5HVKA

Crystal structure of limk1 mutant d460n in complex with full-length cofilin-1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
311
structure length
297
Chain Sequence
GAMGSRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRNLNSHNCLVRENKNVVVADFGLARLMVDPDRKKRYVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Noncanonical Substrate Recognition of Cofilin/ADF Proteins by LIM Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords LIM domain kinase 1
total genus 72
structure length 297
sequence length 311
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hvkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hvkA01
4EZ3A 4RIYA 3UMWA 1H1PA 5HD7A 3VS2A 4CFMA 4FV5A 2XK4A 4M0YA 2EXEA 5FTGA 4OTDA 3P4KA 5H8GA 3MFTA 4U40A 5IMEA 2J5EA 2B1PA 4WUNA 5ANIA 4FKGA 2XCKA 4PRJA 1JNKA 3EL7A 3AD6A 3QKKA 4AN2A 1LP4A 5KMNA 4DG3E 2HIWA 3QUPA 4FV3A 5AAFA 1KV2A 3VW8A 4ZJJA 4WG5A 3LQ5A 5EYCA 2X7GA 3QQLA 2XBJA 2VAGA 1Q3DA 2PSQA 2CMWA 4O7LA 2XIRA 5A46A 4G3DA 1DI8A 3GOKA 4Y73A 4OT5A 1IASA 2UW8A 3W2CA 2ZJWA 2OIQA 3AGMA 3R0TA 4O7ZA 1BYGA 2OFUA 2OKRA 3P9JA 5HBEA 2X6DA 4YZCA 1IA8A 3UVPA 4R78A 4KA3A 4AWIA 4I3ZA 5GJDA 2YEXA 4ZSAA 1JSVA 3IQ7A 4FTCA 4GL9A 4MTAA 4YLJA 5HLPA 4FBXA 5IF1A 1H01A 3DK7A 2BDWA 2X4FA 2WMWA 2C3IB 3AC1A 5DR2A 4BR3A 1MP8A 4FTLA 2C0TA 4JS8A 1YXUA 5CNNA 2WXVA 4N6YA 5BYYA 3CS9A 4EL9A 5JGBA 3LKMA 2Z7RA 2EUFB 4MF0A 5HU9A 3E88A 3F2RA 2YISA 4YPDA 4ZTLA 1VYWA 4BDJA 5A6OA 4M14A 4I5MA 3TEIA 1XH9A 3DZOA 1OGUA 3NYVA 3EQIA 4A07A 5C8NA 4USFA 4CZUA 4NFNA 3IDCA 3OBJA 3LQ3A 3UOHA 4QP8A 4BCKA 3GI3A 3NEWA 4JJRA 2OH0E 4I5PA 5CZHA 4DEBA 3F3TA 3ZS5A 4F70A 1BUHA 4ITHA 3CTJA 1FBNA 4BB4A 4R1YA 5KBRA 4FYOA 4KBAA 4HYUA 5DVRA 4OTGA 2CPKE 4ARKA 4WRSA 2G15A 2LAVA 3KF4A 5M55A 4MBIA 5IH5A 5CLPA 4ANOA 1BL6A 2YLFA 4ZY6A 4GUBA 4EOLA 2W1DA 2YM3A 5CEQA 5CF5A 4I6BA 4DLIA 1PXOA 3F5PA 2VTTA 1JSTA 2BTSA 2XK7A 5HTCA 5GIOE 2CSNA 3OROA 5A4LA 4FV4A 2R7IA 5DGZA 1ZWSA 2XNGA 5H3QA 1QPDA 4B9DA 4E4MA 4GIIA 4I0RA 5DMZA 4QMMA 3MVMA 3QTWA 2OZOA 4LMNA 4FC0A 3SRVB 2X9EA 3ZFXA 4C2VA 2CLXA 2WGJA 3MFUA 5EM6A 4AACA 1K3AA 1U4DA 3Q60A 3W55A 4CMOA 4W4WA 5KE0A 5HNBA 3ULZA 4O84A 3KQ7A 1Q8YA 5I9VA 4AOJA 5AV1A 4L52A 2OLCA 2VTRA 4BDFA 4MNEA 2PYWA 3CY2A 4GG5A 4E6DA 1H25A 2BDJA 3PUPA 1UV5A 3B8QA 2W9ZB 4XRLA 4GU6A 3C50A 3CQWA 3W2RA 1XO2B 4EK8A 1PW2A 2C0OA 2ITNA 3B2WA 1E9HA 2BZKB 3QRTA 4QMZA 1FQ1B 3A8XA 3HECA 5BVDA 3FZPA 4YUQA 2A27A 1DAWA 4QMQA 1GY3A 1UKIA 4H36A 5FP5A 5I9UA 4ZIMA 1PJKA 5M07A 2GSFA 3OTUA 5CF4A 4PL3A 2KULA 1YW2A 3K3IA 4I4FA 2XEYA 4D2VA 4U5JA 4JAIA 3TWJA 5IUGA 5IMXA 4L01A 5E92A 4E5AX 3MJ2A 4AW1A 4HW7A 4FTQA 1FMOE 3V6RA 1X8BA 3MTLA 4FNWA 2UZNA 2QHNA 4H3PA 4QYGA 2UW0A 3HA8A 4S30A 2QG7A 3ZEWA 4KD1A 2ACXA 2VX3A 4LRMA 5KKRB 2VO3A 3LHJA 3TM0A 4F7NA 3HZTA 2GFCA 2WMRA 2OZAA 5IKWA 3PRIA 4YJPA 4BCHA 3DLSA 1IAHA 3VS3A 4U42A 4EHZA 2PMOX 5CENA 3G9NA 3A4PA 3AQVA 3EQPA 4NK9A 4D5KA 4CKJA 5DRDA 1ZZLA 3GUBA 4IWPA 4GVAA 2VGOA 3NUNA 4ALUA 4AU8A 5HG7A 3UOLA 3VRZA 5HD4A 4XBUA 1ZOHA 4V05A 3FMLA 3BELA 4ZSJA 3TZ9A 3HMNA 3REPA 3PJCA 3R7VA 3AGLA 3UZRA 3W1FA 2C3LA 2QONA 4E4LA 5AR2A 3ERKA 4I5HA 3ZRKA 4QQTA 3ZO3A 2Y4PA 4IX6A 5KMLA 2X4ZA 2WTDA 1OPKA 2XRUA 3C0HA 3OUKA 3NMUF 1UWJA 5HO8A 2YCRA 1WBSA 4EBWA 3HRCA 3FZRA 5DE2A 4ZK5A 3VS5A 2OSCA 1A06A 2Z7LA 4X0MA 5HVYA 3QWKA 4XV9A 2Z60A 4FNZA 4HPUE 2OJGA 4QTBA 4DEGA 2PUPA 1YKRA 2BDFA 3IW6A 2IVUA 4FT3A 4KSQA 1V0BA 3PXKA 3DNEA 3VBYA 3BLRA 4Z7GA 2VWWA 3MN3A 4KIKB 4NKAA 5FLFA 4FIJA 3PXFA 1G8AA 4FTUA 5EI6A 5EQEA 3GC9A 4O0TA 5JT2A 4O1OA 4DF3A 5AAEA 2UW6A 3VHKA 5CQUA 3QQUA 4ERKA 4XCUA 2QO9A 3DBQA 2WHBA 2YIYA 3GENA 2BUJA 4TWOA 4BHZA 5AR7A 4JLCA 3CQUA 2SRCA 4KKHA 5E90A 3RPYA 3ZO1A 2BRGA 3M42A 1OIYA 4CD0A 2V7AA 3SW4A 3LFAA 2WKMA 4TYHB 1JPAA 4FTMA 5FM3A 3GT8A 2JIIA 3DDPA 5I9WA 4C59A 4D2RA 1YWRA 3ZM9A 1YDRE 2VNWA 4B6LA 3E5AA 2WELA 3QA0A 4QQJA 4EOPA 3BGPA 3QUDA 4C7TA 4IW0A 1NY3A 4KNBA 4U3ZA 4BYIA 2PWLA 3UG1A 4FIHA 5AP1A 3QALE 4ANQA 3KVWA 1Q4LA 3GU5A 4FTJA 4C4IA 4QO9A 5LMAA 3ORPA 3JY0A 3P79A 4IXPA 4AQCA 4DGNA 5KX8A 4BTFA 4OTHA 3MH2A 3JVSA 3UPXA 1B39A 4KRDA 5C8MA 1PYXA 3LAUA 4C37A 2QQ7A 2XIYA 2Y7JA 4QP9A 4XV2A 3FL5A 2Y4IC 4XRJA 1GAGA 3FI4A 3W2PA 1DAYA 5T68A 3D0EA 3A62A 3KCKA 5KMMA 4ZZOA 4R77A 4O2ZA 1Q24A 2OI4X 2BIKB 2XK9A 5CVHA 5ETAA 4Y83A 4AA5A 5E8XA 4AGCA 4D1SA 4XG9A 4RX5A 3UGCA 3BU5A 4YZDA 4D1XA 4OTWA 3WF8A 3FV8A 4G3FA 3P86A 4ASDA 4M3QA 4RFZA 4BWKA 2E9OA 2UW5A 1W83A 3LFDA 1WBWA 2VRXA 2VZ6A 3R7OA 1PYEA 2YZLA 3OCSA 5EDQA 5GJGA 5LWMA 3RPRA 4D0XA 4XG7A 2F7ZE 4XOYA 4E6CA 2B55A 3UNKA 4ZMEA 3PJ8A 2EB3A 3WIKA 4QOXA 4XP3A 3G15A 4IVAA 3Q2MA 5HHWA 3LLAA 4RJ8A 3H0YA 1JVPP 2XCHA 4G6NA 2GPHA 2A4LA 4QYEA 3MI9A 2O5KA 3LFNA 1XBAA 4EZ7A 3DTWA 3DNDA 3ZO2A 4CYJA 5HE0A 4CZYB 3GCUA 3P5KA 2BAKA 4U80A 1CKPA 1PXMA 3NS9A 4IZYA 3S0OA 4L45A 4MH7A 2XH5A 2I0HA 3DLZA 4JDJA 4L44A 4RIXA 4KBCA 4NFMA 1LPUA 1JBPE 2EVAA 3HV5A 4PDOA 2C5YA 4TTHB 3HRBA 5HESA 2B0QA 5I4NA 4X3FA 3LW0A 1PY5A 3LJ2A 3OEZA 1IEPA 4V0GA 5K5NA 4IAYA 3CPCA 4AGWA 5D7VA 4BBMA 4JG7A 5ANOA 5IISA 5GZAA 2X8DA 3QCQA 4E8AA 2XKCA 4CKRA 1H00A 4RPVA 4NCTC 4WG4A 1M7NA 5K0XA 