3A 4ZY6A 3OW3A 1V0BA 3SQQA 2J0JA 3F3ZA 3GT8A 5IKWA 5AIKA 5GIPE 4FTIA 3HEGA 3NNXA 3QQLA 3GUBA 4FSWA 3SOAA 4AF3A 3W1FA 2X2MA 1ZOHA 2C0IA 2LAVA 4BDKA 2FVDA 4HVGA 5IMXA 3Q53A 5AUUA 2XNBA 4BDHA 4O86A 2JIUA 4MXZA 4CFXA 3LZBA 3RZFA 2OJ9A 1ZYLA 2AUHA 4HYSA 4RJ5A 3MJ2A 3VAPA 3OZ6A 2P4IA 4AZEA 1FGIA 5JN2A 2FO0A 2YA9A 2ZVAA 4E4MA 3TJDA 2VWUA 1H1WA 4YZMA 2C5XA 4R3RA 2FSMX 3PRIA 2VO3A 3PXKA 2WZJA 4A07A 5HKMA 3UMXA 4FSUA 4CNHA 4ITJA 4A06A 3F5XA 1XH9A 3EL7A 4GG7A 2FSOX 5AM6A 3FEGA 2NRUA 1ZARA 3GEQA 3PXQA 3QF9A 3RMFA 3UOLA 1J7IA 4CKRA 4BCMA 3H10A 3GU5A 4X2JA 5CNNA 4D2SA 2XJ0A 4AZTA 2UW5A 3GU8A 1H28A 3NUSA 2Z2WA 5L2TA 2VO7A 4YMJA 3NIZA 5IISA 4FTLA 1NY3A 1L3RE 4U41A 4D5KA 3ZONA 1WBOA 4NCTA 3DK3A 2CNQA 4G9CA 2XB7A 3RAIA 4IM2A 2CKEA 1QPDA 2V5QA 5IQIA 4NZWB 3DQWA 2I1MA 5CQUA 2W7XA 5L6WL 5M57A 4ORKA 3CBLA 4JG7A 5E8XA 3GU4A 3VHKA 4AT4A 2GNIA 4M97A 3R22A 4DTKA 3R9RA 4NIFA 1V0PA 3MB7A 4H3PA 2B53A 4B6LA 3CS9A 4BWXA 4YJOA 5FTOA 3QL8A 1WCCA 4JOAA 4O1PA 4FZAB 5DEWA 3OUKA 4AQCA 3ATSA 1QPEA 4YO4A 4WNOA 3CJGA 4YJRA 5HOAA 2WMXA 3HKOA 2R3NA 3NPCA 2VAGA 2XUUA 3COMA 4FKOA 4L43A 5FEQA 3V5TA 5DGZA 4N70A 4PDYA 5AP3A 4FV8A 4CFVA 4PX6A 3CE3A 3A4PA 3UVQA 4I5PA 4QPAA 3VBXA 2X81A 3LFEA 3ZS5A 4O38A 2IVVA 3O0GA 4C2WA 2ZMDA 4ZSGA 2EB3A 2X7GA 3QTIA 1FINA 4X3FC 3ZLSA 2Y8OA 3VBWA 3WZDA 4ZJVA 3V51A 4JG6A 4KIOA 5IQAA 4IJPA 4DEEA 4BCIA 1WVYA 3CTQA 4RWIA 1CKJA 1WFCA 4ZTRA 3ZXZA 4ANLA 3UQFA 3FLYA 5JFXA 5DR9A 2EU9A 2PVHA 3G0EA 2GHGA 1MRYA 4PDSA 4TYEA 2XK9A 3FSFA 3MFUA 3QLFA 4BIBA 4JT3A 3H9FA 2HXQA 4L8MA 3R9HA 3BGQA 4WG5A 2WQBA 1RW8A 2QVSE 5HCYA 4BDEA 4RIYB 2QOIA 4FSYA 4XG9A 3DY7A 3KXXA 4EOQA 4RJ3A 2A1AB 2JGZA 4R7IA 4CSVA 5ICPA 5TO8A 3G9NA 4QMTA 5CEOA 4ITIA 1M7QA 4UZHA 5EOBA 5FTGA 3QCSA 1H1RA 3LFQA 1HCLA 3OY1A 4FVQA 1H0VA 2UW0A 4FT7A 4MCVA 2XRWA 5CTPA 3Q96A 4TW9A 1ATPE 4E4XA 4YURA 2IZTA 2QOFA 3D7TB 3EQGA 3LFFA 4G6LA 5ANJA 5BVNA 3QD0A 4MHAA 5K0XA 3ZEWA 4Z7HA 5KMLA 4LUDA 4AA0A 3BHYA 2ESMA 2YIRA 3ELJA 2FA2A 4G3EA 4L3LA 2JEDA 4RJ4A 3I5NA 3FZRA 2VWBA 4V05A 3BEGA 5KO1A 3EYGA 4LG4A 2BDWA 4DLIA 3E64A 5HNGA 4ZS4A 5J1WA 2PK9A 4GK3A 4MQ2A 4ZP5A 4CZUA 5CEIA 4N0SA 4ANNA 3SC1A 4YZNA 1PJKA 3KK9A 3ZMMA 4DFZE 2PUNA 4BCKA 5E8UA 2ZB1A 5EM6A 3RPOA 2GCDA 2ZJWA 3AG9A 3C4FA 3COHA 5ITAA 5BYLA 3H3CA 4G1WA 4L3JA 3ROYA 3PIZA 3NW6A 2YERA 2X7FA 4FKRA 3O8UA 4M14A 4JDJA 1J1BA 1Y6BA 1DI9A 3UOKA 2WU7A 3POZA 3I1AA 2O63A 2XIXA 5A6NA 3F3VA 3GU7A 3NUUA 4KAOA 3QA8A 4TN6A 2PZYA 2W17A 4C7TA 3ZH8A 1OUKA 4JIAA 4P5QA 4F9AA 4O7TA 1WMKA 1QPCA 1PXIA 5FUTA 2J0MB 3VUIA 3WF7A 2PYWA 2FYSA 4EJ7A 2B9IA 2I0YA 2WU6A 4L7FA 4IWPA 5T68A 1DM2A 2XK8A 4U97A 3VRZA 5LMKA 3QGWA 2CKQA 2R3OA 5CSHA 4IACA 4PMMA 2JD5A 2JLDA 3MIAA 2ONLA 2YABA 4MVFA 2ACXA 3SG9A 2O64A 2C6OA 3NMUF 1PXJA 3ZC6A 1ZMVA 3R9DA 4EQMA 2PULA 4BCOA 4J8MA 1J91A 2PUUA 3QQUA 4JBQA 3I60A 3IK3A 2QD9A 5CS6A 3MVLA 4FKTA 3W2RA 5IQHA 4ERKA 4CYJA 4CRSA 2UW7A 2WEIA 4BBEA 4FNWA 2B9FA 4RVMA 3W10A 3COKA 3U6IA 4FG9A 3W2QA 2HIWA 2R7BA 5BNJA 3FLWA 4IH8A 4AP7A 4MX9A 4NWMA 4XV2A 3R8VA 5F94A 3R7YA 2XK7A 3UYSA 4ZSEA 4PQNA 1SVGA 3RBWA 4FEVA 3LFCA 4KIKA 4XV3A 4DF3A 2HYYA 2WMBA 4I6QA 4MXYA 3VF8A 5BUJA 3ORIA 3OWPA 2RFEA 3HMMA 1XH4A 3FYJX 3IQ7A 1PXLA 4L01A 2WXVA 2GPHA 4AZSA 4AACA 3IO7A 4M0ZA 2ITWA 3C5UA 3PPKA 5DT3A 3TV7A 5CAVA 2GQRA 4IFGA 2DS1A 5HG8A 1WAKA 3EIDA 2CDZA 2OF4A 3FZPA 3O8PA 3KULB 2WQNA 3BHHA 3UC3A 3CTJA 4QNAA 4RIOA 1OIUA 5L2SA 4PF4A 1T45A 4WD5A 3MBLA 4F7NA 2C1AA 2J6MA 5AMNA 2VN9A 1IA9A 2E9NA 2XF0A 4NM7A 4K33A 3QYZA 4PMTA 5LQFA 2BPMA 3CR0A 3UZPA 2X9EA 5CSWA 3GC9A 4EZ3A 2ZV2A 3UNJA 3W8QA 4OBPA 2GMXA 5J1VA 5LCKA 5DEYA 3BU6A 3D2KA 3QTZA 5L8JA 2PL0A 1ZXEA 4O2PA 3QRTA 3ZSHA 3VS5A 4E5WA 3HLLA 1Z5MA 3WZKA 4W4VA 3E63A 5H2UA 2QC6A 4FUYA 4Z9LA 5ANDA 2CGXA 2OICA 2VTPA 2GHMA 3HV5A 3AD6A 4YPSA 3AGMA 3QYWA 2GU8A 4JR7A 2B9JA 2BDJA 3F9NA 3P79A 4FR4A 4BI0A 3A99A 4F9CA 3DBQA 3Q9XA 3Q4CA 1SMHA 4LRMA 3DCVA 1WBTA 3R2YA 3A7JA 3O2MA 5L8KA 2PVRA 4UZDA 2G01A 4O0RA 3ORKA 3DFCB 2C3LA 2W1HA 3QZFA 1MQBA 3KCKA 3DKGA 4A9TA 4F65A 3E92A 3DBDA 3TIZA 4MXXA 2XNEA 3A7FA 1EH4A 1SM2A 2YLFA 4OTPA 