3EYGA

Crystal structures of jak1 and jak2 inhibitor complexes
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
290
structure length
280
Chain Sequence
VDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPHIADLKKEIEILRNLYHENIVKYKGICTENGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase
publication title Dissecting specificity in the Janus kinases: the structures of JAK-specific inhibitors complexed to the JAK1 and JAK2 protein tyrosine kinase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 280
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eygA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eygA01
4E93A 4ACDA 2YA9A 4IB3A 5FWKK 3VS0A 4BCMA 1CSNA 3P08A 5M51A 4AOIA 2HYYA 1CTPE 1J7IA 4RA5A 3O96A 4ANSA 4DEHA 3MVJA 4KSPA 3D7ZA 1OMWA 1F3MC 2UZVA 4OBOA 3FLSA 2A19B 3QTUA 5KKRC 4G31A 3EQRA 3ANRA 5ANOA 3GU7A 3Q04A 1OB3A 5L6OA 1DM2A 3ENHA 3R1QA 5KUPA 4F4PA 2W1GA 4D1SA 3GP0A 3UYSA 4FEWA 5L8KA 4EKLA 5HVKA 5K5NA 1OIRA 4C4FA 5LOHA 2UVXA 5M56A 4J53A 4XYFA 3UNJA 4M67A 2YITA 4G3EA 2ZV8A 4DG0E 3TKUA 4MCVA 3D5VA 3MVHA 4KD1A 4J1RA 4PQNA 5C4KA 4CYIA 3LCDA 3QYWA 2QO2A 2YWVA 2W5BA 3G6GA 5HX8A 1SNUA 4C4GA 3WF5A 4D4VA 3IGGA 3KF7A 4R6VA 1LEWA 5CNNA 1PKGA 3OG7A 5EW3A 4TY1A 3LFFA 1ERKA 4BTFA 5DR9A 2VNYA 2C4GA 3IS5A 5DI1A 4ZEGA 5M4UA 5IG1A 3ANQA 4JG6A 2IVUA 2PVMA 4CYJA 2R7IA 4O2PA 1EH4A 3WILA 2VWWA 1Q41A 4GW8A 5AV3A 4FNZA 5D7VA 2XRUA 1OBDA 2XUUA 4G1WA 4L46A 3BV3A 3RAHA 3K3JA 3RI1A 4D28A 3TZ9A 4KRCA 4KIOA 3OWLA 3EN9A 3TV7A 4BKZA 3KMMA 3HMNA 3TNHA 1FMKA 2VTNA 5I9VA 4UV0A 4FGBA 4LMUA 4CCUA 2FGIA 3OF0A 4IWPA 4CLIA 4IQ6A 4NEUA 1ZMWA 3UIMA 1PJKA 3KCFA 4F9BA 3DXQA 3E87A 2HK5A 2JBPA 3LFSA 3W18A 3PG3A 3I60A 4L3JA 4WRSA 4L67A 3ZM4A 3MWUA 4I4EA 5A3XA 1SMHA 3OS3A 3QQGA 3BIZA 4BKJA 1J7LA 4E6AA 3SXRA 3ZCLA 2XA4A 3G33A 3U9CA 1KOAA 3C9WA 3UVRA 3EQPA 3E8EA 