5HVKA

Crystal structure of limk1 mutant d460n in complex with full-length cofilin-1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
311
structure length
297
Chain Sequence
GAMGSRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRNLNSHNCLVRENKNVVVADFGLARLMVDPDRKKRYVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords LIM domain kinase 1
publication title Structural Basis for Noncanonical Substrate Recognition of Cofilin/ADF Proteins by LIM Kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 297
sequence length 311
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hvkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hvkA01
3ULZA 1L3RE 2YIWA 3GC9A 3HP5A 3PVBA 1AGWA 2BAJA 5DA3A 4ZY5A 2UZLA 3CSVA 5EW8A 5GINE 2XIYA 3ZEPA 4H1JA 4BHZA 3S00A 2P2IA 4IW0A 4TW9A 3HV3A 3RCJA 4AGDA 3ZCLA 2IZUA 5LMBA 4QMNA 3POOA 2OWBA 3GFWA 3IPHA 3K5VA 3LXNA 4FZ7A 4G31A 4FSQA 4M3QA 4NIFB 4QQTA 3ET7A 4EK6A 4IZ5A 3D4QA 1U46A 4OW8A 3KU2A 5AX9A 4USEA 3GFEA 2OXXA 2G2HA 3EL8A 2J5FA 3LFEA 4FT0A 4YLKA 3VJOA 4ASEA 4DH8A 1ZY4A 4IIRA 3EOCA 4TWCA 4OBQA 5FTOA 3S3IA 1IA9A 1H8FA 2E9PA 5AUWA 4YU2A 1GIIA 3NNUA 4TWOA 5CAQA 1XH4A 3RK5A 5IISA 4IX4A 4K18A 3Q2JA 1IAHA 2WU6A 2VO6A 4WNPA 2IG7A 2HCKA 4ZSJA 4IANA 3LKMA 3CTQA 1IASA 5LCKA 4DFLA 4X6RA 2C47A 3EJ1A 3ZUVA 4ASXA 1GZ8A 4FG7A 5AIKA 4BDDA 3KVWA 5DIAA 4ALVA 3SRVB 1OKWA 5HCXA 3CEKA 4BDGA 1SNUA 5EQPA 3ZOSA 1I09A 3ZBXA 1LEWA 4C4JA 5C8NA 2BFXA 4FSTA 3G5DA 4CXAA 3QXOA 4IAFA 4APCA 5IF1A 2XIRA 4FTJA 4IWDA 4J8NA 5F4NA 1PW2A 2OIQA 4QMUA 2VWBA 2QI8A 5HKMA 2OXYA 4F64A 3ZONA 4DTAA 3L9LA 5HO8A 2R3NA 2ITWA 4I4EA 2ETKA 4RLKA 1OL5A 1OKYA 2GHGA 4Z7GA 5ANJA 3Q6UA 5GJFA 3A7IA 5AFVA 2PMOX 2QQ7A 3MVLA 3A4OX 3CKXA 4G17A 4G3DA 5CEMA 3I7CA 3FHIA 3NNXA 4Z3VA 2ITZA 3F88A 4OBOA 5HNIX 4PDSA 4YMJA 3F3TA 2F7ZE 2GQGA 3DFCB 4KB8A 3VF8A 2J4ZA 3V8TA 3WBLA 3BE2A 3F3ZA 3ZTXA 4R78A 3KXNA 3D7ZA 2A19B 3TUDA 4CFUA 3PFQA 5D41A 4KRDA 3UOLA 4CYIA 3ZZWA 4GYIA 1YOJA 3COKA 2QOOA 3O2MA 4UMTA 4EHZA 3DNDA 2AUHA 4OGRA 4CCUA 4HZSA 3TKUA 3BV2A 2WMTA 4AN3A 3DK3A 4GV1A 4IB1A 4I1ZA 4CFNA 4UZDA 5EOLA 2JDSA 4RJ6A 3GB2A 1JSUA 1ZYDA 2Y0AA 3KA0A 2ERZE 4GL9A 4KA3A 3VUKA 3F3UA 3ORZA 4HNIA 3OOMA 4L67A 5CX9A 3RM6A 4GW8A 4EOQA 4C3PA 2XNEA 4H3QA 4E5AX 2QOCA 4DG2E 2QU5A 2CN5A 5CSHA 4YPSA 3R7VA 2BDWA 4ONAA 2VTTA 5LQFA 4GCJA 3CGFA 3QUPA 4I3ZA 3SHEA 1JLUE 2UW4A 2XK3A 3GU5A 1W83A 4S33A 4ANOA 4AX8A 4J97A 4D4SA 1GZNA 3CP9A 3DQWA 2BRGA 3QD4A 4BCGA 1W8CA 1U54A 1X8BA 2PWLA 2YM3A 5A4QA 4FOBA 3H9FA 5KKRB 2YIQA 4ZXTA 3EH9A 4NIFA 4NM7A 4IAZA 3GU8A 3T3UA 5I9YA 4IAIA 5HIBA 4FKJA 2UZDA 3QTRA 5IQFA 5TT7A 3QQLA 5K5NA 3MVMA 4A7CA 4KBKA 3EQCA 3P79A 5A9UA 3B8QA 3ITZA 3HEGA 4PMSA 3FMDA 1KE9A 2WMBA 2GMXA 3NYXA 4WNMA 1Q3WA 5HGIA 2W05A 2FSMX 4DH5A 4BZDA 4FK6A 4EH5A 4CYJA 3PVGA 4YC3A 4D2VA 4EJNA 3HRCA 4EYJA 3MBLA 3RHKA 2I0HA 2YIRA 2OZOA 4LRKA 3W2QA 4L8MA 4PF4A 2REIA 2QG7A 1ZAOA 4R77A 3HYHA 3OC1A 3QQJA 4NKAA 1PMVA 3R9OA 4QMOA 5ANKA 2XJ2A 4KWPA 3NNWA 5I9XA 4PY1A 3E64A 4E6DA 5JQ8A 4O7RA 2V62A 2WPAA 3BEGA 2PUNA 1YRPA 4LOOA 3DB8A 1YXXA 1W7HA 4OTDA 2WD1A 4ORKA 3FL4A 3VC4A 2VTPA 1PHKA 4MTAA 4D4VA 3R02A 4GFMA 4YTCA 4IC7A 3S1HA 1XH7A 2Y4IB 2PL0A 2Z7LA 2PVLA 3QTZA 3UIBA 5F9EA 4W8EA 2OGVA 4BDJA 5M57A 4AXAA 3ZRLA 3UIMA 3R21A 3I0QA 3LFBA 2OF4A 5JKGA 4PMTA 2CSNA 3KCKA 4CZTA 3FXXA 1IEPA 5E1SA 4NH1A 2VNYA 4CFFA 5TO8A 4HCTA 4JLCA 2BRHA 4O7ZA 4GU9A 2QOFA 4TT7A 3GC7A 5EYKA 5KZIA 1K9AA 4FEXA 2GFSA 2UUEA 3E5AA 5BUJA 1KE8A 3F5XA 4B8MA 4CLJA 2QOLA 2W5HA 2WMSA 4GT4A 4AE6A 3D83A 4F0GA 2WQOA 3CBLA 4LFIA 4C4HA 3DLSA 4YHJA 5GIOE 2XF0A 3E8DA 5L2WA 5LXMA 1GOLA 2OIDA 3ANRA 2RG5A 3OW4A 2WMXA 4ANMA 2ZMCA 3NUSA 3ETAA 4FI1A 3O0GA 5CS6A 3FUPA 4IWPA 5HIDA 1TQPA 3ZSGA 2KTYA 4WIHA 3BGZA 2C6IA 4YHTA 3NUYA 4YC8A 2C1AA 5CT7A 2H8HA 4PDPA 2WHBA 1R78A 2C3LA 4D4RA 4QMTA 2HOGA 5IUHA 5LWNA 4H39A 3BYMA 2WIHA 5AUUA 1SMHA 2O65A 1YWVA 3AC8A 4KS7A 2PK9A 4X7QA 1Q8ZA 3R7IA 4NK9A 5CU4A 2ZVAA 3GOPA 5DE2A 3W1FA 3HV7A 3KULB 1PF8A 5E8TA 3W2RA 4ERKA 4TRLA 3SC1A 3WF9A 4JQ8A 5LVPA 5M4FA 3AG9A 2HY81 3UGCA 2WU7A 5KX8A 2F7EE 3FQEA 2PVNA 3UOKA 2UV2A 2HZ4A 3RCDA 4QQCA 2G01A 3EIDA 3QU0A 3JVRA 4M14A 3OW3A 3ORKA 3DK7A 3PIZA 4JDIA 4Q9ZA 1NVRA 3PPZA 4TY1A 5HD7A 3UG2A 2F2UA 4YTIA 3P1AA 1VEBA 5JFXA 3ORNA 2G1TA 4DEBA 3ZO4A 1CTPE 2CMWA 2JDTA 2Y6OA 2VZ6A 3AMBA 5AAGA 2J51A 4K6ZA 1UWHA 3F2AA 5A4EA 2C1BA 2YCRA 4FA2A 5CAVA 2HENA 3FMJA 3ZLYA 4JBPA 4K9YA 2QONA 4BDCA 4YZ9A 1XBAA 1H07A 4FL3A 4L53A 5FTGA 3LXKA 3TV6A 4GIIA 2OH4A 4KIOA 2CKQA 4H3BA 4GKIA 2VWIA 4CQGA 4BRXA 2BCJA 4LM5A 3OS3A 1DAYA 4FIGA 3REPA 4EHGA 1JBPE 4U6RA 1H0VA 3U54A 3UO5A 3FKOA 1Y6AA 2J0LA 2O64A 4FOCA 3N4TA 2PZ5A 4R1VA 4U7ZA 2C6EA 4NW6A 5I9WA 4I41A 2E9VA 1IRKA 4W9XA 3LOKA 4DLJA 4AN2A 4WRSA 4ZSEA 3VNTA 1QMZA 3A4PA 4QP1A 5J95A 4F1MA 4GK4A 2OZAB 3DAJA 2DUVA 4FGBA 1ZLTA 5AP0A 2BALA 3CJFA 2PVFA 4DEGA 3JR1A 1W98A 4H36A 4FR4A 2WQEA 4EKLA 1JWHA 3ORPA 4A9RA 5CALA 2R0UA 3QHWA 4S31A 3CIKA 1FVRA 4UMUA 2OXDA 3ZO1A 2Q0NA 3MIYA 1BUHA 2BR1A 3WOWA 4OUCA 4IMYA 5M51A 4EK3A 3PWDA 3BZ3A 3KFAA 2IPXA 2YCSA 4U9AA 3PUPA 4GK2A 1G3NA 3QCQA 4FF8A 5G1XA 3DZOA 