2OSCA

Synthesis, structural analysis, and sar studies of triazine derivatives as potent, selective tie-2 inhibitors
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
255
Chain Sequence
QVLKARIMDAAIKRMKKDDHRDFAGELEVLCKLGHHPNIINLLGACEHYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Angiopoietin-1 receptor
publication title Synthesis, structural analysis, and SAR studies of triazine derivatives as potent, selective Tie-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 255
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oscA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oscA01
3BEGA 2OXDA 3BCEA 4RQKA 1RJBA 4BTJA 4FOBA 3QZHA 5AUTA 4KRCA 4NH1A 2G2IA 2HY81 4FGBA 5FM3A 4X2GA 2CGXA 3I7BA 3I60A 5E91A 1K9AA 1K3AA 1Q8UA 3TZ8A 2WMBA 5A14A 5C8NA 3ZRLA 3DY7A 5EOLA 5AP5A 3R63A 4U0IA 2QNJA 5G1XA 2R3RA 4IAZA 5LJJA 2QHNA 2JKOA 3BYSA 3IKAA 4J96A 3O8PA 4AACA 3F66A 4DFUA 5HNIX 1GY3A 2V0DA 4MBLA 3S4QA 3MVHA 1SNUA 4F6SA 1JSVA 3BPRA 2HOGA 3UOLA 3PPZA 4GS6A 5CYIA 1TQPA 2VTHA 2A0CX 4PV0A 5AR7A 3Q60A 5DT3A 2IVUA 5J79A 3VBXA 4IW0A 4FTTA 2XKCA 3EL8A 4IM2A 4BHNA 3UVRA 4NKAA 3SV0A 5F4NA 4M0YA 1QPJA 2XF0A 4DH7A 4CRLA 2I0YA 2V5QA 1XR1A 3IW4A 5GZ9A 4AT3A 5HTBA 2XCHA 4FNXA 3R02A 5HVYA 1FVTA 2W1GA 1P14A 4G6OA 4C4FA 1KV2A 3G33A 4QQ5A 3VUKA 2PUIA 4S32A 2CLXA 2HZ0A 4EQCA 2E9VA 2BRHA 4F9CA 3QHRA 2ZV7A 3HMIA 2XNOA 4RC4A 4ACDA 4YTHA 4D2WA 2R3MA 3KMWA 2GFSA 5E1SA 2C6IA 5BPYA 3LHJA 2XIZA 3TACA 4PMPA 5B2MA 4DEEA 1KSWA 1CKJA 3BLRA 3VQUA 2XNEA 1OIYA 5M4UA 4MEDA 1URWA 4HGSA 4PTCA 4KS7A 3ACKA 4F08A 5FUTA 5EDPA 2J0LA 3DK7A 3A7JA 3EZVA 4EOOA 1MRUA 4IJPA 4PRJA 5A4TA 4XV2A 3GC7A 2OF2A 4YSMA 1ZARA 3EHAA 5DT4A 4J95A 4FTAA 4CV9A 4H39A 4O0TA 2V62A 3ZUVA 3PVGA 1XH8A 3FXWA 4TT7A 4WG4A 3H0ZA 3FQEA 5HLWA 5M53A 4X3FA 4CFUA 2XNPA 3O96A 3KREA 3IS5A 2WTKC 4U42A 5I9WA 3W10A 2BROA 3FC1X 5J95A 5CI7A 5I3OA 2J5FA 2YN8A 4Z7GA 1IR3A 2PSQA 2OJGA 2YISA 3QA0A 4L00A 4NJ3A 4MNEA 4B8LA 2YABA 5BVWA 4BGHA 4FE2A 2XKDA 3DBFA 5HX6A 3NGAA 4U3YA 5E8TA 4UMPA 1OL2A 5JFVA 5J87A 3QD4A 5HG5A 3JYAA 5EOBA 3UYSA 5D1JA 4TYEA 4G5JA 5CEQA 4DGGA 4FIFA 2XJ1A 3LLAA 2LGCA 2W06A 3L1SA 3GI3A 3BEAA 4PPBA 4WBBB 4XG3A 1OVEA 3DFCB 4AUAA 5JEBA 3GU7A 4XLVA 1OL5A 4Y95A 4LOQA 3U51A 1WBOA 5JK3A 5AV2A 3V5LA 2CGWA 3UNKA 3BIZA 2EU9A 1JPAA 3G0EA 5HNGA 4UYAA 4YBJA 5HTCA 3QUDA 1S9JA 1YXVA 3EQRA 4ALWA 3TIYA 2NNWB 4U6RA 4EK6A 3UP2A 4RX5A 3O51A 5E9EA 2GNJA 3KA0A 3MFTA 4WA9A 1SVHA 3EQFA 3R2YA 2C1AA 2CLQA 3QGWA 1IASA 3ALNA 4QP8A 4K77A 3WBLA 3ZZEA 4UWYA 5AM7A 5M4IA 2B54A 4MXZA 3NIZA 4FT3A 4R8QA 4AG8A 4X3FB 4FEVA 2ITVA 1H1RA 4DEHA 4DF3A 4GSBA 5FG8A 3EFLA 1H1SA 2VX0A 3GP0A 5H8EA 2UVXA 4U3ZA 5ETFA 2NP8A 3N51A 4AE6A 3E88A 4BRXA 3ZONA 2QKRA 4RIWA 3D2KA 4PPCA 2C6OA 4I6FA 3MY1A 1YWNA 3JY0A 3QD0A 2GS7A 3H10A 4MNEB 3GCVA 4ZTSA 1ERKA 4G9CA 4GJ3A 4A9TA 3TXOA 2UW0A 3OWLA 2IWIA 3RCDA 3PJ8A 3RM7A 2WKMA 1U5QA 3R7VA 2YERA 3HV6A 5EM8A 2ITZA 3CS9A 4KBCA 4DFYA 5KNJA 4FR4A 5HD4A 2FO0A 1PXOA 5HE3A 4FKSA 2UW7A 5CAOA 5A4LA 5J1VA 3A4PA 4FGRA 4EK4A 3GBZA 5FTGA 2GNIA 4XS2A 3HGKA 3Q6UA 4UZDA 2PUNA 2F2CB 3VS1A 4PMMA 5AV3A 4ASDA 3NDMA 2GNGA 3ETAA 4XV3A 3PA5A 4E1ZA 1NVSA 2WQOA 4GCJA 4CVAA 4CMUA 4KIKA 2P55A 2UW5A 2YFXA 1ZMVA 2X2KA 4O0WA 5CF8A 3FEGA 3EWHA 3Q5ZA 2C3LA 4IVBA 2BRNA 4QMTA 4CZTA 4D55A 4NM0A 2ETKA 5KKRB 2IVTA 1KE5A 5JZJA 3O8UA 3OOGA 5AA8A 3FV8A 3LW0A 2XK8A 4J52A 1UVRA 3TNWA 2XKEA 4BCQA 1UNHA 4QTDA 3VUDA 4IEBA 4C38A 1QMZA 5DR2A 3T8OA 4RIWB 4F7NA 1R39A 3VW6A 3QD2B 4A9YA 5D7VA 1H26A 5KBRA 3PXFA 2R5TA 4EYMA 2XK3A 3SHEA 4BCPA 4D9UA 3FYJX 3BLHA 4F7LA 4MXXA 3KCKA 4FIHA 4O81A 1LUFA 2QD9A 3TZMA 4V04A 4C33A 3NUYA 2X8DA 3BZ3A 1H00A 3POZA 5FDPA 4RWKA 5HNBA 3LXNA 4DGNA 4EUTA 5E4HA 4IACA 3QKLA 4OBPA 4OR5A 4Y73A 3H9OA 4ZJVA 4CKRA 5L8KA 4O7NA 1H8FA 1KOBA 4H1JA 5EFQA 3ZSGA 1NW1A 4XBRA 3WOWA 2G01A 2RFSA 3CY2A 5E8SA 3V8SA 3CP9A 3E8CA 1Q3WA 4QTEA 4M66A 3U9NA 3FPMA 1H08A 4I3ZA 4AT4A 1PXMA 3R6XA 4M15A 4CEGA 3P7CA 4IAKA 3PLSA 5ANOA 4EKKA 5IQBA 1LP4A 1J1CA 2HWPA 2W1FA 1GAGA 3SXSA 3UG1A 3PXYA 3DQWA 3F5XA 4F09A 2UZWE 3FKLA 4QMWA 4OTWA 4FG7A 4CZUA 4DBXA 4O0XA 3REPA 4F63A 2Z7RA 4NK9A 2IW9A 1W82A 2F7ZE 2WMAA 3ET7A 5DRDA 4KAOA 5M09A 2ZV8A 2YITA 3ZC6A 1M2QA 3OY1A 4IC8A 4DFLA 5KCVA 2ONLC 4OTDA 5TKDA 4XG8A 4BY9E 1PYEA 4ZLZA 1TQIA 5AUYA 5CEIA 4QMOA 1UKHA 2Z7SA 3DNEA 5EI2A 4ASEA 5IA3A 2GCDA 4ZP5A 4NW5A 3MBLA 1Q97A 4RA5A 2WGJA 2FSMX 3CQUA 4IAFA 3KFAA 1H0WA 3R30A 3EFJA 4E20A 4ZK5A 4MKCA 2ERKA 3ZXTA 4BZOA 1UV5A 1FVRA 1W83A 3C4ZA 3LFFA 3OT3A 4I22A 4ZTLA 4AWIA 3K3IA 3AG9A 1QCFA 2R9SA 1YOMA 2QVSE 3ERKA 4GIIA 3A8WA 4YLJA 1Q8YA 3IO7A 3IECA 2NRYA 4EBVA 2PY3A 2O63A 4YTIA 3S00A 4BKJA 2O5KA 3VHKA 4CCBA 5FQDC 1OZ1A 1Q8WA 4DA5A 4MD9E 4AZWA 4FBXA 4G31A 5HG8A 2ZV9A 3MWUA 4CT2A 4LRJA 3R83A 3QLGA 3V5PA 1OBDA 1IRKA 2QO9A 4GV1A 2XH5A 3BWJA 4X2NA 3A62A 5I3RA 3R2BA 3WARA 3RWQA 2I6LA 3B2TA 1B38A 5EQPA 4NTSA 4I6BA 2BPMA 4HVIA 3MA3A 3QKKA 2GS6A 2YDIA 5CSHA 4W8EA 4QPAA 5AFVA 2PVRA 5AX9A 3WF7A 2QHMA 4S2ZA 3LFQA 4ANOA 2I7QA 2B55A 4J99A 4YO6A 1Z57A 4JR3A 3MVLA 3OWJA 4O21A 2PHKA 3FMLA 3MFSA 2G9XA 4F65A 1TVOA 3GVUA 4M84A 3UC3A 