4QTBA 5CANA 2C3IB 3MJ1A 5IDNA 5KMNA 4ZTMA 2GMXA 3A7FA 2QR7A 3FLWA 4FT7A 3QTZA 3R73A 3TUBA 1BI7A 1Y57A 3Q6UA 2BHHA 3GOKA 5HNIX 3F3UA 3QWJA 3FXZA 4QYYA 4UMQA 2VTTA 5J8IA 2NRUA 1VYZA 2A27A 2YDKA 4ZIMA 4GVAA 4BDDA 2YCQA 3LHJA 1T46A 2I6LA 3EHAA 3WE8A 4G2FA 3R2BA 4RIWB 5J9YA 5CQWA 4DEDA 3K5UA 2ONLA 5D9HA 1P14A 3Q3BA 5KCVA 5I9YA 2VNWA 5CZIA 3VN9A 1XKKA 1UU3A 3BGZA 5BVKA 3EJ1A 4XS2A 5C03A 5TR6A 4I0TA 3LCOA 4MQ2A 5KZIA 4E73A 4YZNA 1ZLTA 2QG5A 2XEYA 5DOSA 1OZ1A 4CMUA 3A99A 3B8QA 3JVRA 3MN3A 4CMTA 4EK5A 5E8WA 2UW8A 3PPZA 2WMRA 3MVLA 4JT3A 3NX8A 4BZOA 5AM6A 3U51A 4QMQA 2Z7QA 4AN2A 4GG7A 4HPUE 1KE8A 1XH6A 4U8ZA 2JC6A 5HIBA 3IW4A 4TYJA 3CC6A 3CTJA 3RM6A 2J0LA 4FSZA 4W9XA 3PWYA 5L3AA 3O71A 4JL9A 5IDPA 3EH9A 3S2PA 2NNWB 2OLCA 4WG5A 3D7TB 2R3PA 4QNYA 3C4XA 1W8CA 3QXOA 1NXKA 4C3PA 5M07A 3D2KA 3CD8A 2XCHA 4O0SA 3T9TA 2Q0NA 1MRUA 5EM8A 5HLWA 3V8WA 1UU8A 2Y0AA 5J95A 3O8PA 5AV4A 2W06A 4GEOA 4YJTA 4C37A 4RMZA 3W2PA 3T3VA 3DZOA 1WCCA 1K3AA 4FTAA 4BCFA 3ZZWA 3ZC6A 3H4JA 2ITXA 4BDEA 3NYXA 4BTMA 1GZKA 1Z5MA 5B2LA 3F5XA 4D2SA 3Q5IA 4WT6A 4KUJA 3FQSA 2GNJA 5HG5A 3N4TA 5JH6A 1OL1A 3RCDA 3NS9A 3NGAA 3UVQA 3Q9XA 3RHXA 1FMOE 1UU9A 2AC3A 2DQ7X 4QO9A 5KMOA 4DBXA 3R2YA 5FTQA 4FK3A 3BYUA 4DGGA 4IDVA 2P2IA 2XP2A 2QC6A 3HP5A 4NW5A 1WVWA 2GNGA 2IZSA 4FTRA 2V7AA 3P86A 2OH0E 1IRKA 4FTKA 1VEBA 4AGUA 1H07A 4X3FA 3VUDA 3BHHA 4U0IA 2XKCA 2ZDUA 2XM9A 4KBCA 2C47A 3OXIA 5I9ZA 4LGGA 1R78A 4I5PA 2CNQA 1ZARA 3RBWA 4M13A 4BKYA 4YZBA 4O81A 4FZFB 4KS7A 2BVAA 1JKKA 3WZDA 5EYDA 1K9AA 4GUEA 5EHOA 3R7GA 3TWJA 3PSDA 1Y6AA 2CN5A 2PZIA 2RFNA 3QU0A 4ITIA 4A9SA 4C58A 4DC2A 5IEYA 3TTIA 1KUTA 2VWVA 4I92A 3ZRLA 2X9EA 4XOYA 4DA5A 1SNXA 4EHEA 2C6KA 2WMVA 2C3LA 2G15A 4JR7A 3F82A 4QT1A 4QPAA 3PXQA 5E7RA 2W4JA 3QD4A 3BYMA 1ZMVA 5LMKC 4MD8E 3RPRA 1PF8A 2OICA 3MTLA 3UC4A 3KXMA 3DU8A 5H3QA 3VHEA 2VTPA 3I6UA 5CEKA 