4BTMA 2FYSA 3I6UA 4H3QA 3ROYA 1L8TA 2UVXA 3E7OA 5DNRA 4D2TA 4HGLA 3BYUA 3ALNA 4LG4A 3QGWA 5ACBC 4DINA 3MV5A 4ZSLA 2G9XA 4R5YA 1YOMA 3E87A 4FKVA 2WTVA 4UZDA 2FSMX 4HNIA 5A4TA 2O8YA 4WIHA 4L53A 1MRYA 4P5ZA 3VBTA 5BPYA 4PQNA 5IA2A 4BHNA 4GFOA 2VTMA 4JG6A 4MD8E 4UV0A 3HKOA 3UBDA 2YCSA 3I79A 4FG8A 3CLYA 1YXSA 4QRCA 3RHKA 3VO3A 2YCQA 5J9ZA 4Y5HA 4TYGA 4CFXA 2HK5A 4O81A 4DFXE 4FE2A 3AT4A 3FLZA 3BHUA 4YMJA 1RE8A 4F0IA 3O2MA 4AZWA 2OXXA 5HO6A 2EWAA 2XNBA 4AA4A 1NT2A 3TNQB 3I7CA 3EZVA 5L2QA 4GT3A 2X1NA 5HCZA 5E9EA 2OBJA 3KK9A 4QPAA 4NYEA 5M57A 5DYJA 2PZ5A 3CKWA 3ORLA 2XA4A 2X7OA 5K4JA 3PLSA 4G3EA 2O64A 4CQEA 4F1TA 2QOLA 3UJGA 3S1HA 3RTPA 3TUCA 4FSMA 4O7YA 2PK9A 1PMVA 3PVGA 3MWUA 1LEZA 3SGCA 3H9FA 3F3UA 3QD3A 4BDAA 2C6MA 4QYYA 5C4KA 1FGIA 1ZLTA 1B38A 3VUIA 3LFEA 2QKWB 4XJ0A 4EJ7A 4M15A 2Y4IB 3HMOA 4Q2AA 3PP0A 3D14A 3EN4A 2QLUA 3V04A 1UU8A 5CY3A 3FMHA 2FSLX 2J51A 3QQHA 1PHKA 5AUYA 3BYSA 3HMIA 3QC9A 3TIYA 4KBKA 4C0TA 2ZDTA 4EK4A 3VUDA 4DTAA 3OEFX 3LJ1A 2Z2WA 1OL1A 4DE4A 3G5DA 4RJ3A 4RMZA 4BVUA 5LQFA 4UWCA 3HV4A 3ULIA 2BTRA 3D9VA 3U9CA 4E20A 5IEXA 2BILB 3RK9A 4AF3A 3O7LD 5GINE 1HCKA 1KWPA 4L67A 5G1XA 1KE5A 2R3RA 3K5VA 3ZDIA 3VBQA 4BBFA 4CFNA 2VWYA 3RK5A 3TDVA 3ANRA 2CKQA 5T6KA 3OWKA 3PSBA 4MBJA 5CAPA 4FEQA 5CALA 5FEQA 3IKAA 1OMWA 3PLAE 3TZ8A 4DLJA 2G1TA 3ROCA 4Z16A 4ZAUA 3F5XA 3DA6A 1XBCA 4O6EA 3RZFA 3FBVA 3FC2A 1BI8A 3P78A 4O6LA 3SD0A 4C61A 4O0UA 4D2PA 5CI7A 4LRJA 5CU3A 1O6YA 2WMVA 2R4BA 3QTUA 4BIBA 2JDSA 4RIOA 4BCGA 4G1WA 1GNGA 2X8EA 1PXNA 3QHWA 3A99A 4JX3A 3ORIA 4AOIA 4E73A 3AD4A 4KIOA 3TUDA 4I6QA 4MEDA 4LGDA 2I7QA 3PZEA 4IAIA 1BL7A 4F6WA 4M68A 3ODZX 3M1SA 1SVGA 5BYZA 1REKA 4GYGA 4OAVB 1YXVA 1OZ1A 2QO7A 5CXHA 3MFRA 3BGZA 5TF9A 2Y6OA 3C0IA 1PKGA 2WEVA 3LFSA 5AAGA 1R39A 4LM5A 3SAYA 2C6KA 2BAQA 1WBTA 2UZDA 3QQJA 4C3RA 2F7EE 4ASXA 1M14A 2PVKA 5C27A 3WF5A 4CQGA 4YP8A 4IZ7A 1O9UA 2ITOA 1T45A 3TIZA 4BL1A 5HX8A 1FOTA 4JXFA 2CGXA 2W4OA 3FUPA 3HYHA 3O50A 3ORKA 4H58A 4MXCA 4CVAA 1A48A 3CSVA 4RVLA 2VN9A 4MKCA 5DT0A 3LM0A 5AIKA 2GNIA 5TT7A 4YTHA 4ZSEA 1CM8A 5AUTA 2W1CA 3PG1A 5E91A 5ETFA 4ANMA 3EKKA 4GIHA 3A2CA 4FSQA 4BBEA 3H9OA 4XV3A 4G2FA 3WYYA 3OT8A 4MWHA 4PTCA 4CLIA 3ZHPC 3A7JA 3KXXA 5L2TA 4FV8A 2FSOX 5I0BA 4PP7A 2X7FA 2QG5A 3Q9XA 4HPTE 4EKLA 4I20A 3V8TA 5DH3A 2OICA 4N6ZA 2ESMA 5HGIA 2BZJA 1SYKA 1TKIA 2QU5A 4TN6A 4QP3A 4TY1A 3DT1A 3BU6A 4YZ9A 3ZTXA 3CTQA 2CKOA 2B53A 3E93A 5M4IA 3TZ7A 4EOQA 5L3AA 3C0GA 3FC1X 5DPVA 5FP6A 2NO3A 1JKLA 4DAWA 1UNHA 3DB6A 3E63A 4MYGA 4ACCA 5CSPA 5DR9A 4GEOA 1H4LA 1REJA 2HOGA 3OW4A 4IAFA 1MRUA 2VWVA 1AD5A 2ONLA 3HUBA 4GJ2A 3RP9A 1JKKA 3TKUA 3RGFA 1SM2A 3W2SA 1OI9A 4I23A 5D41A 5AR3A 2IO6A 2R3PA 2XYNA 2HWOA 5EM8A 4FR4A 4EJNA 3EIDA 2VO0A 2ZMCA 3E8CA 3MB6A 3QX2A 4FOCA 4ITJA 1T46A 4WT6A 5JZNA 5HLWA 4K8AA 4C4GA 2J0LA 3I6WA 3NR9A 5IQFA 3FSKA 4IX4A 2WIPA 4PX6A 1UNLA 4C38A 5JQ8A 4O0RA 2RFNA 3R8LA 2QO2A 3OP5A 2I1MA 3ET7A 4IEBA 1URWA 4RLKA 2WOUA 5A4CA 5E8VA 3WIGA 3QZFA 5M08A 3BWJA 3EQBA 3PJ2A 3C51A 1U59A 2RFDA 4RFMA 2BROA 4F9YA 2J0KA 3DDQA 3IDPA 3VN9A 2WMXA 5FWKK 1PXKA 2PMIA 3FMMA 4FKWA 4OT6A 3R8ZA 3GBZA 3A7FA 5L2IA 4CV9A 4LL0A 4AE9A 2JDTA 3I7BA 4EK5A 1LR4A 5I3OA 5BUJA 1GZNA 5KMKA 4J98A 3OOGA 4YZBA 3KULB 4ZXTA 2RG5A 3CR0A 4OW8A 4N4SA 2W9FB 1OIQA 3FKOA 2YDIA 3VUKA 4UB7A 3UQGA 3R63A 1XH5A 4DEHA 3JS2A 4IFCA 5F95A 5M56A 3OXIA 4L68A 3KXZA 5CU0A 1FPUA 5JH6A 3GOPA 4KIKA 4TYEA 4KSPA 4ID7A 3ZSHA 3S2PA 5LVPA 1SZMA 5E8UA 4EOOA 5EFQA 1KE6A 5AUWA 1JAMA 3FMEA 4DFYA 4FX3A 4XS2A 4F63A 4QTDA 1P2AA 3I1AA 1WVXA 2WTWA 5LVNA 3BCEA 1FVTA 3PPJA 2HCKA 2GNHA 3FXZA 5EG3A 4L46A 2O2UA 3C13A 2BRNA 3NYOA 2WFYA 1S9IA 2XVDA 3OUNB 4FV0A 4B8MA 3CJFA 3FLWA 4CKIA 5AA9A 5BVFA 4R3PA 2O65A 4B0GA 4L00A 1KSWA 5IQGA 4EH4A 3VBXA 2XK6A 3RM7A 4BZNA 2E9UA 1RW8A 4XNEA 4QMNA 4FK6A 2B9FA 4CLJA 3LQ8A 3F61A 4P90A 4LGGA 2R3IA 1E1XA 3HV3A 1ZARA 4LFIA 2XF0A 4BDKA 1CSNA 5CEPA 2A19B 4W4VA 2GQRA 2UW7A 3A4OX 1ZYJA 3HLLA 5C01A 4DCAA 2YIWA 3KF7A 4K33A 3PIXA 4XX9A 3Q6WA 5AP0A 2QURA 2J90A 5GZ9A 5L8LA 3JPVA 3QD0A 5HIEA 2PMNX 3NUYA 5FEDA 4QQ5A 4O83A 4AP7A 1OM1A 2PVRA 4J99A 4D2WA 3IOKA 3MPMA 3DJ5A 3EQRA 4IWQA 4R3CA 1WBVA 5DT4A 3NUSA 4E7WA 3MB7A 3E8EA 2W0JA 5EQPA 4O7RA 1WBPA 1OKZA 4I41A 4GCJA 2YAAA 1JSUA 4RWLA 4FT9A 1H0VA 4ZTMA 1YI3A 3F3WA 3F7ZA 3H9RA 5JFSA 4IAKA 4MAOA 4RVMA 3MVHA 2WNTA 3SHEA 1J3HA 2QU6A 3SV0A 1OPJA 2UW9A 4FG7A 3MSSA 4BKYA 5CU6A 1B6CB 2HXLA 4NM0A 2A2AA 3PY3A 3NDMA 4FIFA 5DA3A 4WNOA 4RG0A 4BIDA 4FZ6A 3P0MA 4CT2A 3E92A 3NRMA 4FSYA 2ZMDA 3VUGA 4R7HA 4BFMA 3PA3A 5C9CA 4EHGA 3VS1A 5CAOA 3C5UA 4ZSGA 2VWIA 3B8RA 3R9NA 4BDEA 4X3FC 5ITAA 2C5VA 3KMUA 4EYMA 2B7AA 3E3PA 2UZEA 3D94A 4FEVA 4ZZMA 4RIXB 2CHLA 3RNIA 2UZLA 3L8XA 5J7BA 3ENHA 3UIUA 3R1NA 4D0WA 2RG6A 2I6LA 3R7GA 1OUYA 3T8OA 2GHGA 2PZPA 3S00A 2BR1A 3FL4A 2QHMA 1DI9A 4V0GB 4ERWA 3HMMA 3UP7A 4MXOA 3EN9A 4L7FA 3ZFYA 1OBGA 4GG7A 4ZZNA 5CAVA 1W0XC 5FUTA 5M44A 4F9BA 4S34A 4BKJA 3R7EA 4DGOA 2UVZA 3R2YA 4EK6A 2XRWA 3EOCA 3PPKA 5EW3A 5CSXA 5ETCA 1QPJA 1KUTA 2PU8A 1YDSE 4EH9A 5IUIA 4HOKA 3UO4A 1OPLA 3T9IA 4RLLA 3PVWA 2C3KA 2KTYA 1GJOA 2IW9A 4TT7A 3IG7A 2ZYBA 2VX0A 