3BV2A 2Y0AA 4FV5A 2R3GA 2XJ1A 4Y83A 3R04A 4EH3A 3E8NA 2UW3A 2JDSA 3PPZA 3QWKA 3IPHA 4RVLA 4S32A 4U5JA 2J5FA 1PKGA 2GDOA 2OH0E 4DT8A 4FKVA 3RALA 4JQ7A 2W06A 2YCFA 2I0VA 1CTPE 5AUYA 3ATTA 2C6KA 1U5RA 1YXUA 5CEPA 1Q8TA 2XNOA 3I6UA 4GUEA 4YHJA 2QOCA 3V8SA 2CSNA 3DOGA 2C1BA 3RPRA 3FLQA 2H8HA 2RG6A 2F4JA 4ZLOA 2A4LA 1Q3WA 3A4OX 3DT1A 3F61A 3DAJA 3KN5A 4EZ5A 3EQIA 3VVHA 5M07A 1VR2A 3NRMA 5AP1A 5ETCA 4AOIA 4TYHB 3GI3A 1XBCA 3WI6A 4IDTA 3PY0A 5BYZA 1XWSA 4IWDA 4JL9A 4FKLA 4MBIA 4MEDA 5HG5A 2O65A 2VX3A 3PVBA 4QMZA 4OTFA 4V0GA 4EUTA 3ITZA 1KWPA 4XX9A 5CT0A 2CLXA 2F49A 4XJ0A 3TZMA 3NCGA 3RTPA 3HA8A 3QRUA 3DV3A 1KSWA 4BCQA 2OK1A 4HGLA 4JAJA 4XYFA 2H34A 4RFMA 2YM8A 5FP5A 4ZMFA 2YFXA 3G6HA 4Q2AA 4OTGA 5KMKA 1REKA 5AM7A 4RQKA 2WEVA 4JIKA 4Q5HA 5DMZA 1ND4A 1BUHA 2XIYA 4O0TA 3LLTA 5BVKA 4JRNA 3RPVA 3BYSA 4FNXA 3PXFA 3KXNA 1IA8A 4II5A 4ZTHA 4AW2A 4CFWA 4D4VA 2EXMA 4GH2A 2Z02A 4N57A 4F9WA 3B2TA 4O84A 1PXMA 3EFKA 3NWWA 2YISA 3Q4ZA 4AE9A 1P14A 4ZEGA 3PSCA 4FEXA 3ZOSA 3U55A 3BBTB 4QYFA 1H08A 3OXIA 4KS8A 4UMQA 1NA7A 4W8EA 4E8AA 4DG3E 4FICA 4BCGA 4XCUA 5AR5A 3PVGA 4JBOA 4DH1A 2NP8A 4OTHA 4E4NA 2VTJA 3F2AA 5CVFA 1KE9A 4FIFA 2V22A 3ZBFA 5M4UA 2XNPA 1RE8A 3HMIA 5AR7A 1GOLA 2C5VA 3RI1A 2PWLA 3FAAA 2A19B 4B4LA 3OCBA 4GFOA 5AR4A 5J5SA 5IQGA 3QBNA 1E1VA 4GMYA 4DFYA 2OLCA 4QP1A 5J87A 3ALNA 4D0XA 2I6LA 2REIA 4FKWA 4PMPA 4U80A 5K4IA 5AWMA 4N6YA 4CRLA 1H1PA 4C59A 4EBVA 3D5VA 1FVRA 4I24A 4UALA 4YJNA 5CX9A 5E1EA 4C36A 4UY9A 4W9XA 4FTNA 4YJVA 4BFMA 5HIBA 1YKRA 4NKSA 4PY1A 3E87A 5BVFA 2VWWA 3T9IA 3GU6A 3VQUA 3PYYA 4U8ZA 4D58A 3F69A 2WD1A 3BYUA 3L9NA 4DTAA 2OZAA 3S95A 2Q0NA 3AC8A 2XIRA 1JKKA 3LJ2A 4C4EA 1F3MC 3R01A 5EHLA 4AOTA 2OXDA 1NXKA 4CEGA 5IMEA 4DEBA 4KUJA 3BX5A 2ITUA 1BLXA 2QOHA 4D1XA 2UZEA 2C6LA 1WZYA 3SGCA 5EI6A 2YZLA 4U7ZA 3KY2A 1ZLTA 3R71A 3T3VA 3ZO2A 2LGCA 3I5ZA 5HE1A 4YJSA 5JT2A 4I0RA 4FYOA 4U3YA 3E7OA 5A4CA 4JNWA 4R7HA 3VHEA 3U6HA 2QOBA 3P7AA 3RVGA 2PVLA 3MFRA 4G9RA 5FTQA 4B8MA 4U43A 4JQEA 4TT7A 1G8AA 3MIYA 4OTRA 5LARA 4LM5A 1GIJA 3DXNA 3GENA 1FVTA 2DYLA 1ERKA 3H0YA 3R1NA 4O0XA 3RHKA 3DQXA 4XG4A 4KWPA 3R30A 3KMWA 2QQ7A 5A6OA 1HCKA 2R3PA 4G5JA 1AD5A 3QLGA 4IVAA 3FE3A 3ZM4A 3EH9A 4CV9A 4IX4A 2VTIA 1YOMA 4HNIA 3TNIA 4HVSA 2EVAA 3ZLWA 4EH2A 3FPMA 1VZOA 2IO6A 3G90X 1FGKA 1BL7A 3MTFA 5L2QA 4HVHA 2W1FA 3O51A 3PXYA 2R64A 3JY0A 4IDVA 3VBQA 4RPVA 4BHZA 5DT0A 4WSQA 4MH7A 3OS3A 4LYNA 1WBWA 1UNGA 3BE2A 2V55A 3FMKA 5F4NA 4F1TA 2QR8A 4ANBA 3LCTA 4CQEA 2VTAA 4G17A 4DCAA 3IW4A 2X9FA 3CPBA 3MJ1A 3NAYA 4FV6A 3KKVA 2VTNA 1CKIA 5HD7A 2ITPA 5LVOA 4DBXA 3D14A 4D5HA 3UNKA 3ODYX 4BTKA 2RIOA 3DXPA 3RP9A 4F0GA 2RF9A 4QP8A 2WQEA 3GBZA 3QCXA 3W8LA 3DDPA 3S3IA 5AR3A 1RJBA 4E7WA 2YN8A 1BL6A 5JZJA 4D2WA 2ZYBA 4ENYA 3MGYA 4ARKA 1OL6A 4RZWA 5AR2A 4J99A 5FXSA 3KMMA 3WF5A 2EXCX 3GC8A 2WTCA 3JVRA 3QRJA 4IC7A 4ALUA 5IUGA 1U54B 3FXWA 3RPYA 3IGOA 3FHRA 5HZNA 4CZTA 5JRQA 3UZTA 4JDHA 4A4OA 3IONA 3TXOA 4AOJA 4USDA 4J97A 4C3FA 4M12A 5HU3A 3BLRA 2WIPA 2XA4A 3NCZA 3CLYA 4IM3A 1SZMA 1UNHA 2WTWA 4RC2A 4DFXE 1APME 5DH3A 1TQIA 3FLNC 2BMCA 4E1ZA 2YACA 4WBBB 5EM7A 5I5ZA 3R63A 5LVPA 3LHJA 3EQDA 4D4RA 5GJFA 3DZQA 1JVPP 1TQMA 4FKGA 3V8WA 3D94A 5TR6A 3VJOA 5KNJA 2UVYA 5JZNA 4IWOA 4TWOA 5C03A 2JFMA 4CG8A 4EH6A 4KS7A 4I5HA 4UEUA 4YGAA 4B0GA 3ZM9A 4PNKA 4ZZNA 1VEBA 4NW5A 3C0GA 3ZFYA 5TF9A 2C5YA 4M66A 4BCFA 5HVJA 2R3MA 3PA4A 3F7ZA 1XQZA 3QGYA 3EMGA 4HZSA 1YI4A 4O22A 4Y46A 5K3YA 3U8WA 3W55A 4EOOA 3SA0A 2Z7SA 5EK7A 1TVOA 3HL7A 5K9IA 3IDBA 5CI6A 3A7GA 4X7QA 1ZWSA 4O82A 3MY0A 3HNGA 4R1YA 5JGDA 2XK6A 4YLKA 1BMKA 4FTKA 2C47A 3FDNA 3NNWA 5D1JA 4NEUA 4EKKA 5M51A 3GOKA 3ZZEA 2QKWB 4XRJA 3MI9A 4O27B 4XP3A 2BROA 4MNEB 2OIBA 4IX5A 3R7VA 5DIAA 4IEBA 4ZTNA 3FZOA 1E1XA 3EQCA 3MVMA 4X2GA 4E93A 5HTBA 3MVHA 3ZHPC 3LKMA 3ZTXA 3KREA 4FTRA 1J3HA 4QYHA 5C4LA 5A4QA 4FKQA 4NT4A 3A7IA 3QQHA 4WIHA 4YSMA 2J9MA 4CCBA 3ANRA 1J7UA 4IAZA 4F0FA 3QQJA 5L6OA 5AV4A 2QG5A 3PXRA 4W9WA 4RFYA 4KBCA 1DAWA 2BRMA 3NUYA 3TNPC 4BBFA 3UYTA 4NYEA 3RKBA 5G6VA 5BMMA 3LLAA 2PVFA 5GZAA 1JKLA 1X8BA 5CQWA 3FL4A 2ZV9A 4I94A 