4WA9A 4OLIA 3T8OA 1SZMA 3W2SA 5CTPA 5E92A 3GGFA 3PVUA 4HJOA 5KKRC 2W96B 4RIXB 5EDPA 4BF2A 3ROCA 4B4LA 4YZNA 2Q0BA 4FV8A 3K5UA 2PPQA 2XK7A 4HPUE 4M12A 5M44A 3PXZA 1U59A 1STCE 3MH3A 4TZRA 4C34A 4ZSGA 3NIZA 4EWHA 3CTHA 4YJTA 2CGXA 2OJGA 3QC9A 2ETRA 3UZRA 3Q4UA 4HYIA 2XUUA 5EM8A 4FVPA 5I9UA 1W0XC 1HCKA 3ORLA 3ZS5A 5HQ0A 3PDTA 2QCSA 4Y83A 3UMXA 1YQJA 5HD4A 2UW0A 4FG9A 4KKHA 3OHTA 1JPAA 5IH6A 5CEQA 3Q4CA 4J95A 4F7SA 1O9UA 2HWPA 3I6WA 3Q9YA 3UVPA 3OBJA 5HNBA 2VTSA 4YBJA 4UZHA 4YURA 5A3XA 3IQ7A 3S2PA 4AG8A 3F6XA 3ZU7A 2PYWA 3RP9A 3NVMB 4FEUA 5FWKK 2BIKB 2R7IA 5FM2A 3NYVA 3PG3A 3G0FA 2F2CB 2VTOA 4G34A 4I5MA 4JIAA 3TV7A 3HLLA 3LCDA 4MKCA 3LQ8A 1YXVA 2WQMA 4O1OA 1Q24A 2XNOA 3OY3A 5HTBA 2O5KA 5HG9A 1XH5A 2JDOA 5F95A 5CF4A 5EHYA 3DBCA 1DM2A 2Y4IC 4RRVA 5CVFA 3VF9A 4JG8A 1WAKA 1JKSA 3Q4TA 3K3JA 5BVWA 4UWCA 4XRJA 4O82A 4C61A 4D2TA 1OIUA 3L8VA 5CSPA 2ZYBA 5T6KA 4B6LA 3OXIA 3W18A 5HVYA 2WMQA 3MFSA 3ZLWA 2GNJA 4BKYA 4DHFA 2J0KA 2KULA 4FTRA 5BNJA 4EI4A 2Y4PA 3ZSHA 4RX9A 3FZSA 4DCEA 2W1DA 5EI2A 5AAFA 4E4XA 1RDQE 3HMNA 4YHFA 3U51A 4C59A 3IGGA 2QOIA 3EQGA 2J0IA 3E88A 4IJPA 4BFMA 4QPSA 5A54A 2OJJA 2W4JA 4M7IA 3V5WA 3FEGA 4CKIA 3FJQE 4RWLA 3WF5A 5IMXA 2V7OA 4IM2A 4F6WA 5BVOA 4BICA 4FK3A 4TNBA 5DT0A 4ZS0A 4Q2AA 4II5A 3KQ7A 5L2IA 2PUPA 3OROA 5BPYA 3BBWA 2AC5A 4W4YA 3WIKA 3A7FA 3OD6X 4U8ZA 3VS6A 3MESA 3C1XA 3H3CA 5ANGA 4FKTA 1CM8A 4UYNA 1Q8TA 5AV3A 1JQHA 1ZYSA 2YM8A 4UMRA 2YEXA 3ZXZA 4Y46A 5GIPE 1IR3A 3FMKA 3MVHA 4NKSA 2FVDA 2J7TA 3OWJA 3UQFA 4DTBA 4RC4A 1H0WA 2XNGA 3AC1A 2RGPA 2WEIA 1REJA 3FBVA 4D1SA 1FINA 3QD0A 3UVRA 4BGQA 5FBOA 5IQIA 1A06A 4MF0A 2WQBA 2RSVA 5E9EA 3GC8A 2CN8A 3UBDA 4EOPA 2OLCA 2VRXA 1YI3A 3E3BX 4P90A 5EI6A 5HBHA 4DFYA 4MWHA 2H6DA 3I1AA 2EVAA 5AADA 3Q6WA 2FSOX 1EH4A 3FQSA 2C6OA 4M66A 4UALA 4V01A 1CKJA 4YZBA 3UP7A 3VS1A 4RWKA 4EHVA 2VO0A 5HU3A 2RG6A 4J1RA 2R3PA 4PL5A 4ALUA 3C4ZA 3C9WA 4PX6A 3Q60A 1OB3A 1JOWB 2EXCX 4E4NA 3GQIA 4I20A 3U87A 1F0QA 4MNFA 4PTEA 4EQCA 2VTQA 4IACA 5IQDA 4NSTA 3LCOA 2JBPA 1YWRA 4NUSA 3IONA 5KMNA 4AAAA 2XNNA 2VTNA 1B39A 3F2NA 4ZTLA 5C03A 5BX0A 3RKBA 3UP2A 2GQSA 1GIJA 5CU6A 4AA4A 3FZRA 5FGKA 3HRBA 2BPMA 5J1VA 2UZNA 5J8IA 3W33A 1KE5A 5LVNA 2J5EA 3I4BA 2WXVA 5AJQA 2P4IA 2VUWA 3I79A 3OUKA 4LGGA 3GVUA 3HVCA 3TIZA 3ODZX 1FMOE 5DR2A 3O8UA 3WARA 1OUKA 4Y95A 3GOKA 1WBWA 3GEQA 4KS8A 5CT0A 1FPUA 2XB7A 1V0PA 1OITA 1ZYJA 5LARA 4D55A 4BIDA 5A4CA 5KMIA 4GK3A 3FLZA 3SG9A 5H3QA 1KE6A 3JS2A 1LP4A 2RL5A 3VQHA 3F7WA 4N6YA 4QMVA 4XP3A 3PPJA 4O0RA 4LQMA 3FXZA 3RALA 4CD0A 4CZUA 4E5BA 5DHJA 4QMPA 4C7TA 4XG7A 4XV1A 4BCFA 4F7NA 4YNEA 2GDOA 3VBVA 3GCUA 3ERKA 3EFLA 3FYKX 1XH9A 3ENHA 5E91A 4F63A 2JFMA 4F9WA 2YERA 4FTOA 5M07A 3Q5ZA 3FZTA 5FUTA 4JOAA 2QO7A 3EQPA 3UZTA 2BIYA 3EFWA 4K0YA 4RC2A 4QMSA 3R28A 5AP2A 3LCTA 4JX3A 5AEPA 2W4KA 3QRKA 2ITNA 4ZJIA 1URCA 3KMUA 1KV1A 3QCSA 2CKOA 3SXFA 3N4VA 3MVJA 4HGTA 2ITPA 3V3VA 4EEVA 5IDNA 1DAWA 2W1CA 4JDJA 3HX4A 1PKGA 4KSQA 1HCLA 2RF9A 4NU1A 3R04A 4MBIA 3R8PA 4DAWA 5AUTA 1Q8UA 4C3FA 3FLNC 5EFQA 5LVLA 5DMZA 1ZYCA 3ZSIA 4XOYA 4BTKA 2OI4X 3EN7A 3R8UA 1URWA 4ZLOA 4TYEA 3V04A 3OCBA 4N4SA 1WMKA 3PIYA 2BDJA 2W1GA 4JQEA 2XBJA 1H27A 3BV3A 2ZM1A 2XZSA 2PTKA 5ANEA 1JKLA 3BLRA 3DDQA 3DB6A 4MBJA 5CI6A 1ATPE 4FYOA 4EH4A 2YISA 4JT3A 2BZJA 4M69B 3PVWA 2JGZA 3ID6C 3LM0A 2VTLA 4QOXA 3BHYA 5C01A 4BDHA 3RVGA 4EZ7A 1FBNA 1YHWA 3LVPA 4AT3A 5IQBA 1BMKA 3R7UA 4FSMA 5FD2A 4MXYA 4UN0C 4DN5A 5G6VA 3ELJA 4JG7A 1M2PA 4TL0A 4BY9E 1I44A 3V51A 1XHAA 1CSNA 4R3CA 2HW7A 4J8MA 2YM6A 3RM7A 2R3LA 3SLSA 2NP8A 4KNBA 1P5EA 2WMWA 2IZTA 3HL7A 3GC0A 2JBOA 4FKSA 3AGLA 3JY9A 3KGAA 4FSUA 3T3VA 2E2BA 4XG6A 4FNXA 4DGGA 2UZOA 4KIQA 1H1SA 3EYGA 5E8UA 5AV2A 3ZRMA 4EOSA 3OFMA 2R3MA 3MFUA 4XV3A 4LL5A 4O84A 3D9VA 5CLPA 5IA2A 4H1MA 2VO3A 3DNEA 3ORXA 5AUYA 2QOHA 2YIXA 5DFPA 4FC0A 4ASDA 2GNFA 3E8EA 3OG7A 4KIKB 4QMLA 2DYLA 3P7BA 1XH8A 2BKZA 5HBEA 4G3FA 4FKQA 3ZDIA 3DJ5A 1OBGA 4Y72A 1J1BA 5CVHA 1QPJA 3P0MA 4DGLC 3QUDA 5EKOA 2BZKB 3C13A 3UIXA 1QCFA 5IQCA 3LJ2A 3MPTA 3VRZA 2IVSA 4TYHB 4E4LA 3Q96A 4QYFA 4DT9A 5H9BA 3FI4A 2V0DA 5C1QB 5J5SA 4ITHA 4RFZA 3BKBA 3FQHA 3F69A 1VJYA 1YOMA 4YJVA 2ZOQA 5IUIA 2V5QA 4QYGA 3V5PA 4DFNA 4D5KA 4G3GA 2B9JA 4IM0A 4FTKA 4IJ9A 3VBYA 4AZSA 1KV2A 2ZV7A 4R7IA 4L6QA 4EORA 5K0XA 4EH8A 4NYEA 3FMLA 2C6DA 2F49A 3UPZA 1M7QA 2YJSA 4O6LA 4F65A 2NNWB 2X7OA 4F9AA 2VTRA 3JUHA 4G5JA 2PVHA 3BWFA 4YZCA 5ITAA 3NRMA 5ANDA 5LOHA 4Y85A 5BVFA 3O17A 1ZMVA 4BI0A 4DTKA 5DT3A 4C8BA 3BHHA 5KUPA 1OL2A 2JEDA 1Y57A 3ZRKA 3R6XA 3QLGA 4RIWB 3L8XA 3DTCA 4TN6A 4CV9A 3MW1A 2ZV9A 3AT3A 5K5XA 5D9HA 4R7HA 4AFEA 1S9IA 5CEKA 3COIA 3U55A 3TV4A 4YR8A 2VO7A 4ZLYA 2R3GA 4YC6A 2Z2WA 5BMMA 3A61A 5HBJA 2IVTA 2WMUA 3QZGA 3R8MA 4PRJA 2C5XA 4FKLA 4IX6A 5DN3A 3FDNA 2C6KA 1SYKA 3JY0A 2RKUA 4HYUA 4UV0A 3TL8A 5CWZA 4C33A 1SVGA 4D2RA 3BEAA 5ACBC 4EH7A 2W1IA 2VWVA 2X2LA 4GG7A 3VBWA 5AM6A 2QR7A 5HCYA 4RLLA 3BU6A 4R7BA 2OJIA 4TYJA 5HI2A 2ZDTA 4M69A 4E93A 1YDTE 2C5NA 3EB0A 4WOVA 4MEDA 4MVFA 4QNAA 4AGWA 3EWHA 5C8MA 3MJ1A 1SM2A 4M67A 2OSCA 4W4WA 1OPLA 4RT7A 4F1OA 4LI5A 5BVDA 2C6MA 1XBBA 4QMYA 4DBXA 2GNLA 3VUTA 4O0YA 4Z55A 