4ZLYA 4XYFA 4FV6A 4IM0A 2C5NA 2WTJA 2JIVA 2WOTA 3L8XA 1OUKA 3HP2A 4FF8A 4LQMA 3DGKA 4JBOA 2NRUA 2QQ7A 3EQPA 3ZUTA 4AW5A 3U4UA 3VRZA 3P4KA 2X0GA 4BI2A 1V0BA 4R77A 2DWBA 4L7FA 3QQFA 4F1TA 1IAHA 4EOJA 3E64A 3K3JA 1UA2A 3VS2A 3PVWA 4A4XA 4E4NA 4RFMA 1Z9XA 3PJCA 4QTAA 4Y72A 4FMQA 5AV1A 4L8MA 2FH9A 4LRMA 4DAWA 3HMOA 4N6ZA 4QMNA 1A06A 4YMJA 4X3JA 2WB8A 5L2QA 2QLQA 4P7EA 3TNIA 4FEWA 4FKWA 4JJRA 3AGLA 5ICPA 2EXMA 3CQWA 3DCVA 4ONAA 1DAYA 3R9RA 4MHAA 5DIAA 2X8IA 3NAYA 3O71A 3QTZA 4A7CA 3A8XA 3R8VA 1K2PA 4ERKA 3GQLA 4DLIA 3VBTA 2OSCA 3TNHA 2C68A 1OB3A 3HLLA 3LCDA 3EQGA 1DAWA 4LGDA 4QYEA 4O0UA 1YQJA 3UZTA 2O0UA 2VNWA 3NMUF 2Y4IB 4FSWA 2PUUA 1PMEA 3MVMA 3Q96A 4F99A 1OGUA 2QI8A 4JDHA 5AP4A 3WF9A 3A7IA 3ZFYA 4HCTA 4BGQA 2HXQA 2SRCA 3NLBA 3NR9A 5ETIA 4AN3A 3FI8A 3FJQE 2C6TA 4AT5A 3NZ0A 5L8LA 1IA9A 2CKEA 4PTGA 4TYHA 1YKRA 1CMKE 5HTIA 1CTPE 4BI1A 2PVKA 5BX0A 3BGPA 5KMIA 1F5QA 3PPJA 4DEGA 4JI9A 3ZSHA 5BNJA 1OIRA 3LKMA 4O7VA 3MH3A 4AGDA 1JVPP 2CCHA 4G6NA 4ZY4A 5K4IA 3U6HA 4TYGA 3A7FA 4IMYA 4FKGA 3FE3A 4JG8A 2W5HA 5AP6A 2BFXA 2UUEA 3D5XA 4QYGA 3CY3A 3QCYA 2EB3A 1VYWA 1Y6AA 4NEUA 3QWKA 2A1AB 3BRBA 5DBXA 4ZSEA 1W8CA 2E9NA 3Q9WA 2I0HA 3OCBA 1XBCA 3UOHA 4DHFA 5IA4A 3PTGA 4G17A 3F7ZA 3Q4CA 1XH4A 3NNXA 4GK3A 4L01A 2X39A 4TZRA 4ENXA 4DFBA 2Z2WA 3GB2A 2HZIA 3E87A 3F69A 4YLLA 1MP8A 4EHGA 2C6MA 4Q9ZA 2WU7A 4KD1A 3VF9A 3UBDA 4KA3A 3KRJA 4BDJA 1CDKA 4GK4A 3RPRA 3KMUA 4GK2A 5K9IA 2B7AA 1LEZA 1Q41A 3BELA 3UNJA 4OTGA 5J7BA 4QQCA 3QQLA 1T45A 4ANMA 3RNYA 4CKIA 3PSDA 2BRBA 3HP5A 3Q9XA 4WRGA 3QQUA 2CPKE 4TYHB 3SD0A 3ZCLA 4EOQA 2H8HA 4FKOA 5ANGA 2CNVA 2OF4A 2VTLA 3EKKA 1H1WA 4N6YA 3DJ6A 2ITQA 3KRRA 4FSMA 2CKOA 2R2PA 5AWMA 5J9YA 2VAGA 4O2PA 4AFEA 3EQDA 4H1MA 2YAAA 3AC1A 4ORKA 4CLJA 1BL7A 2W5AA 4MWIA 4BN1A 4J7BA 5LVLA 1Q5KA 2DYLA 2ETMA 3V5WA 3S1HA 1J1BA 3HA8A 4X0MA 4ANSA 4Y5HA 3P08A 2VWVA 3OUKA 4EH3A 4II5A 3N4TA 1FBNA 5HBEA 1UWJA 3KRXA 3R7GA 3DBDA 4X6RA 4QD6A 4OTRA 4K11A 5HIDA 3VF8A 3VN9A 2C5OA 3O0GA 3ZMMA 4W4WA 3H3CA 4UALA 3RBWA 5KZ0A 5IEXA 3ZLWA 4C3FA 4PWNA 2GNHA 3FMHA 2J51A 1REJA 2JKMA 1Q8TA 3DPKA 5DI1A 5E8UA 4BBFA 2B0QA 5DEYA 3LAUA 4MQ1A 4QO9A 5TT7A 4CFXA 3E3PA 1YVJA 3NWWA 4O7YA 5IG1A 3L8SA 1E9HA 4FTKA 4O38A 2C5YA 5IH4A 2JKKA 3GNIB 5AUZA 1JAMA 3S0OA 3V01A 1NVQA 5C27A 2FA2A 3BHUA 5IQFA 1Y57A 4BTMA 1WBTA 4PL3A 3WILA 2QONA 2UZVA 4IZAA 4BIEA 2JD5A 4WRSA 3D0EA 5FDXA 3E7OA 4AA0A 2ZB0A 1XO2B 3NYOA 4I41A 4IJ9A 4FG9A 4L43A 5KHXA 1MRVA 1BUHA 2R3LA 3EN7A 4QP4A 3FY0A 3JPVA 3NSZA 1ZRZA 4AN2A 2JDVA 4D0XA 2BAKA 4QMSA 4J53A 2F7XE 4DEAA 3RP9A 2R3PA 3AC5A 2ESMA 4QP2A 4JS8A 2WMTA 4XP3A 4USDA 4K1BA 2V55A 4GW8A 5DGZA 4O6LA 1OPLA 3TV4A 5IUHA 4Z9LA 4M8TA 2JBPA 2Z8CA 4ZIMA 3VS5A 4FEUA 4BGGA 5HVKA 4HJOA 5FP6A 5B0XA 3V5TA 4DG2E 4NYEA 4X21A 1BL6A 4R3CA 4USEA 5TOZA 2Q83A 3VHEA 3I81A 3BU5A 1YRPA 3S2PA 4WG3A 3R9DA 3ROYA 2QOHA 4ZZNA 5I4NA 1M17A 4FTNA 5CTPA 3QCSA 1QPCA 4DT8A 4ZS4A 5ANJA 2P4IA 4NCTA 3OROA 2HAKA 2JLDA 5KMMA 3UO5A 3KXGA 1UU3A 3GOPA 4BZDA 5F94A 4JDKA 2WQNA 4O91A 3H9RA 1AQ1A 1XH9A 4DTBA 4UN0C 2EB2A 4Q9SA 2VTAA 2J2IB 4JVGA 1YDTE 3TZ7A 2V7OA 3F3TA 4I6HA 4RX7A 5DEWA 5DWRA 3UPZA 2OW3A 3K2LA 4O96A 3EOCA 4F70A 5HBHA 2CNUA 4KABA 3TKHA 2OJFE 3OS3A 3RJCA 2XNMA 2XJ0A 4FTIA 4YC6A 2IVSA 4Y8DA 3EN4A 3QC4A 4PY1A 3RWPA 4G9RA 5HO6A 3W2PA 4C36A 2WELA 3FI2A 3SXRA 5M4CA 4H36A 4S34A 2IZRA 2YJRA 2YM7A 2PVJA 4S31A 2GU8A 4FT9A 4LV8A 4XG9A 3NW7A 4I0RA 3PSCA 3UODA 2OO8X 3NUNA 4HW7A 3ULZA 4ZZMA 3C51A 3HRCA 2R7BA 4ID7A 4V01A 2Y9QA 2UVYA 4JBVA 4RJ8A 3N9XA 4ZXTA 3LFEA 3VW8A 3ZO4A 4AZFA 4BDFA 5JMSA 4CG8A 4YTCA 5K5NA 4AZEA 2AUHA 3MIAA 4JIAA 3QU0A 4MBJA 3SQQA 1XJDA 5HBJA 3KRWA 3F3UA 3FHRA 4E93A 4I21A 3C4WA 1ZOEA 3OEZA 3PSBA 2E9UA 4FZDB 4IB0A 4XCUA 3PFQA 4GIHA 2RFDA 4YHJA 3PLAE 3L9LA 2BAJA 3VJOA 1W0XC 4ANNA 3I0OA 2IW8A 2XRWA 3MSSA 3UOKA 5CF5A 3PIYA 5HQ0A 3ZXZA 1BI7A 1SM2A 3NCZA 3LMIA 3U55A 4GKHA 2W0JA 4FNWA 3PJ2A 3D2IA 3EL7A 4H3BA 5LVOA 4LGGA 3ZH8A 3RNIA 2JDSA 4G16A 5GIOE 3FL4A 3SDJA 2QU5A 3CC6A 1NY3A 3KVWA 3NUPA 4FTQA 5C8MA 4YTFA 4D2SA 4EOKA 3AMAA 4FVRA 2WMSA 5CU2A 3FWQA 4RIOA 4XJ0A 4A9UA 4IVAA 5E8YA 5F95A 4GL9A 3Q53A 3HUBA 2UZBA 1OIQA 2XVDA 2HCKA 3OEFX 4RJ3A 4LI5A 2JAMA 2HK5A 3QYWA 3EFKA 4X2KA 2ITUA 1FMOE 4OGRA 3QX4A 4D5KA 3LLTA 4FKUA 4U44A 4R1YA 4QPMA 3VJNA 1OECA 3DBCA 2O64A 4TYJA 5BUIA 2X2LA 5HKMA 1OMWA 5DH3A 5BUJA 5CAPA 4F6WA 3MH1A 3TKIA 3PZEA 2UW4A 4BCJA 3RVGA 1PKGA 5HIBA 4IWOA 2CKPA 3KULA 4DH5A 4BDDA 3OW3A 4C34A 3MN3A 1H01A 4G3GA 5AEPA 2Y6MA 4QYYA 3ZYAA 4USFA 2XK9A 2PL0A 3W55A 2X8EA 4YC8A 2F49A 1J7IA 1GZ8A 3D9VA 4EONA 5KMJA 1U46A 2VO3A 4FSQA 3GU5A 3V3VA 1RQQA 2Q0BA 4QMLA 1YI3A 5CQUA 2PMNX 3KXNA 3DB6A 3CR0A 4HCVA 3V5QA 2VGOA 1YI6A 2C6EA 3KU2A 3VS3A 5EQYA 3OVVA 2OZOA 4U79A 3BBWA 3OXZA 2GNLA 1MQ4A 5IA2A 2R3KA 3VRYA 3FMNA 3Q5IA 4O22A 4FNZA 1OKZA 4A07A 5J5SA 1YI4A 1W98A 2QLUA 2OLCA 4U41A 5M51A 3F3VA 3QRKA 1R0EA 1HOWA 3GCQA 5CS6A 4QQJA 1MRYA 1RDQE 2DQ7X 3BX5A 3TG1A 2WAJA 4D1ZA 5IEYA 4GT5A 3TDVA 1JWHA 4FKVA 4I5CA 4DEBA 3COKA 3IGOA 2W4JA 3E8NA 3PIXA 3FI3A 5H2UA 4DBNA 2QOBA 2XZSA 2ZB1A 4KKHA 5DE2A 5A9UA 3KULB 2O8YA 4MXAA 2LAVA 4M7IA 