2XM8A 1FOTA 3SA0A 1YQJA 4BBMA 5DR6A 1O6LA 3UTOA 4F65A 3JUHA 3LQ5A 4DFBA 1W84A 2FA2A 1I44A 2XKDA 3D0EA 3HYHA 3LJ2A 4D58A 3V5QA 3NUUA 4AGCA 4MBIA 1R3CA 4EI4A 3DJ7A 4DTAA 4FTQA 2UZEA 4J8NA 5AAEA 3QQLA 3C0GA 3DBEA 2JDOA 3M42A 3E3PA 3ULIA 3UPZA 3IDPA 3UIBA 2JKQA 3I7BA 4IE9A 5CVFA 3R7UA 1KV1A 4ANNA 1RE8A 2HW6A 5BUJA 4R78A 2WTVA 5KKRB 4YJRA 3UG1A 4OTGA 3GB2A 4AZWA 1Y91A 4RLKA 4FKRA 4GT4A 4FODA 3QZGA 5AM7A 3RWQA 4W8DA 3SLSA 4A9YA 4F1MA 2IWIA 4C4JA 2NO3A 2O8YA 4Q2AA 4XP3A 2CGVA 2JITA 4O0WA 1VR2A 1OPJA 2VTAA 3DBCA 4FL2A 4JDIA 4MKCA 3BBWA 1Q4LA 2GCDA 5FP5A 2O2UA 4G3CA 4YTCA 2OU7A 4IWQA 3U4UA 3G0FA 2UVZA 3BV2A 3MVMA 4MVFA 3MB7A 2VTRA 4P90A 4PF4A 3UOJA 4H3BA 3RPYA 3ZOSA 4CFNA 4ZJVA 2ZM1A 4W9WA 3DFAA 4AA4A 2OSCA 5HBHA 4LG4A 4FV5A 5J79A 5KBQA 3BGPA 3Q5ZA 3FYJX 3VVHA 4AN3A 1ZY5A 3WZUA 2Y8OA 3P7BA 4FV4A 5CLPA 2PULA 2P2HA 3FEGA 3ZC5A 2QOHA 3BU6A 3UE4A 2PZPA 2YLEA 3FI3A 4O0TA 5CT0A 2PVJA 4C3RA 4Y72A 4XBUA 4A4OA 2UW5A 3LPBA 2V62A 4FNWA 4GK4A 4TTHB 5A54A 4FYNA 3ZZEA 4ACMA 5HBJA 1JSUA 2R3NA 4QPSA 4G3GA 1PMNA 2OXXA 2ZV2A 4FIJA 2J0MB 3ZO1A 5HIEA 2NPQA 5IH4A 5BYZA 2PY3A 4O21A 4XP0A 5EI6A 4NZWB 4ARKA 5D7AA 2C5OA 3ZMMA 3MIYA 4PL4A 4Z9LA 3AC4A 3COKA 4PP7A 2VTOA 2QLUA 2W5HA 4M68A 5FUTA 3FMDA 3FZ1A 4X21A 2R64A 3NYOA 4E26A 4X3FC 2QOCA 1PYXA 3G15A 4P5QA 4O0VA 4QMXA 4XP2A 3NVKI 3W55A 2UW3A 2QNJA 2OJGA 3GC8A 4JRVA 2CKQA 3GEQA 3R0TA 4KNBA 4C35A 2OI4X 4JAJA 3PZHA 4IAAA 3P79A 2ZM4A 4RVKA 2X2LA 4BCJA 3MFTA 1IEPA 1U54A 4O91A 1IAHA 2WD1A 5CWZA 2XIYA 2F7EE 3QKMA 5CEQA 3UC3A 3ZFMA 2PHKA 4GIHA 2QOBA 3P7AA 4ANQA 5D12A 4FTLA 3B2WA 5HU9A 4YLLA 2QD9A 3OW3A 2OZOA 4FUYA 5ANGA 5LVPA 2J6MA 4UALA 2GHGA 3C4WA 5JMSA 1J1CA 4PP9A 4IM2A 2GTNA 4YBKA 2QR8A 4AW1A 1KE6A 4X0MA 3OOMA 3R83A 1PY5A 3G6HA 3ZSIA 2XNBA 3V5LA 1PXOA 4O7RA 4GH2A 4KSQA 4UBAA 5KMLA 1H28A 4PV0A 3VQUA 5HE2A 3DAKA 4FKPA 4C2WA 3CGOA 