2WPAA 1P4FA 4FIJA 5CF6A 1ZY5A 2QKRA 4EH5A 2PHKA 3GVUA 4ZJJA 4WSYA 2CN8A 3HZTA 4QTCA 1PXKA 3IW7A 1ZAOA 3ZFXA 2F7EE 3CD3A 4BZNA 5HORA 4RIXA 3G0FA 3OTUA 2C5NA 3TN8A 2YDJA 4XBUA 4QYYA 4JI9A 3OROA 1B39A 4LL5A 3C1XA 4CMUA 4HPUE 2ITNA 4LOOA 4I21A 4ITHA 4RX9A 5HVYA 2YWVA 4FTAA 1Q8WA 1AQ1A 3II5A 2XMYA 4MBLA 1Q8ZA 3MH3A 3TNHA 5M44A 4GKIA 2BVAA 3WIKA 4DYMA 2FGIA 3SG8A 2BZKB 3QX4A 2YITA 2WTIA 4O91A 3NDMA 4LOQA 1OPLA 3TUCA 2QODA 4IHPA 4E5AX 3KXGA 2X0GA 2QO7A 4EHVA 3ZO3A 2OIQA 1MRUA 3LVPA 4FKPA 5CLPA 5KE0A 4RX5A 4NJ3A 4I5CA 3QTXA 5IF1A 4LGGA 1PYEA 3L9LA 2XBAA 3L1SA 4IAFA 4LMNA 5K5XA 2VX1A 1I09A 4XOYA 3RPSA 4I6BA 4O0YA 4D2TA 5I9WA 4IB5A 1M2PA 1Q3DA 4X2KA 1UNLA 2GS7A 3P7BA 3QTUA 4RX8A 4BTJA 4C58A 2JKMA 4DEHA 5FEEA 4F7SA 2VNYA 4A9SA 4DH8A 2JAMA 3K3JA 3PA5A 5JH6A 3HDNA 5TOZA 3LXLA 4AGWA 3LOKA 3FI3A 4BZDA 2IW8A 3UNZA 4CLJA 4UX9A 4F9YA 5BVWA 5KMNA 3ZDIA 3WARA 4CD0A 4I3ZA 4RVKA 5BUEA 4QP3A 1FOTA 4FIIA 4LGHA 4AW0A 3SLSA 4ZTLA 4HGEA 4IWQA 2C3KA 3MVJA 4FV1A 5EQPA 3RWPA 4JQ8A 3EQFA 2UVXA 5LMAA 4S33A 3RZBA 2BRGA 3OCSA 4YPDA 5A4EA 4Y8DA 5JQ8A 3VN9A 1ZZLA 1JSTA 1P4OA 3UQGA 3OOGA 4MXCA 4JG8A 3QUEA 3VBTA 1JNKA 4EWHA 4NFNA 4FT5A 1YDSE 3MFSA 4H39A 4RVTA 3VS7A 4AG8A 4E26A 5B2LA 4NM0A 3OCTA 4RJ8A 2PVKA 2OJIA 2VU3A 1W84A 3N4VA 5CZHA 5DN3A 2XKCA 1QMZA 3NYXA 4EQUA 2J7TA 2W1EA 1UU3A 5IA5A 5CU3A 4MD9E 3KRXA 2VWXA 5HCXA 2VNWA 5BVDA 5C26A 1W7HA 4EK3A 3HMOA 4D2PA 4YR8A 1K9AA 4NFMA 5IQFA 4E6CA 3PY1A 4PP7A 4EOKA 5F20A 1XBBA 2G1TA 3LJ0A 3D83A 4MWHA 3VUDA 4F08A 5F9EA 4X21A 4DITA 4FOBA 3QD4A 3RAHA 3VS3A 5IG1A 2E2BA 3L8SA 4QPMA 3BWFA 4WRSA 3W33A 5KMMA 3L9MA 1A9UA 1GZNA 3V5PA 3TJCA 3P08A 5CNOA 1YHWA 3E3PA 4AT5A 5C9CA 3LFBA 1YI3A 2QU5A 4J53A 2WOUA 4H3QA 4BIEA 4O7NA 3MESA 3R28A 1MRVA 3QALE 4ASZA 4OT6A 4I1ZA 3PJ1A 4XLVA 3TUDA 4XMOA 2CGWA 3PIXA 4XP2A 4FTJA 4Y5HA 3C51A 5IA2A 2CNVA 4KINA 4NJDA 3OWKA 2XKEA 4EOIA 3ORMA 3MA6A 3LQ3A 4HGSA 4EI4A 4CVAA 3LPBA 4LRKA 3N4TA 1M2QA 4ZOGA 1E9HA 4DGMA 2HCKA 4HNFA 3EFJA 4IAKA 3P7CA 4JRVA 4G2FA 3WZEA 5JFSA 2C6EA 2QURA 2W4OA 2WTKB 3PXZA 4DFBA 2GHLA 1PXPA 2ITTA 3GQLA 5AP7A 2JBPA 4Y85A 3G6GA 3LXPA 5KKRB 5EW8A 3DNDA 2ZM4A 4LMUA 5AUXA 4XRLA 4GT4A 1XJDA 3I0OA 2ITXA 4XS2A 3TZ7A 2I40A 3EKKA 2WTDA 4G3FA 3LAUA 4K6ZA 4AGUA 3BZ3A 1Q4LA 4NM3A 5FRIA 3F2RA 2I0HA 3AOXA 1Q62A 3W18A 3NW7A 3O17A 1Y8GA 2UZUE 4NIFB 3ZRKA 1XKKA 4YTIA 3KMUA 4FEUA 3NVKI 3DBFA 4AGDA 5C27A 2P55A 3GNIB 3NNVA 4ACGA 3W16A 2PVJA 4GYIA 3TKIA 3FMHA 4QMYA 3R83A 4I0SA 1CSNA 3PTGA 5IPJA 4TWNA 2BAKA 2YLEA 3EFWA 5IQBA 2VTTA 3AD4A 5JGBA 4IFCA 3GB2A 3UJGA 2NO3A 3EZVA 3MTLA 3LQ8A 3CGFA 4EK6A 3CQEA 5J5TA 4BCHA 3H9RA 3Q04A 4BKZA 5EYMA 1O9UA 5FD2A 3U6JA 3KEXA 5AV2A 3E8EA 1LP4A 3PP0A 3O7LD 4NK9A 3D5UA 3BQRA 3P1AA 3TV4A 4HW7A 4NW6A 3NZ0A 2JBOA 3BE9A 4Z16A 2Y9QA 3GQIA 4GV1A 4OTIA 4YC8A 5T6KA 4RBLA 3RM6A 1KUTA 4QP2A 3IS5A 4PMSA 4S34A 3KGAA 3P4KA 4M8TA 4UYAA 3KVWA 1LEZA 5ETAA 4W8DA 3S1HA 5CSPA 3RK5A 4QT1A 3P5KA 5DWRA 2X8IA 2W4JA 5LXMA 3IDPA 4FL1A 3ZRLA 3TWJA 1BYGA 4X3JA 4QMWA 3QTQA 4M84A 5FBNC 2Q0BA 3UG2A 2V7AA 4M68A 5I3RA 4TYIA 3C4EA 3MH2A 4O0UA 3M1SA 4UN0C 4L45A 4BI1A 4EHGA 3PDTA 2BZJA 4N6ZA 5IEVA 3OXZA 4R3CA 4S2ZA 2DQ7X 2ITVA 4ZK5A 1IAHA 4DH3A 1G3NA 3CEKA 1DS5A 1WBSA 2IVSA 4QYGA 1LEWA 3AC4A 4ZAUA 5EM8A 4EH9A 3L9PA 3TTJA 4QO9A 2XIZA 4JX3A 5BYYA 3KL8A 2YAAA 4L00A 5CVHA 4MF0A 1JKSA 3G2FA 4FEQA 2QO2A 4YHTA 4IXPA 2JKOA 2UW6A 3BQCA 4FE2A 3PRFA 3NW5A 5D12A 2QG7A 3NVMB 5IH6A 5GZ9A 3ORTA 2W99B 2GNGA 2ZM3A 5HLWA 2FB8A 3ZCLA 4DAWA 4XUFA 1XH7A 5ANEA 4E6DA 3JYAA 5HE3A 1B6CB 4OTQA 1L8TA 5H9BA 2G9XA 2X6EA 4XG7A 1U5QA 5D11A 5HQ0A 3NAXA 3OTVA 4Q9ZA 2XK3A 4R77A 4UWCA 3UQCA 1FBNA 4F70A 3DKCA 3JUHA 3PPJA 5AUVA 3TKHA 4BICA 1Q8YA 4RIWA 2WMUA 5FWKK 4RRVA 5IDPA 2JITA 2PUPA 3NS9A 2BFXA 4YJTA 2R3LA 4AFJA 1U46A 2XNNA 3FQSA 5H3QA 3RAWA 2OG8A 2VTLA 3EHAA 4EK8A 2XNGA 3DTWA 4IZ5A 3V5LA 1PKDA 4GKHA 3QAME 5AP5A 5E1SA 1GNGA 4WA9A 4CQGA 2WOTA 3DLZA 3O71A 5B7VA 4I0TA 4BF2A 5A4TA 3UO5A 4I93A 5T3QA 2ZV7A 5L4QA 4JR3A 3EN5A 1S9JA 5IA0A 3EZRA 3QFVA 4F09A 2WB8A 3FXZA 1ZMWA 1Q24A 2Y4PA 2YHVA 3MW1A 4FNZA 4JDKA 4GVJA 