2OSCA

Synthesis, structural analysis, and sar studies of triazine derivatives as potent, selective tie-2 inhibitors
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
255
Chain Sequence
b'QVLKARIMDAAIKRMKKDDHRDFAGELEVLCKLGHHPNIINLLGACEHYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Synthesis, structural analysis, and SAR studies of triazine derivatives as potent, selective Tie-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 255
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oscA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oscA01
3VUHA 2R7BA 2BDWA 2O3PA 3ENMA 5DPVA 1XKKA 3BYVA 4L3LA 4BWPA 4MXYA 4ZY5A 4RX5A 3OS3A 3V5TA 4AGUA 4BIDA 2P3GX 3B2TA 4ZZOA 3P0MA 5JSMA 2CNUA 2JKOA 3E63A 4FK6A 2VN9A 2QOBA 4S34A 5DR9A 3G5DA 3QRIA 3O8TA 4LOQA 3G15A 3HV3A 4K0YA 5TE0A 3UBDA 4O7VA 1R39A 3R28A 1JSVA 3V3VA 4EYJA 1AD5A 4O2PA 1ZWSA 3L8VA 4BTJA 4MBJA 3QCXA 3HECA 4U8ZA 3RWPA 2HXLA 3SA0A 4NJ3A 1W98A 3UNJA 2GHLA 3WF7A 4KAOA 4HYSA 5M53A 4QMWA 3C4EA 4JR3A 2X9FA 3RTPA 3PUPA 3VBXA 4AZFA 1PKDA 3BELA 2QHMA 4BCNA 5GZ8A 4CMUA 3FYJX 1IAHA 4MNFA 4DINA 3A61A 1JSTA 3QWKA 3Q6WA 4M12A 3FL5A 4YJOA 1PXIA 3THBA 4TT7A 2UW6A 4J52A 2LGCA 3PTGA 3Q4CA 3S1HA 1STCE 5EOLA 2WO6A 2X2KA 3PE1A 1UU3A 1PJKA 5D1JA 5E8UA 2GNFA 3Q52A 3U87A 2JKMA 4I4EA 3OC1A 4N70A 2ESMA 4Z7HA 1OL7A 2E9NA 5GJDA 4BCOA 1TQMA 3TG1A 2R3GA 1YWRA 2J0JA 4J1RA 4I22A 4R7IA 3S95A 3W2SA 3EYHA 1J7IA 3OMVA 4KINA 3KF4A 1F5QA 3BV2A 1JOWB 1H07A 4TWCA 4N6YA 2R5TA 2W0JA 3RINA 4E73A 5D12A 2OIDA 5I9YA 3FMDA 4PX6A 4UWYA 4MXAA 4WIHA 4RX7A 5IH4A 3N9XA 3HGKA 3RAHA 2YCRA 3VC4A 3TCPA 4YMJA 3QTZA 4AU8A 4X7QA 4GT3A 4RJ4A 1Q8UA 3GCUA 2PUIA 2GNJA 4EOQA 3EKNA 4PMPA 4XRLA 2Y4PA 3EZRA 4ZOGA 4NL0A 4KSPA 4PTGA 4QMZA 4YJPA 4BWKA 2OIBA 4LMNA 5LVPA 5CT7A 4PDSA 2R3RA 3WOWA 3LFSA 3EYGA 1U46A 2XMYA 4QYYA 4YJQA 3A62A 3FDNA 1H1PA 4PF4A 3RCDA 3VS0A 5BNJA 4FIGA 5FXRA 1JAMA 5HO8A 3R71A 4BBFA 5B2MA 4LM5A 4D2TA 4BCKA 3IONA 4FTCA 3ZZEA 3NX8A 4E26A 4G6OA 2IZUA 2UW3A 4AWIA 3U4WA 3ZUUA 2PVHA 5K3YA 3IDPA 5HTIA 3O71A 3PA3A 2BKZA 2WMAA 3QWJA 4IW0A 4YJRA 2V62A 3LMHA 2JITA 5HOAA 3MJ2A 4FZAB 3CTHA 4K77A 5CT0A 2CGWA 4LRJA 2O8YA 4UXLA 2VO0A 5D10A 2WEVA 1OI9A 1ZZ2A 3ZXZA 4ZLZA 4OTPA 1GIJA 3FWQA 2C5YA 2YDKA 3W2RA 4QTDA 1ZYSA 3QRTA 4A4LA 3KK9A 3A7HA 4YZNA 5CS6A 4CEGA 4Y95A 3OUKA 3GCQA 5EW3A 3F61A 1XWSA 3ACJA 4XV3A 2ACXA 4C4JA 2GNGA 5KMMA 3U55A 3OEZA 3QUEA 5EHYA 4AXAA 3JS2A 2YHVA 1YHVA 4QP9A 3D7ZA 3EN5A 3AC1A 3R7GA 1XJDA 3MV5A 1NXKA 3AGLA 4U7ZA 4CSVA 3KL8A 5CQUA 3PSBA 4O7YA 4P7EA 4AT5A 5A9UA 5J1VA 2W1EA 5IF1A 4IE9A 5A46A 1B39A 4C02A 3Q96A 2QKRA 3VVHA 3CIKA 4QP4A 4F7SA 1UKIA 4EBWA 1HOWA 2Q0NA 4TWOA 5DH3A 3FMHA 5AP0A 4AZEA 4IX6A 5FEQA 4TL0A 4RVMA 4TKSA 4OTWA 4I5PA 3SG8A 2CLQA 3OG7A 4H39A 4RBLA 3LFEA 4F0FA 4CLJA 2PZRA 4G9RA 5EI6A 5HE0A 3RWQA 1BL7A 5F20A 5M55A 2E9UA 4M97A 5EKNA 3COHA 2UW7A 4NK9A 3LW0A 1L8TA 5EQPA 3NUXA 3HZTA 5LVOA 5HTCA 3PG1A 1J7LA 3U4UA 3ID6C 4XJ0A 3EKKA 4GU6A 1M17A 4ERWA 3CY2A 4EHVA 3FAAA 2C6EA 4KABA 3FY0A 4EH4A 4M69A 5AAEA 4BF2A 4KUJA 3D14A 3UQGA 1KUTA 3MDYA 3OCSA 4JQ8A 2WU6A 3C50A 3OT3A 3LFCA 2P4IA 2F9GA 3F6XA 3PRFA 3O23A 5FG8A 4FKRA 2OH0E 3VF9A 4QTEA 4K6ZA 2P33A 3NVKI 5M56A 3FPQA 5DT4A 5L2IA 4ZLOA 3TNPC 4C35A 3QD2B 4DTKA 4JG6A 3O8UA 3KXHA 4BDKA 2WTKB 3PXZA 3JR1A 5E8YA 2VWWA 3OD6X 3DB6A 1OBGA 2OJ9A 3E8NA 1KOAA 3I1AA 3WARA 3K5UA 3WZDA 4U81A 4ALVA 4BTMA 3ZFMA 3ZFYA 4ZSEA 3F3WA 4A9TA 4LYNA 3LIJA 2YIWA 5BVDA 2RFSA 3PLAE 3JVSA 4PNIA 4EQCA 4JIKA 3HMOA 4CZTA 3GC7A 2Z7RA 3MY1A 3BBWA 3PRIA 4RIYA 1UNGA 4PDPA 4LUEA 2QI8A 4PNKA 1OVEA 4RZWA 1OUYA 4C4IA 4EH7A 2C6MA 2RFNA 3IDCA 4GIIA 1RJBA 3EN6A 4WBBB 3HMIA 5CQWA 2IW6A 3KMUA 5CSVA 3MGYA 5AX3A 3VS7A 4EOIA 4HVIA 3MVJA 3E92A 4FSWA 2GMXA 2ITUA 4FICA 2UZTA 1QMZA 4C3PA 1H1WA 2XK9A 3BQRA 3MVMA 4FODA 4MD7E 3LZBA 4FZ7A 4IAKA 4O0SA 4YR8A 3R73A 4OLIA 4WHZA 1SVHA 5J7HA 5K0XA 1FOTA 5D7AA 3WE8A 2G1TA 1FGKA 5KNJA 4FTMA 3HMPA 4UMQA 4L7SA 1J91A 2IPXA 4G3EA 1XO2B 4JR7A 5A14A 4IM3A 4BBEA 4FSMA 3QFVA 4PTCA 4LOPA 2HELA 3TKUA 4JX7A 1OL6A 3LMGA 2B0QA 4EJ7A 2ERKA 3F2NA 3IW6A 1PF8A 3AG9A 5KHWA 4BHNA 4FSNA 5BVEA 4FVQA 2GTNA 2FO0A 3KF7A 4X3FC 4YZMA 5F94A 2R3JA 4AT3A 3DBFA 3LXKA 2OFVA 3RMFA 1Q3DA 4DTAA 3NR9A 3BU5A 4XV2A 3D5WA 3O17A 3QGWA 2PUUA 4CG8A 1XBAA 3NIEA 4UMRA 4JQEA 2CKOA 4DEAA 3CLYA 4M15A 5IISA 3DLSA 4HPTE 5D9HA 2OLCA 4I5MA 3CKXA 1XH7A 2I0EA 3KY2A 3R8VA 1PW2A 1TQPA 3QQJA 4NTTA 1H26A 5BX0A 5KUPA 3NS9A 2KULA 2Z02A 3WI6A 4BIBA 5IA3A 2X8DA 4DFYA 2JLDA 3O7LD 5GIOE 3LJ2A 4C38A 3F3UA 4HNFA 5TT7A 2ITVA 3PJ2A 4L53A 4AN9A 5ANOA 5F1ZA 3KXZA 1Q8YA 4P5ZA 1VZOA 1FMKA 4CRLA 2A2AA 4IAFA 3FUPA 1Q8ZA 4DN5A 5J9ZA 3U6HA 2VX0A 3ZHPC 3CEKA 5HO7A 3N51A 5FTQA 3ZBXA 3V8SA 1AGWA 2OSCA 3P4KA 4JXFA 4MVFA 5HI2A 3QRUA 2OZAB 2FUMA 3TN8A 1QPCA 4H1MA 1E1VA 4I24A 2C69A 2VRXA 3HYHA 5EG3A 5F95A 4UN0C 4CQEA 1XH6A 4NFNA 4BGGA 3H4JA 4OTGA 3R9NA 2XVDA 2W1FA 3MB6A 4MF0A 5FQDC 4DFNA 2QOQA 3B8RA 3HP5A 1YDRE 3ALOA 4FIEA 4O21A 4OTIA 4AUAA 5FRIA 2ITPA 4O6LA 4ZTMA 3OT8A 3WZUA 5HE1A 1MRVA 3ERKA 3I0OA 5DOSA 3FI3A 4U43A 2YM6A 4AA5A 4X6QC 1PKGA 2YITA 4TNDA 5AP4A 