5DR6A 5IUIA 3EQHA 4K9YA 5DMZA 4EOIA 4FSYA 3R7OA 1J7UA 2XB7A 3A7HA 4JT3A 4EYJA 3ZLYA 4J98A 4FC0A 4C4GA 1PKDA 4DITA 3MW1A 3TDWA 4D58A 4DCEA 4WNKA 4NIFA 3R8ZA 4ZSLA 5JGAA 2PVMA 3F9NA 1Q8ZA 3W16A 5EDRA 1BYGA 4K33A 4YJOA 2BAQA 5TO8A 1YHWA 3WI6A 3IK3A 5LMBA 2W1HA 1PRYA 4D9TA 2BILB 4AN9A 5GZAA 4TKSA 4EI4A 3TM0A 3L8VA 3EH9A 3HA6A 3DNDA 4JR7A 1PMUA 1PXPA 2W9ZB 4JDIA 2REIA 4RVLA 4CFVA 3GENA 4Z7HA 4GFMA 3FLSA 3MFRA 3R9HA 4FZFB 4UXQA 4P5ZA 3MJ1A 4OTIA 4RVMA 3MVJA 1PHKA 5BVNA 5E7RA 4FL2A 2CJMA 2ITTA 3Q52A 4GFGA 4O6EA 4DTKA 2OBJA 3QWJA 4YURA 3NNWA 2VWZA 4IAYA 2WMRA 3NRMA 5E8WA 5IMXA 4QMMA 4RJ6A 4RZVA 1A9UA 1ZY5A 3ENMA 3FZRA 4RFYA 1ZXEA 4AOTA 3PWYA 3IOPA 3IQ7A 2UV2A 4HYSA 4IWQA 4QP7A 4YZMA 2PYWA 3JVRA 4EWHA 4C58A 2YM4A 4IAAA 4P90A 2OK1A 4HVGA 3WE8A 4YUQA 3O50A 4NFMA 2OI4X 4BWKA 1IAJA 2WTCA 2YAKA 4AZVA 4UZHA 4B6LA 4WG5A 2PZ5A 4NIFB 2XYNA 1FQ1B 2VTTA 3GCSA 2Y8OA 4G34A 2ITPA 3D5VA 4RRVA 3DQXA 1JNKA 3AT2A 2VZ6A 5CEPA 3FUPA 4AW2A 5A6OA 5BMSA 5DVRA 3TJDA 5CNNA 3FXXA 3ZDIA 2J0JA 1Q99A 3QQJA 5AV4A 4L45A 5CAUA 5HG7A 3GT8A 5I9XA 3BYVA 3FPQA 3OCGA 2YIXA 4ZTRA 1CM8A 1Q3DA 4BDGA 4MXOA 5L8JA 3VQHA 4ZSAA 4GMYA 4GRBA 3EIDA 5AP3A 2OIQA 1XQZA 4I0SA 1E1XA 4QMXA 4UXLA 5DT0A 3PUPA 5FBOA 3HRBA 4FUYA 4XV9A 2ZYBA 5AUVA 3HRFA 1OIUA 5T6KA 3ZBFA 5ANEA 4RIYB 2G2HA 5EYCA 2PVYA 5AR3A 2BRMA 3PPKA 4D2PA 2B9FA 4ZTQA 4YBKA 2VTSA 3WF5A 4F6UA 2XUUA 4F4PA 2X7FA 4CNHA 3B8RA 5HORA 2EVAA 2WXVA 4FTOA 2QOLA 3DKCA 1XWSA 5DOSA 3QTWA 3Q6WA 4XP0A 1UKIA 4D28A 4XP2A 4BTKA 4RVTA 5K0XA 4YJNA 4TWPA 3NCGA 4LRKA 3UZPA 4R78A 3GEQA 3R22A 1WBPA 2PUPA 1YW2A 5L2WA 4AGUA 3LFCA 4AA5A 4E3CA 1LR4A 2PZRA 4C0TA 4BDIA 4NU1A 4DG3E 1ND4A 4LUDA 3VS4A 5AP0A 4BCGA 1FOTA 5LCJA 1P4OA 4OBOA 3W2QA 2VWWA 3ORZA 4LOOA 4I1ZA 5AM6A 3RPYA 3CGOA 3OMVA 3CEKA 3QD3A 4MD8E 3AT4A 3AQVA 3FMMA 4IIRA 4FA2A 2VTQA 1Y8YA 3D83A 4ACHA 3R8UA 4W9WA 3F7WA 2KTYA 3KC3A 5JH6A 2Y4PA 3FBVA 3E7VA 3MY5A 3OT8A 1Q61A 2CCIA 1JOWB 3K54A 4TNDA 2WTIA 4E73A 2VO6A 3D4QA 3JS2A 3E93A 2BVAA 4AZTA 4IB5A 4BDEA 2P3GX 1JQHA 3W33A 3F82A 4J1RA 5D9HA 4HVDA 3KN5A 4O2ZA 2VX3A 4W9XA 3MJ2A 4YZCA 4OAUC 3DXPA 4A4LA 2YDKA 3N4UA 2BHHA 1ZYJA 5A4CA 2H34A 2WTDA 3RALA 5CEKA 4AAAA 4C02A 5IA0A 4WNOA 4GKIA 4RVKA 3DZQA 4O0YA 2YM5A 2UZLA 5M08A 2IJMA 2GNFA 5AP1A 4P2KA 2VTOA 3FL5A 4PTEA 4QP1A 2GQSA 4L42A 3LFDA 1YOJA 4IE9A 3FMJA 4FTUA 3QTSA 3BI6A 1J91A 3PY3A 2RSVA 4NKSA 4XRLA 4QMUA 1WVXA 4DINA 5KO1A 5LXMA 2O3PA 4IVDA 4PDYA 1V1KA 2BUJA 1H24A 4L6QA 3ZHPC 4AXAA 3MB7A 3DFAA 2FSTX 3QRIA 3C5IA 4AFJA 3QFVA 2WIHA 5FM2A 2E9PA 2GHGA 2XRUA 2HIWA 2ZDTA 2B52A 2VWXA 3NX8A 1HCLA 2RKUA 4L9IA 2B1PA 4XOZA 3VS7A 4KSPA 3VNTA 2W1CA 4M97A 1JLUE 3RM6A 4O7WA 2VRXA 3IONA 4Z55A 4IX5A 5FXSA 5CU3A 5HCZA 2IZUA 3OWKA 5IPJA 2XK7A 1KE8A 3FDNA 4A9RA 3R7YA 4ANBA 2WNTA 3LFSA 3G6GA 4EJNA 3ANQA 4FKJA 2WMQA 4L3JA 1KWPA 3BV2A 4Q5EA 1Q4LA 2C0IA 3CIKA 3PY1A 4L44A 5DYJA 2VGPA 4ZAUA 1ZYCA 3DK6A 4UX9A 4F9BA 5CI6A 2C47A 4L46A 2ITWA 4IANA 5BYLA 3BQCA 4QPSA 5E92A 3EKNA 4RFZA 2WQBA 3QGYA 4HCUA 3BV3A 5JRQA 2OKRA 3TZ9A 2WU6A 4N57A 3F5UA 4NJDA 4E5AX 4DG0E 4ANQA 3KF7A 3KVXA 3E3BX 4MD7E 2UZNA 1M2PA 3ORKA 2GHMA 4M67A 2WMUA 2GPHA 5CQWA 4LL5A 4WHZA 4XLIA 4PP7A 3VS0A 2UZEA 3BLQA 1I44A 1PXIA 3DTWA 5EK7A 5HEZA 3WE4A 3LMHA 2WMXA 4QP3A 2PK9A 3IDBA 1XH6A 4HGEA 5ACBC 3DXQA 4JNWA 4B0GA 2P2IA 4PL4A 3ZUUA 4BFMA 1CSNA 4F0GA 5E8ZA 3OOMA 2EUFB 4I4FA 4TWCA 3IW7A 4PQNA 4RLLA 3RAHA 1YHSA 1RE8A 2JITA 1O6YA 2R3HA 3P5KA 1XHAA 2BTRA 4FKTA 3LXLA 4MAOA 4XRJA 3ALOA 3C9WA 2XNGA 3H30A 2BDWA 1Y6BA 3DBQA 3P78A 4G3EA 2QKWB 3AC8A 4EK8A 2CNQA 5K4JA 3LQ3A 4K6ZA 1UWHA 3M11A 1BKXA 4K8AA 3FC2A 4U80A 5EW3A 2GMXA 3W2SA 4FX3A 3KMMA 3KB7A 4AW1A 3QZGA 3DXNA 3RAKA 5C26A 3VBYA 5JQ8A 3Q4UA 3ZRMA 3ZZWA 3LMGA 2A27A 3QTXA 4E26A 5HE2A 5BVFA 4U9AA 4JQ7A 4AQCA 1P5EA 5AP2A 5DR9A 3TL8A 4RBLA 4JX7A 4R1VA 1PXKA 3LQ5A 4C7TA 5IDNA 4ITIA 3ROCA 4RLKA 2RFNA 5HE1A 2PZYA 4DLJA 4D2RA 4NM5A 1FPUA 1M2RA 3M2WA 1EH4A 2X1NA 4PDSA 4RC3A 3RK5A 5L6WL 5L4QA 2BCJA 2YCSA 4FT0A 1V0PA 5EDQA 2YA9A 2DS1A 5F20A 4XG4A 3CD8A 4FK3A 5HESA 2QC6A 4YJVA 5KZIA 4WIHA 2HY0A 3DB8A 1PYXA 2R3NA 5CWZA 1P2AA 1A48A 3DDQA 4O1PA 5A4EA 5BVDA 4O7TA 3KY2A 1FMKA 4M12A 3UIBA 2B4SB 3V04A 1B39A 4KBAA 4F9AA 4WUNA 1PW2A 5HD7A 5FLFA 4APPA 5CASA 3QXOA 5C4KA 1OKWA 3TI1A 5L3AA 3R1YA 2VN9A 3JVSA 1DS5A 3TV7A 4HZSA 3QUEA 2C4GA 5FXQA 2YACA 2VWBA 3BBTB 3UYTA 4BBEA 3I6UA 3QTRA 2JDRA 2FVDA 2WTKB 3LQ8A 4WD5A 3GFEA 3UTOA 4ACGA 4CFWA 4GJ2A 4R7BA 2QOKA 5CAQA 3G51A 4RPVA 4XHKB 4Y46A 2PULA 4FTJA 3NUUA 2X9FA 2UZOA 3QTIA 5D41A 5HO8A 2BTSA 2BZHB 2ACXA 4CRSA 3F6XA 2I0EA 2XIKA 4IWPA 5I9VA 3W2CA 4RSSA 3OY3A 3F88A 5CU0A 4G2FA 3ORNA 4UMTA 2G1TA 5IA5A 3PWDA 4W4YA 3RPOA 4Y85A 4XG7A 3DOGA 1WCCA 3LCOA 4IX4A 4QQTA 3AC3A 4R3RA 4BKYA 5K3YA 5CVHA 3UO4A 5EM6A 4RMZA 4F7SA 4PNKA 4V0GB 4OAVB 2Q0NA 3FZTA 2JBOA 3QTQA 4ZY5A 3GFWA 3OP5A 3E63A 3FZOA 4KINA 3WIGA 3G9LX 4FL3A 4N4SA 5CVFA 5EG3A 4YP8A 5BYZA 5L6OA 3F2RA 5FEEA 4B4LA 1YDSE 1JSUA 3NUSA 3KXZA 4RIXA 5B2KA 4NM7A 2YIYA 3MPMA 3C7QA 2QG7A 2W05A 3JR1A 3R0TA 4CCUA 4HGLA 4YHFA 4MBIA 2WFYA 2XS0A 5LCKA 5DRBA 4DH3A 5KBQA 2RGPA 1PF8A 3R04A 3MA6A 5IU2A 