3OY3A 4YC3A 2OJFE 1Y91A 3NUAA 1KV2A 5AIRA 5HVKA 1LR4A 4CG9A 2J0LA 3DA6A 4AGCA 3A61A 2VO6A 1V0OA 1FMKA 3S00A 4OAUC 1I44A 3Q9WA 4CKJA 2WTVA 4U79A 5KMJA 3F3UA 5LMBA 2XK4A 4R5YA 3QKMA 1OB3A 4USEA 3ODZX 3VBYA 3F88A 3GCQA 3JVSA 3MPTA 4L42A 4EJNA 4FTCA 1UVRA 3R8PA 3UVRA 4BL1A 3O7LB 4H36A 4L67A 3PG1A 5IUIA 4M7IA 4UXLA 3I4BA 2X7OA 2Y6MA 2BHEA 3JS2A 4A7CA 2GNJA 4KIKB 4IAIA 4FYNA 4BGHA 3CQUA 4EH4A 5BMSA 3JPVA 3QZHA 4E6AA 2ERZE 2EUFB 2PTKA 4ID7A 3L8VA 5IQDA 4GIHA 2RKUA 5CXZA 2PMOX 3R02A 2ITQA 2FSLX 1NT2A 5EW3A 4ASXA 4FGRA 3NNUA 2RFSA 4J98A 5ETIA 4DBNA 4C61A 2WTJA 4HYIA 4IC8A 4FSNA 4RG0A 4LRJA 3R8UA 4B7TA 3PWDA 5KBRA 5ANOA 4ZMEA 4X6RA 2HK5A 4M3QA 3ETAA 3OBGA 4A9YA 4APCA 4R78A 3E7VA 2X2LA 3BV3A 2PE0A 3QTSA 4KSQA 5G1XA 4EHZA 2BIKB 4V01A 3BGPA 1R3CA 2PVYA 4XH6A 5CZIA 4FTQA 4K11A 4XV1A 3AXWA 3QQKA 4JDIA 4I20A 4F1MA 3FWQA 4F6WA 4IQ6A 4ZLZA 3FMDA 5HIDA 4EH7A 1Q41A 1ZYCA 5AA8A 1ZYDA 2PSQA 3EYHA 1TQPA 3PE1A 5EI2A 4M69A 4O81A 3TNQB 1U59A 4GT3A 5CYIA 4HCVA 3PP1A 3A62A 4I4EA 3WOWA 1ZYSA 5KMOA 2CKOA 4RWLA 3S0OA 2VTSA 2XH5A 2R9SA 2IW6A 2Y6OA 3MH0A 4I6HA 4IJ9A 3ZO4A 1OZ1A 4BC6A 4ERWA 2G2IA 3H0ZA 3FPQA 3R8MA 4M0YA 5E8ZA 4C57A 4NSTA 4EWQA 3DB6A 4YSJA 4NH1A 5EYCA 5M09A 3UIUA 4WNPA 5DLSA 2ZAZA 3ZU7A 4U44A 4FV7A 4ACDA 4B8LA 5IU2A 3KK8A 3RGFA 2YDIA 3UZRA 4BY9E 2JFLA 3RAKA 1JQHA 2PE1A 5M53A 4ZTQA 2UZLA 4GS6A 4U9AA 4FNYA 4X2FA 4CCUA 5HICA 1YRPA 2VZ6A 3Q9YA 4EZ7A 2ZM1A 4FL2A 1Q8UA 3SRVA 2C3JA 3GCVA 5HHWA 2F7XE 4XG3A 1GJOA 3UOHA 3LM0A 5CALA 2YM6A 4BDDA 3R9NA 1MUOA 1PXNA 3EJ1A 5L6PA 3HRCA 1KOBA 2P3GX 4QMMA 3HP2A 3LCOA 4AZWA 2XJ2A 2W5HA 3F3TA 3LJ1A 3OEZA 3FHIA 3U9NA 5IEXA 1OMWA 5DI1A 4YLJA 3EQRA 2XCHA 5M55A 1W8CA 5CANA 4RWJA 2GS2A 4K2RA 3R21A 4FIHA 4DEAA 5K4JA 3Q5ZA 5A14A 4KBAA 4BR3A 3VS0A 5C8NA 2JAVA 3AC3A 4V04A 1UA2A 3ZZWA 3ACKA 3UP7A 3POOA 2CCIA 3BHVA 3QCYA 3R7OA 4G31A 3BU3A 5HI2A 3MS9A 5DFPA 3SV0A 4G3GA 2C4GA 4GSBA 1CKPA 5J7HA 4X3FA 3CPCA 3CQWA 3DFAA 3EN4A 4LQMA 4EOSA 5CVGA 4CKIA 3KQ7A 3PJ3A 2YAKA 4H58A 4AUAA 5I9ZA 3FI8A 1URWA 3HECA 3D2IA 4GU6A 4IZAA 3RINA 5A9UA 4IM0A 4FTTA 4V0GB 4KA3A 3Q6UA 4HPTE 1KOAA 3HV6A 4FSMA 1NW1A 3B2WA 4KRCA 2Z60A 3V5WA 1H0WA 4EONA 4FI1A 4BWPA 1RDQE 5IA4A 3MYGA 4RLKA 3BGZA 2G15A 3LXNA 5CAUA 4DA5A 5L3AA 3A7HA 4FV0A 3LMHA 4PDOA 2ETKA 3CCNA 4OUCA 3H30A 1BKXA 4YP8A 4ZJIA 4G3DA 2R3JA 3W32A 2WTKC 3G5DA 4TXCA 3BLQA 4L6QA 3UMWA 3C0HA 4XV9A 1AGWA 4QMUA 2RFNA 5GJDA 3UVPA 4NCTC 3OWLA 1W98A 3PFQA 5KKRC 3MV5A 3U4WA 4BCNA 5HE0A 3EB0A 3FI2A 3VC4A 3VUTA 3NUNA 5FGKA 3W2OA 2G2HA 4U81A 5KX8A 3E8DA 5ACKA 4BTFA 2R3RA 3DLSA 4XEYA 4FV3A 3WF8A 3BHUA 2XYUA 2NPQA 1H1QA 1H8FA 4BCPA 1GAGA 4L3PA 4DFUA 1CM8A 4Y73A 4TWCA 4ACMA 1YDTE 3AC1A 4WNMA 3SXFA 3FC1X 4OT5A 3FC2A 3NIEA 4IB1A 4DHFA 4G16A 4WUNA 2I7QA 4UXQA 2QHMA 3V5QA 1ZYJA 4XLIA 4HYHA 4B9DA 3MSSA 3LXKA 3BWJA 5HNIX 4ACHA 3C0IA 4MD7E 4FZ6A 4MQ1A 2OGVA 4TYJA 2JDOA 5AP4A 4HJOA 4EH8A 5AADA 2CLQA 4XG6A 3PJ2A 3DS6A 4AW1A 1UU9A 1XHAA 4O7SA 4KKHA 3ZSGA 5JKGA 3I7CA 3QC4A 4NM5A 2CJMA 3OC1A 4RSSA 4BDCA 2E9OA 4P4CA 4QD6A 4XHKB 4ZZOA 4GFMA 1YW2A 2ZOQA 4FZDB 2V62A 3G33A 4FX3A 4FMQA 5TT7A 4TPTA 1OL7A 3G9LX 2OFUA 2OF2A 1F5QA 5ANKA 2GNFA 2OZAB 5DHJA 1OUYA 2BILB 4F63A 3HP5A 3IDCA 3UIBA 4YJQA 5GJGA 3ZDUA 2B0QA 2WKMA 3EQHA 3FMMA 4UMUA 3CKWA 2HZ4A 5JGAA 3KF7A 4OGRA 3HV3A 5JK3A 3A8WA 3LE6A 3FXXA 3D4QA 3WF6A 4CXAA 4U0IA 3NUXA 4KABA 4E4LA 5FLFA 5M4FA 3Q60A 5E8SA 1CDKA 5AX9A 5IUHA 5LVNA 2XBJA 3RCJA 3DAKA 3DGKA 4M13A 2PZ5A 5JFWA 3CSVA 2QOLA 3CGOA 4C33A 4BZOA 4GL9A 3UGCA 4H05A 2BZHB 2OIDA 4L46A 3F6XA 5J79A 4O6LA 1G8SA 3ORXA 5M56A 2OU7A 4QMVA 3TCPA 3VUMA 2WIHA 3AD5A 3D15A 5HNBA 4ZY5A 5D9HA 3VULA 2JKKA 2WFYA 3VRYA 4EBWA 4NL0A 2P0CA 4FZFB 4XG8A 1YWVA 3VS1A 3DTCA 4E20A 3MDYA 5CXHA 4R6VA 4WRGA 3CP9A 3C5IA 4O7VA 5CWZA 3OCGA 4E73A 2HENA 4H1JA 4KKEA 2C6MA 4O7LA 1K2PA 3OFMA 2VTHA 4RX7A 4TYGA 2Z7QA 5HO7A 4EUUA 5IQCA 4FSZA 5KBQA 5TKDA 4QPSA 2GNLA 3Q4TA 4FKJA 1YI6A 5D7VA 5DA3A 5HESA 4C8BA 3M11A 1H01A 2WMVA 4L44A 3F3WA 3NUPA 2UZOA 4IIRA 4GK4A 4MNEA 5CSXA 4GFGA 1WBVA 2F7ZE 4JS8A 3WZJA 4D9TA 4C62A 3WILA 3O8TA 4U42A 