3QAME 3OWPA 4FKQA 4GJ3A 4O22A 4HCVA 5CS6A 3V6SA 3KREA 5AV2A 1IG1A 3HV6A 3PA5A 2W7XA 4RGJA 3PWDA 1Y57A 1LEWA 4IM2A 4RX8A 4F0FA 3QUEA 2C47A 4WHZA 3VJNA 5BUIA 4LI5A 5HKMA 2CNQA 3QTRA 4C33A 3NIZA 1Y6AA 2JIVA 5CXZA 5GNKA 3WBLA 2WPAA 5AP3A 3DBEA 4ZTSA 5M4CA 5HBJA 2BFYA 3O8UA 2GS7A 2PE0A 3U87A 2W17A 4NWMA 4QMPA 2OGVA 5IQCA 3A8WA 4G9RA 4YO4A 3S95A 4CCUA 3VHEA 3V01A 2HY0A 4K18A 2C4GA 4JX7A 4IDVA 4R5SA 1F3MC 1U5QA 2IZUA 4JDIA 3RM6A 4DH3A 1H0WA 3MTFA 1NA7A 3PIZA 4QT1A 4LV5A 3DBCA 4FKIA 3R7YA 5A4QA 5GJFA 4EOSA 5BUEA 5JRQA 1Q97A 3QC4A 3SQQA 3GU6A 3VIDA 3DFAA 3DBFA 3D83A 4OTPA 5FBNC 3NGAA 2FVDA 3SX9A 2W4JA 5AP4A 3L9MA 3KXGA 4IADA 3UPZA 1J91A 1XH7A 4GMYA 4EOKA 4D4YA 5HTBA 1IRKA 3EQCA 3LFBA 2V55A 4MBLA 4WD5A 1NVSA 2WQEA 3D5WA 3G90X 4G3GA 4TYIA 3OTVA 5TKDA 5JK3A 2J7TA 3MIYA 1MUOA 4FKUA 4CFUA 3DAEA 1Q8WA 3TNWA 3EJ1A 3UIMA 2ZOQA 3CTHA 4P4CA 4AZTA 3NVMB 5DT3A 4RZVA 4FODA 4J8NA 3LZBA 3C4FA 2HYYA 3VQUA 3OXTA 3RMFA 3C7QA 2R7BA 2HWPA 4YPSA 4ANLA 1Q3WA 4TZRA 4U45A 2NNWB 4N70A 4U41A 3JYAA 1FMKA 4V01A 5CSWA 4BCQA 3CKXA 4NCTA 3I0OA 3WE8A 2HENA 4CV8A 4U6RA 4EWQA 1KOAA 3VC4A 2G01A 2R3MA 5AUVA 4EEVA 3LCOA 4NJ3A 3SA0A 4USEA 3UO5A 2ITVA 2RSVA 3QRUA 4EOIA 5IA1A 4G5PA 2IWIA 5JGDA 4W9XA 5FGKA 2VTSA 2B52A 4MQ2A 4NT4A 5FXSA 4L3LA 5AX3A 5DN3A 2W05A 2WMSA 4CGAA 4LV8A 3D15A 5A6NA 3D7ZA 1H1WA 3RAWA 3R9DA 3TZMA 3NYNA 5KKRC 5HVKA 4FV2A 3UZTA 3V8WA 3A7IA 2QR8A 4U7ZA 2OU7A 4OBPA 4Z9LA 2DS1A 5IQDA 2C30A 5HNIX 2UZOA 3NYXA 2YJRA 3ZBXA 5EOLA 4EH7A 4HVDA 1TVOA 4IAAA 1H07A 3CP9A 3EN6A 4F09A 2FUMA 4YSMA 2OF2A 2BVAA 3H30A 5IDPA 4U3YA 5AUXA 5L2SA 4O38A 5IA4A 1GZOA 4YTIA 2YIQA 5HQ0A 4RC2A 2A1AB 4H39A 4MK0A 3W32A 4EQUA 2AC5A 4YO6A 4DFBA 2UW4A 4X21A 4HVHA 2PVLA 1OITA 4S32A 4Y46A 3NNVA 5HCXA 5H8BA 2YJSA 4F6UA 4GU9A 3F88A 4O86A 2ETRA 3AG9A 5DG5A 4CFFA 4CG8A 3OOMA 4L9IA 4NSTA 3BEAA 3KY2A 5FXQA 4E93A 4PMMA 3QLGA 3MPTA 5HORA 2J0JA 3E64A 2UV2A 4RWKA 5BVOA 3DXPA 2IZSA 5EYKA 4JIAA 4LL5A 2XK8A 4ZTNA 4XLIA 3WYXA 4RJ7A 3DKGA 3QA8A 3I60A 2ZM1A 4KAOA 3G2FA 4U44A 3JY9A 4ZS0A 3FY2A 2ZV9A 4FT7A 2V0DA 3IO7A 4S31A 2PVMA 1JQHA 2HAKA 2RF9A 3NCZA 1J7IA 4L8MA 3LXPA 2F49A 3HAMA 3KXHA 3EHAA 1FVVA 2Z7SA 3BGQA 3ACKA 4MVFA 5JEBA 3M11A 3LMHA 4P7EA 2GQGA 1YOLA 3QLFA 2QOBA 3TT0A 4BDGA 3F66A 4GSBA 4YHJA 1M2QA 2ZDUA 3O7LB 1YHWA 4GK4A 2QD9A 3UDBA 5HVJA 3WILA 2XJ2A 2YIXA 3QCSA 4HCUA 3G0EA 3AT2A 4GW8A 4RJ6A 4WOVA 4D58A 3R9RA 2J0MB 4PMTA 4DG0E 3UYSA 1Y6BA 4CXAA 3FY0A 2EU9A 4A4OA 2IVVA 1ZRZA 3FE3A 3MH3A 1KOBA 5HICA 3AOXA 5BVWA 4JI9A 3CQEA 4AXAA 5FXRA 2BMCA 5J5TA 5M06A 4CCBA 4KIPA 3ORMA 3R8PA 4FSZA 4WBBB 3UNJA 4ACGA 3SLSA 1SNXA 3FHRA 4IB1A 2I0VA 4JDKA 4D4RA 5JFVA 4A9RA 4MNFA 2GHLA 3OG7A 1DM2A 4G16A 3FZTA 4IDTA 2H9VA 4WO5A 4LGHA 3RK7A 4HYIA 3F3VA 3ZO4A 4IJ9A 3DJ6A 4BTKA 5KHXA 3IDBA 4C58A 2YACA 1RQQA 4FSUA 4OAUC 4F7LA 4IC8A 3V5WA 2YM5A 3G6HA 3L8VA 1Q5KA 4XEYA 4WSQA 4FKLA 3QL8A 4YLKA 1U5RA 3ACJA 3QYZA 4X2KA 4O7SA 4M84A 5DFPA 4EH6A 5IG1A 5BYLA 4FGBA 3DTCA 3BE2A 2O0UA 5HO7A 3R1SA 2QOHA 3MDYA 2XZSA 3QTZA 3IS5A 5H9BA 3SRVA 4IWOA 4MF1A 3R7IA 4A9SA 3FLQA 1U54A 1H8FA 1NVRA 3OZ6A 2CDZA 4EONA 4DH8A 4D55A 5IQIA 2JEDA 2OW3A 2Z8CA 4YBKA 4FGRA 4AA0A 3Q53A 3V5PA 3LJ0A 4MNEB 4Z7HA 2CKEA 4K11A 4I5CA 1JLUE 4TNDA 1U54B 4I94A 4QP4A 2W1GA 3V5TA 3F82A 3ZDUA 3ZYAA 2XS0A 3WZJA 3KK8A 1O6LA 5CEMA 4FA2A 3RWQA 3DKFA 2FA2A 3Q52A 1OKYA 3LCTA 4XUFA 1OKWA 3OMVA 4TYHA 3ZONA 4EK3A 3R2BA 3WZEA 2JC6A 1F0QA 2YA9A 3MA6A 4AS0A 4PF4A 3QCXA 2GNGA 3FI3A 4GFGA 4FEWA 3MA3A 3MY5A 3POZA 4AN9A 4D2SA 5D9HA 5KBQA 4C34A 5K3YA 3BHTA 5E8SA 4DGLC 5AR5A 1WMKA 2JBOA 3ZC6A 3P08A 5CYIA 3ZLYA 4V04A 5LVLA 3EWHA 2IZRA 3SDJA 4CMTA 1GIIA 4ACMA 5AADA 5LVOA 3QF9A 3KC3A 3DBDA 3POOA 1ZXEA 5CASA 4O7TA 2QC6A 2FH9A 4J71A 4Y5QA 2P55A 4FV1A 5BQ0A 4GKIA 4M97A 1HCLA 4A9TA 2VNYA 4ENXA 1OUKA 4FTNA 1W84A 4QNAA 4PPCA 4BWPA 2RIOA 2PVHA 5CANA 3Q04A 4AT3A 1OIUA 3LXLA 3R22A 5EW8A 3TUBA 3LE6A 4PWNA 4ALWA 1OKVA 3C4ZA 3RCDA 1Y8GA 4DBXA 3ZOSA 3BBTB 4QMLA 4TPTA 5M51A 1BI7A 4FT0A 5CVGA 3WI6A 3LOKA 4RX9A 5IA0A 1SVHA 3PPZA 4QMOA 4FSWA 3TI1A 3UVRA 4O0YA 2WTKB 4PDSA 3UOKA 5DEYA 2YWVA 3S4QA 3SG8A 3IOPA 1Q62A 3OWLA 2UZVA 4AN3A 5DR6A 3PVBA 5E8WA 4BDIA 3Q6UA 2W1ZA 5EI8A 3PDTA 4AGDA 2PHKA 4G6LA 4M69A 3SVVA 3UYTA 1AGWA 4GVJA 4W8EA 4IFGA 3K54A 1MRVA 3II5A 2CNUA 2PZYA 2RGPA 2QOCA 2BZHB 2ZVAA 3PE1A 4O1PA 3QRJA 2WTJA 2EB2A 4UX9A 4M8TA 4ZY4A 3FKNA 4CFWA 5CF8A 4QP2A 3R01A 4M69B 4ZLYA 2YIRA 5IQAA 2XYUA 4KKEA 5TOZA 3VNTA 4BGGA 4FIEA 1P5EA 2B4SB 4UMUA 2IW6A 3L8PA 2CNVA 2OJIA 4XG4A 3MJ1A 3R21A 3Q2JA 4MXAA 5L2WA 4ACHA 4PL5A 3V5JA 3DXNA 3ID6C 3DQXA 4YTFA 2NPQA 4M66A 5LWNA 2YFXA 4RC4A 2XNEA 4H1JA 2IVTA 2YABA 2YITA 3D5UA 4RWIA 1RJBA 4IX5A 5L6OA 5A3XA 3ORXA 4Q5EA 3HDMA 3ZUVA 1Y91A 4CTCA 3COHA 3ZSGA 4JG8A 2YM4A 5DLSA 4X6RA 1Q8ZA 3PVUA 5IQEA 2C69A 4FSRA 3FLSA 2REIA 4L42A 2XIZA 3R9OA 5AUUA 4OBOA 1M52A 2R3HA 3F3ZA 3GNIB 3WF9A 4A9UA 4FIGA 5D10A 5A4EA 5JFWA 1XKKA 4B4LA 3BU3A 2ZV8A 3S3IA 4AW0A 2VWZA 3FLNC 4E4NA 5HX6A 4IBMA 1M2RA 4NM5A 2V5QA 5C26A 3U4WA 1W98A 2B9JA 2ETMA 3RI1A 2VWXA 4IZAA 2ZV7A 4RSSA 5DEWA 2PMLX 3KRJA 3CJGA 2HW7A 4ANNA 3ZSIA 1Y8YA 3DKOA 4EZ5A 