1RE8A 2HIWA 2E9UA 4BCNA 3AQVA 3I5NA 4ALWA 5AA9A 5BYYA 4RWJA 3TZ7A 3IW7A 4FKUA 1Q5KA 4EZ5A 3UNKA 3NNVA 1RJBA 5I3OA 3V6RA 5KHWA 1Q62A 4AZWA 3P4KA 4D4YA 1YDRE 2JAVA 1Q4LA 4QP9A 4KUJA 3DA6A 4FV4A 1U5QA 3UQGA 4I6QA 4FSNA 4XRLA 3MWUA 3C5UA 2ZB1A 3BLHA 3FZPA 1PY5A 3EYHA 4KIKA 5HHWA 4ANLA 3QX2A 3ACJA 5B7VA 2XRWA 4NJ3A 3UNJA 3W2PA 4DFZE 5HVKA 4EH3A 4Y5HA 1W82A 4RFYA 2UZVA 4UXQA 4JIKA 3PY3A 2W1ZA 5I5ZA 3C5IA 1Y6BA 2WTVA 1V1KA 2UZWE 4JBVA 4NTTA 4TYHA 1KE7A 3QRJA 3HMIA 5AR3A 4MWIA 3MFRA 4MF1A 4AW2A 4O27B 4U42A 1OZ1A 2LAVA 3UYSA 3WILA 4F1TA 4PP9A 2YZAA 5IU2A 2PZYA 2QR8A 2XRUA 1E9HA 4QP7A 4C2WA 1R39A 2C69A 4GFOA 1JKTA 3LQ5A 4AW5A 2Z7QA 4ZY4A 4UBAA 3TDWA 5KMOA 1GZKA 5A6OA 1YHVA 3BRBA 2PU8A 3E93A 2YA9A 4FTTA 2B9HA 4PL3A 3ZC6A 2YCQA 3BE9A 1RW8A 3LM5A 3ALNA 3QZFA 5HVJA 3VUMA 5GZ9A 2FYSA 4PUZA 3BI6A 4FTAA 4X2JA 2QC6A 4GT5A 2IW8A 1VR2A 3ZXTA 1UWJA 4C0TA 4XMOA 2NO3A 5E4HA 4HNFA 5C27A 2XIKA 4EOMA 2X8EA 2ZB0A 3V8SA 2PULA 4R5SA 3WF7A 3WYYA 4U81A 3QTUA 2PVMA 3VUHA 3WZDA 1ZRZA 4PDYA 2BZIB 5DEYA 3UO6A 2WGJA 4FEWA 4XCUA 4DEEA 4JR3A 1PXJA 4IZ7A 5CY3A 3DS6A 4J98A 4O2PA 1KUTA 2HXQA 2W99B 4HYSA 5IDPA 4EYMA 2JFLA 2JIIA 3O51A 1FOTA 2EWAA 5AV0A 5EYDA 4BDEA 4JG6A 2YLFA 4XOZA 3SRVA 5CSVA 2QLUA 2I0EA 2ZAZA 1LUFA 4QQ5A 4U3ZA 5EDRA 4E73A 5L8KA 4H05A 2IVUA 3KXMA 4LRJA 4MAOA 4K1BA 3RNIA 5T68A 5CQWA 3BQCA 4H3PA 2P33A 1KOAA 2RFDA 4RC3A 3RMFA 3R8ZA 3R7YA 2W17A 1J7IA 3FMMA 3GCSA 1PXLA 4W4VA 2HWOA 4OAVB 3QYWA 1Q99A 1ZWSA 4QD6A 4IH8A 5KCVA 2FSTX 3F66A 3GXLA 2CPKE 2C3JA 1PYXA 1PMEA 2W5BA 3W55A 3EQIA 4B9DA 3QGYA 2YN8A 3TWJA 3C4EA 4ZEGA 3VULA 1T46A 4I6HA 4EWQA 4QYHA 3AXWA 4NL0A 3LFCA 5EQEA 4WHZA 4Y5QA 2ZDUA 3C0IA 3DBFA 3DJ7A 4HCUA 2W0JA 3TZ9A 2R3HA 3SW4A 3Q2MA 4A9SA 2WOTA 3DBQA 2X6DA 5FP5A 4F7LA 4NM5A 4RX8A 4TKSA 4ZY6A 4CRLA 4MQ1A 4FL2A 2X8IA 2UZBA 4OAUC 2IZRA 3KC3A 3EFJA 4GEOA 4P7EA 3L8SA 4A9YA 5HX8A 4KABA 3C4CA 3CLYA 3VQUA 2BVAA 2VX3A 3BHTA 1ZOHA 3UVQA 3BYOA 5A46A 3LCSA 5IG1A 4PDOA 5JEBA 3CE3A 4FSRA 4FKPA 2FSLX 3NVKI 5H8GA 3QUEA 2GNHA 2W1FA 5HICA 3BYVA 2UZUE 5BUIA 2C5YA 2WFYA 1Q3DA 3KXHA 3CQEA 4OTPA 5JFVA 2NRUA 4FV2A 3NDMA 4JDHA 5L6PA 3QRTA 5GNKA 4BTFA 1F5QA 4M97A 4IB5A 2PY3A 4JXFA 4XV9A 3CQWA 4L44A 5BVKA 3VBQA 4BCJA 4XJ0A 3VS2A 4HVIA 4ZMEA 3K3IA 3TI1A 4ZS4A 3ODYX 4L7FA 3BLQA 5FEEA 5I9VA 2IZSA 4E6CA 4RIOA 3QXPA 4MBLA 4XLIA 3U9NA 2BMCA 4ZZOA 5H8EA 2X4FA 3L8PA 4Z9LA 4BIBA 1G8AA 5M09A 2QOKA 3GP0A 3FC2A 4CG9A 5AV4A 3VBTA 2HELA 2WTIA 4OT6A 1WBPA 5CAPA 3M42A 3LFSA 4CKJA 3C4XA 2GNGA 4MK0A 3Q5IA 4U44A 2G9XA 4L3PA 3UTOA 1Q61A 1Q97A 3DQXA 5CI7A 4CMUA 4D1XA 3DKOA 5LWMA 2GSFA 4KBAA 1OI9A 4YSMA 1YWNA 3BYUA 4Q9SA 2BAKA 4D5HA 3DU8A 3BGQA 5K9IA 3ATSA 1ZMWA 3EFKA 3F5PA 3H9OA 4FT9A 4IX3A 5CNNA 3OXTA 4WSYA 2R5TA 3OF0A 2Z7SA 2O0UA 3PSBA 3Q32A 4YLLA 2YDKA 3FMNA 5J7HA 4FICA 3GCQA 4ZLZA 3IGOA 4I4FA 3D0EA 5AUVA 4ZK5A 5E8ZA 4AS0A 3KF7A 5HLNA 3SGCA 4C3RA 1NVQA 3R1NA 3NYNA 4AF3A 3F82A 2YHVA 5ETCA 3NAYA 4NW5A 1NVSA 3MDYA 4GJ2A 4F0FA 2DQ7X 4U45A 5DNRA 5IKWA 3TNQB 3B8RA 3FI3A 4CCBA 3R30A 5HIEA 2V22A 3PA4A 5E8YA 3IECA 4B8LA 3JVSA 4CQEA 3SA0A 3TNIA 3VS0A 4XLVA 3POZA 4BWPA 3K2LA 4E5WA 3C7QA 1OM1A 4M84A 4IVCA 3AGMA 3HECA 3R22A 1U5RA 2QHMA 2XCKA 3FV8A 4BBFA 5CXZA 4R1YA 2JAMA 3AD4A 4NCTC 2QO9A 4W4XA 5IZFA 2HZ0A 2XK8A 2GPHA 4B99A 2UW3A 2Z60A 3NYOA 3ORTA 1F3MC 3QGWA 4FV1A 4I6FA 5IH4A 5M4IA 1H01A 1ZZLA 1OKZA 1T45A 3TDVA 3CC6A 2ITUA 5ICPA 3U6IA 5AP7A 5CASA 2PZPA 2OJFE 3HZTA 3KN6A 3C50A 2JKQA 3BYSA 2BKKA 2PMNX 3QD2B 3HUCA 4RX5A 4DBNA 3BU5A 4FZFB 5JT2A 3MJ2A 3WE4A 3DBDA 4ENYA 3Q52A 5K4JA 1UA2A 4ACDA 2WTWA 2VV9A 2OF2A 3VWAA 2CNUA 4L01A 1LPUA 3TEIA 3OBGA 3F5UA 4EBVA 4YO6A 2QOQA 4EK5A 3VAPA 4OTGA 4RQKA 3R83A 4FZ6A 4RA4A 5HOAA 2WKMA 5I3RA 2IW6A 5H2UA 4EJ7A 3VHEA 5K4IA 4TPTA 2XH5A 2YWVA 3H9RA 3KULA 3MGYA 1FQ1B 4NM3A 4NFNA 2OFVA 1ZZ2A 5AP6A 4KD1A 3TTIA 4QP3A 3NEWA 1AD5A 3RAIA 3RBWA 3TNWA 1YXUA 3DY7A 5J9YA 3SW7A 4JRVA 2J50A 4C4IA 5KMJA 4ZJVA 4BI1A 4XBRA 3LE6A 1J7LA 4BIEA 4FBXA 1W84A 3MB6A 3MH1A 3NUNA 3P9JA 4HPTE 5EK7A 2YM5A 4M8TA 2QLQA 1UKIA 2F57A 3QYZA 4ZTRA 4FKWA 4Y8DA 4LGDA 2QKRA 3V6SA 4F6SA 5HTCA 1CKPA 3P5KA 2YWPA 3DGKA 2LGCA 4PTGA 5HNGA 3VS7A 4C58A 2W1HA 3L9MA 3VUGA 5EW3A 3ZBFA 3HNGA 3QZHA 4S30A 4B0GA 4GG5A 1MQ4A 3CCNA 5CU2A 3RJCA 4FGRA 2OO8X 1YDSE 2C6TA 4X2FA 2O63A 4RA5A 4ZOGA 1VYWA 2WTJA 3QKLA 5GHVA 2FB8A 4FSYA 1GNGA 4IWOA 2QNJA 3DXQA 4WO5A 3AC5A 3EZRA 2BTSA 3GQLA 4G9CA 2BRBA 4J71A 3P7CA 4I5HA 5ANIA 3UZPA 5C26A 2WIPA 3C51A 2XEYA 3IDBA 3D5VA 3ULIA 4TWPA 4XHKB 5EM5A 5ETAA 3TACA 1IG1A 2IN6A 5CAUA 3EN4A 3FY0A 4EBWA 1ZY5A 2QD9A 1TVOA 4D28A 4XS2A 5JSMA 1FVTA 3BHVA 4CMTA 4TWNA 2XKDA 2XA4A 4YJQA 3UJGA 2OZAA 3V5TA 4X3FB 3R9DA 5IQEA 2VWXA 3ANQA 3OTUA 3EMGA 3NGAA 3M1SA 1XBCA 1H24A 5TOZA 3KRXA 1JKKA 4X21A 3RAWA 1P4FA 4EL9A 4CSVA 3T9IA 2PUUA 3FLYA 4UMQA 2BROA 4ZTNA 3CY2A 4UWBA 1UVRA 3NUXA 1L8TA 4CTBA 3HP2A 4IFCA 2YLEA 4F09A 5KMMA 3CKWA 2C0TA 4IADA 2X2MA 5JQ5A 3QQGA 2WEVA 5HE2A 3RZBA 3OOGA 3QA8A 4L46A 5B2LA 4DA5A 3E7VA 3DJ6A 3E8NA 1Y91A 4G5PA 4IHPA 3UODA 4BGGA 3WI6A 5LJJA 2J90A 3GU7A 2XM8A 4IB3A 5L2QA 2VTIA 2UW8A 4U97A 4O0TA 4DFUA 5FLFA 2Q83A 4GMYA 