4RFZA 4M66A 3HEGA 2J0LA 3DFAA 3SX9A 5EI2A 5AADA 5C8KA 1YDTE 1YVJA 3CQUA 5CSHA 3OEFX 3FY2A 4UMTA 3OWLA 5H8GA 3CXWA 4BC6A 3F5UA 1O6YA 2R9SA 5BVWA 4CXAA 2XKDA 2HK5A 4MBLA 4FIHA 2VWUA 1I09A 3DNEA 3ZZWA 4GJ2A 3FLQA 4ANLA 3UOLA 4ARKA 5IZFA 2JDOA 4E8AA 2J51A 5H8EA 3S00A 3Q9WA 3P9JA 2V0DA 4GG5A 5DT0A 3VBQA 3A60A 1GY3A 5CU6A 4B9DA 1U4DA 5AUXA 3G33A 3K5VA 2BALA 3PFQA 4CQGA 4DFBA 1PY5A 2R3OA 4G9CA 4AOTA 4UMUA 5JFXA 3ZUTA 4PL5A 3FZRA 5EOBA 1P14A 4I0TA 2G2IA 4FNYA 1CM8A 4UMPA 1OB3A 4APPA 5CF5A 3NAYA 3R22A 2OG8A 2OO8X 2XK6A 3DJ7A 3EQRA 4EKKA 1WZYA 2JGZA 4GW8A 3N4TA 1GZ8A 5M08A 3QRJA 4D2SA 2GHMA 5KZ0A 4O22A 5IQAA 4KBKA 2QU5A 4QMVA 4WUAA 3ZO2A 2BZKB 4N6ZA 5KBQA 3BCEA 1DI9A 2CJMA 4NCTC 5JFWA 3QA8A 4F9BA 4ZTNA 5AX9A 3HUBA 3D2IA 1PMEA 2UVXA 3R01A 4OW8A 4X3FA 4O0YA 5AJQA 3HA8A 4KB8A 3SKCA 4AZWA 1WBPA 3BGZA 5AA8A 5HG8A 2WQBA 3Q5IA 4DEGA 4CV9A 3LJ0A 4CTBA 3FMJA 4ZSGA 5CU2A 5HNIX 3RPYA 3NNXA 3QAME 1OKZA 5JRSA 2WELA 1PHKA 4JRNA 4OR5A 2R3PA 3T8OA 2E9PA 1W82A 3VW8A 4ACCA 2E9VA 4KRDA 3VIDA 3NYOA 5GHVA 4U44A 2Q83A 3NUPA 2V7OA 4H58A 3P23A 2UW9A 3MFUA 2W4JA 2JFMA 3HV5A 4U80A 5E92A 2HZ4A 2XIYA 1H1RA 5DHJA 1JVPP 4ZXTA 4HGEA 1PXLA 3PWYA 3AGMA 4IH8A 4O27B 1R0PA 5ICPA 3PP0A 4M69B 5EM5A 1Q3WA 3UVPA 3E87A 3JVRA 3OTUA 2I0HA 3KU2A 3DOGA 3RBWA 4EC9A 3R21A 1UA2A 3GENA 3UC4A 4W4YA 4WG5A 4HVSA 3H9OA 3Q53A 5EKOA 2HOGA 2WMTA 3DBCA 2R0IA 2VAGA 4L8MA 2I0VA 1MUOA 4EH9A 4DH1A 2C3LA 2OJJA 3NUYA 3CGFA 5EHOA 1YOJA 4MKCA 1MRYA 5HESA 3DK3A 3DA6A 4X6RA 4APCA 1IRKA 4O84A 2H6DA 4ZY4A 4E6CA 4IWPA 4TNBA 3F82A 4BB4A 4DH3A 4J95A 3MH1A 4FIJA 4B6LA 4EJNA 5J95A 4C34A 1S9JA 4BDGA 3EQBA 3ZH8A 4J97A 4MAOA 5CEIA 2QU6A 4FIFA 2XBAA 3RHKA 4J99A 4ZSJA 3E88A 1O9UA 4FT7A 2WTIA 2WGJA 4L44A 3PY1A 4JDHA 4RIYB 2BZIB 3P86A 1OITA 4QMOA 2PULA 2Z7LA 3AC2A 3C5UA 3ZFXA 4DCAA 3HX4A 3KN5A 3UOKA 3KMWA 3VS4A 4CYIA 4EH8A 4ERKA 5BUEA 1UVRA 4OTRA 5HG9A 3GOKA 1KV1A 3Q4TA 3T9TA 3P7CA 3CP9A 4EZ7A 2VX1A 3VULA 1OL5A 1RQQA 2NO3A 3VHKA 1GAGA 4AGCA 2PE1A 3P78A 5IA2A 4YU2A 3PIXA 5TKDA 3W2OA 4FEUA 3E7OA 4ACDA 5M4IA 1P4OA 2BZJA 4M68A 3I79A 4QNAA 3SAYA 1VYWA 4RWIA 1Z5MA 4JG7A 3R8MA 1J1CA 2UZOA 3AMBA 3BIZA 4P90A 5CTPA 1PXNA 4CRSA 3GU5A 3E3BX 4S2ZA 4MWHA 1H00A 3QL8A 1H08A 5CZIA 1UNHA 4LGDA 3FE3A 4ID7A 2HY81 2OF4A 3KKVA 3GU7A 2YFXA 3QYWA 1O6KA 4D9TA 4AGDA 2XEZA 3D94A 4GRBA 2O2UA 2Z7SA 3CR0A 2YM5A 3MA3A 3Q2MA 2VWYA 4K2RA 4P2KA 4FT9A 4EH5A 2YEXA 3LCDA 5EW9A 3BRBA 4D9UA 4ENYA 4R1YA 5AR4A 3PJCA 3QUPA 4XYFA 5CWZA 4E5BA 1PMNA 5IPJA 4UX9A 1OBDA 4I6BA 5CXHA 4MD8E 4QRCA 3V6SA 3DJ6A 1OIYA 3LPBA 4FTUA 4NCTA 2QOHA 3BEAA 2GNLA 5E8TA 4EOMA 2W17A 3ORTA 3VQHA 2QURA 5CNOA 2B52A 3NEWA 4Q2AA 4FKOA 4FEXA 3DCVA 2WMWA 4G6LA 3SOAA 2GQRA 3R9DA 4HGSA 2ZV7A 2CN8A 4D4RA 1W84A 3QZGA 3MESA 4DA5A 2C6DA 3QRKA 4USFA 1FVTA 1PXOA 2PE2A 4FYNA 5IG1A 2Z60A 4DH7A 4OAVB 3CTJA 3HVCA 4QTBA 3ZDIA 3HRFA 2FVDA 3DJ5A 4BKJA 4DAWA 1W7HA 2F49A 4RA4A 3U54A 4QMUA 3OCTA 5IDPA 4IAIA 5CLPA 5BPYA 2DQ7X 3TV6A 4RC2A 1FPUA 4YSMA 2IN6A 4GFGA 1ZRZA 4M0YA 3R9OA 2XNGA 5CY3A 4AOJA 3FZSA 4IZ7A 4ITIA 3DZOA 3S4QA 4UBAA 4XBUA 4J96A 5KZIA 4LGGA 4YZ9A 5IQGA 3RHXA 2I1MA 2YCQA 2VTOA 2R3LA 3QX4A 4KIPA 5DT3A 4C7TA 5AAGA 4C62A 4OTQA 5HLWA 3E5AA 4LL0A 2JDTA 3II5A 4RZVA 4X3JA 5GNKA 2W96B 4O1PA 3VNTA 4EOKA 4O0XA 5CAUA 3IGGA 3MTLA 3SOCA 5KMOA 4RGJA 2VGOA 3R9RA 5IQEA 4HZRA 1YXUA 4C8BA 3JXWA 1WBVA 3Q32A 4P4CA 4Z9LA 4XG2A 3R8ZA 3RI1A 3U8WA 3KULB 4FNZA 5BVFA 4M14A 2FA2A 2XF0A 4K18A 5HIEA 3OZ6A 2IZTA 2Q0BA 4ANNA 2YM8A 3KVWA 2PU8A 4E5WA 4FSTA 3RZFA 5A4CA 5C1QB 1SNXA 4MEDA 4F63A 4AACA 5CAPA 3EQGA 5CSPA 4YPSA 5IUHA 4NIFA 2OXYA 5FDPA 2Z2WA 3OW4A 4PDYA 3PA4A 5HNBA 2ERZE 4IHPA 4FIIA 4ALUA 5J9YA 5JFSA 4H1JA 5EHLA 2PVRA 1H28A 2PMNX 3D9VA 2BCJA 4RRVA 4FTNA 3PXRA 3FV8A 3ROCA 3A8XA 4W4WA 3K3IA 3OTVA 2YDIA 4BRXA 3TNIA 1JLUE 4ACHA 4DBXA 3TZ8A 2WMRA 5IUGA 1T45A 4FEWA 5IH6A 5IMEA 3JUHA 3PG3A 4LFIA 3HAMA 4C4EA 5JN2A 2CSNA 1Q97A 2UUEA 3BHTA 4V05A 2W1IA 4Y73A 4QMQA 2OFUA 4KNBA 3WZJA 4LOOA 4EK6A 4FMQA 3R7IA 4K11A 2VZ6A 2C5NA 2ZVAA 1JKSA 4IZYA 4ANBA 2J9MA 4XLIA 3FI8A 4UYAA 4W8DA 2VTPA 3MS9A 2JIIA 5I4NA 5DA3A 4DEIA 3GP0A 3RP9A 3O0GA 2OJFE 4X3FB 3VRYA 3Q4UA 4XRJA 2ITWA 3QQFA 5FXQA 2FSLX 4Q5EA 4C3RA 4N0SA 3ZS5A 2FGIA 2RF9A 3AQVA 2FSMX 4FE2A 2ONLC 4MXZA 5EDRA 3DDPA 4QMXA 3ZLYA 1H1QA 3FXWA 3RM6A 2UZVA 4O0RA 2ZM4A 2VTHA 4J53A 1PXKA 5DG5A 5DR6A 3FKLA 4PP7A 2YDJA 2XJ1A 2ZM3A 1Q61A 5FM3A 5M4CA 3TDWA 4DEEA 5L8KA 4A4XA 4BYIA 3Q9ZA 3ZDUA 4XEYA 4RVLA 2QODA 4EKLA 2RKUA 4EOPA 2PVFA 2OW3A 2W7XA 3L1SA 4OGRA 3WF5A 5J1WA 4IC7A 2XEYA 5C4LA 3ROYA 2JC6A 3I4BA 2A27A 3KGAA 4U45A 3IKAA 4MQ2A 5AM6A 1TVOA 4RLKA 3UODA 3FPMA 3NGAA 1J7UA 4CVAA 4HVHA 3EZVA 2EXCX 4TWNA 4E1ZA 2UV2A 4CFWA 3UOHA 4GSBA 3LQ5A 3FL4A 4GEOA 2ZV9A 1QL6A 4L67A 2X7GA 4MX9A 3KRWA 3VBYA 3ZRKA 3ORZA 5LVLA 4K33A 2C5XA 4D1SA 4G17A 2OKRA 2JD5A 2VGPA 2A4LA 3CD8A 4G3GA 5EDPA 3AT2A 2AC5A 4IVCA 4UY9A 3LXPA 4MCVA 4XLVA 4BCQA 1Q62A 1H0WA 3O7LB 3FJQE 3FC2A 1K3AA 4JX3A 2UZDA 4OBPA 5HCZA 3GNIB 3JYAA 2GCDA 2OI4X 2PTKA 2RSVA 2X7OA 3NCZA 3IW5A 5A4LA 2VTTA 3V51A 3T9IA 4WNKA 3WYXA 2RFDA 1Q8WA 3DU8A 3LM5A 5E8SA 4CFUA 4F6UA 