5EYKA 3QRJA 3ZEPA 4D4SA 3LFNA 4QMZA 5CENA 1HCKA 2UZUE 2YWPA 3I6WA 3ORPA 3MH0A 4LM5A 4U8ZA 5CALA 5JGDA 1PMNA 2NO3A 3NAXA 4P4CA 4YO4A 5HOAA 4IH8A 3FLQA 4E4XA 4FL1A 3NS9A 1VYZA 3EB0A 4ACMA 4E8AA 4FSUA 1T46A 2IZSA 4JRVA 3T3VA 3PG3A 4EH2A 3LXKA 1M7NA 4FG8A 3QTUA 2YDJA 2C3JA 3LVPA 2QCSA 3HZTA 4EOSA 3UVPA 5JQ5A 2Y7JA 3R00A 3RTPA 1CKIA 1OUYA 4D4RA 2V7AA 2JEDA 3CQEA 3FZ1A 3OUNB 2W1DA 3AD6A 3NNUA 5D7AA 4O83A 4GVAA 4I24A 3FKOA 4IB3A 1Y91A 3R28A 4BC6A 4XV1A 4CKJA 4DEIA 1X8BA 4GG7A 4RIXB 5KMLA 2I1MA 1L3RE 4LMNA 3EJ1A 4OBQA 4QOXA 4WKQA 1YXSA 3BYOA 4O84A 2HZ4A 1O6KA 2I40A 1ZWSA 3KXHA 5GIPE 2B9HA 3QZFA 4WSYA 5IQIA 4CV8A 4W8DA 2VTPA 3L9MA 3LJ1A 4QMVA 4FKQA 3ZFMA 3DLZA 2R64A 3KRLA 4IZ5A 4CMTA 4XNEA 2C5VA 3OTUA 4FV2A 3RCJA 1W7HA 4LOPA 3VWAA 2J6MA 2ONLA 4KIQA 4W4VA 4ZOGA 4EH6A 4YSJA 4DH8A 4O0VA 4CQEA 4B8MA 5J1WA 2A4LA 4UWBA 4LL0A 3TUBA 2JIUA 1NT2A 4IM3A 4C3PA 2PVHA 4EL9A 3FZPA 3D14A 3FLWA 3ZOSA 4AZSA 4CFMA 2QG5A 3UP7A 3TJCA 3PA4A 2W5BA 2OJ9A 5L2TA 4TN6A 3POOA 2ZDUA 3KK9A 3R1SA 3IW5A 3DDPA 4GU6A 4AGCA 3GCUA 4F0FA 2IW6A 4O7ZA 2GHLA 4XG2A 4YJSA 3Q3BA 3RINA 3VUTA 3AC2A 2B9IA 2EXEA 4MXYA 3BE2A 4L68A 4X3FC 4L3LA 4AP7A 5IH5A 1XBAA 4ZSJA 3GC0A 3FQSA 4YNEA 4AF3A 2ZM3A 5L2SA 3PXQA 2EXCX 3PIZA 4BCHA 4E5WA 4BHZA 2Z7LA 3D15A 5IISA 3ULIA 2QO2A 2VWUA 5B2LA 2FB8A 3HKOA 1PJKA 2YM6A 4D2VA 2OJJA 5HVJA 3VBWA 4BDKA 4YJQA 4C2WA 4EZ3A 5M56A 2PWLA 4HPTE 4PF4A 2P2HA 4O1OA 3ZRKA 1QPDA 4FZ6A 4ASXA 2KULA 4G5PA 4CYIA 4J71A 3ZBXA 4BBMA 3E5AA 4NTTA 4UV0A 3R71A 2H6DA 3AC4A 5I0BA 3Q4ZA 4FV7A 4I94A 5AR8A 5LMKA 5A6NA 2HWOA 3SVVA 4C57A 2PPQA 5EM7A 3NYVA 3OCTA 4MNFA 5IQHA 5HGIA 1STCE 3NW5A 1KV1A 3DA6A 5HE0A 2JC6A 4C62A 5JSMA 2YJSA 3ATSA 3B2WA 1R0PA 2IG7A 3PG1A 4UMRA 3O2MA 4S30A 2QOOA 5KE0A 1WAKA 2W4KA 1OITA 3ZTXA 1ZZLA 4OTQA 4TNBA 2WZJA 3RAIA 4D2TA 4ENYA 5IQAA 1VJYA 1NA7A 2R3GA 4ZMFA 3ORMA 5T3QA 4HGTA 3UOJA 4FKPA 4HYHA 4B9DA 4HOKA 5JZNA 5KKRC 4RZWA 5EHLA 3QZIA 3R1QA 3V5JA 1H1PA 5JN2A 3RI1A 3DTCA 2WPAA 3UDBA 4KS8A 1OKYA 3UIXA 4DFNA 2WEVA 2Z7QA 3HDNA 3U8WA 4ZMEA 4QMQA 5F1ZA 3TNPC 3BE9A 3U54A 4BDHA 3CLYA 4JIKA 1ZYSA 4MTAA 3AGMA 2VV9A 3EQBA 3NYXA 5EI8A 5EQEA 1M52A 4YU2A 2BKKA 4C4JA 2E9OA 2C0OA 5FGKA 3EMGA 4BVUA 3ZLXA 3A99A 4FTMA 4JDJA 4IAIA 1U54A 4GH2A 2FYSA 4JLCA 2BDFA 1BX6A 2PVFA 5CVGA 4D5HA 2XM8A 3R7UA 5AR4A 2ETRA 3NW6A 5LQFA 2C6LA 1OL7A 2C3IB 3FSKA 3C0HA 4KIOA 5D11A 3PYYA 1H25A 3BYMA 3P23A 4IFGA 1WZYA 3KCFA 4R5YA 3VUIA 4BI0A 3OG7A 1OM1A 2VO7A 3FMDA 2OIDA 3CKXA 3LXPA 3MYGA 4N0SA 4OTFA 3W32A 4AU8A 4QYHA 5C1QB 4D4YA 3O17A 4IB1A 5C8KA 4HNIA 4OTHA 4JX3A 4TWOA 4FNYA 2R3OA 2YEXA 3ANRA 4XG6A 5LVNA 4R7HA 3P86A 3HL7A 2CHLA 4F9WA 3ZO3A 3UQGA 1ZOGA 1LEWA 1PY5A 1Z5MA 4C4EA 1KE6A 3SG9A 4IX3A 1WMKA 3DAKA 4X7QA 3VIDA 4DH1A 2ITOA 2VTRA 1UU9A 2WEIA 4HVHA 2CKQA 4CMOA 5AA9A 4LMUA 3VS6A 4WNMA 1GIHA 4OT6A 1VR2A 3FKNA 4IVCA 3R8LA 3AOXA 4BIBA 2YWVA 5GNKA 1FGIA 3CTQA 3R21A 4GYIA 3A4OX 3GGFA 4QTCA 3SA0A 5LVMA 4HYIA 1U54B 3PP0A 2JGZA 4GT4A 4I20A 3R8MA 1KOAA 4OUCA 4PX6A 5AV0A 4FVPA 3R7EA 4PP9A 5E8VA 4ACCA 4RWJA 2FSLX 3UQFA 4MF0A 3U6JA 2WO6A 3ELJA 3I79A 3VC4A 2AYPA 2QR8A 3KGAA 3NUXA 3PE1A 5HCXA 5C01A 3W2OA 4CD0A 5GJFA 3ID6C 2WD1A 3EQIA 4UBAA 3TIZA 2XEYA 4TXCA 4NT4A 4O86A 4TTHB 4D4VA 4BCKA 3LCKA 2HENA 3M42A 5B7VA 3N4VA 4O7SA 4IADA 3E8DA 4XX9A 3ACJA 4BCFA 3P1AA 3KK8A 5CZIA 5IKWA 1AGWA 1MUOA 3LE6A 4L52A 1TQMA 4I93A 4QMYA 4D1XA 3CXWA 3DU8A 3PXZA 3TTJA 3DKOA 4UYNA 3ZO2A 3VUMA 4RT7A 2J50A 2W96B 4AGWA 1JKTA 3NVMB 2P0CA 4FICA 3VO3A 3W2RA 5K5XA 2A19B 5AP7A 4YLKA 2C3KA 4O82A 2C1BA 2OH4A 4I92A 3W1FA 4CSVA 2OFVA 3RZBA 3ZSIA 3O7LD 3C0IA 3HYHA 3WZEA 3WYXA 4CZYB 4UWCA 3SW7A 4ZJJA 4RGJA 2YCFA 3V6RA 4H05A 2RFEA 4FT5A 3LCTA 1J7LA 2C0TA 2XYUA 4Q5HA 4MF1A 2HZNA 5A3XA 5CSPA 4GUEA 2QODA 2W1ZA 5HIEA 4FIEA 3BGQA 5M55A 5T68A 3SG8A 2ZV2A 3UE4A 1ZYLA 2OIBA 2XKFA 1WBVA 2XNBA 4RC2A 3C4EA 3IW6A 4WUAA 2HELA 2BMCA 3JUHA 5A54A 2VO0A 4IC7A 3V8WA 1UNLA 2GTMA 3CCNA 3P9JA 4M14A 4MWHA 3OBGA 2IO6A 4WSQA 4ZJIA 3WF6A 3FLYA 4AOIA 1WVWA 2OJIA 2Y6OA 2J90A 3IOKA 4ITHA 4EH7A 5D12A 2XEZA 2H96A 4IX6A 1OKVA 5C4LA 4RIYA 4E7WA 3JXWA 5FEQA 1YXTA 2A2AA 1PXLA 3RHXA 4EH9A 5G6VA 3F2AA 4YZDA 3PRFA 4TPTA 4EKLA 4XEYA 5EHYA 4X6QC 4EHZA 2GFCA 3K5VA 4AX8A 4YC3A 2X6EA 5BVKA 5HO7A 5IDPA 4DCAA 2Y4IC 4EUUA 3FXZA 3G2FA 1U59A 5AAGA 4WT6A 3JY9A 3DK3A 5EW9A 3S95A 4RX9A 5M57A 2VTIA 2VTNA 5HLPA 3I7CA 3BKBA 3DLSA 3FZSA 3Q32A 4A4OA 4HVSA 2R4BA 3NNVA 2UW6A 3HV5A 4FEQA 5TR6A 5AJQA 5LVPA 3UJGA 4MXCA 3FMEA 3R73A 4CFFA 4ZZOA 4DGOA 2X7GA 3HNGA 5M06A 2X2MA 4KKGA 5FBNC 5CEOA 5ITAA 1PMVA 1TKIA 4U97A 4QTBA 3ZU7A 3WZJA 5EKOA 1DI9A 3LPBA 5J8IA 5FTQA 1ZYDA 4E5BA 1WFCA 4M68A 5M4FA 1JKSA 2X9EA 1V0OA 4QP6A 4ZSGA 5H8GA 4C2VA 4DGLC 1OBGA 3NUAA 3HEGA 2BR1A 2OXXA 4E6DA 5GZ8A 4QMPA 2F2UA 3HAVA 2B53A 3QA8A 4FVQA 4K0YA 5CU4A 5KHWA 3PJ1A 4EK5A 1B6CB 2ITNA 2WMVA 4FV0A 3AD4A 4R5SA 2XJ2A 4W4XA 4FTLA 5DLSA 5HI2A 3OCSA 5HU9A 3SXFA 2PMOX 4IDTA 2W99B 4LYNA 3BWFA 3UIMA 4AW0A 5GINE 4QP9A 3ORIA 4FSRA 4FV3A 3ZM4A 1F0QA 4NFNA 2JIIA 1SMHA 3RK7A 4I0TA 4Q2AA 4G1WA 2GQRA 3Q2MA 4DEDA 4ALVA 5DPVA 4EH4A 4PNIA 3CPBA 4C61A 5HLNA 3HUCA 5EYMA 