4RIXA 3EQBA 4OTFA 2ETMA 3TKHA 4AU8A 3MA3A 3QZIA 4H58A 4DGNA 5I9ZA 3HMMA 3CD3A 3G9NA 4MXCA 4RJ3A 4QMZA 2UW7A 5CEOA 5JZJA 5L6WL 1V0OA 3MSSA 4L42A 5AV1A 5DWRA 1J3HA 3MH2A 4AOJA 3WIGA 2C68A 4G2FA 3UOHA 3KXXA 4JBQA 3QKMA 2XK6A 4DF3A 4X3JA 5J79A 3D2KA 4D2PA 3F2RA 2Z7RA 3KEXA 4YGAA 3ZM9A 2DWBA 3V5LA 3G6HA 2PE2A 4JR7A 3MA6A 1O6KA 3TJDA 5EM7A 4PNKA 2ACXA 4Q5HA 5DLSA 2Y7JA 5TF9A 4DEAA 5LMKC 1Q8YA 4E20A 4DH1A 5HE3A 2OG8A 2R64A 4JNWA 2SRCA 4DFBA 2E9OA 1TKIA 2PVRA 4FIEA 3OT8A 4QT1A 2RFEA 3RNYA 3ZFYA 4ARKA 1A9UA 4XNEA 4D2SA 2I0YA 1DI9A 2HAKA 2XK4A 3DK6A 4F4PA 2ESMA 3NUAA 3UE4A 3OCSA 2BDFA 2PVKA 4C35A 3HUBA 4QP2A 4R5YA 1UNGA 3COHA 4AUAA 3L9PA 4LOPA 3TZMA 4ZTMA 3C4FA 3VUDA 3CQUA 3ZHPC 5AWMA 4AGUA 3R00A 5CU3A 4L3JA 4FIIA 3JYAA 4LMUA 4FTCA 2Z8CA 3F61A 3O50A 2CCIA 3NUUA 3OXZA 3PP0A 4FIHA 4HVGA 5M06A 3VW8A 4O21A 5BVEA 3TTJA 4BDBA 2BILB 2R3JA 3HGKA 2FA2A 2X7FA 3MTLA 4YJOA 2ONLC 3WZUA 3CY3A 4EQMA 5KBRA 3LMHA 1G5SA 4BKJA 2W9ZB 1R0EA 4AOIA 3D7TB 4IZYA 3VO3A 5A6NA 5EH0A 3P78A 4RIYB 5HG5A 3GU4A 2HK5A 1BX6A 1LEZA 1SVEA 3PXQA 1O6YA 5JRSA 5JZNA 4M13A 1REKA 3QKKA 3F9NA 4YZDA 2QG5A 1H1QA 4IM3A 3DXNA 4M0YA 1M52A 4FTUA 5CEIA 2X9EA 4JVGA 3F7ZA 3G9LX 3R71A 4S34A 4FV5A 2ITYA 3RAKA 3TJCA 4A9UA 3ZMMA 2QVSE 3FAAA 4R8QA 3FPQA 1K2PA 3RK7A 4BGHA 4YLJA 4KIPA 2VGOA 4YZMA 3GI3A 4DG0E 2A2AA 3LLAA 2GTMA 3W32A 4G3CA 4XG4A 4FT7A 5M08A 5CSXA 4YJPA 4KAOA 3NZ0A 2CJMA 4BCOA 4CEGA 3S0OA 5JGBA 4O0VA 3HV5A 4C36A 2PMIA 4CT1A 3TN8A 5DYJA 2UVYA 1MRYA 4RJ4A 4ZJJA 5LCJA 2CGWA 3D5XA 3RPVA 4AN9A 5J9LA 5EYMA 2OW3A 5KMLA 3ZUTA 4MHAA 4LV8A 5IEXA 3SX9A 1BYGA 1ZOGA 4FVQA 4ZIMA 4DH7A 4BDIA 2ITOA 3ZUUA 5JH6A 1XKKA 2A0CX 4LYNA 1M14A 2JKMA 3OCGA 3NCZA 1WBNA 3I0OA 4I0SA 3PJ2A 5DRBA 1K3AA 3TIYA 3KF4A 4A4LA 3UG1A 2PVJA 5I4NA 4PPCA 5L2SA 4YJNA 4O0SA 5E8SA 4OTQA 1UU9A 2CDZA 1OL1A 4GVJA 4J7BA 5EG3A 3OUNB 4QP4A 5AX3A 5TE0A 5L8LA 3B2TA 4C4EA 2XJ1A 4HW7A 4KKGA 1E1VA 2BHEA 3ORIA 4HGLA 3ROYA 3WYXA 3ZC5A 4WBOA 2B55A 2X4ZA 3NWWA 4GKHA 3LMGA 4QYEA 2B9IA 2B0QA 3FC1X 3PXYA 3L9NA 1ERKA 2B53A 1MQBA 4ERWA 3LFQA 3E87A 4WG3A 3HMPA 4YBKA 1OVEA 2P0CA 4OTHA 3HA8A 2GCDA 2R3FA 3QCYA 3FHRA 4C62A 3HAMA 4NEUA 4BCIA 3KL8A 4L3LA 4WT6A 5J7BA 2PMLX 3FKNA 4JBOA 2WB8A 4ZTSA 3MY5A 3COMA 2X1NA 2OH0E 4G3EA 5GJGA 5EW9A 4E3CA 4M15A 3MPAA 4DYMA 5C4KA 2IO6A 3O23A 3VHKA 4EQUA 4TYIA 4G16A 2PE1A 3NW6A 3A2CA 4IDTA 5IA1A 3R1QA 4BDKA 1WCCA 5FRIA 5E7RA 5HU9A 3TCPA 4YTFA 3HV4A 1WVYA 4APPA 3IW4A 3R9NA 5BQ0A 5M53A 4RFMA 4TYGA 3SOCA 3ZM4A 4ZP5A 3TXOA 2C3KA 4O1PA 4F9CA 2WOUA 5AUXA 2R3RA 3KREA 2HXLA 3UNZA 2UZEA 4QNYA 3PJCA 4L00A 3QTIA 4WSQA 5EHOA 2JKKA 4JRNA 4GYGA 2VNWA 2YDIA 2R4BA 3MS9A 2C5VA 4FMQA 3W8QA 4CFMA 4D2WA 5D12A 4RSSA 5LVMA 2XNPA 4O7NA 3QAME 2BAQA 4X3FC 3QHRA 3RPYA 3A7GA 4W8DA 4IWQA 4GVAA 2YIYA 3MV5A 3VVHA 4QQJA 3T9TA 2YZLA 3D7TA 1R0PA 3L1SA 4XG3A 4RVMA 3ZH8A 2FO0A 2PZIA 4CV8A 2CKPA 3CS9A 4RIYA 2JDVA 4I94A 4BVUA 1XJDA 2EB2A 2OJ9A 2EUFB 5EOBA 1RQQA 4AWIA 4L9IA 4BZNA 4FV0A 5AP4A 4EONA 4IEBA 1XH6A 3H0YA 3VN9A 5E8XA 4CGAA 5KBQA 4ZZMA 2VTJA 4O91A 2Y9QA 5D10A 4FSZA 3PZEA 3RZFA 3FLWA 1Q41A 2WTKC 4P4CA 4RX7A 4BCHA 2X8DA 5FXQA 4O81A 4AACA 4ZTHA 4QTCA 2PUIA 4EK4A 3TZ8A 3BBTB 1H00A 4ZSLA 3VIDA 3WZJA 4RJ8A 3R1SA 4FSWA 4U41A 5FEQA 4M0ZA 4MXXA 3ZLXA 4CMOA 5FBNC 1IAJA 3DAKA 2GFCA 5CZHA 5IEVA 5HE1A 3U6JA 5AM7A 4ITIA 4MD8E 3VBXA 4V0GB 1YXSA 5BUEA 4ZMFA 1U54B 2B7AA 3OZ6A 3LW0A 4RG0A 4RQVA 1Y8YA 1ND4A 2W4OA 1ZXEA 3G90X 3THBA 2I7QA 4FYNA 2R3KA 2W06A 3BWJA 5CZIA 3UC4A 2CLXA 3AC4A 5GZ8A 4E7WA 3FY2A 1UV5A 3NAXA 4G6NA 3E8CA 5IQAA 3KXGA 3S4QA 4QYYA 3PLAE 1B38A 3PA5A 3PWYA 4DLIA 4UX9A 3A8XA 2BRNA 2FH9A 4FIFA 1YW2A 3N9XA 2IVVA 1MRUA 4ACHA 2G2FA 3LFDA 4XG9A 4F7JA 4EKKA 3RTPA 5IA3A 1OGUA 2UW5A 4OTRA 5EHLA 5CF6A 5KO1A 3CGOA 4IAKA 1WVWA 2CKEA 3AOXA 3DCVA 3NPCA 3ORMA 5AR7A 2B52A 4FZAB 4U0IA 5AP5A 1JSVA 5M4UA 4IE9A 4FKVA 2WMAA 4F9BA 4B7TA 3LHJA 5CF8A 4FKIA 4GFGA 4QRCA 3RPSA 4K77A 2HZNA 3LZBA 2X39A 3KVXA 3GCPA 4L45A 3UIUA 3U4UA 5AAEA 2C0IA 3DKCA 1B6CB 5FEDA 4BYIA 1NXKA 3SDJA 2F4JA 3LXLA 4K11A 1Z57A 4C57A 5IUGA 4ANQA 5AR2A 5J87A 5IA5A 1IA8A 5DBXA 4E6AA 4WKQA 2XJ0A 2QKWB 4JAJA 3R1YA 3LMIA 2YAKA 1PYEA 3R7GA 4IC8A 4XYFA 2J9MA 2XMYA 3OT3A 5HG7A 5F1ZA 3CTJA 1FGKA 1HOWA 2R2PA 4BWKA 4EOLA 2HY0A 1OL6A 4N70A 1BLXA 2VU3A 3GNIB 2QO2A 3QC4A 1PXOA 2XS0A 3JPVA 5DPVA 3KMMA 5IH5A 3PJ3A 3TT0A 3I7BA 3D14A 3D5UA 2X7GA 3QQHA 4YO4A 3F3WA 5HEZA 3QTQA 4JI9A 4ZSAA 4USFA 5D1JA 4ANSA 4Z7HA 5C8KA 3VS3A 1JAMA 3G33A 3V01A 4EUUA 4I92A 4O6EA 1JVPP 4A06A 4I0RA 3GCVA 4EC8A 5DR6A 3R8VA 2OBJA 4CZYB 4PQNA 5CF5A 1OIYA 4DEHA 4JS8A 2ZMDA 4YPDA 1SNXA 3AD6A 2YCFA 5DT4A 1R3CA 3LCKA 2F7XE 5F94A 5IQHA 2OICA 3H10A 4ANBA 1WFCA 3UPXA 2GS6A 1OECA 3N51A 4RIWA 3O7LD 4KBCA 4PV0A 4F0IA 2BFYA 4EC9A 4O22A 5EI8A 2WTCA 5AIRA 1E1XA 3IO7A 2WELA 2IW9A 3U8WA 3FI8A 3CD8A 4HGSA 2JC6A 4EOIA 2OIBA 2GU8A 4O0WA 3WZKA 1J7UA 4JJRA 4BDFA 3QL8A 2J0MB 3KY2A 4PPAA 4X2KA 3OTVA 4R3PA 5CVGA 4YP8A 3R7OA 5E90A 4V0GA 4WUNA 2XIZA 3QLFA 4C4FA 3PSCA 4MCVA 3W8LA 1M7NA 4XBUA 4BC6A 1H1RA 3II5A 4IB0A 4HVHA 4RBLA 4ZTQA 4U5JA 2RFSA 3FKLA 3R9HA 4LMNA 3O8PA 3W2CA 1YOLA 4I22A 2A1AB 