3KREA 2OZAA 4BI1A 2RG5A 3FKOA 1Y91A 2YIYA 2YAKA 3F9NA 5HD7A 3ATTA 4LI5A 3HLLA 4QPMA 5HG7A 3GT8A 4D55A 4OT6A 2VTMA 3DAEA 2ZV2A 4OT5A 2OJGA 4BL1A 5TOZA 4X0MA 5K5NA 2ZB1A 3M11A 2XNPA 4FKUA 4AW0A 5GINE 5J87A 3EOCA 4CKJA 1VR2A 2JKQA 4YPDA 3RK5A 4AT4A 1M14A 3DV3A 4ZSLA 3TNQB 5AAFA 3FHRA 5DIAA 2R7IA 3BLQA 1J1BA 5DGZA 3ZYAA 3R02A 3UE4A 2CKPA 3R8PA 3CD3A 3LAUA 5FUTA 4DHFA 5ANIA 3EQHA 2UZEA 4II5A 4PMSA 4CFVA 3I7CA 4C2WA 4CV8A 3R8UA 4E7WA 2UVZA 3TJDA 4D5HA 2RGPA 1JBPE 1PXPA 1IEPA 3BEGA 3OWPA 3ALNA 1RDQE 3V8WA 2B54A 3ZRMA 2QOOA 4RJ8A 2XB7A 3ORNA 4BDFA 4C0TA 5CAVA 5IU2A 5L6PA 3P08A 4GYIA 4YSJA 1BMKA 3F88A 2ZM1A 3PXQA 3UG2A 4WNMA 2HCKA 3FMLA 2IVVA 3WZKA 4J71A 1Y8YA 3OOGA 3V6RA 5HBHA 2JAVA 4AA4A 1KV2A 3QTSA 4J8NA 4TRLA 2OJIA 4TYIA 3QYZA 3GQLA 2B1PA 2C5OA 2ITQA 3EL8A 5KKRC 3C1XA 3GCSA 2FSTX 4O96A 4QT1A 1OIUA 4R3CA 4XHKB 4IB0A 3ZO3A 4WNPA 3VS3A 5CU0A 1LPUA 3G0FA 3B2WA 2ONLA 3DGKA 3QHWA 4IWDA 1ZYLA 1PMVA 4DFUA 2ITTA 4IZ5A 4AE9A 3GCPA 4QP3A 3FXZA 3RCJA 1XBBA 2VO3A 3CBLA 4AW5A 3JY9A 3DNDA 2F7ZE 5JFVA 2J7TA 3EMGA 5A3XA 2R4BA 4NM5A 4XG6A 2PUNA 3BZ3A 4WSQA 3HP2A 4MF1A 5E91A 5EYDA 4AP7A 1Q41A 4GUEA 3MJ1A 2RFEA 3TWJA 2YERA 4TPTA 5L2QA 3PVUA 4WBOA 5HICA 3VRZA 4PY1A 4FTTA 4XG7A 2QG7A 5ANKA 5KE0A 5ITAA 4CZYB 4YJNA 4DFLA 5E4HA 1ZOEA 4EOJA 4PQNA 4TWPA 4BZDA 1JKLA 4Q9SA 4WSYA 2XH5A 1YOLA 4M67A 3GVUA 4EWQA 4D2WA 2W1DA 2Y4IC 3CTQA 4FUXA 5DBXA 4CNHA 3TUBA 4NM0A 2J4ZA 2HZ0A 3B8QA 2X8IA 4D28A 4FZ6A 4R3PA 3RAIA 4NZWB 2W5BA 3CKWA 5EYCA 5D11A 4QTAA 5AP2A 2V7AA 4C3FA 4BZOA 4EYMA 5JGAA 1A9UA 3SW7A 5K0KA 3PLSA 1U5RA 2C4GA 4I23A 3MY5A 1IASA 2X9EA 5AIKA 1BI7A 2W1GA 2B55A 5FD2A 2V22A 4FKJA 3DZQA 1SVGA 2A1AB 2JEDA 4YZDA 3TNHA 5L3AA 2C6LA 4NIFB 5AUVA 4A9RA 4ZIMA 4BHZA 2X8EA 2X2LA 5E8WA 3UZRA 3VUIA 3FMNA 2R3IA 4PV0A 1H25A 4NT4A 4XG3A 3C0HA 4YJSA 3VUKA 4B0GA 4IAZA 3G90X 4GKIA 3FMMA 2P55A 2PVJA 4XS2A 3VAPA 1UNLA 4S32A 4UWBA 2WU7A 2R0UA 4U41A 1XH9A 4XOYA 3D7TB 5AP1A 3GU6A 4IM0A 4PDOA 5AV0A 2PUPA 2IJMA 1OIRA 4MD9E 2R3KA 5KCVA 1R78A 4EHZA 4IJ9A 1PMUA 2JDSA 2B53A 4JG8A 4LRMA 3VJOA 3VO3A 2PMOX 4GK3A 4C57A 4RA5A 4EOOA 4RWKA 1CKPA 3L9MA 3COIA 3FSFA 5F4NA 4TY1A 5JEBA 4QYHA 4AN3A 4R7HA 1H01A 1P5EA 2QR8A 5DMZA 4O7TA 4O83A 3QCSA 1QCFA 3L8XA 4CKIA 1EH4A 3OCBA 5HIDA 3BYOA 4D58A 1PYXA 2YCFA 4EHGA 4RFYA 4NKAA 2O64A 5B0XA 5M07A 3BGQA 4IANA 4CD0A 3ZRLA 5CALA 2GNIA 3Q3BA 3QU0A 5L8JA 2CMWA 2DWBA 3HMNA 1DAYA 5ANEA 3QKLA 4ZZNA 2KTYA 3E8DA 3LHJA 1CKIA 4XMOA 3U51A 2JIUA 4DEDA 4I6HA 4BIEA 4O7NA 5DVRA 1LUFA 2BIYA 4Y72A 3R7YA 1HCLA 2PMIA 4D2PA 4U0IA 4EONA 4FKVA 5KMKA 3HV4A 3MPAA 4O0WA 1BUHA 2PE0A 3WE4A 4FNXA 2WMVA 3TDVA 4DEHA 2AUHA 4BCFA 5J7BA 1SMHA 3FYKX 3BI6A 4FZFB 2GFSA 2JBOA 4RIWA 3QCYA 4L00A 2BTSA 3EWHA 2ITOA 4CT1A 2EWAA 4IJPA 4PTEA 4ZTHA 2CGXA 3PSDA 4BTFA 3RAWA 4GG7A 1T46A 1U54B 2EXMA 2ITZA 2OICA 3KRLA 5KX8A 2PPQA 3O8PA 4O86A 3FKNA 4HCTA 3EFWA 4RQVA 4USEA 4MXXA 4FSZA 2C1AA 1J3HA 4L3JA 1QPEA 5BUIA 4DEBA 2OWBA 5JMSA 2WQEA 3PIZA 4KKEA 4HVDA 3KVXA 3QXOA 5DEWA 4K9YA 1KOBA 5E8ZA 3SXSA 2I40A 3NWWA 5KO1A 3AOXA 3GC9A 3NYNA 3OCGA 3OY3A 4CLIA 2ITNA 2W1CA 3OHTA 4WT6A 3ZEPA 5JT2A 2B4SB 3GU4A 3KCFA 4H36A 3SVVA 4Y5HA 5CU3A 1K9AA 5CEKA 4ZS4A 4F64A 4A9UA 3BHUA 3Q60A 3IOPA 4FV3A 4IZAA 3V5QA 2RIOA 5AP3A 2FYSA 5M06A 4I5HA 2WMSA 4IX5A 4B8LA 4Z55A 5CANA 2Y0AA 3EJ1A 4BCIA 4N57A 4FVRA 4LL5A 4W4XA 3NCGA 3H3CA 4ZS0A 3UP2A 2F4JA 5A4QA 4IB5A 3MVLA 2PVLA 5E1EA 5FM2A 1YKRA 4TYGA 5EQEA 1R0EA 3PE2A 4QTCA 3EQIA 2WMQA 3R30A 2GSFA 3QTQA 1ZYCA 3S0OA 3QUDA 5IKWA 5E1SA 4MNEA 3EQFA 4DH5A 4WRGA 4B7TA 1G8AA 2EB2A 2OBJA 5KMLA 4FKSA 3KN6A 4XP3A 2CKEA 4RX9A 3SRVA 4QP2A 4BFMA 1GZKA 3DQWA 3KXMA 3KULA 3PZEA 3NVMB 2B9IA 3LCSA 4HW7A 3NW6A 3W32A 2OU7A 3F69A 3MSSA 4FG9A 3FLNC 2PVKA 2XRWA 3Q2JA 4RFMA 3VS6A 5JK3A 4GJ3A 3EHAA 4E6DA 4TXCA 5IQIA 2ZAZA 1IA8A 3G6HA 3GXLA 3IDBA 3ETAA 5TR6A 5ANJA 2QLQA 4FT3A 4H05A 2VTJA 4IFCA 3C13A 4I3ZA 4Y85A 3EIDA 4KKHA 1FVRA 4E4LA 4DT9A 2VNYA 2P2HA 5T68A 3RK7A 1CTPE 4EH6A 1A06A 5K5XA 4A07A 4OBQA 4E4NA 2QOKA 3FC1X 2CNQA 2BKKA 3TL8A 2PZIA 1XQZA 2WPAA 2YJSA 4GS6A 3EFJA 4QP8A 3FHIA 1ERKA 3DFCB 4GL9A 4V0GA 5HNGA 5DI1A 3KQ7A 4FSRA 4E5AX 4W9WA 5HBJA 4YHJA 3NUAA 3MFSA 3R1SA 3MIYA 3HL7A 3W1FA 4JAJA 4JS8A 3R7UA 2VWVA 3QQHA 3DBQA 2VTNA 4MXCA 2WZJA 3D5UA 5CNNA 3W2CA 3RPVA 3R63A 4LG4A 3TZMA 4FTAA 5L2SA 3DBDA 4UYNA 4ZTSA 3W10A 4S30A 3OWJA 2XK7A 3LFDA 3A4OX 4RC3A 5LCKA 3QZHA 4G3CA 4KWPA 3VQUA 3BE9A 4BDHA 4L9IA 4HPUE 4D0XA 4AA0A 4OBOA 5IEXA 5E90A 1W8CA 3DTCA 5AR3A 4DTBA 2J2IB 3Q6UA 3EFKA 3MY0A 4QYFA 5H8BA 3IOKA 4O7WA 3RK9A 4AW2A 4KS7A 3AC4A 3PXYA 4O6EA 4D1XA 1R3CA 4PWNA 2Y8OA 2C68A 1UU9A 5IA4A 4BICA 3AT3A 3VJNA 3R9HA 4CYJA 3SRVB 4NUSA 3UIXA 5C9CA 3O96A 5F9EA 4QQCA 4I4FA 2BTRA 4BI0A 4EHEA 3M2WA 2YWPA 4JBPA 3KC3A 4FT5A 4FV6A 5EYMA 3I6UA 4AOIA 5GZAA 2X6EA 4I21A 3QC9A 1W83A 4YP8A 1IA9A 4RJ5A 4GUBA 1BLXA 4IIRA 5JZNA 5HQ0A 4X2GA 4LQMA 3ORLA 4NYEA 1FVVA 2BMCA 4DITA 2YIRA 2WFYA 2ZV8A 3R7EA 4DG2E 4YC3A 1QPJA 4JDJA 5HIBA 4D0WA 1ZMVA 2WQMA 1ZOHA 1GZOA 3C51A 3R0TA 2R3FA 5FBNC 1MQBA 1V1KA 4D4VA 4EK5A 3QX2A 3OF0A 4D2RA 3ATSA 3F3ZA 4IB1A 4GFMA 3COMA 4FV7A 1DAWA 