4BICA 1KUTA 2WTVA 3GQIA 3K5UA 4MH7A 3UGCA 3LZBA 1YXUA 3NIEA 3S3IA 3RGFA 1SZMA 3VUHA 2RG6A 4EC9A 3I5ZA 4K18A 5CXHA 3GC8A 4M69A 4FODA 5H3QA 2HYYA 2XIRA 2R3JA 2YM8A 5M44A 1WBSA 5CF6A 4M3QA 1H4LA 3RZFA 2ITYA 4C8BA 2AC3A 2YIWA 2J0KA 4PL5A 5JFXA 5ACKA 4F7JA 2WIPA 5AAFA 2VWIA 1G3NA 3LCSA 3SOAA 4O7RA 2BALA 4BCOA 2RL5A 3EN5A 2AC5A 2R0UA 4I6QA 3ZC5A 3O23A 4XOYA 4GVJA 3LM0A 3H9FA 5HICA 5L6PA 2W7XA 3VBQA 2QURA 1H0VA 2RF9A 4DN5A 2QOFA 5IA1A 4IZ7A 4TW9A 3FY2A 4E6QA 5I9YA 4B99A 4D1SA 3DJ7A 3IGGA 5JRSA 4Z3VA 4BYJA 1UU8A 1ZMUA 3SKCA 1G5SA 4EORA 3CJFA 3W8LA 3CJGA 4NZWB 4IWDA 4YHTA 1YHVA 3KXMA 4BYIA 1ZLTA 3A7GA 3NPCA 4BF2A 5AMNA 4EZ5A 2F7EE 2PVNA 5CY3A 5LOHA 5D10A 4O0RA 5CAVA 5CT7A 3G6HA 2YIRA 3R7IA 4CGAA 3VVHA 3H4JA 2OWBA 3QXPA 5IF1A 3NVKI 4BTFA 3CBLA 3QC9A 4OTPA 2BHEA 3AT3A 1BMKA 3G90X 4TYIA 2YCQA 3COMA 4GFOA 4M69B 5BQ0A 1J3HA 4YNOA 1O6LA 5IQDA 3D5WA 1FGKA 1UU7A 4JQ8A 4FIJA 3AMYA 3I5NA 2VD5A 2ZM4A 4KNBA 4HNFA 2Z02A 3U6IA 3FHIA 1BI8A 3OXIA 2Z60A 1QL6A 5AUXA 4CLIA 4FTCA 2UZDA 3MGYA 3KXXA 3HV4A 3QYZA 2GS2A 1E1VA 1FVVA 4FKRA 5CSVA 1YXXA 3QALE 5DG5A 3CGFA 4JRNA 4YPSA 4CYJA 3CD3A 2OH0E 4JAIA 3A61A 4DE4A 4ARKA 2CSNA 3VAPA 3PXRA 3QRUA 4KIKB 4GG5A 3UIUA 2F9GA 4U45A 2PMLX 2C6DA 4ANLA 4IFCA 5AAEA 3SGCA 2PVLA 4H3QA 2GDOA 4EQMA 1OI9A 2JDOA 2RIOA 4AE9A 5ANKA 3GXLA 3FYKX 3QLFA 4RJ5A 1GOLA 3L9NA 1QPEA 2BZIB 5C9CA 4KB8A 2YIQA 4CG9A 4BB4A 3ZDUA 4BL1A 3LOKA 2OU7A 1H07A 3P7BA 3DKFA 3D94A 2UZTA 3PXKA 3C4FA 3C4XA 4FSNA 4WBOA 5LMAA 3P7AA 3Q9YA 4EK3A 2BIYA 4L7SA 4F9YA 4OT5A 4ZTMA 3KKVA 4EOLA 3TWJA 4O27B 4CXAA 5LWMA 2XA4A 4MYGA 3SAYA 2W1EA 3E92A 1OPKA 4FSZA 5AADA 1R1WA 1VZOA 2RG5A 5AR2A 2VU3A 3F3ZA 4MK0A 4WNPA 4EH8A 4XMOA 5DHJA 3TNQB 5DA3A 4F0IA 4EEVA 5A46A 2PE0A 5DN3A 3MB6A 3EZRA 4XBUA 5FXRA 4QNAA 2X6DA 1GZOA 3PVUA 4KSQA 4M0ZA 4EOPA 4C4HA 3DZOA 4TL0A 4FYOA 4EWQA 2IPXA 3RPVA 4BCMA 2YM3A 3PE2A 2XP2A 4BR3A 4TY1A 1XH5A 3PJ3A 3O8TA 4PMSA 3KEXA 3QQGA 5J5TA 5KMKA 3QL8A 3BU3A 4TWNA 3MTFA 2OXYA 5IMEA 3ODYX 4JBPA 4R6VA 3R8PA 3L8PA 2YHVA 3CE3A 4HPUE 4LFIA 2C69A 3TN8A 5C03A 3UZRA 4YZNA 3HDMA 2VUWA 1H27A 5AR5A 3Q2JA 3FI4A 4NCTC 4YZ9A 1UNGA 4ERWA 3ATTA 2F57A 2OFUA 3LM5A 4KKEA 3I0QA 2OGVA 3PVBA 4YZBA 5AIKA 4CQGA 4RJ7A 1LPUA 4UY9A 3FSFA 4I5MA 2XM9A 4I5HA 3ITZA 4H58A 5JGBA 1RW8A 2JFLA 2QOCA 3HVCA 4K2RA 3TV6A 5LMKC 3OC1A 1M7QA 4MVFA 3KQ7A 1WBWA 4S33A 1OL6A 5CEMA 3UNZA 4NSTA 4NUSA 1GIIA 1P4FA 3D5UA 2CDZA 2WHBA 4YJPA 4DYMA 3G15A 3ODZX 2IN6A 2GSFA 3MDYA 3KL8A 1SVGA 3IDPA 2YZAA 3DV3A 4IQ6A 5IQCA 2J5EA 5BYYA 4GUBA 5CSWA 5AX3A 2HW6A 4P5QA 3EFWA 4V0GA 4YJRA 5FRIA 1XH7A 3EYHA 2JKQA 3HV7A 4KWPA 3HX4A 3W18A 5HZNA 2J0MB 4JG7A 3BU6A 2OICA 2YLFA 5KMNA 2X81A 3Q4TA 3QCQA 4U5JA 1H28A 5I5ZA 3GCPA 2XMYA 3C5UA 2ZVAA 5EW8A 2O65A 2W4OA 1JKKA 4ZTHA 1SYKA 4FZ7A 4IXPA 3MESA 2E2BA 1U4DA 5EHOA 2V22A 3VUGA 3EN6A 2XBAA 2PE1A 3QQKA 4C35A 4MCVA 4RWLA 4BWXA 4FV9A 4U43A 3FQHA 1XKKA 3A2CA 3BHTA 4CT1A 5HG9A 4DC2A 2QO7A 2WQMA 3HMNA 4ZY6A 3IPHA 1GIJA 3TUCA 3E8EA 1S9IA 4KRDA 2UW8A 3UC4A 3FLZA 1CKPA 3LJ2A 3SRVA 4ZTNA 4FV4A 3UG2A 3MFUA 2WTWA 2JDTA 3MIYA 4IBMA 3SLSA 3DJ5A 4APCA 4EC8A 2QOQA 1NXKA 4BWPA 4R7IA 3TUDA 5KUPA 3UPXA 3O7LB 3PDTA 1R78A 4FSTA 3UQCA 3ORLA 5A4QA 3TEIA 3HECA 1G8SA 3F2NA 4RWIA 3U4WA 5CXZA 3HAMA 1PXJA 3MPAA 4PUZA 4OLIA 2XCKA 4UEUA 2J4ZA 3IG7A 1ZZ2A 3DKGA 3UMXA 3KF4A 3UVQA 3ZLSA 3FAAA 3CSVA 5AIRA 1DI8A 4XUFA 3ZO1A 4BIDA 2R3QA 2C30A 1PXNA 4MQ2A 3U9CA 3OW4A 5IQGA 3UMWA 2BDJA 4J97A 4ALUA 4YJUA 5E90A 3TCPA 2VTJA 3QX2A 1M14A 1KE9A 2PMIA 4YGAA 2CN8A 3I4BA 5GJGA 4Y83A 4RJ4A 4NM3A 5CX9A 3SOCA 3DBEA 3FLNC 3THBA 3C1XA 5KMOA 3D7ZA 1F3MC 4FTRA 3OBJA 4ITJA 3WF8A 3F3WA 1XBBA 3RPSA 2C6KA 2H9VA 3SRVB 5F9EA 4WO5A 3DAJA 1YWRA 3PY0A 3G5DA 4CTCA 4Y5QA 4AA4A 5IUGA 4FV5A 4N70A 3U87A 1FINA 5FWKK 2BIKB 2W9FB 3OFMA 3QF9A 5CSXA 2HW7A 2QR7A 1H1QA 4E6CA 2XNNA 4I23A 4RQVA 2OZAA 3L9PA 4RA4A 4G3FA 3V8TA 2ZM1A 3ZM9A 3B8QA 2O2UA 3ORXA 3MTLA 4JXFA 2JAVA 4EQUA 4BDBA 2CN5A 2ERZE 1GZNA 4PMTA 4G3CA 4F1OA 2QOIA 4BCIA 2X7OA 4E4LA 4M13A 4FYNA 1L8TA 3GUBA 3MY0A 1YDRE 3OF0A 3IDCA 5JKGA 5BUEA 2R3FA 3Q04A 4EHVA 4X2FA 3C50A 1GZKA 5BMMA 4BZNA 5BVOA 4U40A 1REKA 5TE0A 5E1EA 2IVVA 3ORTA 1BLXA 4O0SA 4DFXE 5CANA 1SNXA 2CGUA 4C4IA 1Q24A 3BHVA 4I4EA 1Q62A 2ZAZA 1I09A 4Z16A 4RG0A 3PP1A 4GU9A 3RK9A 5H9BA 3MV5A 3F61A 4FKLA 3WZKA 3V6SA 1VEBA 1JKLA 4IDVA 4U81A 2DUVA 4JQEA 2ITXA 4TRLA 1ZY4A 3RAWA 5CF4A 3R9OA 4PDOA 3EN9A 5H8BA 4DGMA 5KX8A 3I1AA 5FD2A 4QNYA 3GU4A 5ANDA 5HCYA 5JT2A 3W8QA 4X2JA 4I5PA 2B9JA 4E4MA 3TKUA 2J9MA 4L3PA 3WIKA 5CU6A 5FEDA 2PU8A 2J0IA 4LV5A 1Y8GA 4FEXA 2OZAB 5LARA 3TT0A 4NL0A 5J9LA 3CKWA 2BRGA 3SW4A 3BYUA 3PA3A 4O7LA 4DTAA 4A9SA 4EBWA 4KBKA 3LIJA 2PZIA 3CTHA 4PPAA 5DNRA 2EWAA 2CMWA 3GC9A 3OTVA 3NEWA 2VWYA 4JG6A 4B7TA 4DFZE 1GNGA 1G8AA 2NPQA 2VNYA 5E8XA 5K0KA 4OW8A 5JFWA 3R1NA 3EQCA 2YCRA 3T9TA 4AOJA 4BDCA 5AUUA 4YPDA 2XK6A 2ZOQA 3EYGA 3C4CA 1ZAOA 3TTIA 2PZPA 4FV1A 4LG4A 4R3PA 4EOMA 4QRCA 3DAEA 3LFAA 2UW3A 5J9ZA 5EKNA 2BKZA 4ZLOA 3F5GA 4MX9A 3RHKA 1R3CA 2P33A 4J8MA 1W84A 4YJTA 5ETAA 3WYYA 1O9UA 3QCXA 4J8NA 4D0WA 2GTNA 5BVEA 4JL9A 4NW6A 4BKZA 3KN6A 3ZEWA 2ZMCA 1IA8A 