2YM7A 1H1SA 2C5XA 5F20A 4YC3A 3HAVA 4FUXA 4MHAA 4K6ZA 5E8YA 4X6QC 4I22A 4ZJVA 3NAXA 3FMKA 3NWWA 2PVJA 4L3PA 5EHYA 3EB0A 5IH4A 2R3FA 3O8TA 3LCSA 5JQ5A 5FEEA 4DFUA 3F9NA 2GNJA 1J1BA 4I0SA 3TKHA 4EORA 3Q4CA 2JFMA 4FYNA 1G3NA 3CCNA 3KRWA 4FK3A 1BMKA 1Z57A 1H27A 3EN5A 4JBVA 2DUVA 3TNHA 3FMJA 3UC3A 5FTOA 3FJQE 2X2LA 3K5UA 4C35A 1JKSA 3IW5A 4BRXA 3C4CA 4I4EA 5DRBA 2Q0BA 3EYHA 2J5FA 4I0TA 5ACKA 5J7HA 2PUNA 2R3GA 3FI8A 5CI6A 3NNXA 3NNUA 4J52A 2F7XE 2UZWE 5DWRA 4YTCA 5IZFA 2A0CX 3MW1A 4I1ZA 3QD4A 3MS9A 5K9IA 3EKNA 4IC7A 4WKQA 3KGAA 2UVYA 2F2CB 4PTGA 2YM8A 4DH1A 4EUUA 3WF7A 4EC8A 4X7QA 5J1VA 4LRKA 2WMBA 3CE3A 4C2WA 3NVKI 2GMXA 5ETIA 4X3FB 4JRNA 3D2IA 3FXWA 3GB2A 2I0EA 1GZ8A 4MXZA 4FKPA 3MFSA 2XM9A 4AZVA 4EWHA 4RQVA 3R8MA 4IB3A 2V22A 4BCIA 3COMA 3ORTA 5KZIA 4XP0A 2BIYA 4FKTA 2JDRA 2R3LA 5FTQA 4EOJA 2C1AA 3BLHA 3THBA 4TXCA 4L6QA 1AQ1A 2UW3A 3OWJA 3QKMA 3R04A 4N0SA 1J1CA 2XB7A 3GP0A 1BKXA 3NIEA 4YZNA 2UUEA 3AC5A 4EC9A 1V0PA 3Q32A 2H8HA 3PIYA 1R0PA 3O0GA 3QWJA 4U79A 4A4LA 4BI1A 2GQSA 1QMZA 4HGEA 2W1HA 2C6LA 4UWBA 4RT7A 5EKNA 3KA0A 2X0GA 3NUPA 3DB8A 4RA5A 4EBVA 3QXOA 3ZM4A 4EKKA 4HVGA 2JFLA 2R64A 3A7GA 3KMWA 3GQIA 5HOAA 4KIQA 2JIUA 4HGTA 3Q96A 4P2KA 4QYFA 4X3JA 4XP2A 4H3BA 3PSDA 2VTNA 2O3PA 1CDKA 4PP9A 4K1BA 2X8IA 3FYKX 4FT5A 3DOGA 2P4IA 4BTJA 2DWBA 1NVQA 4YJUA 5LXMA 2VTQA 3IW4A 4IWDA 3U6IA 4FVQA 5AV4A 1IAJA 4FTOA 2BRMA 4RIYB 1KE9A 3COKA 4JQ8A 4YC6A 4D9TA 1G8SA 4U97A 4APCA 4O2PA 4IHPA 3HP5A 3QTXA 2JLDA 1ZOGA 5L8KA 2XNMA 4XMOA 3AMAA 3DQWA 3CY3A 1RDQE 3C9WA 3F2NA 4UN0C 4II5A 2JKOA 3RINA 4BDBA 2W1EA 1KV1A 2YWPA 3WE4A 2X81A 4W9WA 4WNMA 3MVJA 2IG7A 4DN5A 3GC0A 2OJJA 3EFKA 2W1FA 3PRFA 4LOQA 2Z02A 4WRGA 3NX8A 4DH7A 4MXYA 3FZ1A 5E8ZA 3E62A 2ZM3A 4GV1A 4YHTA 1PXLA 2ZM4A 3VWAA 4EH2A 4FZDB 3EMGA 1R3CA 2R2PA 2ITYA 3IECA 3QRIA 4RJ4A 4DITA 2XKDA 3Q5ZA 5HE2A 4FTTA 2C1BA 2ETKA 2W99B 5AX9A 3W2QA 2W06A 3BKBA 3RBWA 1ZMVA 5HNGA 1KE7A 3R28A 4W8DA 4I6FA 3N4TA 3NW7A 5JKGA 3E8DA 2XBAA 3RAKA 4O0WA 3LFQA 1P4FA 4GYIA 4CFVA 2UZUE 4E6QA 3PZHA 4ALVA 2W4KA 4YC8A 3RAIA 4XBRA 2WTCA 3OXZA 4BWXA 5E1EA 2NP8A 4C4EA 3FQEA 2BHEA 3BI6A 3VF9A 2ITXA 2OZAB 4JQ7A 5AIRA 4E1ZA 5EM5A 3TV7A 4QP1A 3R9HA 3NW6A 3MYGA 3AC3A 4O21A 1UU7A 2VX1A 3PG3A 2P2IA 3OW3A 1GIJA 5AJQA 4MD9E 5F94A 3DU8A 3JVRA 1YDTE 1LUFA 2FB8A 3LPBA 4FZFB 4HYHA 3NUUA 3TG1A 4C36A 2CJMA 2YDJA 3T3VA 4F65A 4DG2E 5CF6A 2QCSA 4L7SA 2WIHA 2G2HA 3Q4TA 3QTIA 3HVCA 1XH4A 5LJJA 2WMAA 4WSYA 2C6EA 4IZ5A 4FEXA 1Q8UA 2OIDA 2XJ1A 3R1YA 4XG3A 3HRFA 1Z5MA 2VTPA 3EYGA 3QX4A 1QCFA 3OT3A 4NZWB 3R8UA 3ZRLA 4YBJA 4RJ5A 3PY1A 5D1JA 2WQMA 5L6PA 2PULA 3QYWA 2J4ZA 2H34A 2IW8A 3KN5A 3R71A 4D4SA 4E5WA 4F0GA 2R3NA 3V5QA 1ZYLA 2E9NA 3U8WA 4UYAA 2Q0NA 4GUEA 1XBBA 5HG8A 4W4XA 4RX7A 3W10A 3U54A 4OTFA 2FSTX 5ANJA 4GKHA 3LLTA 3SOCA 4BN1A 3GXLA 1UU3A 2CGVA 1WFCA 2ITTA 4JRVA 4NUSA 1NW1A 3O17A 4CRSA 4EQMA 4NJDA 4FKRA 3OF0A 5GIPE 3PYYA 3Q9WA 5IQHA 3BQRA 5DIAA 3TNPC 4DFNA 4WUAA 3DY7A 4XV1A 3N9XA 5EW9A 5GHVA 3W18A 5I5ZA 2W5AA 3SXRA 5IU2A 4JNWA 1YXTA 2WMTA 3CC6A 2O63A 3O8PA 4UZHA 4O91A 1ZMWA 4ASEA 2J2IB 3HX4A 4PNIA 3VUMA 5B2MA 2XKEA 4M13A 4PV0A 4O0SA 3O23A 4G31A 4HYSA 2C0IA 2XP2A 3UE4A 3CBLA 4ZTRA 4ZY5A 3A7HA 4PTEA 3FLYA 4CG9A 4U8ZA 4GT4A 3NPCA 2W96B 2WQBA 2NRYA 1ZY4A 1ZY5A 2NRUA 2VWUA 3EL8A 2RFSA 3LFCA 3OY3A 4J97A 3UZPA 3RAHA 2JKMA 2OIBA 5IEYA 2J50A 3BLQA 3PXRA 4C4HA 2CN8A 2VTIA 5BVKA 2P3GX 2HZIA 5HTIA 2W1IA 2QODA 1R1WA 3C4XA 1OB3A 1YVJA 1JWHA 4U43A 1OVEA 2C6DA 2J0IA 4FI1A 4UWYA 3UODA 4B7TA 5B7VA 5JSMA 4HNFA 3AMBA 2WZJA 3PSCA 4Z3VA 4F7JA 4IACA 4AZSA 4K0YA 3AMYA 4BGHA 4E4XA 3LMGA 5AR4A 1FVRA 4BCFA 4YJTA 5KMJA 5CEOA 2G2IA 4HZRA 5TE0A 3WZUA 2R3OA 5EYDA 4IMYA 5D7AA 4E6AA 3PE2A 5F1ZA 2XIXA 1ZAOA 2GTNA 3OCGA 4X2FA 3DS6A 5T3QA 5AR8A 2BALA 2J9MA 5AMNA 4UBAA 1VEBA 3WZKA 1ATPE 3COIA 4ZEGA 3VS0A 4BF2A 3MBLA 5CT0A 3TN8A 4QPSA 2AUHA 1SNUA 2R0UA 4I6HA 4FV7A 2F2UA 3IGGA 4D28A 4F7SA 5IUHA 5J79A 5E8TA 5K4IA 1WBNA 5D12A 2E9VA 2C5OA 3P7BA 2VTHA 2JAVA 3T9TA 3D5VA 4PUZA 3K3JA 3ZU7A 4N57A 4MXXA 1U46A 4G6OA 5HEZA 2QR7A 4C4JA 1FINA 3KKVA 4FL3A 4F9CA 5I9ZA 2X9FA 3EQHA 3HNGA 4UMPA 1YWNA 3BYMA 3WARA 1VR2A 3MIAA 4D1ZA 3PXZA 1ZMUA 3I5ZA 4IH8A 2BRBA 3RWPA 4DEIA 4IANA 3PY0A 4F9AA 4K2RA 4A4XA 5JGAA 2VUWA 5BNJA 3RPSA 5AP7A 1P14A 4LOOA 5K0KA 4FL2A 1ZYDA 4OTRA 3UC4A 3GCPA 3MVLA 3CIKA 3LCDA 3MGYA 3R7UA 4ZLZA 4QTAA 4AAAA 5ICPA 3VF8A 3OC1A 2QOFA 4CNHA 2FGIA 4ENYA 1PMUA 2OWBA 4DCEA 2G2FA 3RZBA 4PPAA 4FOBA 3TJCA 2OH4A 4DHFA 2VTJA 3TTIA 3KL8A 2EXMA 3G0FA 4ZOGA 4NU1A 5AP2A 1XJDA 3WZDA 3PJ1A 4U9AA 2BRHA 3AC8A 2GTMA 3GU4A 3JXWA 4AUAA 3NCGA 2W5BA 4AFJA 3FPQA 1Q41A 1UWHA 3FWQA 4NKSA 3I4BA 2JDVA 3ZC5A 2R3QA 3ZLSA 1SVEA 4DFZE 5AFVA 5EQYA 4DT9A 5HLNA 4YGAA 3VBVA 3ORNA 4PL4A 1XQZA 2ZB1A 2CLQA 2VD5A 5H2UA 3TKIA 4C62A 5J1WA 1PXPA 2C3JA 3FPMA 4A9YA 3SKCA 4AT4A 4JL9A 1SMHA 1GIHA 3A60A 3WF6A 3HP2A 3M2WA 5B2KA 3W33A 3QTSA 5LCKA 2WOTA 3ZUTA 3QD2B 4BDCA 3WOWA 4ANSA 4BGQA 4F1MA 4W4YA 4NW6A 3Q5IA 2PTKA 3RVGA 3TCPA 5M4UA 2VO6A 4FKOA 4KS8A 3BWFA 2WQNA 3ZUUA 1CMKE 2YLEA 4QMUA 3FI2A 3ZZEA 1QL6A 4PMSA 3TTJA 5KMOA 3OS3A 5EOBA 2PZIA 5FM2A 4KINA 5HBHA 