4MXOA 3TUDA 2PWLA 3U6IA 3SC1A 2VU3A 3VUTA 3VF8A 2PSQA 3ZONA 3IGOA 3ZC5A 4YLJA 2PZ5A 5TF9A 4O2ZA 3NYVA 5IH5A 5CAOA 4XG8A 5FEDA 4ACMA 4R8QA 3ZUVA 4EUUA 4BCJA 2XA4A 3BPRA 1E9HA 3LLTA 3LXLA 3NUUA 4CFNA 3UPZA 3QCQA 2YJRA 2WIHA 2XIRA 3UNZA 4C4HA 3VBVA 5JKGA 4O0VA 2CN5A 3H10A 4EK8A 4GK2A 4ENXA 3V5JA 4O7RA 2JFLA 2NRYA 4HGLA 4IM2A 2BRGA 3UIBA 1G8SA 1NVSA 2YM4A 5HVYA 1REKA 3ZTXA 1M2PA 3LVPA 1OUKA 4ZTLA 1UU8A 2W4KA 5DYJA 2P0CA 2XRUA 4QMTA 3MH0A 4QYGA 2YWVA 5BMMA 3QQLA 1BL6A 1DM2A 1M2RA 3F66A 4D2VA 5I9WA 2X81A 3BGPA 3PPJA 4FV8A 4X2FA 3MI9A 3C4WA 4OTDA 3W16A 3RZBA 4BDAA 4XG4A 5LARA 3W18A 4EZ5A 2BZHB 3BBTB 3UO6A 2EU9A 1APME 3NNUA 5CENA 4O7LA 4YUQA 4FK3A 2UW0A 3SLSA 5KKRB 2C3KA 3U9NA 4U9AA 2ZDUA 5ACBC 4YURA 4BKZA 4KRCA 5KMJA 3VBTA 2IG7A 3AMYA 1ZYDA 4A9SA 4AX8A 4KBAA 3FLZA 5BVKA 4EI4A 4KSQA 3FLYA 4X2NA 3ET7A 3RPRA 4RIWB 4QQTA 3PA5A 5C8MA 4NFMA 2ETKA 4QMPA 3GU8A 2QONA 3W8QA 1GIHA 2VX3A 3LCOA 3E8CA 4FSUA 5I9VA 3UZTA 1U59A 3VN9A 3C0IA 1FMOE 1WBOA 1YXSA 2JBPA 2UW5A 3LMIA 3EN4A 3TKIA 1OPKA 5HE3A 3UO5A 5AP7A 3ZSIA 4RT7A 4DC2A 4JVGA 3LXNA 2C0IA 4GV1A 3EB0A 2YACA 1P4FA 3MTFA 3UPXA 2AC3A 4EH2A 4L45A 1OGUA 5C03A 2W5AA 3I5NA 2WTCA 4D1ZA 3GBZA 1F3MC 3DKCA 3KXGA 1BX6A 5HG5A 3H0ZA 3I7BA 5LMBA 5FP5A 4C61A 3PPKA 2IVTA 4FL2A 4BDCA 2HYYA 4WD5A 4O38A 3DXNA 4GU9A 3QC4A 2Y4IB 3R2BA 4FNWA 4XV9A 4YLKA 4I20A 4ANSA 4KIKA 2XK4A 4QOXA 4FBXA 5GJFA 3T3VA 5AWMA 4C4FA 4F1TA 3L9PA 3ZEWA 4XCUA 2BRHA 3NYXA 3DB8A 4R77A 2XIZA 4PMMA 4XBRA 4RMZA 3AD5A 2NPQA 5EH0A 3UYTA 4EH3A 1SM2A 1S9IA 2PL0A 4O0TA 2DS1A 4IFGA 4MNEB 5DFPA 2ITXA 4DFXE 3FZPA 2BHEA 4YNEA 3K54A 5AR8A 1WBTA 3ZOSA 3G9NA 5DRBA 4EL9A 2H9VA 3UOJA 4LV8A 5LMKC 1YI4A 3D5VA 2W9ZB 3IPHA 4JDIA 4PMTA 3R7VA 3N4UA 5IEVA 4C58A 2GFCA 4DG3E 2ZYBA 4FG7A 1KE6A 4WG3A 5HCXA 3EQCA 4G5PA 3VW6A 3T3UA 3REPA 4JI9A 1VYZA 4I5CA 2WEIA 1SVEA 2YIXA 4BKYA 1I44A 3KRJA 3ODYX 4I93A 2GQSA 3IQ7A 4R1VA 3ULIA 4E93A 4G5JA 1UU7A 3D0EA 2HW6A 3D2KA 3A4PA 3W55A 2XNNA 5DLSA 2C1BA 2QD9A 5TO8A 3LFNA 5CF6A 1LEWA 2C5VA 4GMYA 4UWCA 5HGIA 2GQGA 3D4QA 3WF8A 2IVUA 3FMKA 3S2PA 3GC8A 4Z16A 2FH9A 1FINA 3CCNA 3D83A 2XNMA 4EQMA 5CI7A 4FSYA 3DPKA 4GVJA 4PPAA 3C4FA 5B7VA 1WAKA 5K4IA 1Y8GA 2J5EA 1ZARA 2GPHA 5BVNA 2HW7A 3D7TA 4V0GB 4MYGA 5B2KA 3MWUA 4J8MA 4TW9A 4EK3A 4D5KA 3UDBA 3P7BA 3TTIA 2Y6OA 5CXZA 4FSQA 2VTAA 2PVYA 4PRJA 4BDIA 1YI3A 4CKRA 2QNJA 4B99A 5LVMA 3QTWA 3TM0A 2J0KA 4FTIA 2VWXA 2G9XA 3F5XA 4QNYA 4E6AA 4PUZA 2UVYA 4W4VA 4LGHA 2O5KA 2WTJA 5AP5A 5EDQA 4FOBA 2VNWA 3HRBA 4FTLA 5ETFA 3LFBA 5CVFA 1AQ1A 2OK1A 4ONAA 1WCCA 2OF2A 3DDQA 3EN9A 5HVJA 3SD0A 4XH6A 5ANDA 1YOMA 3EFLA 3RPOA 1Q4LA 3VS2A 4U5JA 2BAKA 2W5HA 1X8BA 4BYJA 1KE5A 3TT0A 3SQQA 5I9XA 3FSKA 4RX8A 3W33A 4ZJJA 5CYIA 3CQWA 3PYYA 5EW8A 5KBRA 1GZNA 1FGIA 2XZSA 5LWMA 4UV0A 2VWZA 4KKGA 4BCGA 3AMAA 3QZIA 4MTAA 1GOLA 5KMIA 3ZO1A 4XX9A 4ZSAA 4RVKA 3OP5A 3MBLA 2GS6A 3BU3A 2OIQA 1BYGA 4FKQA 2Y6MA 1WBSA 5DWRA 1TQIA 5GZ9A 4JLCA 3PSCA 1WVXA 2O0UA 4QMNA 2UW8A 4ZTQA 3F2AA 3O2MA 4YHFA 2BDJA 4EC8A 3F3VA 4M13A 4FEVA 2VTQA 2QR7A 2PVMA 3BX5A 1U54A 3QTUA 5HCYA 3TIZA 3ZLWA 5L2WA 2XBJA 2BAJA 2JIVA 4C4GA 3PPZA 2PHKA 5C27A 4Z7GA 4IEBA 4BTKA 4FI1A 1NW1A 1ZMWA 1KE8A 2QO7A 5LCJA 1ZOGA 4EUTA 2YN8A 3DLZA 2R2PA 4L52A 4YJUA 3PZHA 4IC8A 3N4VA 2QG5A 2QKWB 3C5IA 2UZNA 2LAVA 3FBVA 1OZ1A 3PJ3A 3AC3A 5EM8A 1FQ1B 1YHWA 5IQDA 4ZP5A 4JDKA 3KXNA 3VWAA 5I9ZA 2C6KA 2WOUA 3Q9XA 3UP7A 2C6TA 2JAMA 3GQIA 5M57A 3NZ0A 4OTHA 5LMKA 3SHEA 2X2MA 4PL4A 1YDSE 2X6DA 3OW3A 5IQBA 5IMXA 4ZZMA 3TJCA 4F7LA 1NVQA 3F3TA 3VHEA 1E1XA 3NW7A 3WF6A 4R7BA 3L8PA 1OKYA 5IA1A 2QO9A 4BDBA 4F7JA 2ETRA 4FTJA 4RWLA 1YXTA 4A06A 3CJFA 3VS5A 5AP6A 3PDTA 3NNWA 3TZ7A 4ZLYA 4Y46A 1UV5A 3F7ZA 3NIZA 3DS6A 2YA9A 4CFXA 4I1ZA 4HGTA 3KMMA 2ZDTA 5ETIA 4GH2A 4I6QA 4U3ZA 3TACA 3IW4A 4I6FA 3NUSA 4DYMA 3WF9A 1YRPA 3PIYA 3U9CA 4QMMA 4CFMA 4AGWA 4AE6A 5A6NA 1CKJA 5D7VA 4QD6A 5J9LA 2Z7QA 4QMLA 4S33A 5FBOA 2BDFA 3BYMA 4FUYA 3CY3A 3BLHA 1UWHA 4FZDB 4U79A 2PYWA 2QHNA 4HYHA 3OVVA 2CCHA 2XJ2A 1V0BA 4HZSA 4F65A 1ND4A 3DXQA 4YLLA 4PPCA 3WZEA 4BDDA 1PXMA 3ANRA 5T6KA 3QKKA 1PYEA 2I0YA 3CJGA 5C26A 2C6IA 4O7ZA 1Q24A 2R3HA 2YISA 4GT4A 4F08A 1YQJA 3MW1A 4FR4A 4DCEA 3OXZA 2XCHA 2X4FA 3AC5A 3ZLSA 2BVAA 4HJOA 5HD4A 2CHLA 2UZBA 4FKLA 5FTOA 3UQCA 4O7SA 4DH8A 2CNVA 3LOKA 1UWJA 1KWPA 4MWIA 4DT8A 3HV7A 4C59A 4RPVA 2QO2A 4RLLA 4F6SA 3Q04A 2CGVA 2QCSA 5CF8A 4NM7A 4I0SA 2AYPA 3ZMMA 3P1AA 3QQGA 2YCSA 3FXXA 2P2IA 1XR1A 4L42A 2YLEA 2R3QA 2XKFA 3JPVA 4NU1A 3GI3A 4HOKA 5IDNA 4FV4A 2VUWA 5M51A 3A99A 5IQFA 2HAKA 2ZMCA 3CC6A 4ZJVA 5CAQA 4RVTA 4L6QA 1RE8A 3W8LA 5IEYA 2VTLA 3BYSA 5ANGA 2CDZA 3IW8A 5HHWA 2PZYA 4ANQA 4FYOA 2SRCA 4KIKB 3DTWA 3WILA 1ZLTA 4KS8A 5DNRA 4C2VA 2GS7A 2WKMA 3PXKA 5IQHA 1ZAOA 1H4LA 2F57A 2QVSE 2WQNA 3SDJA 3TXOA 3ZO4A 2JDVA 2OXXA 4RJ7A 3ACKA 3K2LA 3BHHA 3PVGA 1CMKE 2BPMA 1ZXEA 2FSOX 4NSTA 4NW6A 3KB7A 4QMYA 4X2KA 3L8SA 5G1XA 3G2FA 3OROA 5A4TA 4IMYA 5CEOA 1F0QA 2EVAA 4FV9A 5H3QA 3IW7A 3LCKA 3NRMA 2ITYA 4ZK5A 3W2QA 2GU8A 5I0BA 5AV4A 3RNYA 3WBLA 3U6JA 4JOAA 2F7XE 3IS5A 3NLBA 4PP9A 1MRUA 3HA6A 5ETAA 2DUVA 3TV7A 4AQCA 4BBMA 5LWNA 4I94A 