1WBNA 4F64A 3FMKA 2CGVA 2YLEA 3IW8A 3PRIA 4NWMA 3NYNA 2WQEA 2X4ZA 3QAME 4HZRA 4PDPA 4UMQA 3HMMA 5EI6A 4AS0A 3MH2A 5IEVA 3R01A 4FV8A 4LGHA 2C5XA 5L2IA 2FGIA 3QQHA 2W1IA 4CTBA 3BQRA 1U5RA 2XIXA 3QBNA 5CLPA 2XBJA 4UB7A 3P0MA 5EM5A 4GEOA 5CT0A 1GJOA 5EH0A 3BGZA 4BDAA 3MPTA 1ZMWA 1ATPE 3AXWA 5JFSA 4F1MA 4RX8A 2UVZA 1IEPA 3VULA 3MI9A 5TF9A 2Y0AA 4JAJA 4FK6A 4KIPA 2WOUA 1JBPE 2HXLA 3H0YA 5I9UA 2QU6A 3QRTA 3ENHA 1MQBA 4GYGA 5ANIA 5HU3A 4JOAA 4L67A 1AD5A 2BZKB 5CNOA 4BCNA 3G9NA 4FUXA 2WMWA 3AD5A 3G0FA 3E62A 3OWPA 4L53A 3T3UA 3OHTA 2XK4A 3BHYA 5GJDA 3BHHA 3P79A 4UMUA 4XH6A 3T9IA 4G6LA 3GU6A 5IQEA 2ZMDA 4ZEGA 3D7TA 4EH5A 4YR8A 2JFMA 3AMBA 3QHWA 2FSOX 2FUMA 3ZS5A 3A60A 4KUJA 1WVYA 4C37A 5IZFA 3COIA 4QT1A 3HV3A 3CPCA 4H3PA 5M07A 3DT1A 3QKMA 3WZDA 4C3RA 2G15A 2I0VA 3RMFA 1IG1A 4FZAB 3QUPA 4IHPA 1DM2A 2IZTA 3COHA 3GOKA 4FKIA 2R3IA 3II5A 4EHEA 4IZYA 2F4JA 5DFPA 3VBVA 5LWNA 3OD6X 3R9NA 5J7HA 4WOVA 4HYUA 2R7IA 5GHVA 4EZ7A 2VX1A 4LUEA 3C13A 4ZS0A 3ZFXA 3DS6A 2BFYA 3M1SA 4G3DA 2PTKA 3LFBA 5FP5A 4DT9A 3SC1A 3MS9A 4JBQA 4FOCA 1APME 5FTOA 2YZLA 3F5PA 4U7ZA 1KE7A 2G2FA 1OPJA 5HX8A 4GT3A 4A06A 1YOLA 3LJ0A 5IH6A 2R0IA 4ASZA 3OZ6A 2GQGA 5CZHA 4FI1A 1JSTA 3UO6A 5HHWA 2XIYA 3Q9ZA 2BZJA 4V05A 4FIIA 3C0GA 3D7TB 5EYDA 3HMPA 1NVRA 4E6AA 2VTMA 3PZHA 3WZUA 4FT7A 4FIGA 3SX9A 4C59A 2X4FA 2OG8A 2PE2A 1URCA 1YWVA 3GU8A 1OL1A 1SVEA 3V51A 4CFNA 2UW9A 1ZOHA 5AUWA 5I9ZA 3CTJA 3OXTA 3RKBA 5ETCA 2W17A 4QYFA 2J7TA 2ZJWA 4EJ7A
chains in the Genus database with same CATH superfamily
3BEGA 4O4EA 2OXDA 3BCEA 4RQKA 1RJBA 4BTJA 4FOBA 3QZHA 5AUTA 4KRCA 4NH1A 2G2IA 2HY81 4FGBA 5FM3A 4X2GA 2CGXA 3I7BA 3I60A 5E91A 1K9AA 1K3AA 1Q8UA 3TZ8A 2WMBA 5A14A 5C8NA 3ZRLA 3DY7A 5EOLA 5AP5A 3R63A 4U0IA 2QNJA 5G1XA 2R3RA 4IAZA 5LJJA 2QHNA 2JKOA 3BYSA 3IKAA 4J96A 3O8PA 4AACA 3F66A 4DFUA 5HNIX 1GY3A 2V0DA 4MBLA 3S4QA 3MVHA 1SNUA 4F6SA 1JSVA 3BPRA 2HOGA 3UOLA 3PPZA 4GS6A 5CYIA 1TQPA 2VTHA 2A0CX 4PV0A 5AR7A 3Q60A 5DT3A 2IVUA 5J79A 3VBXA 4IW0A 4FTTA 2XKCA 3EL8A 4IM2A 4BHNA 3UVRA 4NKAA 3SV0A 5F4NA 4AXEA 4M0YA 1QPJA 2XF0A 4DH7A 4CRLA 2I0YA 2V5QA 1XR1A 3IW4A 5GZ9A 4AT3A 5HTBA 2XCHA 4FNXA 3R02A 5HVYA 1FVTA 2W1GA 1P14A 4G6OA 4C4FA 1KV2A 3G33A 4QQ5A 3VUKA 2PUIA 4S32A 2CLXA 2HZ0A 4EQCA 2E9VA 4FJVA 2BRHA 4F9CA 3QHRA 2ZV7A 3HMIA 2XNOA 4RC4A 4ACDA 4YTHA 4D2WA 2R3MA 3KMWA 2GFSA 5E1SA 2C6IA 5BPYA 3LHJA 2XIZA 3TACA 4PMPA 5B2MA 4DEEA 1KSWA 1CKJA 3BLRA 3VQUA 2XNEA 1OIYA 5M4UA 4MEDA 1URWA 4HGSA 4PTCA 4KS7A 3ACKA 4F08A 4QDEA 5FUTA 5EDPA 2J0LA 3DK7A 3A7JA 3EZVA 4EOOA 1MRUA 4IJPA 4PRJA 5A4TA 4XV2A 3GC7A 2OF2A 4YSMA 1ZARA 3EHAA 5DT4A 4J95A 4FTAA 4CV9A 4H39A 4O0TA 2V62A 3ZUVA 3PVGA 1XH8A 3FXWA 4TT7A 4WG4A 3H0ZA 3AKJA 3FQEA 5HLWA 5M53A 4X3FA 4CFUA 2XNPA 3O96A 3KREA 3IS5A 2WTKC 4U42A 5I9WA 3W10A 2BROA 3FC1X 5J95A 5CI7A 5I3OA 2J5FA 2YN8A 4Z7GA 1IR3A 2PSQA 2OJGA 2YISA 3QA0A 4L00A 4NJ3A 4MNEA 4B8LA 2YABA 5BVWA 4BGHA 4FE2A 2XKDA 3DBFA 5HX6A 3NGAA 4U3YA 5E8TA 4UMPA 1OL2A 5JFVA 5J87A 3QD4A 5HG5A 3JYAA 5EOBA 3UYSA 5D1JA 4TYEA 4G5JA 5CEQA 4DGGA 4FIFA 2XJ1A 3LLAA 2LGCA 2W06A 3L1SA 3GI3A 3BEAA 4PPBA 4WBBB 4XG3A 1OVEA 3DFCB 4AUAA 5JEBA 3GU7A 4XLVA 1OL5A 4Y95A 4LOQA 3U51A 1WBOA 5JK3A 5AV2A 3V5LA 2CGWA 3UNKA 3BIZA 2EU9A 1JPAA 3G0EA 5HNGA 4UYAA 4YBJA 5HTCA 3QUDA 1S9JA 1YXVA 3EQRA 4ALWA 3TIYA 2NNWB 4U6RA 4EK6A 3UP2A 4RX5A 3O51A 5E9EA 2GNJA 3KA0A 3MFTA 4WA9A 1SVHA 3EQFA 3R2YA 2C1AA 2CLQA 3QGWA 1IASA 3ALNA 4QP8A 4K77A 3WBLA 3ZZEA 4UWYA 5AM7A 5M4IA 2B54A 4MXZA 3NIZA 4FT3A 4R8QA 4AG8A 4X3FB 4FEVA 2ITVA 1H1RA 4DEHA 4DF3A 4GSBA 5FG8A 3EFLA 1H1SA 2VX0A 3GP0A 5H8EA 2UVXA 4U3ZA 5ETFA 2NP8A 3N51A 4AE6A 3E88A 4BRXA 3ZONA 3PFYA 2QKRA 4RIWA 3D2KA 4PPCA 2C6OA 4I6FA 3MY1A 1YWNA 3JY0A 3QD0A 2GS7A 3H10A 4MNEB 3GCVA 4ZTSA 5BV3A 1ERKA 4G9CA 4GJ3A 4A9TA 3TXOA 2UW0A 3OWLA 2IWIA 3RCDA 3PJ8A 3RM7A 2WKMA 1U5QA 3R7VA 2YERA 3HV6A 5EM8A 2ITZA 3CS9A 4KBCA 4DFYA 5KNJA 4FR4A 5HD4A 2FO0A 1PXOA 5HE3A 4FKSA 2UW7A 5CAOA 5A4LA 5J1VA 3A4PA 4FGRA 4EK4A 3GBZA 5FTGA 2GNIA 4XS2A 3HGKA 3Q6UA 4UZDA 4AQKA 2PUNA 2F2CB 3VS1A 4PMMA 4AXDA 5AV3A 4ASDA 3NDMA 2GNGA 3ETAA 4XV3A 3NFGB 3PA5A 4E1ZA 1NVSA 2WQOA 4GCJA 4CVAA 4CMUA 4KIKA 2P55A 2UW5A 2YFXA 1ZMVA 2X2KA 4O0WA 5CF8A 3FEGA 3EWHA 3Q5ZA 2C3LA 4IVBA 2BRNA 4QMTA 4CZTA 4D55A 4NM0A 2ETKA 5KKRB 2IVTA 1KE5A 5JZJA 3O8UA 3OOGA 5AA8A 3FV8A 3LW0A 2XK8A 4J52A 1UVRA 3TNWA 2XKEA 4BCQA 1UNHA 4QTDA 3VUDA 4IEBA 4C38A 1QMZA 5DR2A 2ZFYA 3T8OA 4RIWB 4F7NA 1R39A 3VW6A 3QD2B 4A9YA 5D7VA 1H26A 5KBRA 3PXFA 2R5TA 4EYMA 2XK3A 3SHEA 4BCPA 4D9UA 3FYJX 3BLHA 4F7LA 4MXXA 3KCKA 4FIHA 4O81A 1LUFA 2QD9A 3TZMA 4V04A 4C33A 3NUYA 2X8DA 3BZ3A 1H00A 3POZA 5FDPA 4RWKA 5HNBA 3LXNA 4DGNA 1W2DA 4EUTA 5E4HA 4IACA 3QKLA 4OBPA 4OR5A 4Y73A 3H9OA 4ZJVA 4CKRA 5L8KA 4O7NA 1H8FA 1KOBA 4H1JA 3UDZA 5EFQA 3ZSGA 4LDTA 1NW1A 4XBRA 3WOWA 2G01A 2RFSA 3CY2A 5E8SA 3V8SA 3CP9A 3E8CA 1Q3WA 4QTEA 4M66A 3U9NA 3FPMA 1H08A 4I3ZA 4AT4A 1PXMA 3R6XA 4M15A 4CEGA 3P7CA 4IAKA 3PLSA 5ANOA 4EKKA 5IQBA 1LP4A 1J1CA 2HWPA 2W1FA 1GAGA 2IF8A 3SXSA 3UG1A 3PXYA 3DQWA 3F5XA 4F09A 2UZWE 3FKLA 4QMWA 4OTWA 4FG7A 4CZUA 4DBXA 4O0XA 