3LIJA 1IAJA 2A0CX 4YO6A 1G5SA 3FMJA 4EOMA 5B0XA 4OAVB 5DG5A 3KU2A 4I23A 3ZRMA 2R3KA 4I5MA 3F7WA 3Q9ZA 3QCQA 5B2KA 3D0EA 3VJNA 2QR7A 4ANOA 2WMQA 3VUHA 5CU0A 2AYPA 5LMKC 1JAMA 5JFVA 3K5VA 2VTOA 4WHZA 1Y6AA 4GG5A 3G15A 3BU5A 2OZOA 2O2UA 4GK2A 2ONLC 3C4WA 5AV0A 4EK4A 2PZIA 4GW8A 2IWIA 1XH8A 2C5OA 3ZUTA 4E3CA 4KD1A 4DTBA 2ZV8A 4LUEA 2H9VA 5HBHA 5GHVA 5I4NA 3ZYAA 2HY0A 1NVRA 3O23A 3R8LA 5GNKA 1KE6A 3KFAA 5BUIA 5CY3A 4YU2A 2Z7LA 4D0WA 1PMUA 4YZBA 4DEIA 4FUXA 2PU8A 3HV4A 4K0YA 4AWIA 5HO8A 1UWHA 3QZIA 4JAIA 4LV8A 5EKNA 3AMBA 4J52A 4XBRA 5L2WA 4QQJA 4RQVA 3E5AA 5EDRA 5HLNA 4ZSAA 2X1NA 5FP6A 1KE7A 3SD0A 1PMEA 3C7QA 3OBJA 2GTNA 2OWBA 2IN6A 3V8TA 3HUCA 3M42A 4KBKA 4O2ZA 3TACA 4F7LA 3R1YA 4IAYA 2C6DA 3U4UA 2Y4IB 3THBA 3FJQE 2BKKA 3U87A 4DE4A 3FZ1A 2YIXA 3MN3A 1A06A 2YJRA 3LCDA 5E8VA 2OXYA 3R6XA 3ZXTA 3Q32A 4ANSA 3SDJA 4XP0A 2XZSA 2YZAA 3E88A 5AJQA 4D28A 4BGQA 3QA0A 4TNBA 2R0IA 2XVDA 1JSVA 1CMKE 1PMVA 4MD8E 5EFQA 4L52A 4O21A 4CV8A 3FL5A 3UG1A 5CASA 4U3ZA 3B8RA 1OIRA 1YWRA 3ZC5A 3DAEA 3FLSA 2PPQA 5I0BA 1OL5A 4YJUA 4AS0A 3N4UA 2Z7RA 2PVMA 5EI8A 4AZFA 1OVEA 2ZDTA 1OECA 3SX9A 3FYKX 1Y57A 4C2VA 2F2CB 2HWPA 4YBJA 5EG3A 3QUPA 4J8NA 4C4JA 3Q6WA 3V6SA 4J71A 3PA3A 3IW5A 2VWYA 5BX0A 3B8QA 3Q52A 4L68A 3DXQA 5M4CA 3ZO1A 4IAAA 2CPKE 3GCPA 2IVUA 4GEOA 4DC2A 4EHEA 3HA6A 3QRKA 4CTCA 5JSMA 4D2RA 3MY1A 3PIYA 3SOCA 5KCVA 3P86A 5C4KA 5D41A 4C3PA 4QMQA 3REPA 2BR1A 4O7RA 3PWYA 2SRCA 3L8PA 4J96A 3VF9A 5BPYA 4IW0A 4CMOA 4K77A 2B4SB 3O96A 4AZVA 3VS6A 2XYNA 4DH7A 3OD6X 2OBJA 4UB7A 1OKZA 1JOWB 5HG7A 3WE4A 4I41A 4L53A 2VRXA 4DG0E 5CEQA 1IRKA 3RK7A 3G51A 3R2BA 2XP2A 5ANIA 5E8TA 4E6QA 4BB4A 5DBXA 3EWHA 3FZTA 3R00A 5FM3A 3R7IA 2RSVA 5EOLA 5HG9A 3KRWA 4TWPA 4RIXB 1H24A 3FSKA 3GCUA 4G34A 4AA4A 2OO8X 4HYUA 4FKUA 4W4XA 4D4SA 3MA3A 3CIKA 4IANA 4QQTA 1DAYA 4KKGA 4HGTA 4QTDA 4N4SA 4F4PA 2J90A 1STCE 4DN5A 3AC2A 3PSBA 4M67A 2AC3A 1KE8A 3RHXA 4BVUA 1BI8A 2BTSA 3UIXA 1FPUA 1JPAA 1M7NA 2O0UA 1YXXA 3ALOA 2BKZA 5BQ0A 4BBMA 4AAAA 2ITYA 2JDVA 3FBVA 4IB3A 4XG2A 3ZFMA 5C1QB 4U40A 1XBAA 3FKLA 3FMEA 4AXAA 2NRYA 5AFVA 4RMZA 3ULIA 2W1ZA 1P2AA 2QO9A 4GUBA 3BPRA 3A60A 2YWPA 3RNIA 4RA5A 3C4ZA 2VGPA 3DBCA 5EYKA 3TV6A 4FT3A 2UUEA 3LM5A 3P23A 3R0TA 5EDQA 2GNHA 3OVVA 3LCSA 3IW8A 5FXRA 4PPBA 4IZ7A 4QTBA 3SXSA 5EDPA 1J1CA 1OBGA 4TY1A 4FG8A 5DRDA 1UKHA 2WQMA 3D7ZA 2W1GA 4RIYA 2P2IA 5CU2A 5AP0A 4F6UA 3OOMA 4EL9A 5AAEA 5EM5A 1W82A 3QKLA 3VQHA 5HO6A 3Q5IA 3HRFA 3AC5A 1SVHA 2J0IA 3COIA 2UZDA
chains in the Genus database with same CATH superfamily
4K1BA 3AQVA 3PUFC 1Y8YA 4C4FA 1OKVA 3E3BX 1IR3A 5E92A 2WMWA 3D7TA 5KZIA 4IE9A 5TE0A 3OF0A 5DVRA 3I0QA 4GJ2A 1GIHA 1VYWA 3D5XA 3UDBA 4XNEA 2A27A 4D4YA 2E9UA 2XEZA 4GU9A 3RK9A 2YJSA 2BAJA 4RLLA 4K9YA 3TI1A 3ID6C 3EN9A 3GGFA 1GIIA 3EQPA 3QXOA 4BDFA 4F7JA 2OKRA 2R4BA 2PUIA 2YM3A 1PYXA 4C4HA 3C9WA 3TIYA 4MK0A 3W0SA 4O6EA 1REJA 2B7AA 4MTAA 4HOKA 2JDTA 4PUZA 3WYXA 2R7IA 4DGLC 1MP8A 1OIQA 2VTQA 2W1IA 3HV7A 3KF4A 4FSTA 3LFAA 4WO5A 3FY2A 5DPVA 4C37A 4QMXA 3PZHA 3IW6A 4P7EA 4F0IA 5J9ZA 4O0VA 2RFDA 1M2RA 3BYOA 2A2AA 4UMTA 4ANMA 2W05A 4DEGA 4DH5A 1TZDA 4PPAA 3R9OA 2F57A 2WMTA 1DI8A 2HZNA 4F9BA 5E91A 3SVVA 3QD2B 3HMNA 4L9IA 2DWBA 3K54A 5AP6A 2C30A 4ASDA 2IPXA 3MFTA 2YDKA 3MB6A 4UV0A 3U9CA 5DOSA 4TRLA 4C4GA 2BRNA 2HW7A 4FBXA 2OI4X 5IH5A 4NTSA 3LCKA 4GCJA 1WBNA 2IW9A 3SKCA 4FRFA 4EOPA 4UWYA 3K5UA 5BVOA 5HX6A 2IVTA 3FV8A 4RJ6A 3RM7A 5L8LA 3W0QA 3BRBA 4RWKA 5J9LA 1IG1A 3DBEA 4O0SA 4RFZA 4UYNA 3RJCA 5IZFA 4ZY4A 4TKSA 5ACBC 2VD5A 5GINE 5IQEA 2BTRA 3A8XA 5CEKA 5LWNA 5FEDA 2QLQA 4RC3A 3NYVA 3UE4A 1Z57A 4AA5A 4MBJA 5EH0A 4BDJA 4QNYA 4DGNA 4IBMA 3UIMA 5AAGA 2KTYA 3KXHA 2YCRA 4F78A 3BYVA 4FVRA 4BDIA 1OBDA 5AUZA 3D5WA 2R3QA 4YNEA 3IG7A 4FK3A 5I3OA 4I92A 4BDBA 4DGOA 3V3VA 2AC5A 4WOVA 5KZ0A 1GZOA 2VWVA 4H1MA 4IVBA 4MXAA 3RWQA 4WUAA 2YCSA 4QMLA 1PY5A 2E9VA 1LUFA 1OL2A 4TNDA 1PW2A 3R7UA 1ZOGA 3EFLA 4FODA 3F66A 3S4QA 4I6FA 4CZYB 2FSTX 2YM5A 5LWMA 5GZ8A 2J4ZA 3KULA 4RC4A 4ZXTA 4X0MA 4X2NA 5B2MA 5HX8A 4D1ZA 5HEZA 5HE2A 2I0EA 2VX0A 4BI2A 4BJJB 3F5PA 4I4FA 5AR8A 