2X4ZA 4L3PA 5EYKA 5LJJA 2WD1A 3K3JA 3R83A 3ENHA 3MB7A 3MFTA 4R5YA 1ATPE 2QOCA 1REJA 2EUFB 3R1YA 3BV3A 4IQ6A 4J98A 5J79A 1Y57A 4AZTA 4ZMFA 4RJ6A 3ORKA 1GIIA 4FTRA 1XBCA 2I6LA 5GJGA 4AZSA 4L01A 4LV5A 3OUNB 5HLPA 2WIPA 3TI1A 4FC0A 4AAAA 4JBVA 3HDNA 1DS5A 4F9YA 3EN7A 3UGCA 3QZFA 3KCKA 1W0XC 4DFZE 5DRDA 2HXQA 2VWBA 4G3FA 4QO9A 4EQUA 2F2UA 4CMOA 3ORXA 3ZCLA 4QP1A 4RIXA 1JWHA 2Z8CA 3TTJA 4P5QA 3UJGA 3C7QA 4M0ZA 4ASZA 1NT2A 4IACA 2HENA 4NJDA 3C4ZA 4V04A 5FGKA 4IVBA 4CTCA 4TTHB 4DLJA 3C4CA 3F5PA 4AN2A 3KFAA 4NWMA 5E8VA 5LXMA 5DEYA 5JGBA 3LQ3A 1R1WA 3KXXA 4YNOA 3IG7A 5M44A 1Y6AA 2BIKB 4U6RA 2E9OA 5JGDA 3ELJA 3PVWA 5IQCA 4YJVA 2I7QA 5CZHA 1Y6BA 3FLSA 4BN1A 2BFYA 2QOLA 2W1HA 4FV1A 4USDA 4Q9ZA 5LVNA 1IG1A 4BCHA 5K4JA 2HWPA 4LMUA 2G2HA 3FMEA 3CPCA 3Q5ZA 3R2YA 3MYGA 4F0GA 4JIAA 4JNWA 1JQHA 3UVRA 3R04A 1YI6A 3E3PA 2X0GA 2YM7A 1WMKA 2IZRA 3FZTA 3NAXA 4U42A 4YTFA 1U5QA 3CE3A 4CT2A 4ZEGA 1Q99A 5JZJA 4O91A 2XUUA 2E2BA 2R3MA 2X7FA 3TNWA 2IZSA 1NY3A 2HWOA 2Y7JA 2NP8A 1Q5KA 3NUNA 3UC3A 5BYLA 3HNGA 3ZBFA 3M42A 3H9RA 1YWNA 5A6OA 3R8LA 2PY3A 3RVGA 1WBWA 5AM7A 3SW4A 3OFMA 4H3QA 3A7FA 3HKOA 3PY3A 5AR7A 5AEPA 1LEZA 4ZJIA 5L4QA 4XV1A 4C37A 4G31A 4CCBA 3D15A 3V04A 3SV0A 2GNHA 4BZNA 4DGLC 2IWIA 3QGYA 3P79A 4W8EA 5FWKK 1O6LA 2HY0A 4TYJA 3LM0A 5M4FA 4NKSA 3DAKA 4GKHA 3AC8A 4PPBA 3ORIA 4FTQA 4LUDA 2XKCA 3Q9YA 2BFXA 3DAJA 3QHRA 5T3QA 4EEVA 2XCKA 3E64A 3MH3A 2EB3A 5JRQA 3PVBA 4JL9A 2NNWB 3SXFA 1DI8A 1M2QA 4CCUA 2PMLX 4BR3A 4DF3A 4EOSA 3P5KA 2C3JA 1VEBA 4NH1A 3FI2A 3MVHA 5AIRA 2BRBA 3TEIA 2W4OA 4NW5A 5L2TA 5GIPE 3L9NA 3R1QA 2VTSA 1H24A 2UW4A 3G9LX 4IX3A 4XP2A 5H9BA 5HLNA 3QTXA 5FXSA 5EFQA 3TZ9A 3RKBA 2XP2A 2IO6A 4X21A 4BGHA 5HORA 2WAJA 2YAAA 3R7OA 4CG9A 4LRKA 4G1WA 2Y9QA 2QC6A 3W2PA 5AUUA 2YIQA 3SXRA 4FGBA 5EM7A 3RALA 3VBWA 5C01A 2HZIA 5EI8A 4BI2A 4RJ3A 4JJRA 3KRXA 3QA0A 3OXIA 4YGAA 2G2FA 3GGFA 4I92A 3FZOA 3HDMA 4K8AA 4BDJA 1QPDA 1B6CB 1YXVA 1B38A 3BWJA 5CEQA 4ASEA 3TKHA 3UG1A 1KSWA 2ZOQA 4FV2A 4FTOA 4L46A 1ZZLA 4L7FA 4UZHA 4DGGA 3QKMA 4YTIA 4CMTA 4A7CA 4L68A 4U3YA 2NRUA 2HIWA 5AV1A 5J5SA 2C0TA 3LCTA 5FDXA 2BAQA 5HTBA 3AXWA 4WUNA 1MQ4A 3RNIA 3CQEA 1PRYA 3HAVA 1ZMUA 4KA3A 4WRSA 2XK3A 5E7RA 1OPLA 2WMUA 3GCVA 1M52A 3DY7A 3GFEA 5EQYA 3LQ8A 2DYLA 3CS9A 2CGUA 4BY9E 5IA5A 3TIYA 2WMXA 3LLAA 2XNBA 5D41A 5CEMA 4U97A 1A48A 3QALE 4MK0A 1LP4A 2W06A 3MPMA 3QQKA 1SNUA 2C47A 3GEQA 3DKOA 3DQXA 4ANMA 4G3DA 4C33A 4F1MA 3PP1A 2WMBA 4PL3A 1WFCA 4FX3A 4FT0A 5C4KA 1ZY4A 4TYHA 3FQHA 2UZUE 3LFQA 3ZSHA 4XUFA 2XYNA 2YABA 3AD6A 3QQUA 4M7IA 4RG0A 5CF4A 5HU3A 4EZ3A 3R00A 4BDEA 4BWXA 5CVHA 4GVAA 5HVKA 3MPTA 4FTKA 1OL1A 4YJTA 4DLIA 3I5ZA 1JPAA 2CLXA 3BHYA 4AFEA 3DBEA 3BU6A 3VUGA 4YBJA 1G5SA 3UTOA 2OXDA 3FQSA 2W99B 4FF8A 4DGMA 4YZBA 5M4UA 2WQOA 1OL2A 2QOFA 5E9EA 4QQ5A 1UKHA 1SYKA 4WNOA 3BYUA 3RPSA 3I6WA 4YTHA 2BILB 1CSNA 3ZC6A 4B8MA 1K2PA 3RGFA 4HVGA 4DE4A 3HUCA 4QYEA 3Q4ZA 3RJCA 3V8TA 2F7EE 4RSSA 4UB7A 3DK6A 5FLFA 4JBOA 2V55A 3QD4A 2XNOA 4TZRA 2C3IB 3C9WA 3DT1A 3R6XA 3LJ1A 3BWFA 3HV6A 4FKGA 1V0OA 5HX6A 5AFVA 4DBNA 3VUDA 3NW5A 2IVSA 2YZAA 3A7JA 4FKIA 2J6MA 2J90A 4C36A 4IX4A 2QOIA 3AT4A 3I0QA 3MIAA 4FA2A 5KMNA 1URCA 5FTGA 4ZMEA 2HZNA 4DG0E 3GFWA 4KIOA 2XJ0A 1XH8A 5AUTA 5AUZA 3MFRA 4WG4A 3E7VA 3FEGA 2VD5A 4IXPA 2XKEA 3QD3A 5JQ8A 1OMWA 4A4OA 4OTFA 3TUCA 4F6WA 1GNGA 4MH7A 1JKKA 4AW1A 4YC6A 4MBIA 3EH9A 4EWHA 5HZNA 1OM1A 1WBNA 3A8WA 3H9FA 5DN3A 2WTWA 1YHSA 2PZPA 4J7BA 2B9HA 2C30A 3V5WA 5CI6A 3M1SA 4Y5QA 2H34A 2WNTA 4K1BA 2WOTA 4QPSA 2VV9A 3WYYA 2GS2A 4CGAA 3BQCA 4CZUA 1WVYA 4ZAUA 3D5XA 2B7AA 1KE7A 4FG8A 4DGOA 3FZ1A 3OBJA 4BCMA 2ZB0A 4M8TA 4I41A 4IAYA 2X1NA 4RIXB 3ORPA 4RC4A 1LR4A 4R6VA 3ULZA 1ZYJA 4BGQA 5K9IA 5M09A 5EM6A 4WO5A 2OZOA 4IB3A 2O65A 2VWIA 3ZLXA 4O1OA 5AMNA 4EOLA 5AUYA 3BKBA 3QF9A 4EORA 3A7GA 4S31A 4RWJA 5AR2A 5AV3A 3DKFA 3GC0A 3UYSA 2CPKE 4XG9A 5I5ZA 1OIQA 3C0GA 4JQ7A 4JRVA 3QTIA 4F70A 5AA9A 1MP8A 2BROA 4IDTA 1JKTA 3AD4A 3R1NA 3LFFA 3POZA 3UNKA 2REIA 2VTRA 4D4YA 4YZCA 5DR2A 3QLFA 4X2JA 4YHTA 1YXXA 2QLUA 3EQPA 3OXTA 4IADA 4ALWA 3OY1A 5H2UA 5L6WL 1L3RE 4GFOA 4CFFA 2WTKC 4BCPA 4R5SA 1M7NA 2A19B 4E3CA 3G6GA 3A2CA 3NSZA 4UEUA 5B2LA 4KBCA 4UXQA 1H27A 4F1OA 4F9WA 4O81A 4E20A 5I3RA 4A9YA 5CSWA 1JNKA 4QP7A 1WVWA 3KRRA 1BKXA 2J50A 4HYIA 4ITJA 3GUBA 3V01A 4XNEA 4ASXA 3GOPA 5BYYA 2XK8A 2H96A 4FV5A 1IR3A 5CSXA 3ZM4A 2PK9A 3KA0A 4IWQA 1OKVA 2RG6A 4F9AA 1XH5A 3QXPA 1ZY5A 2XIXA 3FQEA 4XOZA 3NMUF 1H1SA 4HCUA 3IECA 4BVUA 3FLWA 4YO6A 3UZPA 3TV4A 3ZM9A 4WOVA 4YBKA 4JT3A 1GJOA 5L8LA 5G6VA 3QBNA 2IW8A 4Q5HA 2B9JA 2GTMA 5EK7A 4MQ1A 4HYUA 5BMSA 3F7WA 2VTIA 3RAKA 2W9FB 1M7QA 3EL7A 3MA6A 4IDVA 1YWVA 3UVQA 4D4SA 5BUJA 3COKA 3CPBA 3PXFA 3ZU7A 5AV2A 4O82A 4F4PA 5JQ5A 3CGOA 3VS1A 3V5LA 2C6OA 2VO6A 3H30A 5BVOA 3DXPA 1SZMA 4IWOA 2IW9A 2FB8A 3E62A 4NTSA 3GB2A 4GIHA 4ACGA 3PJ8A 2JKKA 2GDOA 4QP6A 3EQDA 4GYGA 2J0IA 2V5QA 2X39A 4EBVA 5CX9A 1TKIA 2OGVA 1BI8A 1URWA 2XIKA 3UMXA 4R78A 3MH2A 4FVPA 2PVNA 3P7AA 4I0RA 3LE6A 4FOCA 4H3BA 4NEUA 5IUIA 5FP6A 5CASA 2C0OA 4FV0A 3IO7A 2O63A 3JY0A 4HCVA 3NPCA 2R64A 4O0UA 2UZWE 5HBEA 5AR5A 1NA7A 2OH4A 3BHVA 