2W9FB 4FKOA 2OXYA 3R7IA 3Q2MA 3R22A 4IZYA 2JIIA 3G9LX 5IKWA 5J5SA 2BILB 4YHJA 2YFXA 1H1RA 2JFLA 1QCFA 4NW6A 5HTIA 1KE7A 4PDSA 2JBOA 1FGKA 3WZEA 5BVWA 4FIEA 2Y4IC 4H3QA 4O82A 4HGTA 5HVYA 2QQ7A 3QUPA 4C3FA 4F08A 4IAFA 3U4WA 3E92A 4D1ZA 3D83A 2XK9A 4IAYA 4H36A 5C01A 3TJDA 5CF5A 3AT2A 1SVEA 3SD0A 1OVEA 4U6RA 3PE2A 4OTHA 5HO8A 3UP7A 5CXZA 2J9MA 5I0BA 3EN5A 4FVPA 4USDA 4BDBA 4DGLC 2J5FA 2XNMA 4CVAA 4R7HA 5HGIA 4OAUC 2I0EA 3DOGA 4GVJA 2Z60A 3FYKX 4AFEA 4IVCA 5DYJA 3TIZA 3U6JA 1M7NA 1H1SA 3PJCA 4RFMA 4F1TA 5FDPA 3MV5A 3FQHA 2ITWA 4XLIA 5FRIA 2WQBA 4YSMA 1YWVA 4NM3A 3AD6A 3R28A 4FYOA 5IQIA 2PZ5A 5HE1A 4F6SA 2RL5A 2HAKA 3AMYA 4AW5A 5CSPA 1PXMA 3HAVA 4ZMFA 5CEPA 3PPJA 3OVVA 2HXLA 5DIAA 3L1SA 3FHIA 2RKUA 4UX9A 1YXVA 2JD5A 4CG9A 3EYHA 5EW8A 5L8LA 3GOPA 3PVUA 1OL6A 3R7OA 3R9HA 4EQMA 4IDTA 4QP4A 1WMKA 3AQVA 4LRKA 3W10A 4C34A 5HG8A 1V1KA 5TOZA 5CASA 2XK6A 4F70A 3K5VA 2BR1A 1YW2A 1Q5KA 5JRSA 3TNPC 4EJ7A 1XQZA 3EN4A 1JKSA 1KOBA 3LXNA 2QU5A 4PTGA 2I40A 4OR5A 4PDPA 5K9IA 2QOKA 2CDZA 2QONA 3HZTA 3KMWA 3C13A 3DB6A 3SOAA 4F99A 1WBVA 2ITOA 2BZJA 2Y6OA 2EVAA 4TWNA 4E4NA 1OKWA 1U46A 1WAKA 3MPMA 3ZTXA 3DTCA 4WBOA 2PWLA 4MHAA 4WOVA 1XBCA 3H30A 4MNEA 5IQGA 3EB0A 3OXTA 1PW2A 4J7BA 5FQDC 1JWHA 3CJFA 4H58A 4DTKA 1BUHA 2HCKA 5TKDA 4JX3A 4LRMA 4EWHA 2LGCA 3QYZA 4FNXA 4FKWA 4D2WA 2VWIA 4RWLA 2B9HA 1J91A 3LM0A 5IZFA 3MW1A 3P23A 2OF4A 5C4LA 5EI2A 1QMZA 4JQ7A 3KY2A 4O7YA 3WIGA 4IB1A 3ZUVA 3F3TA 2ITPA 2OH4A 4TYHA 2R4BA 4FG7A 4K2RA 2X0GA 3VAPA 4UMTA 4FSMA 1H24A 1OL5A 3KXNA 5M08A 5G6VA 3DK3A 3AC3A 3NIZA 3MFUA 3WI6A 2I0HA 5KMKA 4CG8A 3ZFXA 5CEIA 1KE9A 1ZOGA 4GSBA 2I0VA 4GU6A 5EI8A 4CKJA 5AP1A 1M2PA 5DNRA 4I1ZA 2BALA 3PY1A 5B0XA 3A4OX 2F57A 4ENXA 5JQ5A 2RFEA 5F4NA 4AGDA 4JX7A 4FSRA 3QQFA 2NRYA 3QCSA 1XR1A 3FDNA 4ZTSA 3GT8A 5IQBA 1OKVA 4O0RA 3SG8A 1X8BA 3QGYA 3R1YA 4MK0A 3VBWA 3CSVA 