3REPA 4F63A 2Z7RA 4NK9A 2IW9A 1W82A 2F7ZE 2WMAA 3ET7A 5DRDA 4KAOA 5M09A 2ZV8A 2YITA 3ZC6A 1M2QA 3OY1A 4IC8A 4DFLA 5KCVA 2ONLC 4OTDA 5TKDA 4XG8A 4BY9E 1PYEA 4ZLZA 1TQIA 5AUYA 5CEIA 4QMOA 1UKHA 2Z7SA 3DNEA 5EI2A 4ASEA 5IA3A 2GCDA 4ZP5A 4AXCA 4NW5A 3MBLA 1Q97A 4RA5A 2WGJA 2FSMX 3CQUA 4IAFA 3KFAA 1H0WA 3R30A 3EFJA 4E20A 4ZK5A 4MKCA 2ERKA 3ZXTA 4BZOA 1UV5A 1FVRA 1W83A 3C4ZA 3LFFA 3OT3A 4I22A 4ZTLA 4AWIA 3K3IA 3AG9A 1QCFA 2R9SA 1YOMA 2QVSE 3ERKA 4GIIA 3A8WA 4YLJA 1Q8YA 3IO7A 3IECA 2NRYA 4EBVA 2PY3A 2O63A 4YTIA 3S00A 4BKJA 2O5KA 3VHKA 4CCBA 5FQDC 1OZ1A 1Q8WA 4DA5A 4MD9E 4AZWA 4FBXA 4G31A 5HG8A 2ZV9A 3MWUA 4CT2A 4LRJA 3R83A 3QLGA 3V5PA 1OBDA 1IRKA 2QO9A 4GV1A 2XH5A 3BWJA 4X2NA 3A62A 5I3RA 3R2BA 3WARA 3RWQA 2I6LA 3B2TA 1B38A 5EQPA 4NTSA 4I6BA 2BPMA 4HVIA 3MA3A 3QKKA 2GS6A 2YDIA 5CSHA 4W8EA 4QPAA 5AFVA 2PVRA 5AX9A 3WF7A 2QHMA 4S2ZA 3LFQA 4ANOA 2I7QA 2B55A 4J99A 4YO6A 1Z57A 4JR3A 3MVLA 3OWJA 4O21A 2PHKA 3FMLA 3MFSA 2G9XA 4F65A 1TVOA 3GVUA 4M84A 3UC3A 4ZLYA 4XYFA 4FV6A 4IM0A 2C5NA 2WTJA 2JIVA 2WOTA 3L8XA 1OUKA 3HP2A 4FF8A 4LQMA 3DGKA 4JBOA 2NRUA 2QQ7A 3EQPA 3ZUTA 4AW5A 3U4UA 3VRZA 3P4KA 2X0GA 4BI2A 1V0BA 4R77A 2DWBA 4L7FA 3QQFA 4F1TA 1IAHA 4EOJA 3E64A 3K3JA 1UA2A 3VS2A 3PVWA 4A4XA 4E4NA 4RFMA 1Z9XA 3PJCA 4QTAA 4Y72A 4FMQA 5AV1A 4L8MA 2FH9A 4LRMA 4DAWA 3HMOA 4N6ZA 4QMNA 1A06A 4YMJA 4X3JA 2WB8A 5L2QA 2QLQA 4P7EA 3TNIA 4FEWA 4FKWA 4JJRA 3AGLA 5ICPA 2EXMA 3CQWA 3DCVA 4ONAA 1DAYA 3R9RA 4MHAA 5DIAA 2X8IA 3NAYA 3O71A 3QTZA 4A7CA 3A8XA 3R8VA 1K2PA 4ERKA 3GQLA 4DLIA 3VBTA 2OSCA 3TNHA 2C68A 1OB3A 3HLLA 3LCDA 3EQGA 1DAWA 4LGDA 4QYEA 4O0UA 1YQJA 3UZTA 2O0UA 2VNWA 3NMUF 2Y4IB 4FSWA 2PUUA 1PMEA 3MVMA 3Q96A 4F99A 1OGUA 2QI8A 4JDHA 5AP4A 3WF9A 3A7IA 3ZFYA 4HCTA 4BGQA 2HXQA 2SRCA 3NLBA 3NR9A 5ETIA 4AN3A 3FI8A 3FJQE 2C6TA 4AT5A 3NZ0A 5L8LA 1IA9A 2CKEA 4PTGA 4TYHA 1YKRA 1CMKE 5HTIA 1CTPE 4BI1A 2PVKA 5BX0A 3BGPA 5KMIA 1F5QA 3PPJA 4DEGA 4JI9A 3ZSHA 5BNJA 1OIRA 3LKMA 4O7VA 3MH3A 4O4BB 4AGDA 1JVPP 2CCHA 4G6NA 4ZY4A 5K4IA 3U6HA 4TYGA 3A7FA 4IMYA 4FKGA 3FE3A 4JG8A 2W5HA 5AP6A 2BFXA 2UUEA 3D5XA 4QYGA 3CY3A 3QCYA 2EB3A 1VYWA 1Y6AA 4NEUA 3QWKA 2A1AB 3BRBA 5DBXA 4ZSEA 3W0SA 1W8CA 2E9NA 3Q9WA 2I0HA 3OCBA 1XBCA 3UOHA 4DHFA 5IA4A 3PTGA 4G17A 3F7ZA 3Q4CA 1XH4A 3NNXA 4GK3A 4L01A 2X39A 4TZRA 4ENXA 4DFBA 2Z2WA 1XMLA 3GB2A 2HZIA 3E87A 3F69A 4YLLA 1MP8A 4EHGA 2C6MA 4Q9ZA 2WU7A 4KD1A 3VF9A 3UBDA 4KA3A 3KRJA 4BDJA 1CDKA 4GK4A 3RPRA 3KMUA 4GK2A 5K9IA 2B7AA 1LEZA 1Q41A 3BELA 3UNJA 4OTGA 5J7BA 4QQCA 3QQLA 1T45A 4ANMA 3RNYA 4CKIA 3PSDA 2BRBA 3HP5A 3Q9XA 4WRGA 3QQUA 2CPKE 4TYHB 3SD0A 3ZCLA 4EOQA 2H8HA 4FKOA 5ANGA 2CNVA 2OF4A 2VTLA 3EKKA 1H1WA 4N6YA 3DJ6A 2ITQA 3KRRA 4FSMA 2CKOA 2R2PA 5AWMA 5J9YA 2VAGA 4O2PA 4AFEA 3EQDA 4H1MA 2YAAA 3AC1A 4ORKA 4CLJA 1BL7A 2W5AA 4MWIA 4BN1A 4J7BA 5LVLA 1Q5KA 2DYLA 2ETMA 3V5WA 3S1HA 1J1BA 3HA8A 4X0MA 3BL7A 4ANSA 4Y5HA 3P08A 2VWVA 3OUKA 4EH3A 4II5A 3N4TA 1FBNA 5HBEA 1UWJA 3KRXA 3R7GA 3DBDA 4X6RA 4QD6A 4OTRA 4K11A 5HIDA 3VF8A 3VN9A 2C5OA 3O0GA 3ZMMA 4W4WA 3H3CA 4UALA 3RBWA 5KZ0A 5IEXA 3ZLWA 4C3FA 4PWNA 2GNHA 3FMHA 2J51A 1REJA 2JKMA 1Q8TA 3DPKA 5DI1A 5E8UA 4BBFA 2B0QA 5DEYA 3LAUA 4MQ1A 4QO9A 5TT7A 4CFXA 3E3PA 1YVJA 3NWWA 4O7YA 5IG1A 3L8SA 1E9HA 4FTKA 4O38A 2C5YA 5IH4A 2JKKA 3GNIB 5AUZA 1JAMA 3S0OA 3V01A 1NVQA 5C27A 2FA2A 3BHUA 5IQFA 1Y57A 4BTMA 1WBTA 4PL3A 3WILA 2QONA 2UZVA 4IZAA 4BIEA 2JD5A 4WRSA 3D0EA 5FDXA 3E7OA 3AKKA 4AA0A 2ZB0A 1XO2B 3NYOA 4I41A 4IJ9A 4FG9A 4L43A 5KHXA 1MRVA 1BUHA 2R3LA 3EN7A 4QP4A 3FY0A 3JPVA 3NSZA 1ZRZA 4AN2A 2JDVA 4D0XA 2BAKA 4QMSA 4J53A 2F7XE 4DEAA 3RP9A 2R3PA 3AC5A 2ESMA 4QP2A 4JS8A 2WMTA 4XP3A 4USDA 4K1BA 2V55A 4GW8A 5DGZA 4O6LA 1OPLA 3TV4A 5IUHA 4Z9LA 4M8TA 2JBPA 2Z8CA 4ZIMA 3VS5A 4FEUA 4BGGA 5HVKA 4HJOA 5FP6A 5B0XA 3V5TA 4DG2E 4NYEA 4X21A 1BL6A 4R3CA 3BL9A 4USEA 5TOZA 2Q83A 3VHEA 3I81A 3BU5A 1YRPA 3S2PA 4WG3A 3R9DA 3ROYA 2QOHA 4ZZNA 5I4NA 1M17A 4FTNA 5CTPA 3QCSA 1QPCA 4DT8A 4ZS4A 5ANJA 2P4IA 4NCTA 3OROA 2HAKA 2JLDA 5KMMA 3UO5A 3KXGA 1UU3A 3GOPA 4BZDA 5F94A 4JDKA 2WQNA 4O91A 3H9RA 1AQ1A 1XH9A 4DTBA 4UN0C 2EB2A 4Q9SA 2VTAA 2J2IB 4JVGA 1YDTE 3TZ7A 2V7OA 3F3TA 4I6HA 4RX7A 5DEWA 5DWRA 3UPZA 2OW3A 1W2FA 3K2LA 4O96A 3EOCA 4F70A 5HBHA 2CNUA 4KABA 3TKHA 2OJFE 3OS3A 3RJCA 2XNMA 2XJ0A 4FTIA 4YC6A 2IVSA 4Y8DA 3EN4A 3QC4A 4PY1A 3RWPA 4G9RA 5HO6A 3W2PA 4C36A 2WELA 3FI2A 3SXRA 5M4CA 4H36A 4S34A 2IZRA 2YJRA 2YM7A 2PVJA 4S31A 2GU8A 4FT9A 4AAYA 4LV8A 4XG9A 3NW7A 4I0RA 3PSCA 3UODA 2OO8X 3NUNA 4HW7A 3ULZA 4ZZMA 3C51A 3HRCA 2R7BA 4ID7A 4V01A 2Y9QA 2UVYA 4JBVA 4RJ8A 3N9XA 4ZXTA 3LFEA 3VW8A 3ZO4A 4AZFA 4BDFA 5JMSA 4CG8A 4YTCA 1ST0A 5K5NA 4AZEA 2AUHA 3MIAA 4JIAA 3QU0A 4MBJA 3SQQA 1XJDA 5HBJA 3KRWA 3F3UA 3FHRA 4E93A 4I21A 3C4WA 1ZOEA 3OEZA 3PSBA 2E9UA 4FZDB 4IB0A 4XCUA 3PFQA 4GIHA 4I6LA 2RFDA 4YHJA 3PLAE 3L9LA 2BAJA 3VJOA 1W0XC 4ANNA 3I0OA 2IW8A 2XRWA 3MSSA 3UOKA 5CF5A 3PIYA 5HQ0A 3ZXZA 1BI7A 1SM2A 3NCZA 3LMIA 3U55A 4GKHA 2W0JA 4FNWA 3PJ2A 3D2IA 3EL7A 4H3BA 5LVOA 4LGGA 3ZH8A 3RNIA 2JDSA 4G16A 5GIOE 3FL4A 3SDJA 2QU5A 3CC6A 1NY3A 3KVWA 3NUPA 4FTQA 5C8MA 4YTFA 4D2SA 