3ODZX 2BUJA 3C4XA 1XHAA 4IBMA 3F2RA 4ORKA 4AFJA 1G3NA 3RM7A 3S3IA 4V01A 1JSUA 1IAJA 3UQFA 5IA0A 3SGCA 3WIKA 5KHXA 1KE9A 4UZDA 1OPJA 3POOA 4F09A 2G15A 4EK4A 4OAUC 3LKMA 4FKWA 4AS0A 5A54A 5E8XA 4MHAA 3DK7A 2CCIA 4F99A 3I60A 4Y8DA 3G0EA 3KEXA 3A7IA 3ZSGA 4QQJA 4E6QA 2WTDA 5BYZA 1NVRA 4AF3A 4Z3VA 2BHHA 1OECA 3E8EA 4QPAA 4XP0A 4Y83A 5HKMA 4G2FA 5HE2A 3DKGA 5L6OA 2JDRA 5HEZA 3LFAA 4HNIA 2YZLA 3O51A 3OWKA 2XM8A 4B4LA 4GT5A 2W05A 3IK3A 4G6NA 4YTCA 3PJ1A 2UZLA 4OUCA 3PY0A 5LOHA 3OOMA 3HRCA 3QLGA 4G16A 3E93A 2B9FA 5C8NA 4UALA 4IVDA 2ETMA 2WHBA 2YM3A 3O50A 5CEPA 3BE2A 2F2CB 4ASDA 2ZJWA 2W1ZA 1VJYA 5CVGA 5DE2A 3V5PA 4QMSA 5HX8A 5AUWA 4KIQA 2G01A 4W9XA 4F7NA 4ANOA 4FKTA 3SG9A 3L9LA 4U40A 4GK4A 4M3QA 5HO6A 2J0MB 4TYHB 4R3RA 4KD1A 3UIUA 5J5TA 1YW2A 3PWDA 5A4EA 1Z9XA 2WB8A 4TN6A 4YO4A 2XS0A 3ORMA 1RW8A 3HMMA 2XYUA 2WTVA 4ZY6A 3UMWA 5LMAA 1P2AA 4AZVA 3H0YA 2CKQA 2XNEA 2XM9A 2GHGA 3BLRA 4GCJA 4FKPA 5LQFA 4RIOA 3FI4A 4ZTRA 4L43A 5HU9A 1HCKA 2VO7A 3ITZA 4DGNA 4E4MA 4FL3A 5BQ0A 4TYEA 4N4SA 3G51A 4JAIA 4WA9A 1OKWA 2A0CX 2BRNA 1Q8TA 2J5FA 1CDKA 2YLFA 5I9UA 2RL5A 3NDMA 4IAAA 1V0PA 3CSVA 1Z57A 4G34A 5ETCA 2ZMDA 5I3OA 4WKQA 4AG8A 2R3NA 3I81A 1PXJA 4IVAA 3ANQA 3WIGA 1H0VA 3F5GA 5FEEA 3OBGA 4FEQA 5CU4A 4FGRA 1H8FA 2BR1A 2QQ7A 5ACKA 2EXEA 5J8IA 2BRMA 4RQKA 4YC8A 4E4XA 3NNVA 4ITHA 4F9CA 5JH6A 3MN3A 3KK8A 3VUMA 3ZXTA 1XH4A 3QD0A 4NM3A 2WXVA 2H8HA 3QTRA 3UO4A 1FBNA 4F0IA 4JBQA 4M84A 4H3PA 4FL1A 3UIMA
chains in the Genus database with same CATH superfamily
3VUHA 2R7BA 2BDWA 2O3PA 3ENMA 5DPVA 1XKKA 3BYVA 4L3LA 4BWPA 4MXYA 4ZY5A 4RX5A 3OS3A 3V5TA 4AGUA 4BIDA 2P3GX 3B2TA 4ZZOA 3P0MA 5JSMA 2CNUA 2JKOA 3E63A 4FK6A 2VN9A 2QOBA 4S34A 5DR9A 3G5DA 3QRIA 3O8TA 4LOQA 3G15A 3HV3A 4K0YA 5TE0A 3UBDA 4O7VA 3W0SA 1R39A 3R28A 1JSVA 3V3VA 4EYJA 1AD5A 4O2PA 1ZWSA 3L8VA 4BTJA 4MBJA 3QCXA 3HECA 4U8ZA 3RWPA 2HXLA 3SA0A 4NJ3A 1W98A 3UNJA 2GHLA 3WF7A 4KAOA 4HYSA 5M53A 4QMWA 3C4EA 4JR3A 2X9FA 3RTPA 3PUPA 3VBXA 4AZFA 1PKDA 3BELA 2QHMA 4BCNA 5GZ8A 1XMLA 4CMUA 3FYJX 1IAHA 4MNFA 4DINA 3A61A 1JSTA 3QWKA 3Q6WA 4M12A 3FL5A 4YJOA 1PXIA 3THBA 4TT7A 2UW6A 4J52A 2LGCA 3PTGA 3Q4CA 3S1HA 1STCE 5EOLA 2WO6A 2X2KA 3PE1A 1UU3A 1PJKA 5D1JA 5E8UA 2GNFA 3Q52A 3U87A 2JKMA 4I4EA 3OC1A 4N70A 2ESMA 4Z7HA 1OL7A 2E9NA 5GJDA 4BCOA 1TQMA 3TG1A 2R3GA 1YWRA 2J0JA 4J1RA 4I22A 4R7IA 3S95A 3W2SA 3EYHA 1J7IA 3OMVA 4KINA 3KF4A 1F5QA 3BV2A 1JOWB 1H07A 4TWCA 4N6YA 2R5TA 2W0JA 3RINA 4E73A 5D12A 1VLRA 2OIDA 5I9YA 3FMDA 4PX6A 4UWYA 4MXAA 4WIHA 4RX7A 5IH4A 3N9XA 3HGKA 3RAHA 2YCRA 3VC4A 3TCPA 4YMJA 3QTZA 4AU8A 4X7QA 4GT3A 4RJ4A 1Q8UA 3GCUA 2PUIA 2GNJA 4EOQA 3EKNA 4PMPA 4XRLA 2Y4PA 3EZRA 4ZOGA 4NL0A 4KSPA 4PTGA 4QMZA 4YJPA 4BWKA 2OIBA 4LMNA 5LVPA 5CT7A 4PDSA 2R3RA 3WOWA 3UDZA 3LFSA 3EYGA 1U46A 2XMYA 4QYYA 4YJQA 3A62A 3FDNA 1H1PA 4PF4A 3RCDA 3VS0A 5BNJA 4FIGA 5FXRA 1JAMA 5HO8A 3R71A 4BBFA 5B2MA 4LM5A 4D2TA 4BCKA 3IONA 4FTCA 3ZZEA 3NX8A 3P5JC 4E26A 4G6OA 2IZUA 2UW3A 4AWIA 3U4WA 3ZUUA 2PVHA 5K3YA 3IDPA 4O4BB 5HTIA 3O71A 3PA3A 2BKZA 2WMAA 3QWJA 4IW0A 4YJRA 2V62A 3LMHA 2JITA 5HOAA 3MJ2A 4FZAB 3CTHA 4K77A 5CT0A 2CGWA 4LRJA 2O8YA 4UXLA 2VO0A 5D10A 2WEVA 1OI9A 1ZZ2A 3ZXZA 4ZLZA 3VONA 4OTPA 1GIJA 3FWQA 2C5YA 2YDKA 3W2RA 4QTDA 1ZYSA 3QRTA 4A4LA 3KK9A 3A7HA 4YZNA 5CS6A 4CEGA 4Y95A 3OUKA 3GCQA 5EW3A 3F61A 1XWSA 3ACJA 4XV3A 2ACXA 4C4JA 2GNGA 5KMMA 3U55A 3OEZA 3QUEA 5EHYA 4AXAA 3JS2A 2YHVA 1YHVA 4QP9A 3D7ZA 3EN5A 3AC1A 3R7GA 1XJDA 3MV5A 1NXKA 3AGLA 4U7ZA 4DHZA 4CSVA 3KL8A 2IEWA 5CQUA 3PSBA 4O7YA 4P7EA 4AT5A 5A9UA 5J1VA 2W1EA 5IF1A 4IE9A 5A46A 1B39A 4C02A 3Q96A 2QKRA 3VVHA 3CIKA 4QP4A 4F7SA 1UKIA 4EBWA 1HOWA 2Q0NA 4TWOA 5DH3A 3FMHA 5AP0A 4AZEA 4IX6A 5FEQA 4TL0A 4RVMA 4TKSA 4OTWA 4I5PA 3SG8A 1G8KA 2CLQA 3OG7A 4H39A 4RBLA 3LFEA 4F0FA 4CLJA 2PZRA 4G9RA 5EI6A 5HE0A 3RWQA 1BL7A 5F20A 5M55A 2E9UA 4M97A 5EKNA 3COHA 2UW7A 4NK9A 3LW0A 1L8TA 5EQPA 3NUXA 3HZTA 5LVOA 5HTCA 3PG1A 1J7LA 3U4UA 3ID6C 4XJ0A 3EKKA 4GU6A 1M17A 4ERWA 3CY2A 4EHVA 3FAAA 2C6EA 4KABA 3FY0A 4EH4A 4M69A 5AAEA 4BF2A 4KUJA 3D14A 3UQGA 1KUTA 3MDYA 3OCSA 4JQ8A 2WU6A 3C50A 3OT3A 3LFCA 2P4IA 2F9GA 3F6XA 3PRFA 3O23A 5FG8A 4FKRA 2OH0E 3VF9A 4QTEA 4K6ZA 2P33A 3NVKI 5M56A 3FPQA 5DT4A 5L2IA 4ZLOA 3TNPC 4C35A 3QD2B 4DTKA 4JG6A 3O8UA 3KXHA 4BDKA 2WTKB 3PXZA 3JR1A 5E8YA 2VWWA 3OD6X 3DB6A 1OBGA 2OJ9A 3E8NA 1KOAA 3I1AA 3WARA 3K5UA 3WZDA 4U81A 4ALVA 4BTMA 3NFFB 3ZFMA 3ZFYA 4ZSEA 3F3WA 4A9TA 4LYNA 3LIJA 2YIWA 5BVDA 2RFSA 3PLAE 3JVSA 4PNIA 4EQCA 4JIKA 2ZFYA 3HMOA 4CZTA 3GC7A 2Z7RA 3MY1A 3BBWA 3PRIA 4RIYA 1UNGA 4PDPA 4LUEA 2QI8A 4PNKA 1OVEA 4RZWA 1OUYA 4C4IA 4EH7A 2C6MA 2RFNA 3IDCA 4GIIA 1RJBA 3EN6A 4WBBB 3HMIA 5CQWA 2IW6A 3KMUA 5CSVA 3MGYA 5AX3A 3VS7A 4EOIA 4HVIA 3MVJA 3E92A 4FSWA 2GMXA 2ITUA 4FICA 2UZTA 1QMZA 4C3PA 1H1WA 2XK9A 3BQRA 3MVMA 4FODA 4MD7E 3LZBA 4FZ7A 4IAKA 4O0SA 4YR8A 3R73A 4OLIA 4WHZA 1SVHA 5J7HA 5K0XA 1FOTA 5D7AA 3WE8A 2G1TA 1FGKA 5KNJA 4FTMA 3HMPA 4UMQA 4L7SA 1J91A 2IPXA 4G3EA 1XO2B 4JR7A 5A14A 4IM3A 4BBEA 4FSMA 3QFVA 4PTCA 4LOPA 2HELA 3TKUA 4JX7A 1OL6A 3LMGA 2B0QA 4EJ7A 2ERKA 3F2NA 3IW6A 1PF8A 