3WE8A 1WVWA 1W0XC 1QL6A 3CY2A 3CC6A 1WBPA 4O4EA 5F1ZA 4ZTSA 5ETFA 1Q99A 1R0PA 2WO6A 3KVXA 5DRBA 3TDWA 2P2HA 3VS2A 4XOZA 4C0TA 4EC8A 3R7GA 3KC3A 4CFMA 2XALA 4JJRA 4PL5A 5FXQA 1PMNA 1RQQA 5AUTA 3GC7A 3QQGA 4X6QC 4R5SA 4F1OA 4CFNA 1JSUA 2BCJA 4IZYA 4TTHB 2NNWB 3ERKA 5DR2A 2XKDA 2PY3A 3PVUA 2CHLA 3VNTA 3JR1A 1NVQA 2C68A 4WBOA 4FEWA 2C3IB 3EOCA 4ALVA 1Q61A 4ALWA 5E90A 3ULZA 2X4FA 2J0KA 2W5BA 4QP9A 4RA4A 1ZOEA 2UVZA 2YM7A 4L7SA 4LI5A 1VJYA 2UW8A 4E5BA 3GFEA 4D1SA 2Z8CA 4DCEA 3KB7A 1XH5A 3BEAA 2BAQA 3PZEA 3QC9A 4GJ3A 4YZCA 3ZBXA 3C4CA 2W9ZB 3ENMA 4HCUA 4PV0A 2Y4IC 1ZRZA 4FL3A 5IDNA 5C01A 3Q2JA 4MUQA 3CTHA 4FIGA 4GVAA 2E9PA 3AMAA 1UU8A 5LCJA 3QXPA 4OR5A 3LFNA 3SW7A 2BALA 4PRJA 2UZNA 2R2PA 3VUGA 4H3BA 3CXWA 1XH6A 5HGIA 2C69A 2X8EA 4CMTA 4RIWB 4UBAA 3TDVA 2W5AA 3LMGA 4OBQA 3PUPA 4BN1A 2OXXA 4A9RA 4LOPA 1IEPA 1OKYA 4QRCA 4YTHA 1Q5KA 1YWNA 2V7OA 3EKNA 3OEFX 4BGGA 2CGUA 4AE6A 5I9VA 3FKNA 4AN2A 2WQOA 4FSQA 4BKJA 1PRYA 4RT7A 3OT8A 3PJCA 5CU4A 3QUDA 3HDMA 4JX7A 5AV1A 4APPA 3UPZA 4PWNA 2HZIA 1M52A 4KIPA 4F6SA 4C3RA 3U51A 2CN5A 2IF8A 2R0UA 4YNOA 3NEWA 3DK7A 3HAVA 2HZ0A 4TYHA 2JIIA 3IGGA 5JMSA 3U54A 3HVCA 2G2FA 4Y5QA 4OTDA 4F64A 1M17A 5M4IA 3MPAA 2YIQA 2VGOA 5HD4A 4ZSJA 4ZTMA 3PLAE 4B99A 5KHXA 1JBPE 3QKKA 1FMOE 3QX2A 5KHWA 2XS0A 5IA1A 1M14A 1VYZA 4CT1A 2QCSA 4GT5A 1H1SA 2BUJA 3UC4A 2B9HA 4YC6A 3GXLA 4C38A 2KULA 4O83A 2J2IB 3QWJA 4QQ5A 4YHFA 4Y72A 4AX8A 3OW4A 2W4KA 4JVGA 3TUBA 3GC0A 4G6OA 3SW4A 1YDRE 2X6DA 3VIDA 3VW8A 4C35A 3KCFA 4DHIB 4FKSA 2BHHA 5DR6A 2VWZA 2IJMA 5ANGA 4AT3A 3LFSA 3NLBA 4J1RA 4LGDA 4FF8A 4OTWA 4FK6A 1YQJA 5C8MA 3HX4A 3K2LA 3EN6A 4EKLA 3CY3A 4WT6A 3KXMA 4MF1A 3BHTA 4KNBA 2WMSA 3V01A 4ZLYA 2YCQA 3HRBA 4DG2E 3DB8A 1PHKA 3HUBA 3SXRA 2Y7JA 4UWBA 5AP2A 2WHBA 3F5UA 2R3FA 3DKFA 1YXTA 3DJ6A 4DGGA 1O6KA 3P78A 3SAYA 3F2NA 5CF4A 3O50A 3ZSIA 2UZWE 2QOKA 3R7EA 4F99A 5A4LA 4FV4A 4QMSA 2WMRA 4K8AA 4MYGA 3OUNB 1YHVA 4YBKA 5HCZA 3ZUUA 4A4XA 4AU8A 4M69B 2BFYA 3AT4A 2H96A 2ERKA 2GTMA 3I79A 3JXWA 5FDPA 5JQ5A 3NX8A 3N9XA 4EYJA 2UZVA 5J9YA 4W4WA 4BDAA 3V04A 4G3CA 2QI8A 3BKBA 2PZRA 2J5EA 1F0QA 3BI6A 2UZTA 5D7AA 4IMYA 3FLZA 3DKOA 2IZRA 2O5KA 4PTGA 2OSCA 4QQCA 5AV3A 4EC9A 5JEBA 1ZMUA 4W4YA 2B55A 3Q2MA 3CKXA 3ANQA 3ZUVA 1XO2B 1QCFA 3R1SA 4LFIA 3CJFA 4QDVA 2JDRA 4YTFA 3FUPA 4KIQA 3FQHA 3QD3A 4AFEA 3AGLA 4RZVA 4YZ9A 2YIWA 3S2PA 3TTIA 4CLIA 5AX3A 3IOKA 5E8WA 1H00A 5DE2A 1PF8A 1O6LA 3NFFB 3OG7A 2WNTA 4MWIA 3AKKA 5EKOA 4U6RA 3K3IA 3TL8A 2X39A 1W83A 3SRVB 1UU7A 2XCKA 1O6YA 3TZ9A 4ENXA 2ZB0A 4PTCA 2HY81 5H8GA 4ZZMA 4CYIA 3BYMA 3UDSA 3R1QA 5JRSA 1TKIA 1UV5A 3FZSA 4QTAA 3WF9A 3RCDA 3ORLA 4BKYA 5I9YA 2C6TA 3W2SA 1XR1A 3OHTA 1R0EA 4ONAA 1YVJA 4CGAA 4R8QA 3VWAA 4O1OA 4Y95A 3BELA 4Z7GA 5LOHA 1LPUA 4FTOA 4FTUA 2P33A 4KSPA 4P90A 4ASEA 1R1WA 1ZY4A 3UODA 1H07A 2BIYA 2B54A 2GQGA 5CI7A 2CMWA 2PZPA 4EQCA 3TT0A 1K3AA 3E62A 4O7WA 3FMNA 3N51A 4PP9A 5M06A 5EYDA 4EEVA 3PG3A 2VWIA 3AT3A 4PPCA 3Q4UA 4J7BA 4IVCA 3UO4A 1R39A 5E4HA 4QMNA 1H4LA 4LL0A 2OH4A 5CSVA 1BX6A 3GFWA 3VUKA 2QOOA 4RGJA 3IKAA 2GSFA 2X4ZA 1SVEA 2R5TA 5GIOE 2QHNA 3BCEA 3T8OA 3FMLA 2GQSA 4A9UA 1V1KA 2GS6A 4P2KA 5H8EA 2UV2A 2BDFA 2X2KA 2UW9A 3C4XA 4X3FB 3UOJA 4MAOA 3NFGB 2QOQA 5AEPA 2JKQA 2WMAA 2W0JA 4WKQA 5LVLA 4D55A 3LMIA 4BCJA 3ZLXA 2EXEA 3LW0A 1H25A 3IOPA 3KRJA 5CT7A 2HXLA 2IG7A 4DINA 4FTMA 2HW6A 2CNUA 1S9IA 4BYIA 4IX6A 5KUPA 3DZOA 3ROCA 3MY5A 1T46A 2QLUA 4R1VA 3T3UA 2PMIA 3H4JA 3W2CA 5FBOA 2OJGA 2JC6A 4C4IA 2ETMA 3FY0A 3AMYA 2ZDUA 5CAQA 2XM9A 3HYHA 3OT3A 4S30A 3M2WA 5AUWA 3V5JA 5LVMA 2F9GA 2VUWA 1JWHA 2QONA 3QHRA 3F82A 4DEDA 2C6IA 4PDPA 4AW5A 4CFUA 5CEMA 2XM8A 3D9VA 4GIIA 3E8CA 3KN6A 4QMOA 5CAPA 1QPJA 4FV9A 2FUMA 4O7YA 4ACCA 5EQYA 3HMPA 4ZIMA 3VS4A 4NUSA 3TEIA 1U54A 4DLJA 3P0MA 3BLHA 3KXZA 3GOPA 1OKWA 1ZZ2A 5HTIA 3MPMA 4WNKA 1J7LA 1JLUE 4HZRA 1UKIA 1YHSA 2GFCA 2QNJA 3KRRA 3PLSA 3UO6A 1UWJA 2VTMA 5H8BA 5AAFA 1NVSA 3NGAA 5A3XA 4QOXA 2W9FB 1H26A 3C13A 4DFNA 2R3HA 3DDQA 5DT4A 4HVIA 1OM1A 4G6NA 4BHNA 4Z55A 4GYGA 4K18A 2HELA 3QRIA 4EK5A 3TM0A 4AAYA 4QYEA 3Q3BA 4UMPA 4JLCA 5HBJA 5I9UA 