3FQSA 1VJYA 3AC4A 3V51A 4ACDA 2QOKA 4L43A 1DS5A 3GC8A 3QZGA 3QQGA 1Q61A 2VTOA 2IVSA 5J9YA 4MWIA 3Q3BA 3F2AA 3FMDA 3GQLA 3C4WA 3TJDA 3EQFA 5LVMA 2Z7QA 4UYNA 3Q4UA 3HDNA 3BQCA 4KWPA 3RALA 3EQGA 1K2PA 3QZIA 4QD6A 3O96A 4O7VA 2QOIA 3KB7A 3BHVA 2OK1A 3NZ0A 3P7AA 3EFJA 4LQMA 4BDDA 4QTEA 1H26A 2VTAA 3C1XA 3DAKA 3MH0A 2GS6A 4R1VA 4RVTA 4YURA 3PXYA 2RKUA 5G6VA 4USDA 2OJFE 5LMKA 5HCYA 1S9JA 2IN6A 1L3RE 4CYIA 3AC2A 4F99A 1OL6A 5EDRA 1WCCA 2ITWA 5C4LA 3QGYA 3UOJA 1W82A 4M12A 3L9LA 2AYPA 3BE9A 4NIFA 3ALOA 1OIRA 2XKFA 4RWJA 1HOWA 5DI1A 3RCJA 2X2MA 1UA2A 4RFYA 3R6XA 3PFQA 4IM0A 2AC3A 3CPBA 4NM7A 3I81A 4R8QA 3JR1A 3DK3A 2C6TA 5IA3A 2OJ9A 4QMSA 4F08A 4I92A 2ZB0A 1URCA 3MH1A 2C6IA 3GEQA 4NIFB 4OUCA 3VW6A 5B0XA 3TNIA 3GCVA 4TKSA 3R8VA 3P7CA 4HGSA 5LOHA 5CU2A 3VUTA 4R3RA 5AV3A 5IPJA 3A61A 3GU7A 5EKOA 2QNJA 4O27B 4UY9A 4FIIA 4JBOA 2BCJA 5CSVA 1IR3A 4EH8A 3N51A 4J53A 3Q9ZA 3K2LA 3N4VA 2H6DA 3DCVA 3D2KA 4CZTA 3F5UA 3KVXA 1BLXA 2JD5A 5AA8A 4OBQA 3DK6A 4NTTA 4Y8DA 5L4QA 4QPMA 3ZRMA 5AP5A 3U9NA 3ODYX 5L6WL 3U55A 5IQBA 2J6MA 5LCJA 1ZOEA 4TW9A 2I40A 2CCIA 3TXOA 1OL5A 3FZOA 4NEUA 1G5SA 1YHVA 5CZIA 3G33A 2WB8A 4QMTA 1GZKA 2BPMA 5JFXA 1PMEA 3R73A 2C6OA 2OXDA 2BFXA 3KMMA 2HY81 4YHFA 3AXWA 4M0ZA 4D4VA 3FXXA 5CWZA 5KO1A 4JR7A 5FQDC 1R0EA 5HU3A 1WVYA 2P0CA 5TR6A 3U51A 2ITQA 2CN5A 3L8SA 3QKLA 3RPOA 1XH6A 4IVCA 3DGKA 1M17A 4OTIA 3N4UA 5I9YA 1ZYSA 3HL7A 3R83A 1J7UA 4YU2A 4L3JA 5E1SA 4BI2A 4ZJIA 1XR1A 5HI2A 3FZSA 4J8MA 4HVSA 3VS6A 3U6JA 1PRYA 4RRVA 4ZP5A 3GGFA 3V3VA 5ANEA 2WMUA 3D5XA 3FAAA 4KABA 3OHTA 3PTGA 2BZIB 4BDHA 3IW8A 4YLLA 2PVNA 5L8JA 3QQKA 4PDYA 4G17A 4LUDA 3NUXA 2IJMA 1ZZ2A 2PY3A 3UQFA 3OFMA 2JDOA 4GH2A 4TYJA 3EFLA 3F69A 5ANKA 4IVDA 4JBQA 2EXCX 5E7RA 3BHYA 5CQWA 2HZ4A 3FDNA 5KUPA 4QYHA 2ONLC 3OY1A 4AE6A 4FNXA 5D11A 4BICA 1YWVA 1CTPE 2XNNA 4FKSA 3BHHA 5CAUA 4EI4A 4R7BA 3G51A 3CGOA 5EM7A 4ASZA 4JIKA 4XYFA 4XG2A 5I9XA 4BZDA 2OO8X 4YJNA 3EFWA 4EHVA 3SC1A 4FTRA 4CEGA 3MY1A 3IK3A 1R78A 3H0ZA 5TO8A 5LARA 4R6VA 3LXNA 3W16A 4YR8A 1Z9XA 3U6HA 4Y85A 3PA4A 4EQCA 2E9PA 3OD6X 4MCVA 4AT5A 2C5NA 1E1VA 3AD5A 1APME 1XHAA 5C1QB 3ENMA 2C68A 4X2JA 2JAMA 3BEGA 2V7OA 3R30A 4GK3A 4S2ZA 5H8EA 4BYJA 4Y95A 3OBGA 3ZFMA 3I0QA 4QQCA 3ZXZA 3CXWA 5J95A 4DGMA 4J1RA 4RA4A 5CT7A 3UIXA 2GNLA 3W8QA 2PE2A 4S33A 2OXYA 3FMNA 4XHKB 2QLQA 4C02A 3E8NA 5IH6A 4YJVA 2BAJA 4YJSA 3VRYA 2B9HA 2YERA 1WZYA 4G3CA 1H08A 3RPVA 1YXXA 3JUHA 2PUUA 3D4QA 4BI0A 4FTIA 4UXLA 5FDXA 2WMQA 3V8SA 4O82A 1PXIA 5EDPA 2CCHA 2P2HA 2VTLA 3L9PA 3ORZA 3VS7A 5J87A 4D5HA 3DZQA 5F4NA 2F4JA 4CRLA 4JDHA 5M4FA 4A7CA 1STCE 4DEAA 4E5BA 4JOAA 4LMUA 3QU0A 2JGZA 4G9CA 5EHLA 3W8LA 2R3JA 4M67A 4ZLOA 1XWSA 3KEXA 4WA9A 5AUZA 4OR5A 3UIBA 4GS6A 4K9YA 4BY9E 3ZLXA 4NH1A 4Q5HA 4FZ7A 3BBWA 3ZH8A 4EHEA 5J5SA 4BCOA 2GCDA 3CD8A 3U4UA 3KN6A 4QTCA 4XLVA 3QRKA 3VJOA 1H28A 4R7IA 4U0IA 1OBDA 1K9AA 1TQMA 3KRXA 4H05A 5CEKA 2HZ0A 4I24A 2P33A 3BYVA 1CKIA 4IB5A 4CTBA 1H1QA 2H96A 3IW7A 3P23A 5FBOA 2GS2A 1WAKA 1WBOA 2RFEA 4PY1A 2WU7A 4AOTA 4F9WA 2QOOA 3TV4A 1O6KA 3DPKA 4YZMA 4PNKA 2XJ0A 3GU8A 5BX0A 3ZCLA 2CKPA 1VZOA 3T3UA 4APPA 1P4OA 2UZBA 5BVEA 2WEIA 5AV0A 4HJOA 3KRLA 1ERKA 2IPXA 3FEGA 5IEVA 3PXQA 4IVBA 5FRIA 4C8BA 3TL8A 3IONA 4M7IA 4NW5A 4DH5A 4I21A 3BV2A 4KS7A 3ELJA 4NTSA 4QP7A 1EH4A 4J95A 4QNYA 4ZMFA 2R5TA 3VUHA 4D9UA 3DXQA 5CEIA 5KZ0A 3HEGA 2YN8A 5A14A 5A54A 3SG9A 1H1RA 2QI8A 4ZS4A 4Z55A 4O7WA 2FO0A 3VBWA 5FD2A 4KKGA 5IA5A 2WO6A 3UQCA 4FUYA 4RBLA 1I09A 4ITIA 4AX8A 3V5LA 1I44A 1XH8A 4NM3A 5JMSA 4EH5A 1W8CA 2PUIA 4RQKA 4AFEA 4BCMA 2W5HA 4FF8A 5CTPA 3F6XA 4BCJA 4UMTA 4LUEA 5B2LA 3H10A 1KE8A 4J96A 4F6SA 2RL5A 1ND4A 4O0VA 5KHWA 4DEDA 5IDNA 4QMYA 2IZTA 2JKQA 3E3BX 4RIWB 1WVWA 2XEZA 4WNKA 5JRSA 3ZZWA 2VGPA 4C3FA 4DTKA 4IIRA 5HE3A 4XG8A 4C57A 3H4JA 2YZAA 4EYJA 2WD1A 4ORKA 2VU3A 5HG5A 4FSTA 3RJCA 4IAZA 4AG8A 2F9GA 5F9EA 2PE1A 2ITUA 5FDPA 2BHHA 2XMYA 3QBNA 4BIEA 4JQEA 4RIWA 2GNFA 4MQ1A 1YRPA 3UMXA 2LGCA 2XM8A 3KXNA 4FSNA 3GFWA 4IX3A 1Q8TA 5M09A 5DBXA 4TRLA 3LIJA 3C4EA 2F57A 2QOQA 4QP6A 2OF4A 4FVRA 1UVRA 5LMBA 1YOJA 4IE9A 4F64A 3NAYA 4O0XA 4OGRA 1YI6A 1JKTA 4TWNA 2XIKA 3QFVA 4TNBA 5BMMA 3UP2A 4Q9ZA 5KMIA 5E4HA 3PJ3A 4WG3A 5M53A 1M2PA 3LMIA 3L1SA 4DTBA 4Q9SA 3EZRA 5EYMA 3BIZA 4PDPA 4RZWA 3OCBA 4CT1A 2UZTA 4DT8A 3KULA 4P5QA 3ITZA 2YAKA 1M7QA 3NNWA 3C5IA 2YM6A 3GCSA 4WNPA 2VWBA 3L9NA 5EI2A 4XOZA 4GFMA 4EUTA 4C4FA 1OL2A 4HVIA 2R9SA 5CU4A 4BCNA 3OCTA 4FNYA 4O7NA 1A9UA 5EHOA 1MQ4A 2Y9QA 1V1KA 4FV9A 2WQOA 2GFSA 3AT3A 3KCFA 4MD7E 2GDOA 2HZNA 3OVVA 4U81A 3NLBA 1YI4A 2GHMA 5DOSA 3HA6A 2X39A 4IJPA 5KNJA 1IA9A 2VV9A 3VAPA 1W7HA 4YJOA 3TDWA 2CGWA 5GZ8A 1YHSA 4AZFA 2B9IA 3KU2A 5LMKC 5HIDA 4X2GA 1V0OA 3IGOA 3SXSA 3ZBFA 2PVFA 3EN7A 2Y6MA 3IPHA 4HZSA 4OTQA 4ZTHA 4EH3A 3VULA 1PXJA 3SW7A 5CSHA 2ZV2A 4DYMA 4NL0A 4IB0A 2XUUA 5ANGA 4EOMA 2ZAZA 3VVHA 5K5XA 4JT3A 3E7VA 3MPAA 4UALA 3O51A 4YSJA 2Q83A 4JBPA 4DBNA 2XNOA 4DA5A 4QMWA 1PMNA 3RHXA 3ZEPA 2HW6A 3B2TA 1JOWB 3DFCB 3FKLA 3DJ7A 3PWYA 4PMPA 4FICA 4UMRA 3TV6A 2WU6A 3FYJX 3LCKA 3QCYA 2DQ7X 4I93A 2ITZA 2Y0AA 4YJQA 3GVUA 5CNOA 1BX6A 4BZOA 2JBPA 3I5NA 1PKDA 