3AG9A 5KHWA 4BHNA 4FSNA 5BVEA 4FVQA 2GTNA 2FO0A 3KF7A 4X3FC 4YZMA 5F94A 2R3JA 4AT3A 3DBFA 3LXKA 2OFVA 3RMFA 1Q3DA 4DTAA 3NR9A 3BU5A 4XV2A 3D5WA 3O17A 3QGWA 2PUUA 4CG8A 3AKJA 1XBAA 3NIEA 4UMRA 4JQEA 2CKOA 4DEAA 3CLYA 4M15A 5IISA 3DLSA 4HPTE 5D9HA 2OLCA 4I5MA 3CKXA 1XH7A 2I0EA 3KY2A 3R8VA 1PW2A 1TQPA 3QQJA 4NTTA 1H26A 5BX0A 5KUPA 3NS9A 2KULA 2Z02A 3WI6A 4BIBA 5IA3A 2X8DA 4DFYA 2JLDA 3O7LD 5GIOE 3LJ2A 4C38A 3F3UA 4HNFA 5TT7A 2ITVA 3PJ2A 4L53A 4AN9A 5ANOA 5F1ZA 3KXZA 1Q8YA 4P5ZA 1VZOA 1FMKA 4CRLA 2A2AA 4IAFA 3FUPA 1Q8ZA 4DN5A 5J9ZA 3U6HA 2VX0A 3ZHPC 3CEKA 5HO7A 3N51A 5FTQA 3ZBXA 3V8SA 1AGWA 2OSCA 3P4KA 4JXFA 4MVFA 5HI2A 3QRUA 2OZAB 2FUMA 3TN8A 3ML1A 1QPCA 4H1MA 1E1VA 4I24A 2C69A 2VRXA 3HYHA 5EG3A 5F95A 4UN0C 4CQEA 1XH6A 4NFNA 4BGGA 3H4JA 4OTGA 3R9NA 2XVDA 2W1FA 3MB6A 4MF0A 5FQDC 4DFNA 2QOQA 3B8RA 3HP5A 1YDRE 3ALOA 4FIEA 4O21A 4OTIA 4AUAA 5FRIA 2ITPA 4O6LA 4ZTMA 3OT8A 3WZUA 5HE1A 1MRVA 3ERKA 3I0OA 5DOSA 3FI3A 4U43A 2YM6A 4AA5A 4X6QC 1PKGA 2YITA 4TNDA 5AP4A 4RFZA 4M66A 3HEGA 2J0LA 3DFAA 3SX9A 5EI2A 5AADA 5C8KA 1YDTE 1YVJA 3CQUA 5CSHA 3OEFX 3FY2A 4UMTA 3OWLA 5H8GA 3CXWA 4BC6A 3F5UA 1O6YA 2R9SA 5BVWA 4CXAA 2XKDA 2HK5A 4MBLA 4FIHA 2VWUA 1I09A 3DNEA 3ZZWA 4GJ2A 3FLQA 4ANLA 3UOLA 4ARKA 5IZFA 2JDOA 4E8AA 2J51A 5H8EA 3S00A 4DDGA 3Q9WA 3P9JA 2V0DA 4GG5A 5DT0A 3VBQA 3A60A 1GY3A 5CU6A 4B9DA 1U4DA 5AUXA 3G33A 3K5VA 2BALA 3PFQA 4CQGA 4DFBA 1PY5A 2R3OA 4G9CA 4AOTA 4UMUA 4LV7A 5JFXA 3ZUTA 4PL5A 3FZRA 5EOBA 1P14A 4I0TA 2G2IA 4FNYA 1CM8A 4UMPA 1OB3A 4APPA 5CF5A 3NAYA 3R22A 2OG8A 2OO8X 2XK6A 3DJ7A 3EQRA 4EKKA 1WZYA 2JGZA 4GW8A 3N4TA 1GZ8A 5M08A 3QRJA 4D2SA 2GHMA 5KZ0A 4O22A 5IQAA 4KBKA 2QU5A 4QMVA 4WUAA 3ZO2A 2BZKB 4N6ZA 5KBQA 3BCEA 1DI9A 2CJMA 4NCTC 5JFWA 3QA8A 4F9BA 4ZTNA 5AX9A 3HUBA 3D2IA 1PMEA 2UVXA 3R01A 4OW8A 4X3FA 4O0YA 5AJQA 3HA8A 4KB8A 3SKCA 4AZWA 1WBPA 3BGZA 5AA8A 5HG8A 2WQBA 3Q5IA 4DEGA 4CV9A 3LJ0A 4CTBA 3FMJA 4ZSGA 5CU2A 3PFYA 5HNIX 3RPYA 3NNXA 3QAME 1OKZA 5JRSA 2WELA 1PHKA 4JRNA 4OR5A 2R3PA 3T8OA 2E9PA 4QDEA 1W82A 3VW8A 4ACCA 2E9VA 4KRDA 3VIDA 3NYOA 5GHVA 4U44A 2Q83A 3NUPA 2V7OA 4H58A 1XMMA 3P23A 2UW9A 3MFUA 2W4JA 2JFMA 3HV5A 4U80A 5E92A 2HZ4A 2XIYA 1H1RA 5DHJA 1JVPP 4ZXTA 4HGEA 1PXLA 3PWYA 3AGMA 4IH8A 4O27B 1R0PA 5ICPA 3PP0A 4M69B 5EM5A 1Q3WA 3UVPA 3E87A 3JVRA 3OTUA 2I0HA 3KU2A 3DOGA 3RBWA 4EC9A 3R21A 1UA2A 3GENA 3UC4A 4W4YA 4WG5A 4HVSA 3H9OA 3Q53A 5EKOA 2HOGA 2WMTA 3DBCA 2R0IA 2VAGA 4L8MA 2I0VA 1MUOA 4EH9A 4DH1A 4DDIA 2C3LA 2OJJA 3NUYA 3CGFA 5EHOA 1YOJA 4MKCA 1MRYA 5HESA 3DK3A 3DA6A 4X6RA 4APCA 1IRKA 4O84A 2H6DA 4ZY4A 4E6CA 4IWPA 4TNBA 3F82A 4BB4A 4DH3A 4J95A 3MH1A 4FIJA 4B6LA 4EJNA 5J95A 4C34A 1S9JA 4BDGA 3EQBA 3ZH8A 4J97A 4MAOA 5CEIA 2QU6A 4FIFA 2XBAA 3RHKA 4J99A 4ZSJA 3E88A 1O9UA 4FT7A 2WTIA 2WGJA 4L44A 3PY1A 4JDHA 4RIYB 2BZIB 3P86A 1OITA 4QMOA 2PULA 2Z7LA 3AC2A 3C5UA 3ZFXA 4DCAA 2XARA 3HX4A 3KN5A 3UOKA 3KMWA 3VS4A 4CYIA 4EH8A 4ERKA 5BUEA 4AXDA 1UVRA 4OTRA 5HG9A 3GOKA 1KV1A 3Q4TA 3T9TA 3P7CA 3CP9A 4EZ7A 2AEGA 2VX1A 3VULA 1OL5A 1RQQA 2NO3A 3VHKA 1GAGA 4AGCA 2PE1A 3P78A 5IA2A 4YU2A 3PIXA 5TKDA 3W2OA 4FEUA 3E7OA 4ACDA 5M4IA 1P4OA 2BZJA 4M68A 3I79A 4QNAA 3SAYA 1VYWA 4RWIA 1Z5MA 4JG7A 3R8MA 1J1CA 2UZOA 3AMBA 3BIZA 4P90A 5CTPA 1PXNA 4CRSA 3GU5A 3E3BX 4S2ZA 4MWHA 1H00A 3QL8A 1H08A 5CZIA 1UNHA 4LGDA 3FE3A 4ID7A 2HY81 2OF4A 3KKVA 3GU7A 2YFXA 3QYWA 1O6KA 4D9TA 4AGDA 2XEZA 3D94A 4GRBA 2O2UA 2Z7SA 3CR0A 2YM5A 3MA3A 3Q2MA 2VWYA 4K2RA 4P2KA 4FT9A 4EH5A 2YEXA 3LCDA 5EW9A 3BRBA 4D9UA 4ENYA 4R1YA 5AR4A 3PJCA 3QUPA 4XYFA 5CWZA 4E5BA 1PMNA 5IPJA 4UX9A 1OBDA 4I6BA 5CXHA 4MD8E 4QRCA 3V6SA 3DJ6A 1OIYA 3LPBA 4FTUA 4NCTA 2QOHA 3BEAA 2GNLA 5E8TA 4EOMA 2W17A 3ORTA 3VQHA 2QURA 5CNOA 2B52A 3NEWA 4Q2AA 4FKOA 4FEXA 3DCVA 2WMWA 4G6LA 1W2FA 3SOAA 2GQRA 3R9DA 4HGSA 2ZV7A 2CN8A 4D4RA 1W84A 3QZGA 3MESA 4DA5A 2C6DA 3QRKA 4USFA 1FVTA 1PXOA 2PE2A 4FYNA 5IG1A 4I6LA 2Z60A 4DH7A 4OAVB 3CTJA 3HVCA 4QTBA 3ZDIA 3HRFA 2FVDA 3DJ5A 4BKJA 4DAWA 1W7HA 2F49A 4RA4A 3U54A 4QMUA 3OCTA 5IDPA 4IAIA 4O4FA 5CLPA 2DQ7X 5BPYA 3TV6A 4RC2A 1FPUA 4YSMA 2IN6A 4GFGA 1ZRZA 4M0YA 3R9OA 2XNGA 5CY3A 4AOJA 3FZSA 4IZ7A 4ITIA 3DZOA 3S4QA 4UBAA 4XBUA 4J96A 5KZIA 4LGGA 4YZ9A 5IQGA 3RHXA 2I1MA 2YCQA 2VTOA 2R3LA 3QX4A 4KIPA 5DT3A 4C7TA 5AAGA 4C62A 4OTQA 5HLWA 3E5AA 4LL0A 2JDTA 3II5A 4RZVA 4X3JA 5GNKA 2W96B 4O1PA 3VNTA 4EOKA 4O0XA 5CAUA 3IGGA 3MTLA 3SOCA 5KMOA 4RGJA 4O4DA 2VGOA 2XANA 3R9RA 5IQEA 4HZRA 3W0QA 1YXUA 4C8BA 4BJJB 3JXWA 1WBVA 3Q32A 4P4CA 4Z9LA 4XG2A 3R8ZA 3RI1A 3U8WA 3KULB 4FNZA 5BVFA 4M14A 2FA2A 2XF0A 4K18A 5HIEA 3OZ6A 2IZTA 2Q0BA 4ANNA 2YM8A 3KVWA 2PU8A 4E5WA 4FSTA 3RZFA 5A4CA 5C1QB 1SNXA 4MEDA 4F63A 4AACA 5CAPA 3EQGA 5CSPA 4YPSA 5IUHA 4NIFA 2OXYA 5FDPA 2Z2WA 3OW4A 4PDYA 3PA4A 5HNBA 2ERZE 4IHPA 4FIIA 4ALUA 5J9YA 5JFSA 3NFGB 4H1JA 5EHLA 2PVRA 1H28A 2PMNX 3D9VA 2BCJA 4RRVA 4FTNA 3PXRA 3FV8A 3ROCA 3A8XA 4W4WA 3K3IA 3OTVA 2YDIA 4BRXA 3TNIA 1JLUE 4ACHA 4DBXA 2A98A 3TZ8A 2WMRA 5IUGA 1T45A 4FEWA 5IH6A 5IMEA 3JUHA 3PG3A 4LFIA 3HAMA 4C4EA 5JN2A 2CSNA 1Q97A 2UUEA 3BHTA 4V05A 2W1IA 4Y73A 4QMQA 2NYAA 2OFUA 4KNBA 3WZJA 