3C5IA 3NZ0A 3SXFA 2R0UA 2C6MA 5KZ0A 3ZDIA 5AP6A 5BPYA 5EHLA 2RG5A 3AT3A 3ODYX 2RG6A 4U42A 1DAYA 3R8VA 3E7OA 3H9OA 4KKGA 4HYHA 5I3RA 5E92A 3ZBFA 2C0OA 3ZDUA 2BROA 3RK9A 3C4FA 4WO5A 3R1NA 4JRNA 4PMPA 1JLUE 4X3JA 2OKRA 4CT1A 3K3IA 3KA0A 3MH2A 5ANJA 2X1NA 2B54A 2CLQA 3SOCA 4YPDA 4D9TA 4NM5A 2GS6A 5DEYA 4GS6A 5AP7A 4RWIA 1ZOHA 2JKKA 3V5WA 5HVJA 4J71A 4JIAA 3GQIA 4FKQA 4A07A 5BVEA 2FSOX 4IACA 1Q97A 3DV3A 4Y8DA 3DKCA 3PP0A 4MF0A 4FSTA 5F20A 4Q5EA 5H8EA 4O7WA 3C7QA 3BCEA 2BAKA 1OPKA 4OT6A 4G34A 2UW0A 3OFMA 5I9XA 3VQHA 5CF6A 4QYGA 3QTXA 4W4XA 4ALVA 3F7ZA 3VIDA 2BFYA 2R3FA 3QZIA 2R3LA 3E7VA 4FKSA 4D1XA 5H8BA 4ZK5A 5KE0A 3O51A 2VTIA 2J0JA 4JQ8A 4I24A 4K18A 4QMYA 3A8WA 2IO6A 3HNGA 3HDNA 2XNGA 4JDKA 4NT4A 5ANDA 3L8PA 3TTJA 2BRMA 3O8UA 5JGBA 2XNOA 4RVTA 2ZB1A 3DK7A 3H10A 3OY1A 3MTFA 3W1FA 3VC4A 4ZTLA 4EK8A 3JR1A 4X3FB 2F4JA 2OIBA 5BUEA 2YM7A 1UNHA 2E9PA 4UMRA 3VS7A 5IUGA 3Q9ZA 2VD5A 4F7NA 1G8SA 3AGMA 3LCSA 4FOCA 4M69A 4V05A 5M57A 1AQ1A 4I6HA 2J0IA 4PWNA 5E8SA 4RZWA 2V55A 3VUIA 2YABA 1ZMUA 4NUSA 2HZ4A 4G6NA 2YZLA 3D9VA 4MXXA 2C6IA 1HCKA 2B7AA 5M44A 5GJGA 3FKOA 4FTTA 4EOLA 4YZCA 1TQMA 2R3RA 2P4IA 2VX0A 4TNBA 2GU8A 3LZBA 5KHWA 4ZTQA 5LCKA 3CPCA 3KRLA 3O50A 4HGSA 3NVMB 5DEWA 2YJSA 4FTNA 3VNTA 4CSVA 1REKA 1UU7A 5EG3A 4E3CA 1UVRA 4IX4A 4PNIA 4A4XA 5KHXA 4QTEA 4OAVB 3BGQA 5JRQA 5AAGA 1PXLA 2OJFE 2IPXA 2BHEA 4YHTA 5ANEA 4HVHA 3R8UA 3F2RA 4ZSAA 3AOXA 3ATTA 3KCKA 3UMWA 2YWPA 1GZNA 4O1PA 1ZOEA 3ZSHA 5GZAA 5IF1A 4HZRA 3COMA 3FL5A 4XRLA 4O0XA 3O0GA 2RFDA 4G9RA 2Y4IB 2CGUA 3EKNA 3FXXA 3MFRA 4RX8A 3JY9A 4WKQA 4DGOA 3VUMA 4E20A 3WOWA 2X6DA 4FKVA 4ITJA 4FV2A 4YJUA 3AC1A 3E8NA 3OXZA 2QO7A 4AT3A 3U54A 5HD7A 3EQDA 3P1AA 4BCOA 3BWJA 2C6DA 2PUNA 5D1JA 3NUSA 3DBFA 3HGKA 3R8ZA 5A4CA 3PA5A 1CDKA 2PVKA 2YAAA 2AC5A 3F5GA 4IC8A 4MF1A 4ZY4A 2WHBA 2UW4A 2XBAA 4IC7A 4YJQA 2ZYBA 2VAGA 2YIXA 