1KV1A 4JBPA 1Q97A 4O7ZA 2XNMA 4R3PA 2WELA 3OWJA 4R7BA 4QMPA 2CCHA 2R3IA 1OITA 3EL8A 3QQFA 5FQDC 3LFDA 2X8DA 3UTOA 4YJPA 1B38A 3E93A 2XRUA 3I81A 4FIEA 3DU8A 2PMNX 1YOLA 3CD8A 4DT9A 4FKIA 5DNRA 5HBEA 3NYOA 2WGJA 3ZEPA 4BIDA 4D2VA 2EWAA 3QZGA 5LJJA 1YOJA 5CU6A 1OPJA 3H9OA 1Z9XA 2VTRA 4YZDA 2Q83A 2ZMCA 3I7BA 5F95A 3WBLA 4ZSLA 4CT2A 5HU9A 5IEYA 2O3PA 4EOJA 4USFA 4FOCA 3UP2A 1KE5A 4HCTA 4M15A 2C0OA 4ANQA 5FM2A 1YXVA 5AA9A 4I22A 3VW6A 3KA0A 5IA3A 3PJ8A 2ETRA 4PNIA 5C8KA 2XARA 4IVDA 5DYJA 3ORNA 4PL4A 3WYYA 4AN9A 2RG5A 4C02A 4EOLA 3OMVA 4BWKA 2WAJA 2B52A 2XEYA 5EHOA 3W2PA 4FZ7A 4O96A 5K5NA 3DPKA 2W96B 3ORPA 2FH9A 3WIGA 2B1PA 1GY3A 3MWUA 3NR9A 3PSDA 4BDGA 2HAKA 3A2CA 4HVDA 3UPXA 4ZS0A 1PXOA 4JXFA 3QTWA 4OW8A 3ENHA 2O8YA 3C50A 3QTRA 4P5ZA 4QP6A 1U4DA 3PVWA 4IB0A 5EW9A 2ITOA 3I6WA 2UW4A 4FT0A 1R78A 4JBVA 2IZUA 4EORA 1WVXA 3DJ7A 4MKCA 4MXOA 1OI9A 2OFVA 3VO3A 3ORZA 4C34A 3ZLYA 5E7RA 3WZUA 3AT2A 5EQEA 5E8YA 5HIEA 4NTTA 2OJJA 4OBOA 3EQBA 3VBVA 1FVVA 4CFFA 4FV2A 3GP0A 4QP4A 1OPKA 3HAMA 4KRDA 5IH4A 1GZ8A 4YTCA 2H6DA 3TKUA 3TZ8A 4OLIA 3MH1A 5CAOA 2C0TA 2VO0A 3LQ5A 2UZBA 3QHWA 1P5EA 1H27A 3OP5A 3P9JA 3NSZA 5EHYA 4AN3A 2YM4A 3JY9A 1A48A 3R73A 1JKTA 2J51A 3FQEA 5I9XA 1IASA 4NKAA 3FKOA 4RJ7A 3V6RA 4Q5EA 5M08A 1SYKA 3HGKA 4DFLA 5FDXA 3RNYA 3ACJA 5A54A 4QP7A 2YIYA 4BYJA 5J7BA 3L8XA 1SNUA 2XKFA 3PY3A 1GZKA 1MQ4A 4D9UA 5KMIA 5L2IA 5J8IA 4TZRA 2DUVA 2ITZA 2J50A 1BI7A 2W1DA 3QU0A 2BRBA 2F2UA 3IECA 4IX3A 2YEXA 4UMRA 5E9EA 4PTEA 2XIKA 3GCSA 5A46A 4J95A 4GRBA 2CGVA 3PE2A 3T9TA 4Z3VA 4QTEA 4FVPA 3OXTA 1FQ1B 2HOGA 1HOWA 2BZIB 4WG4A 5K0KA 4FA2A 2JIVA 3EN7A 4U45A 2GFSA 4FGBA 4S31A 3TG1A 5FG8A 1OGUA 3UBDA 1YXSA 2PMLX 4NU1A 3DNEA 3R8ZA 2VV9A 2RGPA 5D10A 2IZSA 2QU6A 5CF5A 2OW3A 3BBWA 5HLPA 2PVNA 3FI4A 2V0DA 4FG7A 4WG3A 4TL0A 3KRLA 4A4LA 3ET7A 4FSRA 2PE2A 3SHEA 2BRHA 1ST4A 4YLLA 3TNWA 1URCA 2HWOA 4BRXA 4MNFA 4LV5A 4O0WA 4IADA 4G5PA 3BIZA 1OL1A 4KB8A 3NYNA 4Q9SA 4FT9A 4CTBA 5CF8A 2EB2A 5BVEA 4EYMA 5HTCA 3DK6A 5CENA 2RL5A 5J95A 2CKPA 3F5GA 4BTMA 2W1CA 1OIYA 4YUQA 3DJ5A 4FC0A 1SNXA 4PL3A 4ZY6A 3OW3A 1V0BA 3SQQA 2J0JA 3F3ZA 3GT8A 5IKWA 5AIKA 5GIPE 4FTIA 3HEGA 3NNXA 2X0PA 3QQLA 3GUBA 4FSWA 3SOAA 4AF3A 3W1FA 2X2MA 1ZOHA 2C0IA 2LAVA 4BDKA 2FVDA 4HVGA 5IMXA 3Q53A 5AUUA 2XNBA 4BDHA 4O86A 2JIUA 4MXZA 4CFXA 3LZBA 3RZFA 2OJ9A 1ZYLA 2AUHA 4HYSA 4RJ5A 3MJ2A 3VAPA 3OZ6A 2P4IA 4AZEA 1FGIA 5JN2A 2FO0A 2YA9A 2ZVAA 4E4MA 3TJDA 2VWUA 1H1WA 4YZMA 2C5XA 4R3RA 2FSMX 3PRIA 2VO3A 3PXKA 2WZJA 4A07A 5HKMA 3UMXA 4FSUA 4CNHA 4ITJA 4A06A 3F5XA 1XH9A 3EL7A 4GG7A 1W2FA 2FSOX 5AM6A 3FEGA 2NRUA 1ZARA 3GEQA 3PXQA 3QF9A 3RMFA 3UOLA 1J7IA 4CKRA 4BCMA 3H10A 3GU5A 4X2JA 5CNNA 4D2SA 2XJ0A 4AZTA 2UW5A 3GU8A 1H28A 3NUSA 2Z2WA 5L2TA 2VO7A 4YMJA 3NIZA 5IISA 4FTLA 1NY3A 1L3RE 4U41A 4D5KA 3ZONA 1WBOA 4NCTA 3DK3A 2CNQA 4G9CA 2XB7A 3RAIA 4IM2A 2CKEA 1QPDA 2V5QA 5IQIA 4NZWB 3DQWA 2I1MA 5CQUA 2W7XA 5L6WL 5M57A 4ORKA 3CBLA 4JG7A 5E8XA 3GU4A 3VHKA 4AT4A 2GNIA 4M97A 3R22A 4DTKA 3R9RA 4NIFA 1V0PA 3MB7A 4H3PA 2B53A 4B6LA 3CS9A 4BWXA 4YJOA 5FTOA 3QL8A 1WCCA 4JOAA 4O1PA 4FZAB 5DEWA 3OUKA 4AQCA 3ATSA 1QPEA 4YO4A 4WNOA 3CJGA 4YJRA 5HOAA 2WMXA 3HKOA 2R3NA 3NPCA 2VAGA 2XUUA 3COMA 4FKOA 4L43A 5FEQA 3V5TA 5DGZA 4N70A 4PDYA 5AP3A 4FV8A 4CFVA 4PX6A 3CE3A 3A4PA 3UVQA 4I5PA 4QPAA 3VBXA 2X81A 3LFEA 3ZS5A 4O38A 2IVVA 3O0GA 4C2WA 2ZMDA 4ZSGA 2EB3A 2X7GA 3QTIA 1FINA 4X3FC 3ZLSA 2ZFYA 2Y8OA 3VBWA 3WZDA 4ZJVA 3V51A 4JG6A 4KIOA 5IQAA 4IJPA 4DEEA 4BCIA 1WVYA 3CTQA 4RWIA 1CKJA 1WFCA 4ZTRA 3ZXZA 4ANLA 3UQFA 3FLYA 5JFXA 5DR9A 2EU9A 2PVHA 3G0EA 2GHGA 1MRYA 4PDSA 4TYEA 2XK9A 3FSFA 3MFUA 3QLFA 4BIBA 4JT3A 3H9FA 2HXQA 4L8MA 3R9HA 3BGQA 4WG5A 3KIOC 2WQBA 1RW8A 2QVSE 5HCYA 4BDEA 4RIYB 2QOIA 4FSYA 4XG9A 3DY7A 3KXXA 4EOQA 4RJ3A 3W0PA 2A1AB 2JGZA 4R7IA 4CSVA 5ICPA 5TO8A 3G9NA 4QMTA 5CEOA 4ITIA 1M7QA 4UZHA 5EOBA 5FTGA 3QCSA 1H1RA 3LFQA 1HCLA 3OY1A 4FVQA 1H0VA 2UW0A 4FT7A 4MCVA 2XRWA 5CTPA 3Q96A 4TW9A 1ATPE 4E4XA 4YURA 2IZTA 2QOFA 3D7TB 3EQGA 3LFFA 4G6LA 5ANJA 5BVNA 3QD0A 4MHAA 5K0XA 3ZEWA 4Z7HA 5KMLA 4LUDA 4AA0A 