5HLPA 1Z9XA 2JDRA 3GENA 3AC3A 1TQIA 1AQ1A 3CR0A 1KOBA 3MFTA 1J1CA 4BTMA 4QMWA 2ITTA 1M17A 4D58A 4E6QA 4N6ZA 4YJRA 5I0BA 3JXWA 4DINA 1OUYA 3DKFA 3P08A 3QFVA 1VZOA 5DH3A 1Y8GA 5CYIA 5FG8A 2I1MA 4DCAA 3QWJA 1FGIA 4FTNA 3K54A 4F99A 1GZOA 3EN6A 3HV6A 1PXMA 3AMAA 3CXWA 4CFWA 2I40A 5FP6A 3D94A 4WBBB 4RJ5A 4RMZA 3G0EA 3BPRA 3PG1A 4ZAUA 3KXZA 2J0JA 1P2AA 3MIAA 3R2BA 2ZV2A 3TKIA 3QWKA 2RFNA 4ID7A 3QTSA 3ZDUA 4D9TA 2R3QA 3PXKA 4UMPA 3P7AA 5FTQA 3RK9A 2O8YA 2YM4A 4BCPA 4EH6A 4RVLA 4BBEA 4FUXA 5GJDA 3TUCA 4J53A 3TUBA 2B54A 4FV7A 4RJ7A 3MPMA 2XNBA 4S32A 2WMVA 3QA0A 3QRIA 3RAHA 2YITA 2YABA 4IZAA 4K33A 4G6OA 4BR3A 2I6LA 4AW1A 1M2RA 4MH7A 3IW5A 2Y6MA 4USDA 4O7LA 3BELA 2J6MA 4FTMA 2QHNA 5FM3A 1M2QA 2C5OA 1OIRA 4IX5A 4TXCA 2YFXA 3LJ1A 5KMKA 4XG2A 4BYJA 3CPBA 2WNTA 5K0KA 4NCTA 3KK9A 4DGMA 3PLSA 3QX4A 5CNOA 2O2UA 2VWWA 2ZV8A 3LFNA 4NT4A 1GIHA 5J9ZA 4M68A 4OTWA 3NSZA 1YI6A 4D0WA 2VTHA 4NZWB 4RZWA 3NS9A 3EKNA 3KRWA 4U80A 3OMVA 3DV3A 4DEIA 3N4UA 1ZMUA 4IVAA 4FKOA 3OWKA 1BI8A 2P55A 1PXIA 4FV3A 4XP2A 4AOTA 3KRJA 5IA4A 2X6EA 3FMEA 5J5TA 3QQUA 3FSKA 4DT8A 5B2KA 3SD0A 2YM7A 4O38A 4PWNA 4S2ZA 4AT4A 4IAYA 5L6OA 4I93A 3KRRA 2QU6A 4AZVA 4AZFA 4UB7A 2QODA 3RI1A 4WRGA 3ATTA 1PXPA 4FKRA 2XVDA 4E8AA 4MD7E 2YAAA 2FGIA 3ZFXA 5IMEA 5HX6A 4O7SA 3QTWA 4D9UA 2WZJA 5EDQA 4V04A 3QBNA 5L3AA 2OK1A 1H4LA 1H28A 5FQDC 4TNDA 4WG5A 4FV6A 3Q9WA 4A07A 4N57A 3EN5A 4CG8A 3NR9A 4FG8A 4AQCA 3UDBA 2PSQA 4OTIA 5H8BA 4DITA 1DS5A 2GHMA 1TQMA 4RZVA 3QF9A 4G9RA 3RWPA 1A48A 5C4LA 3S95A 1H1PA 3IOPA 2XKCA 4PTCA 4DE4A 3OEFX 1DI8A 5HLWA 2A27A 5M56A 4EK8A 4U43A 2Z02A 4FX3A 2R3IA 2VAGA 1NY3A 4QTDA 2XIXA 3FL5A 4MX9A 4X2GA 4X0MA 3HDMA 2C0OA 3UMWA 2XYUA 4OR5A 5E8VA 4C38A 3LJ0A 4YNOA 4F6UA 2V55A 3EQRA 3GT8A 4HZRA 2H9VA 4PL4A 1Z5MA 4AE9A 4GIHA 4GRBA 2IWIA 1XR1A 4PP7A 2OKRA 3HKOA 5DI1A 4FEQA 3HMOA 2JKOA 3ALOA 3WF6A 3W2OA 3R73A 1MRVA 3RWQA 4NM0A 4ZZNA 1CDKA 4QO9A 3AT2A 2WTDA 3RINA 1YXTA 3C0GA 3LXPA 2VX1A 3HRFA 4J99A 3D5WA 5AP1A 5EQYA 1PXNA 4GU6A 4XUFA 4C37A 1H25A 2YACA 3DKGA 3OWPA 2BHHA 3NMUF 4BL1A 2PHKA 4GS6A 2WQNA 4FUYA 3NCGA 4O83A 3E62A 2R3OA 5IPJA 4A4OA 3O7LB 2XKFA 1OPKA 4EOOA 4NFMA 3ZEWA 4ENXA 4NJDA 5HG8A 4FT5A 1OL7A 5IEYA 2J2IB 3DOGA 3MH0A 2OFUA 4DC2A 1PXKA 4HVSA 5DEWA 5EM6A 1KWPA 4EHEA 2AC3A 3CJGA 2UW9A 5EYCA 5B2MA 1OPJA 4LRMA 3PPKA 4LOQA 2B4SB 3ZLSA 3TM0A 2ITXA 2XNMA 4RPVA 4E26A 3BGPA 2HW6A 3BCEA 4A9TA 2IJMA 3O96A 3W10A 4BCMA 4BTJA 5M4CA 2GTNA 4P5ZA 1UU3A 3PY1A 4I0TA 2CCHA 4KRCA 3O8TA 3TG1A 4CT2A 4L43A 5AUZA 1JNKA 2XCHA 4L52A 1MUOA 1UKHA 4DEDA 4J52A 3PIXA 5AMNA 4CRSA 5ETFA 5A4TA 3D2IA 5ANOA 4GSBA 4O7YA 3A60A 4L68A 3TNHA 4P2KA 3H30A 2FUMA 4CTCA 4AA0A 4BCQA 1UU8A 4IFGA 4LG4A 5BVNA 2F9GA 3WZEA 4Z16A 3HA6A 1R1WA 5AA8A 2C30A 4K8AA 5KNJA 4D0XA 5KE0A 1WBVA 3SAYA 3G15A 4WD5A 5IQGA 1UNHA 2ZM4A 3SG8A 1G8SA 4O2ZA 2GS7A 3ZYAA 5CEPA 2JLDA 3DZQA 3E63A 5DVRA 4CFXA 4AGCA 3LAUA 4LV5A 2P2HA 3MN3A 3OCTA 3PY0A 4KKEA 4KINA 5B0XA 4YUQA 2R9SA 4WG4A 1CMKE 2XP2A 4ANNA 2VD5A 1FMKA 3UO4A 4C2VA 1WBTA 4QTAA 3V8WA 4BKZA 4FNYA 3FLSA 3LLTA 5CENA 3SVVA 1H1WA 2UW6A 3KK8A 4MNEB 5T3QA 4AZTA 5JFSA 3IW8A 3KMWA 2X2KA 3MY0A 2CGVA 3FZOA 4ASZA 4GH2A 4QTBA 2ZJWA 3PJ8A 3VUIA 4CNHA 4LUDA 3EHAA 3EQFA 4XX9A 3ENMA 5JMSA 5LMKA 1OIQA 2EXMA 4MXOA 2EXEA 4CFVA 5D11A 3NW7A 4OBPA 2XBAA 2A4LA 3PE2A 4JQ7A 4AW0A 3BU3A 3Q3BA 4RVKA 3BIZA 3FWQA 2V7AA 3G51A 3SKCA 4QP6A 3FPMA 4IBMA 4FTQA 4BWXA 3KCFA 3UQCA 3W16A 4IQ6A 5M55A 1OBDA 5FXSA 2XYNA 3PXFA 4IVBA 3B2WA 3VJNA 4DGOA 5IA0A 2XEZA 5HORA 3ZO2A 3AT4A 3EKKA 5FXRA 2OU7A 3QTXA 4QP8A 5LMAA 4AA5A 4O7TA 4EH9A 1BL6A 4FVRA 3DAEA 3NX8A 5DGZA 2C3IB 3G6GA 3VRYA 3PRFA 3IDPA 1GAGA 3LFFA 2VTAA 3CPCA 3FI2A 4YSJA 3I5ZA 3M2WA 2ONLA 4FV9A 3E3PA 3KB7A 3RHXA 3SOAA 2XK9A 3WE8A 3DXPA 3UC3A 2H34A 1H08A 1XO2B 4XG8A 4CLIA 4FNWA 3QRUA 4YJUA 3OY1A 2G2IA 2W1EA 4R3RA 4C4GA 5BYZA 1V0BA 3SXRA 3MY1A 4EOJA 2NRYA 2W5AA 3KKVA 4I24A 1BL7A 4J96A 4QMQA 2BUJA 4JL9A 4DH3A 2JITA 4ACCA 1PJKA 5JN2A 2JIUA 3A7HA 2WTKB 1PMUA 2CNVA 4Y73A 2YDJA 4AFJA 1WVXA 1GJOA 4UEUA 3IS5A 5CSWA 2R7BA 2X9FA 3I6UA 2DS1A 3PE1A 3R2YA 4MXAA 2RIOA 1BKXA 3V5QA 3DFAA 3PXRA 4BB4A 3BQRA 4BN1A 2PZRA 5CXHA 3PTGA 1ZYLA 3BX5A 4CKRA 3H0ZA 1PRYA 4RWIA 5JRQA 5J1WA 1GY3A 3ZFMA 4QTEA 1S9JA 4PNIA 4MQ2A 1PKDA 2VWUA 3LPBA 4DG3E 2QOBA 5E1EA 3LQ3A 3DLZA 1XQZA 4PMPA 2AYPA 3EN9A 3O71A 3U9CA 3E92A 5JK3A 4FE2A 3MI9A 1XWSA 2XM9A 2WAJA 3FE3A 5CQUA 3SXSA 4FT3A 4O0UA 4EOKA 3IG7A 3GBZA 5HTIA 3C0HA 5ACKA 5L2TA 3KRLA 4KSPA 4L7SA 2YJRA 5A14A 5CANA 3P23A 5HO6A 1H26A 3NUPA 2P3GX 4QMMA 3R8LA 2JD5A 3Q9ZA 1BI7A 4MNEA 1ZOEA 3IOKA 2VN9A 4IDVA 1OMWA 3DDPA 3RPOA 3RGFA 4ACGA 2C6LA 2BZHB 3GU6A 4R6VA 3ACKA 3EL7A 2QURA 1WBOA 4RVTA 5TR6A 3U4WA 3VW6A 3EZVA 2W9FB 2VX0A 3A8WA 4WUAA 3E7OA 1ZARA 3PZHA 3PA3A 4HYHA 5EKNA 3PSDA 2ITQA 4QPAA 4QMXA 3EQDA 4UWYA 4I5PA 4G1WA 3OP5A 1QPCA 4CVAA 4YJSA 1NW1A 1WZYA 3MYGA 3P86A 3QQKA 3SQQA 4ACMA 3AC2A 1NT2A 1P14A 1SVHA 3RPRA 1QPDA 3FLQA 5AR8A 5JGDA 1JSTA 3R63A 2C4GA 3DBEA 4FNZA 3QCXA 2UVZA 3A99A 2X81A 2W7XA 4HGEA 3FYJX 3V5JA 4BZOA 3VS5A 4HOKA 1CKIA 1UU7A 5TKDA 4NTSA 3SV0A 5BMSA 4X3FA 2NPQA 3VS4A 5AP3A 2BRMA 