3ATSA 2R7BA 2WTJA 3EFKA 4IANA 3RAWA 4PMSA 2IZTA 1Y6BA 1ZY4A 4FVQA 3TV4A 3M2WA 5DE2A 4D4YA 1V0PA 2HZNA 4ASZA 3BE2A 1DI8A 1MUOA 4NM7A 4XUFA 5M4CA 5DRBA 4RJ8A 3NYVA 4Z7HA 4I4FA 3LXPA 1FVVA 1RJBA 4R7IA 3KKVA 4BY9E 4WNKA 2YCSA 4QTDA 3PRIA 2JIVA 3AD4A 4YC6A 5KNJA 3V51A 5EW9A 4ASXA 2XMYA 4WA9A 4IX3A 2C5YA 5CQUA 5FXSA 3GVUA 4Y5HA 4A06A 5BVOA 1B6CB 3CJGA 2CJMA 3G51A 5EKNA 1G5SA 3PY3A 5T68A 2FYSA 3PVWA 4RVMA 3MYGA 3D5WA 4BZDA 4GL9A 3DXPA 2YM8A 1K2PA 4IZ7A 4TPTA 1GZ8A 3BQCA 4J97A 4QMZA 4U41A 2XIZA 3ZUTA 2ETMA 3COIA 2HENA 4KBAA 4MQ1A 3PY0A 4WG3A 4D2TA 2AUHA 5A4TA 4O1OA 5H9BA 3NNXA 3OT8A 3C4ZA 3QTSA 3RPVA 2B0QA 3DNDA 3WF9A 1QL6A 2EB3A 1G3NA 4CCBA 3RHKA 1YHVA 3GCQA 3Q4UA 3JYAA 3KB7A 1YWRA 5KO1A 2ZDTA 3NW6A 3OT3A 3ZH8A 3RZBA 3EN6A 1ZZLA 2WMBA 1J3HA 3UZRA 4EOPA 4Z3VA 3PWDA 5FEQA 4R3RA 2W5AA 5IEXA 3NMUF 1Z9XA 2XJ2A 3QLGA 1PMVA 3NIEA 3TDVA 2DS1A 3GBZA 1XH7A 2W4KA 4XG6A 4F9CA 5AUVA 5G1XA 1U54B 3KK8A 3ERKA 2YM4A 3CR0A 5L2QA 5C1QB 5TO8A 3WIKA 1NVSA 2C68A 3VJOA 3GCUA 4AA5A 1AD5A 3IW8A 4G3DA 3PJ3A 1NVQA 5LQFA 3G9NA 3IGOA 2W96B 3OEFX 1OKYA 5FTOA 4BDIA 3DS6A 3HMOA 4FV0A 3REPA 4U5JA 2BFXA 1SVGA 2WTKC 4GK2A 3BKBA 3FMMA 2XRWA 4MXAA 5B7VA 5M53A 2XZSA 3KRRA 3DBQA 5EOLA 4U81A 4FVRA 2YERA 4P4CA 3RWPA 4FKJA 5CAQA 2XKEA 5DRDA 2VO0A 2W05A 4H3PA 1U4DA 4IWDA 2XYUA 3UO6A 4PX6A 3I81A 4YJOA 4HVIA 4NFNA 3HRBA 3AXWA 4V0GA 2BDJA 4DEEA 4I5HA 3U9NA 2ERKA 3WARA 3IDCA 3F5UA 4ANBA 2F9GA 2XEZA 5GIPE 5LMKA 2CGWA 2YCFA 4YHFA 2ITYA 2BDWA 5BX0A 3LFEA 4BIEA 3KK9A 3W2RA 4CFFA 4EC9A 3GGFA 3R9OA 3I0OA 3OCGA 3S3IA 4IBMA 4DCEA 3GU6A 2VTJA 4KIKA 1STCE 4L8MA 2YZAA 3UZTA 1OI9A 4HPTE 2CLXA 3GCPA 3UYTA 5K4JA 4RC4A 5T6KA 5CYIA 4X7QA 3HV5A 4WUNA 5C8KA 3ZRKA 2WB8A 1LEZA 4BVUA 3FMLA 5C26A 2JFMA 1OL2A 2O3PA 2XF0A 3H9FA 3O23A 3PTGA 4J8MA 4LL0A 4O96A 4YBJA 3T8OA 3SW7A 2CHLA 3D2IA 4C7TA 2A0CX 2RF9A 2VGPA 2PZYA 