3BHYA 2ESMA 2YIRA 3ELJA 2FA2A 4G3EA 4L3LA 2JEDA 4RJ4A 3I5NA 3FZRA 2VWBA 4V05A 3BEGA 5KO1A 3EYGA 4LG4A 2BDWA 4DLIA 3E64A 5HNGA 4ZS4A 5J1WA 2PK9A 4GK3A 4MQ2A 4ZP5A 4CZUA 5CEIA 4N0SA 4JMQA 4ANNA 3SC1A 4YZNA 1PJKA 3KK9A 3ZMMA 4DFZE 2PUNA 4BCKA 5E8UA 2ZB1A 5EM6A 3RPOA 2GCDA 2ZJWA 3AG9A 3C4FA 3COHA 5ITAA 5BYLA 4DDGA 3H3CA 4G1WA 4L3JA 3ROYA 3PIZA 3NW6A 2YERA 2X7FA 4FKRA 3O8UA 4M14A 4JDJA 1J1BA 1OGYA 1Y6BA 1DI9A 3UOKA 2WU7A 3POZA 3I1AA 2O63A 2XIXA 1W2DA 5A6NA 3F3VA 3GU7A 3NUUA 4KAOA 3QA8A 4TN6A 2PZYA 2W17A 4C7TA 3ZH8A 1OUKA 4JIAA 4P5QA 4F9AA 4O7TA 1WMKA 1QPCA 1PXIA 5FUTA 2J0MB 3VUIA 3WF7A 2PYWA 2FYSA 4EJ7A 2B9IA 2I0YA 2WU6A 4L7FA 4IWPA 5T68A 1DM2A 2XK8A 4U97A 3VRZA 5LMKA 3QGWA 2CKQA 2R3OA 5CSHA 4IACA 4PMMA 2JD5A 2JLDA 3MIAA 2ONLA 2YABA 4MVFA 2ACXA 3SG9A 2O64A 2C6OA 3NMUF 1PXJA 3ZC6A 1ZMVA 3R9DA 4EQMA 2PULA 4BCOA 4J8MA 1J91A 2AEGA 2PUUA 3QQUA 4JBQA 3I60A 3IK3A 2QD9A 5CS6A 3MVLA 4FKTA 3W2RA 5IQHA 4ERKA 4CYJA 4CRSA 2UW7A 2WEIA 4BBEA 3TMOA 4FNWA 2B9FA 4RVMA 3W10A 3COKA 3U6IA 4FG9A 3W2QA 2HIWA 2R7BA 5BNJA 3FLWA 4IH8A 4AP7A 4MX9A 4NWMA 4XV2A 3R8VA 5F94A 3R7YA 2XK7A 3UYSA 4ZSEA 4PQNA 1SVGA 3RBWA 4O4CA 3LFCA 4FEVA 4KIKA 4XV3A 4DF3A 2HYYA 2WMBA 4I6QA 4MXYA 3VF8A 5BUJA 3ORIA 3OWPA 2RFEA 3HMMA 1XH4A 3FYJX 3IQ7A 1PXLA 4L01A 2WXVA 2GPHA 4AZSA 4AACA 3IO7A 4M0ZA 2ITWA 3C5UA 3PPKA 5DT3A 3TV7A 5CAVA 2GQRA 4IFGA 2DS1A 5HG8A 1WAKA 3EIDA 2CDZA 2OF4A 3FZPA 3O8PA 3KULB 2WQNA 3BHHA 3UC3A 3CTJA 4QNAA 4RIOA 1OIUA 5L2SA 4PF4A 1T45A 4WD5A 3MBLA 4F7NA 2C1AA 2J6MA 5AMNA 2VN9A 1IA9A 4DHJA 2E9NA 2XF0A 4NM7A 4K33A 3QYZA 4PMTA 5LQFA 2BPMA 3W0OA 3CR0A 3UZPA 2X9EA 5CSWA 3GC9A 4EZ3A 2ZV2A 3UNJA 3W8QA 4OBPA 2GMXA 5J1VA 5LCKA 5DEYA 3BU6A 3D2KA 3QTZA 5L8JA 2PL0A 1ZXEA 4O2PA 3QRTA 3ZSHA 3VS5A 4E5WA 3HLLA 1Z5MA 3WZKA 4W4VA 3E63A 5H2UA 2QC6A 4FUYA 4Z9LA 5ANDA 2CGXA 2OICA 2VTPA 2GHMA 3HV5A 3AD6A 4YPSA 3AGMA 3QYWA 2GU8A 4JR7A 2B9JA 2BDJA 3F9NA 3P79A 4FR4A 4BI0A 3A99A 4F9CA 3DBQA 3Q9XA 2AQXA 3Q4CA 1SMHA 4LRMA 3DCVA 1WBTA 3R2YA 3A7JA 3O2MA 5L8KA 2PVRA 4UZDA 2G01A 4O0RA 3ORKA 3DFCB 2C3LA 2W1HA 3QZFA 1MQBA 3KCKA 3DKGA 4A9TA 4F65A 3E92A 3DBDA 3TIZA 2XAMA 4MXXA 2XNEA 3A7FA 1EH4A 1SM2A 2YLFA 4OTPA 3BV2A 2Y0AA 4FV5A 2R3GA 2XJ1A 4Y83A 3R04A 4EH3A 3E8NA 2UW3A 2JDSA 3PPZA 3QWKA 3IPHA 4RVLA 4S32A 4U5JA 2J5FA 1PKGA 2GDOA 2OH0E 4DT8A 4FKVA 3RALA 4JQ7A 2W06A 2YCFA 2I0VA 1CTPE 5AUYA 3ATTA 2C6KA 1U5RA 1YXUA 5CEPA 1Q8TA 2XNOA 3I6UA 4GUEA 4YHJA 2QOCA 3V8SA 2CSNA 3DOGA 2C1BA 3RPRA 3FLQA 2H8HA 2RG6A 3AKLA 2F4JA 4ZLOA 2A4LA 1Q3WA 3A4OX 3DT1A 3F61A 3DAJA 3KN5A 4EZ5A 4AQKA 3EQIA 3VVHA 5M07A 1VR2A 3NRMA 5AP1A 5ETCA 4AOIA 4TYHB 3GI3A 1XBCA 3WI6A 4IDTA 3PY0A 5BYZA 1XWSA 4IWDA 4JL9A 4FKLA 4MBIA 4MEDA 5HG5A 2O65A 2VX3A 3PVBA 4QMZA 4OTFA 4V0GA 4EUTA 3ITZA 1KWPA 4XX9A 5CT0A 2CLXA 2F49A 4XJ0A 3TZMA 3NCGA 3RTPA 3HA8A 3TYKA 4QEBA 3QRUA 3DV3A 1KSWA 4BCQA 2OK1A 4HGLA 4JAJA 4XYFA 2H34A 4RFMA 2YM8A 5FP5A 4ZMFA 2YFXA 3G6HA 4Q2AA 4OTGA 5KMKA 1REKA 5AM7A 4RQKA 2WEVA 4JIKA 4Q5HA 5DMZA 1ND4A 1BUHA 2XIYA 4O0TA 3LLTA 5BVKA 4JRNA 3RPVA 3BYSA 4FNXA 3PXFA 3KXNA 1IA8A 4II5A 4ZTHA 4AW2A 4CFWA 4D4VA 2EXMA 4GH2A 2Z02A 4N57A 4F9WA 3B2TA 4O84A 1PXMA 3EFKA 3NWWA 2YISA 3Q4ZA 4AE9A 1P14A 4ZEGA 3PSCA 4FEXA 3ZOSA 3U55A 3BBTB 4QYFA 1H08A 3OXIA 4KS8A 4UMQA 1NA7A 4W8EA 4E8AA 4DG3E 3AKJA 4FICA 4BCGA 4XCUA 5AR5A 3PVGA 4JBOA 4DH1A 2NP8A 4OTHA 4E4NA 2VTJA 3F2AA 5CVFA 1KE9A 4FIFA 2V22A 3ZBFA 5M4UA 2XNPA 1RE8A 3HMIA 5AR7A 1GOLA 2C5VA 3RI1A 2PWLA 3FAAA 2A19B 4B4LA 3OCBA 4GFOA 5AR4A 5J5SA 5IQGA 3QBNA 1E1VA 4GMYA 4DFYA 2OLCA 4QP1A 5J87A 3ALNA 4D0XA 2I6LA 2REIA 4FKWA 4PMPA 4U80A 5K4IA 5AWMA 4N6YA 4CRLA 1H1PA 4C59A 4EBVA 3D5VA 1FVRA 4I24A 4UALA 4YJNA 5CX9A 5E1EA 4C36A 4UY9A 4W9XA 4FTNA 4YJVA 4BFMA 5HIBA 1YKRA 4NKSA 4PY1A 3E87A 5BVFA 2VWWA 3T9IA 2NYAA 3GU6A 3VQUA 3PYYA 4AXFA 4U8ZA 4D58A 3F69A 2WD1A 3BYUA 3L9NA 4DTAA 2OZAA 3S95A 2Q0NA 3AC8A 2XIRA 1JKKA 3LJ2A 4C4EA 1F3MC 3R01A 5EHLA 4AOTA 2OXDA 1NXKA 4CEGA 5IMEA 2X0QA 4DEBA 4KUJA 3BX5A 2ITUA 1BLXA 2QOHA 4D1XA 2UZEA 2C6LA 5BV3A 1WZYA 3W0RA 3SGCA 5EI6A 2YZLA 4U7ZA 3KY2A