1O6LA 1YVJA 4XP0A 3A7JA 2H96A 4DFXE 1VYZA 5HO7A 4LL0A 4EZ3A 1KSWA 3FSFA 4XV2A 3PYYA 3I60A 4O86A 4RGJA 3F5GA 3PRIA 4EH2A 3OVVA 3Q4ZA 4JAIA 4C02A 3EQHA 3DTWA 4IVDA 2WMRA 4X6QC 2O3PA 5GZAA 5D7AA 3A62A 1NA7A 2WO6A 5K3YA 2HYYA 4BCKA 3AD5A 5KZ0A 4GUEA 3PP1A 4BBMA 3M11A 2HZIA 3MB7A 3FXWA 4BHNA 2GNIA 5HCZA 2I0VA 4MYGA 2B1PA 5DG5A 5KHXA 2VTMA 4P5QA 1WBSA 2R0IA 5L8JA 5AR4A 1P4OA 3Q53A 4GT3A 1PMNA 4N0SA 4UXLA 3ZO3A 1UNLA 2VWZA 4U79A 4O7VA 4JX7A 4FTLA 5DRDA 1QL6A 2VWYA 5F20A 4FTIA 4FKGA 3NIEA 3IKAA 2X0GA 4LGHA 5CAOA 4TTHB 4I21A 2PE0A 5HESA 4HVDA 3IK3A 3QD3A 4FODA 2EU9A 3U6HA 3WF8A 3LFAA 5CU0A 3UOJA 3MTFA 4AZEA 3NW5A 3Q04A 4HCVA 4F9YA 4BI2A 3R9RA 4WNOA 1MP8A 2CNQA 4FIJA 3C4WA 2UZTA 3AMYA 3GUBA 3IW6A 4QPMA 1FVVA 3R7EA 4UYAA 5BYLA 4MXZA 1J91A 5E8WA 4F70A 3BHUA 3FZ1A 3I81A 4EUTA 4I23A 3Q9XA 4K2RA 1LR4A 2Y8OA 3D15A 4ITJA 4LUEA 2GS2A 4PMMA 4U40A 4AT5A 1OKVA 3F3VA 3G2FA 3R01A 3OWLA 4FZDB 4GJ3A 1QPEA 4XEYA 2UVXA 4UY9A 4E1ZA 1APME 5HE0A 3LIJA 2GQRA 2ITVA 2CHLA 1Q8WA 4I6BA 3KN5A 3DT1A 5AR5A 3QQFA 4WNKA 5ETIA 3ZZEA 5JGAA 3HAVA 4NWMA 4G6LA 4O7WA 2B9FA 4IXPA 3PJ1A 4OT5A 4MD9E 2E9NA 4F08A 4O0XA 5C9CA 2JIVA 5LVOA 5DR9A 4E4MA 5HZNA 4YTHA 3H4JA 3FMHA 2ZM3A 2PVYA 4BDAA 4U3YA 4XH6A 1U4DA 5DOSA 2XKEA 5FDPA 4FL1A 4JDKA 3QALE 4Q5EA 4FEVA 5D7VA 3R0TA 2G15A 4W9WA 5A4LA 5L4QA 4I5CA 4D1ZA 2BTRA 1YI4A 2ERKA 2VGPA 4A4XA 3OEZA 2EB3A 4O96A 3NLBA 4PPBA 3HDNA 4GUBA 1YKRA 4X2NA 3IDCA 4V05A 5JFWA 2CLQA 4IAAA 2CGUA 2GHLA 3UYTA 3DPKA 1YHSA 5FDXA 3TNPC 4AP7A
chains in the Genus database with same CATH superfamily
3ULZA 1L3RE 2YIWA 3GC9A 3HP5A 3PVBA 1AGWA 2BAJA 5DA3A 4ZY5A 2UZLA 3CSVA 5EW8A 4AXFA 5GINE 2XIYA 3ZEPA 4H1JA 4BHZA 3S00A 3BL7A 2P2IA 4IW0A 4TW9A 3HV3A 3RCJA 4AGDA 3ZCLA 2IZUA 5LMBA 4QMNA 3POOA 2OWBA 3GFWA 3IPHA 3K5VA 3LXNA 4FZ7A 4G31A 4FSQA 4M3QA 4NIFB 4QQTA 3ET7A 4EK6A 4IZ5A 3D4QA 1U46A 4OW8A 3KU2A 5AX9A 4USEA 3GFEA 2OXXA 2G2HA 3EL8A 2J5FA 3LFEA 4FT0A 4YLKA 3VJOA 4ASEA 4DH8A 1ZY4A 4IIRA 3EOCA 4TWCA 4OBQA 5FTOA 3S3IA 1IA9A 1H8FA 2E9PA 5AUWA 4YU2A 1GIIA 3NNUA 4TWOA 5CAQA 1XH4A 3RK5A 5IISA 4IX4A 4K18A 3Q2JA 1IAHA 2WU6A 3UDZA 2VO6A 4WNPA 2IG7A 2HCKA 4ZSJA 4IANA 3LKMA 3CTQA 1IASA 5LCKA 4DFLA 4X6RA 2C47A 3EJ1A 3ZUVA 4ASXA 1GZ8A 4FG7A 5AIKA 4BDDA 3KVWA 5DIAA 4ALVA 3SRVB 1OKWA 5HCXA 3CEKA 4BDGA 1SNUA 5EQPA 3ZOSA 1I09A 3ZBXA 1LEWA 4C4JA 5C8NA 2BFXA 4FSTA 3G5DA 4CXAA 3QXOA 1TZDA 4IAFA 4APCA 5IF1A 2XIRA 4FTJA 4IWDA 4J8NA 5F4NA 1PW2A 2OIQA 4QMUA 2VWBA 2QI8A 5HKMA 2OXYA 4F64A 3ZONA 2XANA 4DTAA 3L9LA 5HO8A 2R3NA 2ITWA 4I4EA 2ETKA 4RLKA 1OL5A 1OKYA 2GHGA 4Z7GA 5ANJA 3Q6UA 5GJFA 3A7IA 5AFVA 2PMOX 2QQ7A 3MVLA 3BLAA 3A4OX 3CKXA 4G17A 4G3DA 5CEMA 3I7CA 3FHIA 3NNXA 4Z3VA 2ITZA 3F88A 4OBOA 5HNIX 4PDSA 4YMJA 3F3TA 2F7ZE 2GQGA 3DFCB 4KB8A 3VF8A 2J4ZA 3V8TA 3WBLA 3BE2A 3F3ZA 3ZTXA 4R78A 3KXNA 3D7ZA 2A19B 3TUDA 4CFUA 3PFQA 5D41A 4KRDA 3UOLA 4CYIA 3ZZWA 4GYIA 1YOJA 3COKA 2QOOA 3O2MA 4UMTA 4EHZA 3DNDA 2AUHA 4OGRA 4CCUA 4HZSA 3TKUA 3BV2A 2WMTA 4AN3A 3DK3A 4GV1A 4IB1A 4I1ZA 4CFNA 4UZDA 5EOLA 2JDSA 4RJ6A 3GB2A 1JSUA 1ZYDA 2Y0AA 3KA0A 2ERZE 4GL9A 4KA3A 3VUKA 3F3UA 3ORZA 4HNIA 3OOMA 4L67A 5CX9A 3RM6A 4GW8A 3KIOC 4EOQA 4C3PA 2XNEA 4H3QA 4E5AX 2QOCA 4DG2E 2QU5A 2CN5A 5CSHA 4YPSA 3R7VA 2BDWA 4ONAA 2VTTA 5LQFA 4GCJA 3CGFA 3QUPA 4I3ZA 3SHEA 1JLUE 2UW4A 2XK3A 3GU5A 1W83A 4S33A 4ANOA 4AX8A 4J97A 4D4SA 1GZNA 3CP9A 3DQWA 2BRGA 3QD4A 4BCGA 1W8CA 1U54A 1X8BA 2PWLA 2YM3A 5A4QA 4FOBA 3H9FA 5KKRB 2YIQA 4ZXTA 3EH9A 4NIFA 4NM7A 4IAZA 3GU8A 3T3UA 5I9YA 4IAIA 5HIBA 4FKJA 2UZDA 3QTRA 5IQFA 5TT7A 3QQLA 5K5NA 3MVMA 4A7CA 4KBKA 3EQCA 3P79A 5A9UA 3B8QA 3ITZA 3HEGA 4PMSA 3FMDA 1KE9A 2WMBA 2GMXA 3NYXA 4WNMA 1Q3WA 5HGIA 2W05A 2FSMX 4DH5A 4BZDA 4FK6A 4EH5A 4CYJA 3PVGA 4YC3A 4D2VA 4EJNA 3HRCA 4EYJA 3MBLA 3RHKA 2I0HA 2YIRA 2OZOA 4LRKA 3W2QA 4L8MA 4PF4A 2REIA 2QG7A 1ZAOA 4R77A 3HYHA 3OC1A 3QQJA 4NKAA 1PMVA 3R9OA 4QMOA 5ANKA 2XJ2A 4KWPA 3NNWA 5I9XA 4PY1A 3E64A 4E6DA 5JQ8A 4O7RA 2V62A 2WPAA 3BEGA 2PUNA 1YRPA 4LOOA 3DB8A 1YXXA 1W7HA 4OTDA 2WD1A 4ORKA 3FL4A 3VC4A 2VTPA 1PHKA 4MTAA 4D4VA 3R02A 4GFMA 4YTCA 4DHIB 2X0PA 4IC7A 1XH7A 2Y4IB 2PL0A 3S1HA 2Z7LA 2PVLA 3QTZA 3UIBA 5F9EA 4W8EA 2OGVA 4BDJA 5M57A 4AXAA 3ZRLA 3UIMA 3R21A 3I0QA 3LFBA 2OF4A 5JKGA 4PMTA 2CSNA 3KCKA 4CZTA 3FXXA 2X0QA 1IEPA 5E1SA 4NH1A 2VNYA 4CFFA 5TO8A 4HCTA 4JLCA 2BRHA 4O7ZA 4GU9A 2QOFA 4TT7A 3GC7A 5EYKA 5KZIA 1K9AA 4FEXA 2GFSA 2UUEA 3E5AA 5BUJA 1KE8A 3F5XA 4B8MA 4CLJA 2QOLA 2W5HA 2WMSA 4GT4A 4AE6A 3D83A 4F0GA 2WQOA 3CBLA 4LFIA 4C4HA 3DLSA 4YHJA 5GIOE 2XF0A 3E8DA 5L2WA 5LXMA 1GOLA 2OIDA 3ANRA 2RG5A 3OW4A 2WMXA 4ANMA 3AKLA 2ZMCA 3NUSA 3ETAA 4FI1A 3O0GA 5CS6A 3FUPA 4IWPA 5HIDA 1TQPA 3ZSGA 2KTYA 4WIHA 3BGZA 2C6IA 4YHTA 3NUYA 4YC8A 2C1AA 5CT7A 2H8HA 4PDPA 2WHBA 1R78A 2C3LA 4D4RA 4QMTA 2HOGA 5IUHA 5LWNA 4H39A 3BYMA 2WIHA 5AUUA 1SMHA 2O65A 1YWVA 3AC8A 4KS7A 2PK9A 4X7QA 1Q8ZA 3R7IA 4NK9A 5CU4A 2ZVAA 3GOPA 5DE2A 3W1FA 1W2CA 3HV7A 3KULB 1PF8A 5E8TA 3W2RA 4ERKA 4TRLA 3SC1A 3WF9A 4JQ8A 5LVPA 5M4FA 3AG9A 2HY81 3UGCA 3W0PA 2WU7A 5KX8A 2F7EE 3FQEA 2PVNA 3UOKA 2UV2A 2HZ4A 3RCDA 4QQCA 2G01A 3EIDA 3QU0A 