4EOKA 3AMAA 4FVRA 2WMSA 5CU2A 3FWQA 4RIOA 4XJ0A 4A9UA 4IVAA 5E8YA 5F95A 4GL9A 3Q53A 3HUBA 2UZBA 1OIQA 2XVDA 2HCKA 3OEFX 4RJ3A 4LI5A 2JAMA 2HK5A 3QYWA 3EFKA 4X2KA 2ITUA 1FMOE 4OGRA 3QX4A 4D5KA 3LLTA 4FKUA 4U44A 4R1YA 4QPMA 3VJNA 1OECA 4JMQA 3DBCA 2O64A 4TYJA 5BUIA 2X2LA 5HKMA 1OMWA 5DH3A 5BUJA 5CAPA 4F6WA 3MH1A 3TKIA 3PZEA 2UW4A 4BCJA 3RVGA 1PKGA 5HIBA 4IWOA 2CKPA 3KULA 4DH5A 4BDDA 3OW3A 4C34A 3MN3A 1H01A 4G3GA 5AEPA 2Y6MA 4QYYA 3ZYAA 4USFA 2XK9A 2PL0A 3W55A 2X8EA 4YC8A 2F49A 1J7IA 1GZ8A 3D9VA 4EONA 5KMJA 1U46A 2VO3A 4FSQA 3GU5A 3V3VA 1RQQA 2Q0BA 4QMLA 1YI3A 5CQUA 4F78A 2PMNX 3KXNA 3DB6A 3CR0A 4HCVA 3V5QA 2VGOA 1YI6A 2C6EA 3KU2A 3VS3A 5EQYA 3OVVA 2OZOA 4U79A 3BBWA 3OXZA 2GNLA 1MQ4A 5IA2A 2R3KA 3VRYA 3FMNA 3Q5IA 4O22A 4FNZA 1OKZA 4A07A 5J5SA 1YI4A 1W98A 2QLUA 2OLCA 4U41A 5M51A 3F3VA 3QRKA 1R0EA 3W0PA 1HOWA 3GCQA 5CS6A 4QQJA 1MRYA 1RDQE 2DQ7X 3BX5A 3TG1A 2WAJA 4D1ZA 5IEYA 4GT5A 3TDVA 1JWHA 4FKVA 4I5CA 4DEBA 3COKA 3IGOA 2W4JA 3E8NA 3PIXA 3FI3A 5H2UA 4DBNA 2QOBA 2XZSA 2ZB1A 4KKHA 5DE2A 5A9UA 3KULB 2O8YA 4MXAA 2LAVA 4M7IA 2AEGA 5DR6A 5IUIA 3EQHA 4K9YA 5DMZA 4EOIA 4FSYA 3R7OA 1J7UA 2XB7A 3A7HA 4JT3A 4EYJA 3ZLYA 4J98A 4FC0A 4C4GA 1PKDA 4DITA 3MW1A 3TDWA 4D58A 4DCEA 4WNKA 4NIFA 3R8ZA 4ZSLA 5JGAA 2PVMA 3F9NA 1Q8ZA 3W16A 5EDRA 1BYGA 4K33A 4YJOA 2BAQA 5TO8A 1YHWA 3WI6A 3IK3A 5LMBA 2W1HA 1PRYA 4D9TA 2BILB 4AN9A 5GZAA 4TKSA 4EI4A 3TM0A 3L8VA 3EH9A 3HA6A 3DNDA 4JR7A 1PMUA 1PXPA 2W9ZB 4JDIA 2REIA 4RVLA 4CFVA 3GENA 4Z7HA 4GFMA 3FLSA 3MFRA 3R9HA 3W0MA 4FZFB 4UXQA 4P5ZA 3MJ1A 4OTIA 4RVMA 3P5JC 3MVJA 1PHKA 5BVNA 5E7RA 4FL2A 2CJMA 2ITTA 3Q52A 4GFGA 4O6EA 4DTKA 2OBJA 3QWJA 4YURA 3NNWA 2VWZA 4IAYA 2WMRA 3NRMA 5E8WA 5IMXA 4QMMA 4RJ6A 4RZVA 1A9UA 1ZY5A 3ENMA 3FZRA 4RFYA 1ZXEA 4AOTA 3PWYA 3IOPA 3IQ7A 2UV2A 4HYSA 4IWQA 4QP7A 4YZMA 2PYWA 3JVRA 4EWHA 2IEWA 4C58A 2YM4A 4IAAA 4P90A 2OK1A 4HVGA 3WE8A 4YUQA 3O50A 4NFMA 2OI4X 4BWKA 1IAJA 4FRFA 2WTCA 2YAKA 4AZVA 4UZHA 4B6LA 4WG5A 2PZ5A 4NIFB 2XYNA 1FQ1B 2VTTA 3GCSA 2Y8OA 4G34A 2ITPA 3D5VA 4RRVA 3DQXA 1JNKA 3AT2A 2VZ6A 5CEPA 3FUPA 4AW2A 5A6OA 5BMSA 5DVRA 3TJDA 5CNNA 3FXXA 3ZDIA 2J0JA 1Q99A 3QQJA 3UDTA 5AV4A 4L45A 5CAUA 5HG7A 3GT8A 5I9XA 3BYVA 3FPQA 2X0QA 3OCGA 2YIXA 4ZTRA 1CM8A 1Q3DA 4BDGA 4MXOA 5L8JA 3VQHA 4ZSAA 4GMYA 4GRBA 3EIDA 5AP3A 2OIQA 1XQZA 4I0SA 1E1XA 4QMXA 4UXLA 5DT0A 2NYAA 3PUPA 5FBOA 3HRBA 4FUYA 4XV9A 2ZYBA 5AUVA 3HRFA 1OIUA 5T6KA 3ZBFA 5ANEA 4RIYB 3ML1A 2G2HA 5EYCA 2PVYA 5AR3A 2BRMA 3PPKA 4D2PA 2B9FA 4ZTQA 4YBKA 2VTSA 3WF5A 4F6UA 2XUUA 4F4PA 2X7FA 4CNHA 3B8RA 5HORA 2EVAA 2WXVA 4FTOA 2QOLA 3DKCA 1XWSA 5DOSA 3QTWA 3Q6WA 4XP0A 1UKIA 4D28A 4XP2A 4BTKA 4RVTA 5K0XA 4YJNA 4TWPA 3NCGA 4LRKA 3UZPA 4R78A 3GEQA 3R22A 1WBPA 2PUPA 1YW2A 5L2WA 4AGUA 2XAMA 3LFCA 4AA5A 4E3CA 1LR4A 2PZRA 4C0TA 4BDIA 4NU1A 4DG3E 1ND4A 4LUDA 3VS4A 5AP0A 4BCGA 1FOTA 5LCJA 1P4OA 4OBOA 3W2QA 2VWWA 3ORZA 4LOOA 4I1ZA 5AM6A 3RPYA 3CGOA 3OMVA 3CEKA 3QD3A 4MD8E 3AT4A 3AQVA 3FMMA 4IIRA 4FA2A 2VTQA 1Y8YA 3D83A 4ACHA 3R8UA 4W9WA 3F7WA 2KTYA 3KC3A 5JH6A 2Y4PA 3FBVA 3E7VA 3MY5A 3OT8A 1Q61A 2CCIA 1JOWB 3K54A 4TNDA 2WTIA 4E73A 2VO6A 3D4QA 3JS2A 3E93A 2BVAA 4AZTA 4IB5A 4BDEA 2P3GX 1JQHA 3W33A 3F82A 4J1RA 5D9HA 4HVDA 3KN5A 4O2ZA 2VX3A 4W9XA 3MJ2A 4YZCA 4OAUC 3DXPA 4A4LA 2YDKA 3N4UA 2BHHA 1ZYJA 5A4CA 2H34A 2WTDA 3RALA 5CEKA 4AAAA 4C02A 5IA0A 4WNOA 4GKIA 4DDIA 4RVKA 3DZQA 4O0YA 2YM5A 2UZLA 5M08A 2IJMA 2GNFA 5AP1A 4P2KA 2VTOA 3FL5A 4PTEA 4QP1A 2GQSA 4L42A 3LFDA 1YOJA 4IE9A 3FMJA 4FTUA 3QTSA 3BI6A 1J91A 3PY3A 2RSVA 4NKSA 4XRLA 4QMUA 1WVXA 4DINA 5KO1A 5LXMA 2O3PA 4IVDA 4O4DA 4PDYA 1V1KA 2BUJA 1H24A 4L6QA 3ZHPC 4AXAA 3MB7A 3DFAA 2FSTX 3QRIA 3C5IA 4AFJA 3QFVA 2WIHA 5FM2A 2E9PA 2GHGA 2XRUA 2HIWA 2ZDTA 2B52A 2VWXA 3NX8A 1HCLA 2RKUA 4L9IA 2B1PA 4XOZA 3VS7A 4KSPA 3VNTA 2W1CA 4M97A 1W2CA 1JLUE 3RM6A 4O7WA 2VRXA 3IONA 4Z55A 4IX5A 5FXSA 5CU3A 5HCZA 2IZUA 3OWKA 5IPJA 2XK7A 1KE8A 3FDNA 4A9RA 3R7YA 4ANBA 2WNTA 3LFSA 3G6GA 4EJNA 3ANQA 4FKJA 2WMQA 4L3JA 1KWPA 3BV2A 4Q5EA 1Q4LA 2C0IA 3CIKA 3PY1A 4L44A 5DYJA 2VGPA 4ZAUA 1ZYCA 3DK6A 4UX9A 4F9BA 5CI6A 2C47A 4L46A 2ITWA 4IANA 5BYLA 3BQCA 4QPSA 5E92A 3EKNA 4RFZA 2WQBA 3QGYA 4HCUA 3BV3A 5JRQA 3VONA 2OKRA 3TZ9A 2WU6A 4N57A 3F5UA 4NJDA 4E5AX 4DG0E 4ANQA 3KF7A 3KVXA 3E3BX 4MD7E 2UZNA 1M2PA 3ORKA 2GHMA 4M67A 2WMUA 2GPHA 5CQWA 4LL5A 4WHZA 4XLIA 4PP7A 3VS0A 2UZEA 3BLQA 1I44A 1PXIA 3DTWA 5EK7A 5HEZA 3WE4A 3LMHA 2WMXA 4QP3A 2PK9A 3IDBA 1XH6A 4HGEA 5ACBC 3DXQA 4JNWA 4B0GA 2P2IA 4PL4A 3ZUUA 4BFMA 1CSNA 4F0GA 5E8ZA 3OOMA 2EUFB 4I4FA 4TWCA 3IW7A 4PQNA 4RLLA 3RAHA 1YHSA 1RE8A 2JITA 1O6YA 2R3HA 3KIOC 3P5KA 1XHAA 2BTRA 4FKTA 3LXLA 4MAOA 4XRJA 3ALOA 3C9WA 3PUFC 2XNGA 3H30A 2BDWA 1Y6BA 3DBQA 3P78A 4G3EA 2QKWB 3AC8A 4EK8A 2CNQA 5K4JA 3LQ3A 4K6ZA 1UWHA 3M11A 1BKXA 4K8AA 3FC2A 4U80A 5EW3A 2GMXA 3W2SA 4FX3A 3KMMA 3KB7A 4AW1A 3QZGA 3DXNA 3RAKA 5C26A 3VBYA 5JQ8A 3Q4UA 3ZRMA 3ZZWA 3LMGA 2A27A 3QTXA 4E26A 5HE2A 5BVFA 4U9AA 4JQ7A 4AQCA 1P5EA 5AP2A 5DR9A 3TL8A 4RBLA 4JX7A 4R1VA 1PXKA 3LQ5A 4C7TA 5IDNA 4ITIA 3ROCA 4RLKA 2RFNA 5HE1A 2PZYA 4DLJA 4D2RA 4NM5A 1FPUA 1M2RA 3M2WA