3W2OA 2PPQA 4IQ6A 3QQFA 1F5QA 4X2NA 4AGUA 5CVFA 4DFLA 3F7WA 4XH6A 2JITA 1YQJA 3QXPA 5KCVA 2X6EA 4ANBA 4F4PA 3BX5A 2YHVA 5ANDA 4B99A 5HG9A 4CMUA 4FKJA 1J7LA 3UNZA 3KRRA 3BPRA 3LXKA 4RC3A 3HGKA 4J7BA 4BCPA 3KXMA 5C03A 5HZNA 3GC7A 4FTAA 4F1OA 3CGFA 1OECA 3NSZA 4AW2A 3CD3A 5JZJA 5CX9A 4WBOA 5AP6A 1PF8A 3R00A 5AM7A 2R0IA 4Y72A 3MY0A 4HCTA 4XG6A 2ERKA 2VO7A 3DAJA 3ZXTA 4ZTQA 4FV6A 3RNYA 4CSVA 4JR3A 3G9LX 2DYLA 3Q4ZA 3BZ3A 3H3CA 5AEPA 4FL1A 3CEKA 4JAJA 3SOAA 5EH0A 2CGUA 3P1AA 4GK2A 3UVQA 5FG8A 4BC6A 2OFVA 2PVYA 2PZRA 1TQIA 3RKBA 1GOLA 3R02A 5HE1A 4MX9A 1H24A 2V62A 3D7TB 4QMXA 3ZLWA 5J8IA 3TACA 4BKZA 5BMSA 4FEUA 3QHRA 1Q99A 4KRCA 4UMQA 3ANQA 3MESA 3UO6A 5CAQA 2X2KA 1QPCA 1UNGA 2YDKA 2WAJA 2YCFA 3ZMMA 4DEEA 2I0YA 3GFEA 2XK3A 4YJRA 3BV3A 1MQBA 3D7TA 4K77A 1FGKA 2B54A 3DKCA 3DV3A 3PP1A 5BVNA 3O71A 4OLIA 4AZEA 3R1QA 2GU8A 2WTKC 2WTIA 3LM5A 4FZAB 2QVSE 4G34A 4GRBA 4E3CA 5I3RA 3FHIA 5C8KA 2ERZE 3LVPA 4GT5A 3LFFA 3NW5A 3HV7A 3FQHA 4ONAA 4FG9A 2JKKA 4IM3A 1CKJA 4O96A 4H1MA 4FVPA 3ETAA 4KB8A 4RVKA 4C3PA 2R3KA 4FTKA 2HXQA 4E26A 1TQPA 3KFAA 2BKZA 5AM6A 3HMPA 1UKHA 4YNEA 2PL0A 1VYZA 3GCQA 3F5GA 3G6GA 3Q9YA 4AW5A 1QPEA 1UU9A 5J9LA 3BRBA 3HUCA 4UEUA 3ATSA 3NUAA 1ZYCA 4B8LA 3BYOA 3EQDA 2OG8A 4G5JA 5EK7A 1OL7A 2E2BA 4A06A 5JN2A 2ITPA 4JVGA 4PPBA 4TWCA 5HIBA 3UTOA 4KUJA 4UXQA 5DHJA 4QMVA 3VS4A 4DGGA 4LOPA 3EH9A 4DC2A 4YNOA 3VQHA 4FMQA 4TL0A 3QZHA 5AWMA 2XNPA 2Y8OA 4LYNA 3UG2A 2BKKA 2HELA 3ATTA 3FSFA 3QTQA 5A9UA 2QKRA 1NXKA 3SXFA 4TWPA
chains in the Genus database with same CATH superfamily
4EZ3A 4RIYA 3UMWA 1H1PA 5HD7A 3VS2A 4CFMA 3ML1A 4FV5A 2XK4A 4M0YA 2EXEA 5FTGA 4OTDA 3P4KA 5H8GA 4MUQA 3MFTA 4U40A 5IMEA 2J5EA 2B1PA 4WUNA 5ANIA 4FKGA 2XCKA 4PRJA 1JNKA 3EL7A 3AD6A 3QKKA 4AN2A 1LP4A 5KMNA 4DG3E 2HIWA 3QUPA 4FV3A 5AAFA 1KV2A 3VW8A 4ZJJA 4WG5A 3LQ5A 5EYCA 2X7GA 3QQLA 2XBJA 2VAGA 1Q3DA 2PSQA 2CMWA 4O7LA 2XIRA 5A46A 4G3DA 1DI8A 3GOKA 4Y73A 4OT5A 1IASA 2UW8A 3W2CA 2ZJWA 2OIQA 3AGMA 3R0TA 4O7ZA 1BYGA 2OFUA 2OKRA 3P9JA 5HBEA 2X6DA 4YZCA 1IA8A 3UVPA 4R78A 4KA3A 4AWIA 4I3ZA 5GJDA 2YEXA 4ZSAA 1JSVA 3IQ7A 4FTCA 4GL9A 4MTAA 4YLJA 5HLPA 4FBXA 5IF1A 1H01A 3DK7A 2BDWA 2X4FA 2WMWA 2C3IB 3AC1A 5DR2A 4BR3A 1MP8A 4FTLA 2C0TA 4JS8A 1YXUA 5CNNA 2WXVA 4N6YA 5BYYA 3CS9A 4EL9A 5JGBA 3LKMA 4I6LA 2Z7RA 2EUFB 4MF0A 5HU9A 3E88A 3F2RA 2YISA 4YPDA 4ZTLA 1VYWA 4DHZA 4BDJA 5A6OA 4M14A 4I5MA 3TEIA 1XH9A 3DZOA 1OGUA 3NYVA 3EQIA 4A07A 5C8NA 4USFA 4CZUA 4NFNA 3IDCA 3OBJA 3LQ3A 3UOHA 4QP8A 4BCKA 3GI3A 3NEWA 4JJRA 2OH0E 4I5PA 5CZHA 4DEBA 3F3TA 3ZS5A 4F70A 1BUHA 4ITHA 3CTJA 1FBNA 4BB4A 4R1YA 5KBRA 4FYOA 4KBAA 4LV7A 4HYUA 5DVRA 4OTGA 2CPKE 4ARKA 4WRSA 2G15A 2LAVA 3KF4A 5M55A 4MBIA 5IH5A 5CLPA 4ANOA 1BL6A 2YLFA 4ZY6A 4GUBA 2AQXA 4EOLA 2W1DA 2YM3A 5CEQA 5CF5A 4I6BA 4DLIA 1PXOA 3F5PA 2VTTA 1JSTA 2BTSA 2XK7A 2IEWA 5HTCA 5GIOE 2CSNA 3OROA 5A4LA 4FV4A 2R7IA 5DGZA 1ZWSA 2XNGA 5H3QA 1QPDA 4B9DA 4E4MA 4GIIA 4I0RA 5DMZA 4QMMA 3MVMA 3QTWA 2OZOA 4LMNA 4FC0A 3SRVB 2X9EA 3ZFXA 4C2VA 2CLXA 2WGJA 3MFUA 5EM6A 4AACA 1K3AA 1U4DA 3Q60A 3W55A 4CMOA 4W4WA 5KE0A 5HNBA 3ULZA 4O84A 3KQ7A 1Q8YA 5I9VA 4AOJA 5AV1A 4L52A 2OLCA 2VTRA 4BDFA 4MNEA 2PYWA 3CY2A 4GG5A 4E6DA 1H25A 2BDJA 3PUPA 1UV5A 3B8QA 2W9ZB 4XRLA 4GU6A 3C50A 3CQWA 3W2RA 1XO2B 4EK8A 1PW2A 2C0OA 2ITNA 3B2WA 1E9HA 2BZKB 3QRTA 4QMZA 1FQ1B 3A8XA 3HECA 5BVDA 3FZPA 4YUQA 2A27A 1DAWA 4QMQA 1GY3A 1UKIA 4QDEA 4H36A 5FP5A 5I9UA 4ZIMA 1PJKA 5M07A 2GSFA 3OTUA 5CF4A 4PL3A 2KULA 1YW2A 3K3IA 4I4FA 2XEYA 4D2VA 4U5JA 4JAIA 3TWJA 5IUGA 5IMXA 4L01A 5E92A 4E5AX 3MJ2A 4AW1A 4HW7A 4FTQA 1FMOE 3V6RA 1X8BA 3MTLA 4FNWA 2UZNA 2QHNA 4H3PA 4QYGA 2UW0A 3HA8A 4S30A 2QG7A 3ZEWA 3NFFB 4KD1A 2ACXA 2VX3A 4LRMA 5KKRB 2VO3A 3LHJA 3TM0A 4F7NA 3HZTA 2GFCA 2WMRA 2OZAA 5IKWA 3PRIA 4YJPA 4BCHA 3DLSA 1IAHA 3VS3A 4U42A 4EHZA 2PMOX 5CENA 3G9NA 3A4PA 3AQVA 3EQPA 4NK9A 4D5KA 4CKJA 5DRDA 1ZZLA 3GUBA 4IWPA 4GVAA 2VGOA 3NUNA 4ALUA 4AU8A 5HG7A 3UOLA 3VRZA 5HD4A 4XBUA 1ZOHA 4AXCA 4V05A 3FMLA 3BELA 4ZSJA 3TZ9A 3HMNA 3REPA 3PJCA 3R7VA 3AGLA 3UZRA 3W1FA 2C3LA 2QONA 4E4LA 5AR2A 3ERKA 4I5HA 3ZRKA 4QQTA 3ZO3A 2Y4PA 4IX6A 5KMLA 2X4ZA 2WTDA 1OPKA 2XRUA 3C0HA 3OUKA 3NMUF 1UWJA 5HO8A 2YCRA 1WBSA 4EBWA 3HRCA 3FZRA 5DE2A 4ZK5A 3VS5A 2OSCA 1A06A 2Z7LA 4X0MA 5HVYA 4DDGA 3QWKA 4XV9A 2Z60A 4FNZA 4HPUE 2OJGA 4QTBA 4DEGA 2PUPA 1YKRA 2BDFA 3IW6A 2IVUA 4FT3A 4KSQA 1V0BA 3PXKA 3DNEA 3VBYA 3BLRA 4Z7GA 2VWWA 3MN3A 4KIKB 4NKAA 5FLFA 4FIJA 3PXFA 1G8AA 4FTUA 5EI6A 5EQEA 3GC9A 4O0TA 5JT2A 4O1OA 4DF3A 5AAEA 2UW6A 3VHKA 5CQUA 3QQUA 4ERKA 4XCUA 2QO9A 3DBQA 2WHBA 2YIYA 3GENA 2BUJA 4TWOA 4BHZA 5AR7A 4JLCA 3CQUA 2SRCA 4KKHA 5E90A 3RPYA 4DHIB 3ZO1A 2BRGA 3M42A 1OIYA 4CD0A 2V7AA 3SW4A 3LFAA 2WKMA 4TYHB 1JPAA 4FTMA 5FM3A 3GT8A 2JIIA 3DDPA 5I9WA 4C59A 4D2RA 1YWRA 3ZM9A 1YDRE 2VNWA 4B6LA 3E5AA 2WELA 3QA0A 4QQJA 3NFGB 4EOPA 3BGPA 3QUDA 4C7TA 4IW0A 1NY3A 4KNBA 4U3ZA 4BYIA 2PWLA 3UG1A 4FIHA 5AP1A 3QALE 4ANQA 3KVWA 1Q4LA 3GU5A 4FTJA 4C4IA 4QO9A 5LMAA 3ORPA 3JY0A 3P79A 4IXPA 4AQCA 4DGNA 5KX8A 2ZFYA 4BTFA 4OTHA 3MH2A 3JVSA 3UPXA 1B39A 4KRDA 5C8MA 4JMQA 1PYXA 3LAUA 4C37A 