4LOOA 4EK6A 4FMQA 3R7IA 4K11A 2VZ6A 2C5NA 2ZVAA 1JKSA 4IZYA 4ANBA 2J9MA 4XLIA 3FI8A 3W0PA 4UYAA 4W8DA 2VTPA 3MS9A 2JIIA 5I4NA 5DA3A 4DEIA 3GP0A 3RP9A 2AQXA 3O0GA 2OJFE 4X3FB 3VRYA 3Q4UA 4XRJA 2ITWA 3QQFA 5FXQA 2FSLX 4Q5EA 4C3RA 4N0SA 3ZS5A 2FGIA 2RF9A 3AQVA 2FSMX 4FE2A 2ONLC 4MXZA 5EDRA 3DDPA 4QMXA 3ZLYA 1H1QA 3FXWA 3RM6A 2UZVA 4O0RA 2ZM4A 2VTHA 4J53A 1PXKA 5DG5A 5DR6A 3FKLA 4PP7A 2YDJA 2XJ1A 2ZM3A 1Q61A 5FM3A 5M4CA 3TDWA 4DEEA 5L8KA 4A4XA 4BYIA 3Q9ZA 3ZDUA 4AXEA 4XEYA 4RVLA 2QODA 4EKLA 2RKUA 4EOPA 2PVFA 2OW3A 2W7XA 3L1SA 4OGRA 3WF5A 5J1WA 4IC7A 2XEYA 5C4LA 3AKLA 3ROYA 2JC6A 3I4BA 2A27A 3KGAA 4U45A 3IKAA 4MQ2A 5AM6A 1TVOA 4RLKA 3UODA 3FPMA 3NGAA 1J7UA 4CVAA 4HVHA 3EZVA 2EXCX 4TWNA 4E1ZA 2UV2A 4CFWA 3UOHA 4GSBA 3LQ5A 3FL4A 4GEOA 2ZV9A 1QL6A 4L67A 2X7GA 4MX9A 3KRWA 3VBYA 3ZRKA 3ORZA 5LVLA 4K33A 2C5XA 4D1SA 4G17A 2OKRA 2JD5A 2VGPA 2A4LA 3CD8A 4G3GA 5EDPA 3AT2A 2AC5A 4IVCA 4UY9A 3LXPA 4MCVA 4XLVA 4BCQA 1Q62A 1H0WA 3O7LB 3FJQE 3FC2A 1K3AA 4JX3A 2UZDA 4OBPA 5HCZA 3GNIB 3JYAA 2GCDA 2OI4X 2PTKA 2RSVA 2X7OA 3NCZA 3IW5A 5A4LA 2VTTA 3V51A 3T9IA 4WNKA 3WYXA 2RFDA 1Q8WA 3DU8A 3LM5A 5E8SA 4CFUA 4F6UA 3KREA 2OZAA 4BI1A 2RG5A 3FKOA 1Y91A 2YIYA 2YAKA 3F9NA 5HD7A 3ATTA 4AAYA 4LI5A 3HLLA 4QPMA 5HG7A 3GT8A 4D55A 4OT6A 2VTMA 3DAEA 2ZV2A 4OT5A 2OJGA 4BL1A 5TOZA 4X0MA 5K5NA 2ZB1A 3M11A 2XNPA 4FKUA 4AW0A 5GINE 5J87A 3EOCA 4CKJA 1VR2A 2JKQA 4YPDA 3RK5A 4AT4A 1M14A 3DV3A 4ZSLA 3TNQB 5AAFA 3FHRA 5DIAA 2R7IA 3BLQA 1J1BA 5DGZA 3ZYAA 3R02A 3UE4A 2CKPA 3R8PA 3CD3A 3LAUA 5FUTA 4DHFA 5ANIA 3PUFC 3EQHA 2UZEA 4II5A 4PMSA 4CFVA 3I7CA 4C2WA 4CV8A 3R8UA 4E7WA 2UVZA 3TJDA 4D5HA 2RGPA 1JBPE 1PXPA 1IEPA 3BEGA 3OWPA 3ALNA 1RDQE 3V8WA 2B54A 3ZRMA 2QOOA 4RJ8A 2XB7A 3ORNA 4BDFA 4C0TA 5CAVA 5IU2A 5L6PA 3P08A 4GYIA 4YSJA 1BMKA 3F88A 2ZM1A 3PXQA 3UG2A 4WNMA 2HCKA 3FMLA 2IVVA 3WZKA 4J71A 1Y8YA 3OOGA 3V6RA 5HBHA 2JAVA 4AA4A 1KV2A 3QTSA 4J8NA 4TRLA 2OJIA 4TYIA 3QYZA 3GQLA 2B1PA 2C5OA 2ITQA 3EL8A 5KKRC 3C1XA 3GCSA 2FSTX 4O96A 4QT1A 1OIUA 4R3CA 4XHKB 4IB0A 3ZO3A 4WNPA 3VS3A 5CU0A 4DHJA 1LPUA 3G0FA 3B2WA 2ONLA 3DGKA 3QHWA 4IWDA 1ZYLA 1PMVA 4DFUA 2ITTA 4IZ5A 4AE9A 3GCPA 4QP3A 3FXZA 3RCJA 1XBBA 2VO3A 3CBLA 4AW5A 3JY9A 3DNDA 2F7ZE 5JFVA 2J7TA 3EMGA 5A3XA 2R4BA 4NM5A 4XG6A 2PUNA 3BZ3A 4WSQA 3HP2A 4MF1A 5E91A 5EYDA 4AP7A 1Q41A 4GUEA 3MJ1A 2RFEA 3TWJA 2YERA 4TPTA 5L2QA 3PVUA 4WBOA 5HICA 3VRZA 4PY1A 4FTTA 4XG7A 2QG7A 5ANKA 5KE0A 5ITAA 4CZYB 4YJNA 4DFLA 5E4HA 1ZOEA 4EOJA 4PQNA 4TWPA 4BZDA 1JKLA 4Q9SA 4WSYA 2XH5A 1YOLA 4M67A 3GVUA 4EWQA 2IF8A 4D2WA 2W1DA 2Y4IC 3CTQA 4FUXA 5DBXA 4CNHA 3TUBA 3TYKA 4NM0A 2J4ZA 2HZ0A 3B8QA 2X8IA 4D28A 4FZ6A 4R3PA 3RAIA 4NZWB 2W5BA 3CKWA 5EYCA 5D11A 4QTAA 5AP2A 2V7AA 4C3FA 4BZOA 4EYMA 5JGAA 1A9UA 3SW7A 5K0KA 3PLSA 1U5RA 2C4GA 4I23A 3MY5A 1IASA 2X9EA 5AIKA 1BI7A 2W1GA 2B55A 5FD2A 2V22A 4FKJA 3DZQA 1SVGA 2A1AB 2JEDA 4YZDA 3TNHA 5L3AA 2C6LA 4NIFB 5AUVA 4A9RA 4ZIMA 4BHZA 2X8EA 2X2LA 5E8WA 3UZRA 3VUIA 3FMNA 2R3IA 4PV0A 1H25A 4NT4A 4XG3A 3C0HA 4YJSA 3VUKA 4B0GA 4IAZA 3G90X 4GKIA 3FMMA 2P55A 2PVJA 4XS2A 3VAPA 1UNLA 4S32A 4UWBA 2WU7A 2R0UA 4U41A 1XH9A 4XOYA 3D7TB 5AP1A 3GU6A 4IM0A 4PDOA 5AV0A 2PUPA 2IJMA 1OIRA 4MD9E 2R3KA 5KCVA 1R78A 4EHZA 4IJ9A 1PMUA 2JDSA 2B53A 4JG8A 4LRMA 3VJOA 3VO3A 2PMOX 4GK3A 4C57A 4RA5A 4EOOA 4RWKA 1CKPA 3L9MA 3COIA 3FSFA 5F4NA 4TY1A 5JEBA 4QYHA 4AN3A 4R7HA 1H01A 1P5EA 2QR8A 5DMZA 4O7TA 4O83A 3QCSA 1QCFA 3L8XA 4CKIA 1EH4A 3OCBA 5HIDA 3BYOA 4D58A 1PYXA 2YCFA 4EHGA 4RFYA 4NKAA 2O64A 5B0XA 5M07A 3BGQA 4IANA 4CD0A 3ZRLA 5CALA 2GNIA 3Q3BA 3QU0A 5L8JA 2CMWA 2DWBA 3HMNA 1DAYA 5ANEA 3QKLA 4ZZNA 2KTYA 3E8DA 3LHJA 1CKIA 4XMOA 3U51A 2JIUA 4DEDA 4I6HA 4BIEA 4O7NA 5DVRA 3W0RA 1LUFA 2BIYA 4Y72A 3R7YA 1HCLA 2PMIA 4D2PA 4U0IA 4EONA 4FKVA 5KMKA 3HV4A 3MPAA 4O0WA 1BUHA 2PE0A 3WE4A 4FNXA 2WMVA 3TDVA 4DEHA 2AUHA 4BCFA 5J7BA 1SMHA 4AXCA 3FYKX 3BI6A 4FZFB 2GFSA 2JBOA 4RIWA 3QCYA 4L00A 2BTSA 3EWHA 2ITOA 4CT1A 2EWAA 4IJPA 4PTEA 4ZTHA 2CGXA 3PSDA 4BTFA 3RAWA 4GG7A 1T46A 1U54B 2EXMA 2ITZA 2OICA 3KRLA 5KX8A 2PPQA 3O8PA 4O86A 3FKNA 4HCTA 3EFWA 4RQVA 4USEA 1TZDA 4MXXA 4FSZA 2C1AA 1J3HA 4L3JA 1QPEA 5BUIA 4DEBA 2OWBA 5JMSA 2WQEA 3PIZA 4KKEA 4HVDA 3KVXA 3QXOA 5DEWA 4K9YA 1KOBA 5E8ZA 3SXSA 2I40A 3NWWA 5KO1A 3AOXA 3GC9A 3NYNA 3OCGA 3OY3A 4CLIA 2ITNA 2W1CA 3OHTA 4WT6A 3ZEPA 5JT2A 2B4SB 3GU4A 3KCFA 4H36A 3SVVA 4Y5HA 5CU3A 1K9AA 5CEKA 4ZS4A 4F64A 4A9UA 3BHUA 3Q60A 3IOPA 4FV3A 4IZAA 3V5QA 2RIOA 5AP3A 2FYSA 5M06A 4I5HA 2WMSA 4IX5A 4B8LA 4Z55A 5CANA 2Y0AA 3EJ1A 4BCIA 4N57A 4FVRA 4LL5A 4W4XA 3NCGA 3H3CA 4ZS0A 3UP2A 2F4JA 5A4QA 4IB5A 3MVLA 2PVLA 5E1EA 5FM2A 1YKRA 4TYGA 5EQEA 1R0EA 3PE2A 4QTCA 3EQIA 2WMQA 3R30A 2GSFA 3QTQA 1ZYCA 3S0OA 3QUDA 5IKWA 5E1SA 4MNEA 3EQFA 4DH5A 4WRGA 4B7TA 1G8AA 2EB2A 2OBJA 4O4EA 4FKSA 5KMLA 3KN6A 4XP3A 2CKEA 4RX9A 3SRVA 4BJJA 4QP2A 4BFMA 1GZKA 3DQWA 3KXMA 3KULA 3PZEA 3NVMB 2B9IA 3LCSA 4HW7A 3NW6A 3W32A 2OU7A 3F69A 3MSSA 4FG9A 3FLNC 2PVKA 2XRWA 3Q2JA 4RFMA 3VS6A 5JK3A 4GJ3A 3EHAA 4E6DA 4TXCA 5IQIA 1W2CA 2ZAZA 1IA8A 3G6HA 3GXLA 3IDBA 3ETAA 5TR6A 5ANJA 2QLQA 4FT3A 4H05A 2VTJA