3JVRA 4M14A 3OW3A 3ORKA 3DK7A 3PIZA 4JDIA 4Q9ZA 1NVRA 3PPZA 4TY1A 5HD7A 3UG2A 2F2UA 4YTIA 3P1AA 1VEBA 5JFXA 3ORNA 2G1TA 2AEGA 4DEBA 3ZO4A 1CTPE 2CMWA 2JDTA 2Y6OA 2VZ6A 3AMBA 5AAGA 2J51A 4K6ZA 1UWHA 3F2AA 5A4EA 2C1BA 2YCRA 4FA2A 5CAVA 2HENA 3FMJA 3ZLYA 4JBPA 4K9YA 2QONA 4BDCA 4YZ9A 1XBAA 1H07A 4FL3A 4L53A 5FTGA 3LXKA 3TV6A 4GIIA 2OH4A 4KIOA 2CKQA 4H3BA 4GKIA 2VWIA 4CQGA 4BRXA 2BCJA 4LM5A 3OS3A 1DAYA 4FIGA 3REPA 4EHGA 1JBPE 4U6RA 1H0VA 3U54A 3UO5A 3FKOA 1Y6AA 2J0LA 2O64A 4ZMEA 4FOCA 3N4TA 2PZ5A 4R1VA 4U7ZA 2C6EA 4NW6A 5I9WA 4I41A 2E9VA 1IRKA 4W9XA 3LOKA 4DLJA 4AN2A 4WRSA 4ZSEA 3VNTA 1QMZA 3A4PA 4QP1A 5J95A 4F1MA 4GK4A 2OZAB 3DAJA 2DUVA 4FGBA 1ZLTA 5AP0A 2BALA 3CJFA 2PVFA 4DEGA 3JR1A 1W98A 4H36A 4FR4A 2WQEA 4EKLA 1JWHA 3ORPA 4A9RA 5CALA 2R0UA 3QHWA 4S31A 3CIKA 1FVRA 4UMUA 2OXDA 3ZO1A 2Q0NA 3MIYA 1BUHA 2BR1A 3WOWA 4OUCA 4IMYA 5M51A 4EK3A 3PWDA 3BZ3A 3KFAA 2IPXA 2YCSA 4U9AA 3PUPA 4GK2A 1G3NA 3QCQA 4FF8A 5G1XA 3DZOA 4WA9A 4OLIA 3T8OA 1SZMA 3W2SA 5CTPA 5E92A 3GGFA 3PVUA 4HJOA 5KKRC 2W96B 4RIXB 5EDPA 4BF2A 3ROCA 4B4LA 4YZNA 2Q0BA 4FV8A 3K5UA 2PPQA 2XK7A 4HPUE 4M12A 5M44A 3PXZA 1U59A 1STCE 3MH3A 4TZRA 4AAYA 4C34A 4ZSGA 3NIZA 4EWHA 3CTHA 4YJTA 2CGXA 2OJGA 3QC9A 2ETRA 3UZRA 3Q4UA 4HYIA 2XUUA 5EM8A 4FVPA 5I9UA 1W0XC 1HCKA 3ORLA 3ZS5A 5HQ0A 3AKJA 2QCSA 3PDTA 4Y83A 3UMXA 1YQJA 5HD4A 2UW0A 4FG9A 4KKHA 3OHTA 1JPAA 5IH6A 5CEQA 3Q4CA 4J95A 4F7SA 1O9UA 2HWPA 3I6WA 3Q9YA 3UVPA 3OBJA 5HNBA 2VTSA 4YBJA 4UZHA 4YURA 5A3XA 3IQ7A 3S2PA 4AG8A 3F6XA 3ZU7A 2PYWA 3RP9A 3NVMB 4FEUA 5FWKK 2BIKB 2R7IA 5FM2A 3NYVA 3PG3A 3G0FA 2F2CB 2VTOA 4G34A 4I5MA 4JIAA 3TV7A 3HLLA 3LCDA 4MKCA 3LQ8A 1YXVA 2WQMA 4O1OA 1Q24A 2XNOA 3OY3A 5HTBA 2O5KA 5HG9A 1XH5A 2JDOA 5F95A 5CF4A 5EHYA 3DBCA 1DM2A 2Y4IC 4RRVA 5CVFA 3VF9A 4JG8A 1WAKA 1JKSA 3Q4TA 3K3JA 5BVWA 4UWCA 4XRJA 4O82A 4C61A 4D2TA 1OIUA 3L8VA 5CSPA 2ZYBA 5T6KA 4B6LA 3OXIA 3W18A 5HVYA 2WMQA 3MFSA 3ZLWA 2GNJA 4BKYA 4DHFA 2J0KA 2KULA 4FTRA 5BNJA 4EI4A 2Y4PA 3ZSHA 4RX9A 3FZSA 4DCEA 2W1DA 5EI2A 5AAFA 4E4XA 1RDQE 3HMNA 4YHFA 3U51A 4C59A 3IGGA 2QOIA 3EQGA 2J0IA 3E88A 4IJPA 4BFMA 4QPSA 5A54A 2OJJA 2W4JA 4M7IA 3V5WA 3FEGA 4CKIA 3FJQE 4RWLA 3WF5A 5IMXA 2V7OA 4IM2A 4F6WA 5BVOA 4BICA 4FK3A 4TNBA 5DT0A 4ZS0A 4Q2AA 4II5A 3KQ7A 5L2IA 2PUPA 3OROA 5BPYA 3BBWA 2AC5A 4W4YA 3WIKA 3A7FA 3OD6X 4U8ZA 1TFFA 3VS6A 3MESA 3C1XA 3H3CA 5ANGA 4FKTA 3ML1A 1CM8A 4UYNA 1Q8TA 5AV3A 1JQHA 1ZYSA 2YM8A 4UMRA 2YEXA 2A98A 4Y46A 3ZXZA 5GIPE 1IR3A 3FMKA 3MVHA 4NKSA 2FVDA 2J7TA 3OWJA 3UQFA 4DTBA 4RC4A 1H0WA 2XNGA 3AC1A 2RGPA 4BJJA 2WEIA 1REJA 3FBVA 4D1SA 1FINA 3QD0A 3UVRA 3VS1A 5FBOA 4BGQA 5IQIA 1A06A 4MF0A 2WQBA 2RSVA 5E9EA 3GC8A 2CN8A 3UBDA 4EOPA 2OLCA 2VRXA 1YI3A 3E3BX 4P90A 5EI6A 5HBHA 4DFYA 4MWHA 2H6DA 3I1AA 2EVAA 5AADA 3Q6WA 2FSOX 1EH4A 2X0OA 2C6OA 3FQSA 4M66A 4UALA 1CKJA 4V01A 4YZBA 3UP7A 4RWKA 4EHVA 2VO0A 5HU3A 2RG6A 4J1RA 2R3PA 4PL5A 4ALUA 3C4ZA 3C9WA 4PX6A 3Q60A 1OB3A 1JOWB 2EXCX 4E4NA 3GQIA 4I20A 3U87A 1F0QA 4MNFA 4PTEA 4EQCA 2VTQA 4IACA 5IQDA 4NSTA 3LCOA 2AQXA 2JBPA 1YWRA 4NUSA 3IONA 5KMNA 4AAAA 2XNNA 2VTNA 1B39A 3F2NA 4ZTLA 5C03A 5BX0A 3RKBA 3UP2A 2GQSA 1GIJA 5CU6A 4AA4A 3FZRA 5FGKA 3HRBA 2BPMA 5J1VA 2UZNA 5J8IA 3W33A 1KE5A 5LVNA 2J5EA 3I4BA 2WXVA 5AJQA 2P4IA 2VUWA 3I79A 3OUKA 4LGGA 3GVUA 3HVCA 3TIZA 3ODZX 1FMOE 5DR2A 3O8UA 3WARA 1OUKA 4Y95A 3GOKA 1WBWA 3GEQA 4KS8A 5CT0A 1FPUA 2XB7A 1V0PA 1OITA 1ZYJA 5LARA 4D55A 4BIDA 5A4CA 5KMIA 4GK3A 3FLZA 3SG9A 5H3QA 1KE6A 3JS2A 1LP4A 2RL5A 3VQHA 3F7WA 4N6YA 4QMVA 4XP3A 3PPJA 4O0RA 4LQMA 3FXZA 3RALA 4CD0A 4CZUA 4E5BA 5DHJA 4QMPA 4C7TA 4XG7A 4XV1A 4BCFA 4F7NA 4YNEA 2GDOA 3VBVA 3GCUA 3ERKA 3EFLA 3FYKX 1XH9A 3ENHA 5E91A 4F63A 2JFMA 4F9WA 2YERA 4FTOA 5M07A 3Q5ZA 3FZTA 5FUTA 4JOAA 2QO7A 3EQPA 3UZTA 2BIYA 3EFWA 4K0YA 4RC2A 4QMSA 3R28A 5AP2A 3LCTA 4JX3A 5AEPA 3UDTA 2W4KA 3QRKA 2ITNA 4ZJIA 1URCA 3KMUA 1KV1A 3QCSA 2CKOA 3SXFA 3N4VA 3MVJA 4HGTA 2ITPA 3V3VA 4EEVA 5IDNA 4DHJA 1DAWA 2W1CA 4JDJA 3HX4A 1PKGA 4KSQA 1HCLA 2RF9A 4NU1A 3R04A 4MBIA 3R8PA 4DAWA 5AUTA 1Q8UA 4C3FA 3FLNC 5EFQA 5LVLA 5DMZA 1ZYCA 3ZSIA 4XOYA 4BTKA 2OI4X 3EN7A 3R8UA 1URWA 4ZLOA 4TYEA 3V04A 3OCBA 4N4SA 1WMKA 3PIYA 2BDJA 2W1GA 4JQEA 2XBJA 1H27A 3BV3A 2ZM1A 2XZSA 2PTKA 5ANEA 1JKLA 3BLRA 3DDQA 3DB6A 4MBJA 5CI6A 1ATPE 4FYOA 4EH4A 2YISA 4JT3A 2BZJA 4M69B 3PVWA 2JGZA 3ID6C 3LM0A 2VTLA 4QOXA 3BHYA 5C01A 4BDHA 3RVGA 4EZ7A 1FBNA 1YHWA 3LVPA 4AT3A 5IQBA 1BMKA 3R7UA 4FSMA 5FD2A 4MXYA 4UN0C 4DN5A 5G6VA 3ELJA 4JG7A 1M2PA 4TL0A 4BY9E 1I44A 3V51A 1XHAA 1CSNA 4R3CA 2HW7A 4J8MA 2YM6A 3RM7A 2R3LA 3SLSA 2NP8A 4KNBA 1P5EA 2WMWA 2IZTA 3HL7A 3GC0A 2JBOA 4FKSA 3AGLA 3JY9A 3KGAA 4FSUA 3T3VA 2E2BA 4XG6A 4FNXA 4DGGA 2UZOA 4KIQA 1H1SA 3EYGA 5E8UA 5AV2A 3ZRMA 4EOSA 3OFMA 2R3MA 3MFUA 4XV3A 4LL5A 4O84A 3D9VA 5CLPA 5IA2A 4H1MA 2VO3A 3DNEA 3ORXA 5AUYA 2QOHA 2YIXA 2XARA 5DFPA 4FC0A 4ASDA 2GNFA 3E8EA 3OG7A 4KIKB 4QMLA 2DYLA 3P7BA 1XH8A 2BKZA 5HBEA 4G3FA 4FKQA 3ZDIA 3DJ5A 1OBGA 3P5JC 4Y72A 1J1BA 5CVHA 1QPJA 3P0MA 4DGLC 3QUDA 5EKOA 2BZKB 3C13A 3UIXA 1QCFA 5IQCA 3LJ2A 3MPTA 3VRZA 4AXCA 2IVSA 4TYHB 4E4LA 3Q96A 4QYFA 