2QQ7A 2XIYA 2Y7JA 4QP9A 4XV2A 3FL5A 2Y4IC 4XRJA 1GAGA 3FI4A 3W2PA 1DAYA 5T68A 3D0EA 3A62A 3KCKA 5KMMA 4ZZOA 4R77A 4O2ZA 1Q24A 2OI4X 2BIKB 2XK9A 5CVHA 5ETAA 4Y83A 4AA5A 5E8XA 4AGCA 4D1SA 4XG9A 4RX5A 3UGCA 3BU5A 4YZDA 4D1XA 4OTWA 3WF8A 3FV8A 4G3FA 3P86A 4ASDA 4M3QA 4RFZA 4BWKA 2E9OA 2UW5A 1W83A 3LFDA 1WBWA 2VRXA 2VZ6A 3R7OA 1PYEA 2YZLA 3OCSA 5EDQA 5GJGA 5LWMA 3RPRA 4D0XA 4XG7A 2F7ZE 4XOYA 4E6CA 2B55A 3UNKA 4ZMEA 3PJ8A 2EB3A 3WIKA 4QOXA 4XP3A 3G15A 4IVAA 3Q2MA 5HHWA 3LLAA 4RJ8A 3H0YA 1JVPP 2XCHA 4G6NA 2GPHA 2A4LA 4QYEA 3MI9A 2O5KA 3LFNA 1XBAA 4EZ7A 3DTWA 3DNDA 3ZO2A 2XANA 4CYJA 5HE0A 4CZYB 3GCUA 3P5KA 2BAKA 4U80A 1CKPA 1PXMA 3NS9A 3AKLA 4IZYA 3S0OA 4L45A 4MH7A 2XH5A 2I0HA 3DLZA 4JDJA 4L44A 4RIXA 4KBCA 4NFMA 1LPUA 1JBPE 2EVAA 3HV5A 4PDOA 2C5YA 4TTHB 3HRBA 5HESA 2B0QA 5I4NA 4X3FA 3LW0A 1PY5A 3LJ2A 3OEZA 1IEPA 4V0GA 5K5NA 4IAYA 3CPCA 4AGWA 5D7VA 3W0RA 4BBMA 4JG7A 5ANOA 5IISA 5GZAA 2X8DA 3QCQA 4E8AA 2XKCA 4CKRA 1H00A 4RPVA 4NCTC 4WG4A 1M7NA 5K0XA 4BTMA 2FYSA 3I6UA 4H3QA 3ROYA 1L8TA 2UVXA 3E7OA 5DNRA 4D2TA 4HGLA 3BYUA 3ALNA 4LG4A 3QGWA 5ACBC 4DINA 3MV5A 4ZSLA 2G9XA 4R5YA 1YOMA 3E87A 4O4CA 4FKVA 2WTVA 4UZDA 2FSMX 4HNIA 5A4TA 2O8YA 4WIHA 4L53A 1MRYA 4P5ZA 3VBTA 5BPYA 4PQNA 5IA2A 4BHNA 3UDZA 4GFOA 2VTMA 4JG6A 4MD8E 4UV0A 3HKOA 3UBDA 2YCSA 3I79A 4FG8A 3CLYA 1YXSA 4QRCA 3RHKA 3VO3A 2YCQA 5J9ZA 4Y5HA 4TYGA 4CFXA 2HK5A 4O81A 4DFXE 4FE2A 3AT4A 3FLZA 3BHUA 4YMJA 1RE8A 4F0IA 3O2MA 4AZWA 2OXXA 5HO6A 2EWAA 2XNBA 4AA4A 1NT2A 3TNQB 3I7CA 3EZVA 5L2QA 4GT3A 2X1NA 5HCZA 5E9EA 2OBJA 3KK9A 4QPAA 4NYEA 5M57A 5DYJA 2PZ5A 3CKWA 3ORLA 2XA4A 2X7OA 5K4JA 3PLSA 4G3EA 2O64A 4CQEA 4F1TA 2QOLA 3UJGA 3S1HA 3RTPA 3TUCA 4FSMA 4O7YA 2PK9A 1PMVA 3PVGA 3MWUA 1LEZA 3SGCA 3H9FA 3F3UA 3QD3A 4BDAA 2C6MA 4QYYA 5C4KA 1FGIA 1ZLTA 1B38A 3VUIA 3LFEA 2QKWB 4XJ0A 4EJ7A 4M15A 2Y4IB 3HMOA 4Q2AA 3PP0A 3D14A 3EN4A 2QLUA 3V04A 1UU8A 5CY3A 3FMHA 2FSLX 2J51A 3QQHA 1PHKA 5AUYA 3BYSA 3HMIA 3QC9A 3TIYA 4KBKA 4C0TA 3PFYA 2ZDTA 4EK4A 3VUDA 4DTAA 3OEFX 3LJ1A 2Z2WA 1OL1A 4DE4A 3G5DA 4RJ3A 4RMZA 4BVUA 5LQFA 4UWCA 3HV4A 3ULIA 2BTRA 3D9VA 3U9CA 4E20A 5IEXA 2BILB 3RK9A 4AF3A 3O7LD 5GINE 1HCKA 1KWPA 4L67A 5G1XA 1KE5A 2R3RA 3K5VA 3ZDIA 3VBQA 4BBFA 4CFNA 1ST0A 2VWYA 3RK5A 3TDVA 3ANRA 2CKQA 5T6KA 3OWKA 3PSBA 4MBJA 5CAPA 4FEQA 5CALA 5FEQA 3IKAA 1OMWA 3PLAE 3TZ8A 4DLJA 2G1TA 3ROCA 4Z16A 4ZAUA 3F5XA 3DA6A 1XBCA 4O6EA 3RZFA 3FBVA 3FC2A 1BI8A 3P78A 4O6LA 3SD0A 4C61A 4O0UA 4D2PA 5CI7A 4LRJA 5CU3A 1O6YA 3W0SA 2WMVA 2R4BA 3QTUA 4BIBA 2JDSA 4RIOA 4BCGA 4G1WA 1GNGA 2X8EA 1PXNA 1W2CA 3A99A 3QHWA 3ORIA 4JX3A 4AOIA 3AD4A 4KIOA 3TUDA 4I6QA 4MEDA 4LGDA 2I7QA 3PZEA 4IAIA 1BL7A 4F6WA 4M68A 3ODZX 3M1SA 3AKJA 1SVGA 5BYZA 1REKA 4GYGA 4OAVB 1YXVA 1OZ1A 2QO7A 5CXHA 3MFRA 3BGZA 5TF9A 2Y6OA 3C0IA 1PKGA 2WEVA 3LFSA 5AAGA 1R39A 4LM5A 3SAYA 2C6KA 2BAQA 1WBTA 2UZDA 3QQJA 4C3RA 2F7EE 4ASXA 1M14A 2PVKA 5C27A 3WF5A 4CQGA 4YP8A 4IZ7A 1O9UA 2ITOA 1T45A 3TIZA 4BL1A 5HX8A 1FOTA 4JXFA 2CGXA 2W4OA 3FUPA 3HYHA 3O50A 3ORKA 4H58A 4MXCA 4CVAA 1A48A 3CSVA 4RVLA 2VN9A 4MKCA 5DT0A 3LM0A 5AIKA 2GNIA 5TT7A 4YTHA 4ZSEA 1CM8A 5AUTA 2W1CA 3PG1A 5E91A 5ETFA 4ANMA 3EKKA 4GIHA 3A2CA 4FSQA 4BBEA 3H9OA 4XV3A 4G2FA 3WYYA 3OT8A 4MWHA 4PTCA 4CLIA 3ZHPC 3A7JA 3KXXA 5L2TA 4FV8A 2FSOX 5I0BA 4PP7A 2X7FA 2QG5A 3Q9XA 4HPTE 4EKLA 4I20A 3V8TA 5DH3A 2OICA 4N6ZA 2ESMA 5HGIA 2BZJA 1SYKA 1TKIA 2QU5A 4TN6A 4QP3A 4TY1A 3DT1A 3BU6A 4YZ9A 3ZTXA 3CTQA 2CKOA 2B53A 3E93A 5M4IA 3TZ7A 4EOQA 5L3AA 3C0GA 3FC1X 5DPVA 5FP6A 2NO3A 1JKLA 4DAWA 1UNHA 3DB6A 3E63A 4MYGA 4ACCA 5CSPA 5DR9A 4GEOA 1H4LA 1REJA 2HOGA 3OW4A 4IAFA 1MRUA 2VWVA 1AD5A 2ONLA 3HUBA 4GJ2A 3RP9A 1JKKA 3TKUA 3RGFA 1SM2A 3W2SA 1OI9A 4I23A 5D41A 5AR3A 2IO6A 2R3PA 2XYNA 2HWOA 5EM8A 4FR4A 4EJNA 3EIDA 2VO0A 2ZMCA 3E8CA 3MB6A 3QX2A 4FOCA 4ITJA 1T46A 4WT6A 5JZNA 5HLWA 4K8AA 4C4GA 2J0LA 3I6WA 3NR9A 5IQFA 3FSKA 4IX4A 2WIPA 4PX6A 1UNLA 4C38A 5JQ8A 4O0RA 2RFNA 3R8LA 2QO2A 3OP5A 2I1MA 3ET7A 4IEBA 1URWA 4RLKA 2WOUA 5A4CA 5E8VA 3WIGA 3QZFA 5M08A 3BWJA 3EQBA 3PJ2A 3C51A 1U59A 2RFDA 4RFMA 2BROA 4F9YA 2J0KA 3DDQA 3IDPA 3VN9A 2WMXA 5FWKK 1PXKA 2PMIA 3FMMA 4FKWA 4OT6A 3R8ZA 3GBZA 3A7FA 5L2IA 4CV9A 4LL0A 4AE9A 2JDTA 3I7BA 4EK5A 1LR4A 5I3OA 5BUJA 1GZNA 5KMKA 4J98A 3OOGA 4YZBA 3KULB 4ZXTA 2RG5A 3CR0A 4OW8A 4N4SA 2W9FB 1OIQA 3FKOA 2YDIA 3VUKA 4UB7A 3UQGA 3R63A 1XH5A 4DEHA 3JS2A 4IFCA 5F95A 5M56A 3OXIA 4L68A 3KXZA 5CU0A 1FPUA 5JH6A 3GOPA 4KIKA 4TYEA 4KSPA 4ID7A 3ZSHA 3S2PA 5LVPA 1SZMA 5E8UA 4EOOA 5EFQA 2IF8A 1KE6A 5AUWA 1JAMA 3FMEA 4DFYA 4FX3A 4XS2A 4F63A 4QTDA 1P2AA 3I1AA 1WVXA 2WTWA 5LVNA 3BCEA 1FVTA 3PPJA 2HCKA 2GNHA 3FXZA 5EG3A 4L46A 2XARA 2O2UA 3C13A 2BRNA 3NYOA 2WFYA 1S9IA 2XVDA 3OUNB 4FV0A 4B8MA 3CJFA 3FLWA 4CKIA 5AA9A 5BVFA 4R3PA 2O65A 4B0GA 4L00A 1KSWA 5IQGA 4EH4A 3VBXA 2XK6A 3RM7A 4BZNA 2E9UA 1RW8A 4XNEA 4QMNA 4FK6A 2B9FA 4CLJA 3LQ8A 3F61A 4P90A 4LGGA 2R3IA 3VONA 1E1XA 3HV3A 1ZARA 4LFIA 2XF0A 4BDKA 1CSNA 5CEPA 2A19B 1W2FA 4W4VA 2GQRA 2UW7A 3A4OX 1ZYJA 3HLLA 5C01A 4DCAA 2YIWA 3KF7A 4K33A 3PIXA 4XX9A 3Q6WA 5AP0A 2QURA 2J90A 5GZ9A 5L8LA 3JPVA 3QD0A 5HIEA 