4DT9A 5H9BA 3FI4A 2V0DA 5C1QB 5J5SA 4ITHA 4RFZA 3BKBA 3FQHA 3F69A 1VJYA 1YOMA 4YJVA 2ZOQA 5IUIA 2V5QA 4QYGA 3V5PA 4DFNA 4D5KA 4G3GA 2B9JA 4IM0A 4FTKA 4IJ9A 3VBYA 4AZSA 1KV2A 2ZV7A 4R7IA 4L6QA 4EORA 5K0XA 4EH8A 4NYEA 3FMLA 2C6DA 2F49A 3UPZA 1M7QA 2IEWA 2YJSA 4O6LA 4F65A 2NNWB 2X7OA 4F9AA 2VTRA 3JUHA 4G5JA 2PVHA 3BWFA 4YZCA 5ITAA 3NRMA 5ANDA 5LOHA 4Y85A 5BVFA 3O17A 1ZMVA 4BI0A 4DTKA 5DT3A 4C8BA 3BHHA 5KUPA 1OL2A 2JEDA 1Y57A 3ZRKA 3R6XA 3QLGA 4RIWB 3L8XA 3DTCA 4TN6A 4CV9A 3MW1A 2ZV9A 3AT3A 5K5XA 5D9HA 4R7HA 4AFEA 1S9IA 5CEKA 3COIA 3W0MA 3U55A 3TV4A 4YR8A 2VO7A 4ZLYA 2R3GA 4YC6A 4F78A 2Z2WA 5BMMA 3A61A 5HBJA 1ST0A 2IVTA 2WMUA 3QZGA 3R8MA 4PRJA 2C5XA 4FKLA 4IX6A 5DN3A 3FDNA 2C6KA 1SYKA 3JY0A 2RKUA 4HYUA 4UV0A 3TL8A 5CWZA 4C33A 1SVGA 4D2RA 3BEAA 5ACBC 4EH7A 2W1IA 2VWVA 2X2LA 4GG7A 3VBWA 5AM6A 2QR7A 5HCYA 4RLLA 3BU6A 4R7BA 2OJIA 4TYJA 5HI2A 2ZDTA 4M69A 1W2DA 4E93A 1YDTE 2C5NA 3EB0A 4WOVA 4MEDA 4MVFA 4QNAA 4AGWA 3EWHA 5C8MA 3MJ1A 1SM2A 4M67A 2OSCA 4W4WA 1OPLA 4RT7A 4F1OA 4LI5A 5BVDA 2C6MA 1XBBA 4QMYA 4DBXA 2GNLA 3VUTA 4O0YA 4Z55A 1RE8A 2HIWA 2E9UA 4BCNA 3AQVA 3I5NA 4ALWA 5AA9A 5BYYA 4RWJA 3TZ7A 3IW7A 4FKUA 1Q5KA 4EZ5A 3UNKA 3NNVA 1RJBA 5I3OA 3V6RA 5KHWA 1Q62A 4AZWA 3P4KA 4D4YA 1YDRE 1G8KA 2JAVA 1Q4LA 4QP9A 4KUJA 3DA6A 4FV4A 1U5QA 3UQGA 4I6QA 4FSNA 4XRLA 3MWUA 3C5UA 2ZB1A 3BLHA 3FZPA 1PY5A 3EYHA 4KIKA 5HHWA 4ANLA 3QX2A 3ACJA 5B7VA 2XRWA 4NJ3A 3UNJA 3W2PA 4DFZE 5HVKA 4EH3A 4Y5HA 1W82A 4RFYA 2UZVA 4UXQA 4JIKA 3PY3A 2W1ZA 5I5ZA 3C5IA 1Y6BA 2WTVA 1V1KA 2UZWE 4JBVA 4NTTA 4TYHA 1KE7A 3QRJA 3HMIA 5AR3A 4MWIA 3MFRA 4MF1A 4AW2A 4O27B 4U42A 1OZ1A 2LAVA 3UYSA 3WILA 4F1TA 4PP9A 2YZAA 5IU2A 2PZYA 2QR8A 2XRUA 1E9HA 4QP7A 4C2WA 1R39A 2C69A 4GFOA 1JKTA 3LQ5A 4AW5A 2Z7QA 4ZY4A 4UBAA 3TDWA 5KMOA 1GZKA 5A6OA 1YHVA 3BRBA 2PU8A 3E93A 2YA9A 4FTTA 2B9HA 4PL3A 3ZC6A 2YCQA 3BE9A 1RW8A 3LM5A 3ALNA 3QZFA 5HVJA 3VUMA 5GZ9A 2FYSA 4PUZA 3BI6A 4FTAA 4X2JA 2QC6A 4GT5A 2IW8A 1VR2A 3ZXTA 1UWJA 4C0TA 4XMOA 2NO3A 5E4HA 4HNFA 5C27A 2XIKA 4EOMA 2X8EA 2ZB0A 3V8SA 2PULA 4R5SA 3WF7A 3WYYA 4U81A 3QTUA 2PVMA 3VUHA 3WZDA 1ZRZA 4PDYA 2BZIB 5DEYA 3UO6A 4AQKA 2WGJA 4FEWA 4XCUA 4DEEA 4JR3A 1PXJA 4IZ7A 5CY3A 3DS6A 4J98A 4O2PA 1KUTA 2HXQA 2W99B 4HYSA 5IDPA 4EYMA 2JFLA 2JIIA 3O51A 4QDVA 1FOTA 2EWAA 5AV0A 3TYKA 5EYDA 4BDEA 4JG6A 2YLFA 4XOZA 3SRVA 5CSVA 2QLUA 2I0EA 2ZAZA 1LUFA 4QQ5A 4U3ZA 5EDRA 4E73A 5L8KA 4H05A 2IVUA 3KXMA 4LRJA 4MAOA 4K1BA 3RNIA 5T68A 5CQWA 3BQCA 4H3PA 2P33A 1KOAA 2RFDA 4RC3A 3RMFA 3R8ZA 3R7YA 2W17A 1J7IA 3FMMA 3GCSA 1PXLA 4W4VA 2HWOA 1XMLA 4OAVB 3QYWA 1Q99A 1ZWSA 4QD6A 4IH8A 5KCVA 2FSTX 3F66A 3GXLA 2CPKE 2C3JA 1PYXA 1PMEA 2W5BA 3W55A 3EQIA 4B9DA 3QGYA 2YN8A 3TWJA 3C4EA 4ZEGA 3VULA 1T46A 4I6HA 4EWQA 4QYHA 3AXWA 4NL0A 3LFCA 5EQEA 4WHZA 4Y5QA 2ZDUA 3C0IA 3DBFA 3DJ7A 4HCUA 2W0JA 3TZ9A 2R3HA 3SW4A 3Q2MA 4A9SA 2WOTA 3DBQA 2X6DA 5FP5A 4F7LA 4NM5A 4RX8A 4TKSA 4ZY6A 4CRLA 4MQ1A 4FL2A 2X8IA 2UZBA 4OAUC 2IZRA 3KC3A 3EFJA 4GEOA 4P7EA 3L8SA 4A9YA 5HX8A 4KABA 3C4CA 3CLYA 3VQUA 2BVAA 2VX3A 3BHTA 1ZOHA 3UVQA 3BYOA 5A46A 3LCSA 5IG1A 4PDOA 5JEBA 3CE3A 4FSRA 4FKPA 2FSLX 3NVKI 5H8GA 3QUEA 2GNHA 2W1FA 5HICA 3BYVA 3TMOA 2UZUE 5BUIA 2C5YA 2WFYA 1Q3DA 3KXHA 3CQEA 4OTPA 5JFVA 2NRUA 4FV2A 3NDMA 4JDHA 5L6PA 3QRTA 5GNKA 4BTFA 1F5QA 4M97A 4IB5A 2PY3A 4JXFA 4XV9A 3CQWA 4L44A 5BVKA 3VBQA 4BCJA 4XJ0A 3VS2A 4HVIA 3NFFB 3K3IA 3TI1A 4ZS4A 3ODYX 4L7FA 3BLQA 5FEEA 5I9VA 2XALA 2IZSA 4E6CA 4RIOA 3QXPA 4MBLA 4XLIA 3U9NA 4DHZA 2BMCA 4ZZOA 5H8EA 2X4FA 3L8PA 4Z9LA 2IF8A 4BIBA 1G8AA 2QOKA 3GP0A 3FC2A 5M09A 4CG9A 5AV4A 3VBTA 2HELA 2WTIA 4OT6A 1WBPA 5CAPA 4JMQA 3M42A 3LFSA 4CKJA 3C4XA 2GNGA 4MK0A 3Q5IA 4U44A 2G9XA 4L3PA 3UTOA 1Q61A 1Q97A 3DQXA 5CI7A 4CMUA 4D1XA 3DKOA 5LWMA 2GSFA 4KBAA 1OI9A 4YSMA 1YWNA 3BYUA 4Q9SA 2BAKA 4D5HA 3DU8A 3BGQA 5K9IA 3ATSA 1ZMWA 3EFKA 3F5PA 3H9OA 4FT9A 4IX3A 5CNNA 3OXTA 4WSYA 2R5TA 3OF0A 2Z7SA 2O0UA 3PSBA 3Q32A 4YLLA 4O4EA 2YDKA 3FMNA 4DDIA 5J7HA 4FICA 3GCQA 4ZLZA 3IGOA 4I4FA 3D0EA 5AUVA 4ZK5A 5E8ZA 4AS0A 3KF7A 5HLNA 3SGCA 4DDGA 4C3RA 1NVQA 3R1NA 3NYNA 4AF3A 3F82A 2YHVA 5ETCA 3NAYA 4NW5A 1NVSA 3MDYA 4GJ2A 4F0FA 2DQ7X 4U45A 5DNRA 5IKWA 3TNQB 3B8RA 3FI3A 4CCBA 3R30A 5HIEA 2V22A 3PA4A 5E8YA 3IECA 4B8LA 3JVSA 4CQEA 3SA0A 3TNIA 3VS0A 4XLVA 3POZA 4BWPA 3K2LA 4E5WA 3C7QA 1OM1A 4M84A 4IVCA 3AGMA 3HECA 3R22A 1U5RA 2QHMA 2XCKA 3FV8A 4BBFA 5CXZA 4R1YA 2JAMA 3AD4A 4NCTC 2QO9A 4W4XA 5IZFA 2HZ0A 2XK8A 2GPHA 4B99A 2UW3A 2Z60A 3NYOA 3ORTA 1F3MC 3QGWA 4FV1A 4I6FA 5IH4A 5M4IA 1H01A 1ZZLA 1OKZA 1T45A 3TDVA 3CC6A 2ITUA 5ICPA 3U6IA 5AP7A 5CASA 2PZPA 2OJFE 3HZTA 3KN6A 3C50A 2JKQA 3BYSA 2BKKA 2PMNX 3QD2B 3HUCA 4RX5A 4DBNA 3BU5A 4FZFB 5JT2A 3MJ2A 3WE4A 3DBDA 4ENYA 3Q52A 5K4JA 1UA2A 4ACDA 2WTWA 2VV9A 2OF2A 3VWAA 2CNUA 3W0RA 4L01A 1LPUA 3TEIA 3OBGA 3F5UA 4EBVA 4YO6A 2QOQA 3BL9A 4EK5A 3VAPA 4OTGA 4RQKA 3R83A 4FZ6A 4RA4A 5HOAA 2WKMA 5I3RA 2IW6A 5H2UA 4EJ7A 3VHEA 5K4IA 4TPTA 2XH5A 2YWVA 3H9RA 3KULA 3MGYA 1FQ1B 4QDEA 4NM3A 4NFNA 2OFVA 1ZZ2A 5AP6A 4KD1A 3TTIA 4QP3A 3NEWA 1AD5A 3RAIA 3RBWA 3TNWA 1YXUA 3DY7A 5J9YA 3SW7A 4JRVA 2J50A 4C4IA