2PMNX 3NUYA 5FEDA 4QQ5A 4O83A 2X0OA 4AP7A 1OM1A 2PVRA 4J99A 4D2WA 3IOKA 3MPMA 3DJ5A 3EQRA 4IWQA 4R3CA 1WBVA 5DT4A 3NUSA 4E7WA 1G8KA 3MB7A 3E8EA 2W0JA 5EQPA 4O7RA 1WBPA 1OKZA 4I41A 4GCJA 2YAAA 1JSUA 4RWLA 4FT9A 1H0VA 4ZTMA 1YI3A 3F3WA 3F7ZA 4QDVA 3H9RA 5JFSA 2X0PA 4IAKA 4MAOA 4RVMA 3MVHA 2WNTA 3SHEA 1J3HA 2QU6A 3SV0A 1OPJA 2UW9A 4FG7A 3MSSA 4BKYA 5CU6A 1B6CB 2HXLA 3UDSA 4NM0A 2A2AA 3PY3A 3NDMA 4FIFA 5DA3A 4WNOA 4RG0A 4BIDA 4FZ6A 3P0MA 4CT2A 3E92A 3NRMA 4FSYA 2ZMDA 3VUGA 4R7HA 4BFMA 3PA3A 5C9CA 4EHGA 3VS1A 5CAOA 3C5UA 4ZSGA 2VWIA 3B8RA 3R9NA 4BDEA 4X3FC 5ITAA 2C5VA 3KMUA 4EYMA 2B7AA 3E3PA 2UZEA 3D94A 4FEVA 1TZDA 4ZZMA 4RIXB 2CHLA 3RNIA 2UZLA 3L8XA 5J7BA 3ENHA 3UIUA 3R1NA 4D0WA 2RG6A 2I6LA 3R7GA 1OUYA 3T8OA 2GHGA 2PZPA 3S00A 2BR1A 3FL4A 2QHMA 1DI9A 4V0GB 4ERWA 3HMMA 3UP7A 4MXOA 3EN9A 4L7FA 3ZFYA 1OBGA 4GG7A 4ZZNA 5CAVA 1W0XC 5FUTA 5M44A 4FJVA 4F9BA 5BV3A 4S34A 4BKJA 3R7EA 4DGOA 2UVZA 3R2YA 4EK6A 2XRWA 3EOCA 3PPKA 5EW3A 5CSXA 5ETCA 1QPJA 1KUTA 2PU8A 1YDSE 4EH9A 5IUIA 4HOKA 3UO4A 4LDTA 1OPLA 3T9IA 4RLLA 3PVWA 2C3KA 2KTYA 1GJOA 2IW9A 4TT7A 3IG7A 2ZYBA 2VX0A 3QAME 3OWPA 4FKQA 4GJ3A 4O22A 4HCVA 5CS6A 3V6SA 3KREA 5AV2A 1IG1A 3HV6A 3PA5A 3TMOA 2W7XA 4RGJA 3PWDA 1Y57A 1LEWA 4IM2A 4RX8A 4F0FA 3QUEA 2C47A 4WHZA 3VJNA 5BUIA 4LI5A 5HKMA 2CNQA 3QTRA 4C33A 3NIZA 1Y6AA 2JIVA 5CXZA 5GNKA 3WBLA 2WPAA 5AP3A 3DBEA 4ZTSA 5M4CA 5HBJA 2BFYA 3O8UA 2GS7A 2PE0A 3U87A 2W17A 4NWMA 4QMPA 2OGVA 5IQCA 3A8WA 4G9RA 4YO4A 3S95A 4CCUA 3VHEA 3V01A 2HY0A 4K18A 2C4GA 4JX7A 4IDVA 4R5SA 4AAYA 1F3MC 1U5QA 2IZUA 4JDIA 3RM6A 4DH3A 1H0WA 3MTFA 1NA7A 3PIZA 4QT1A 4LV5A 3DBCA 4FKIA 3R7YA 5A4QA 5GJFA 4EOSA 5BUEA 5JRQA 1Q97A 3QC4A 3SQQA 3GU6A 3VIDA 3DFAA 3DBFA 3D83A 4OTPA 5FBNC 3NGAA 2FVDA 3SX9A 2W4JA 5AP4A 3L9MA 3KXGA 4IADA 3UPZA 1J91A 1XH7A 4GMYA 4EOKA 4D4YA 5HTBA 1IRKA 3EQCA 3LFBA 2V55A 4MBLA 4WD5A 1NVSA 2WQEA 3D5WA 3G90X 4G3GA 4TYIA 3OTVA 5TKDA 5JK3A 2J7TA 3MIYA 1MUOA 4FKUA 4CFUA 3DAEA 2XALA 1Q8WA 3TNWA 3EJ1A 3UIMA 2ZOQA 3CTHA 4P4CA 4AZTA 3NVMB 5DT3A 4RZVA 4FODA 4J8NA 3LZBA 3C4FA 2HYYA 3VQUA 3OXTA 3RMFA 3C7QA 2R7BA 2HWPA 4YPSA 4ANLA 1Q3WA 4TZRA 4U45A 2NNWB 4N70A 4U41A 3JYAA 1FMKA 4V01A 5CSWA 4BCQA 3CKXA 4NCTA 3I0OA 3WE8A 2HENA 4CV8A 4U6RA 4EWQA 1KOAA 3VC4A 2G01A 2R3MA 5AUVA 4EEVA 3LCOA 4NJ3A 3SA0A 4USEA 3UO5A 2ITVA 2RSVA 3QRUA 4EOIA 5IA1A 4G5PA 2IWIA 5JGDA 4W9XA 5FGKA 2VTSA 2A98A 2B52A 4MQ2A 4NT4A 5FXSA 4L3LA 5AX3A 5DN3A 2W05A 2WMSA 4CGAA 4LV8A 3D15A 5A6NA 3D7ZA 1H1WA 3RAWA 3R9DA 3TZMA 3NYNA 5KKRC 5HVKA 4FV2A 3UZTA 3V8WA 3A7IA 2QR8A 4U7ZA 2OU7A 4OBPA 4Z9LA 2DS1A 5IQDA 2C30A 5HNIX 2UZOA 3NYXA 2YJRA 3ZBXA 5EOLA 4EH7A 4HVDA 1TVOA 4IAAA 1H07A 3CP9A 3EN6A 4F09A 2FUMA 4YSMA 2OF2A 2BVAA 3H30A 5IDPA 4U3YA 5AUXA 5L2SA 4O38A 5IA4A 1GZOA 4YTIA 2YIQA 5HQ0A 4RC2A 2A1AB 4H39A 4MK0A 3W32A 4EQUA 2AC5A 4YO6A 4DFBA 2UW4A 4X21A 4HVHA 2PVLA 1OITA 4S32A 4Y46A 3NNVA 5HCXA 5H8BA 2YJSA 4F6UA 4GU9A 3F88A 4O86A 2ETRA 3AG9A 5DG5A 4CFFA 4CG8A 3OOMA 4L9IA 4NSTA 3BEAA 3KY2A 5FXQA 4E93A 4PMMA 3QLGA 3MPTA 5HORA 2J0JA 3E64A 2UV2A 4RWKA 5BVOA 3DXPA 2IZSA 5EYKA 4JIAA 4LL5A 2XK8A 4ZTNA 4XLIA 3WYXA 4RJ7A 3DKGA 3QA8A 3I60A 2ZM1A 4KAOA 3G2FA 4U44A 3JY9A 4ZS0A 3FY2A 2ZV9A 4FT7A 2V0DA 3IO7A 4S31A 2PVMA 1JQHA 2HAKA 2RF9A 3NCZA 4O4FA 4L8MA 3LXPA 2F49A 1J7IA 3HAMA 3KXHA 3EHAA 1FVVA 2Z7SA 3BGQA 3ACKA 4MVFA 5JEBA 3M11A 3LMHA 4P7EA 2GQGA 1YOLA 3QLFA 2QOBA 3TT0A 4BDGA 3F66A 4GSBA 4YHJA 1M2QA 2ZDUA 3O7LB 1YHWA 4GK4A 2QD9A 3UDBA 5HVJA 3WILA 2XJ2A 2YIXA 3QCSA 4HCUA 3G0EA 3AT2A 4GW8A 4RJ6A 4WOVA 4D58A 3R9RA 2J0MB 4PMTA 4DG0E 3UYSA 1Y6BA 4CXAA 3FY0A 2EU9A 4A4OA 2IVVA 1ZRZA 3FE3A 3MH3A 1KOBA 5HICA 3AOXA 5BVWA 4JI9A 3CQEA 4AXAA 5FXRA 2BMCA 5J5TA 5M06A 4CCBA 4KIPA 3ORMA 3R8PA 4FSZA 4WBBB 3UNJA 4ACGA 3SLSA 1SNXA 3FHRA 4IB1A 2I0VA 4JDKA 4D4RA 5JFVA 4A9RA 4MNFA 2GHLA 3OG7A 1DM2A 4G16A 3FZTA 4IDTA 2H9VA 4WO5A 4LGHA 3RK7A 4HYIA 3F3VA 3ZO4A 4IJ9A 3DJ6A 4BTKA 5KHXA 3IDBA 4C58A 4AXEA 2YACA 1RQQA 4FSUA 4OAUC 4F7LA 4IC8A 3V5WA 2YM5A 3G6HA 3L8VA 1Q5KA 4XEYA 4WSQA 4FKLA 3QL8A 4YLKA 1U5RA 3ACJA 3QYZA 4X2KA 4O7SA 4M84A 5DFPA 4EH6A 5IG1A 5BYLA 4FGBA 3DTCA 3BE2A 2O0UA 5HO7A 3R1SA 2QOHA 3MDYA 2XZSA 3QTZA 3IS5A 5H9BA 3SRVA 3W0NA 4IWOA 4MF1A 3R7IA 4A9SA 3FLQA 1U54A 1H8FA 1NVRA 3OZ6A 2CDZA 4EONA 4DH8A 4D55A 5IQIA 2JEDA 2OW3A 2Z8CA 4YBKA 4FGRA 2X0QA 4AA0A 3Q53A 3V5PA 3LJ0A 4MNEB 4Z7HA 2CKEA 4K11A 4I5CA 1JLUE 4TNDA 1U54B 4I94A 4QP4A 2W1GA 3V5TA 3F82A 3ZDUA 3ZYAA 2XS0A 3WZJA 3KK8A 1O6LA 5CEMA 4FA2A 3RWQA 3DKFA 2FA2A 3Q52A 1OKYA 3LCTA 4XUFA 4DDIA 1OKWA 3OMVA 4TYHA 3ZONA 4EK3A 3R2BA 3WZEA 2JC6A 1F0QA 2YA9A 3MA6A 4AS0A 4PF4A 3QCXA 2GNGA 3FI3A 4GFGA 4FEWA 3MA3A 3MY5A 3POZA 4AN9A 4D2SA 5D9HA 5KBQA 4C34A 5K3YA 3BHTA 5E8SA 4DGLC 5AR5A 1WMKA 2JBOA 3ZC6A 3P08A 5CYIA 3ZLYA 4V04A 5LVLA 3EWHA 2IZRA 3SDJA 4CMTA 1GIIA 4ACMA 5AADA 5LVOA 2XAMA 3QF9A 3KC3A 3DBDA 3POOA 1ZXEA 5CASA 4O7TA 2QC6A 2FH9A 4J71A 4Y5QA 2P55A 4FV1A 5BQ0A 4GKIA 4M97A 1HCLA 4A9TA 2VNYA 4ENXA 1OUKA 4FTNA 1W84A 4QNAA 4PPCA 4BWPA 2RIOA 2PVHA 5CANA 3Q04A 4AT3A 1OIUA 3LXLA 3R22A 5EW8A 3TUBA 3LE6A 4PWNA 4F78A 3O5AA 4ALWA