3OWJA 2W99B 3NAYA 2B9IA 4F6UA 4FA2A 4OTIA 3EL8A 1Y8YA 4E6DA 2WGJA 3V5JA 4NJ3A 4BGQA 4RQVA 3VS2A 2IVTA 4PL3A 5CI6A 3ZUUA 3PXYA 2XB7A 4F9WA 3PA4A 2G01A 2QHNA 3ALOA 3LOKA 2B55A 4MEDA 4DTBA 4JJRA 4LOOA 4XG4A 3V8TA 2HIWA 2UUEA 4L43A 4S31A 2DUVA 4TYGA 2C0TA 4DH3A 3HV7A 4A7CA 5CENA 4B0GA 5HHWA 1VZOA 2QO9A 3EQFA 2PUPA 1YOJA 3DQWA 4IX6A 4RT7A 4XMOA 4ZJJA 1YWNA 3HV3A 3BHYA 3IPHA 4I20A 4EH6A 4NTTA 4IVBA 3VBQA 1V0OA 2ETKA 3FLYA 4RJ3A 4FL3A 1CKIA 1NA7A 3W16A 2ZOQA 3EZVA 3HA6A 3Q2JA 4NCTA 3QD2B 4L44A 2R3MA 3AG9A 2J4ZA 4J96A 2IVSA 4D55A 3VULA 5CF8A 5E4HA 4TKSA 2XK7A 3UG2A 4QMUA 4GT3A 1KV2A 4QQCA 1OM1A 5JT2A 1GZOA 5IA0A 3S0OA 2R2PA 4MNEB 3FZOA 3KMUA 2W1CA 4S34A 4EQUA 2YEXA 4IM3A 5AV2A 4O0YA 4HYUA 3IDBA 2G1TA 4WUAA 4M7IA 4ZLYA 4PDYA 4UWCA 1PXKA 2CN8A 2GNFA 2PVLA 2UW7A 2X4FA 4LL5A 4RJ7A 4DITA 4L9IA 4M8TA 4YTFA 5E9EA 2EXCX 4G6LA 4GYIA 4YTIA 3GC7A 5ITAA 4C59A 2IW9A 4BBFA 1OIYA 4TYHB 5LVLA 3KN5A 2XCKA 2EB2A 5D10A 3ALNA 4ZZMA 3VO3A 4CZTA 5IQFA 1H0VA 1Q61A 5HTBA 5EDQA 3R30A 3DXNA 4AZEA 2G9XA 2VO6A 1WVXA 4P2KA 4YO6A 4EOJA 3U6IA 3L9PA 4RC3A 3ORKA 4I23A 4YJNA 5EM5A 3ZXZA 4RGJA 4XV2A 5F1ZA 1DAWA 2OIQA 1B38A 5J9ZA 5DN3A 2WAJA 2WZJA 2VRXA 4GCJA 3QXPA 4L68A 4QP2A 3VW8A 4IAIA 2XBJA 3ET7A 4LQMA 5CXHA 3PJ2A 3SKCA 3LLTA 3UPXA 3KXHA 4QPMA 3LE6A 3PPKA 3R02A 4RIYA 3LCTA 4X2FA 2C3KA 4AZFA 4YO4A 2ITQA 4LFIA 4EOMA 4UYAA 3QTQA 4QQJA 5CI7A 5HESA 3R9DA 4USEA 2R3HA 3KEXA 3TN8A 2WTCA 2O0UA 2C1BA 2Y7JA 3OBJA 3SX9A 1G8AA 2RIOA 4GYGA 2QOLA 4UXLA 4LRJA 4JG7A 4R5YA 3LFAA 3OHTA 4P7EA 4EJNA 3NUAA 2C6OA 4B99A 4JS8A 4BWPA 2QCSA 3LFNA 3MY1A 5HLNA 3CTHA 1NW1A 3FMJA 4RJ6A 4L53A 4BGHA 3PIXA 2X2MA 1TVOA 4I0SA 4IMYA 4CV8A 4IM0A 2OFVA 4JBOA 4GJ2A 1UNGA 4YR8A 3LFDA 4BDHA 4E5AX 3KF4A 5DT0A 4UEUA 4U97A 3BI6A 1P5EA 1L3RE 2X6EA 3OW4A 2ETRA 3CKWA 3NUXA 2WU6A 5LVMA 5LMAA 3NNWA 5LWNA 2X39A 5DHJA 2PZRA 2G2IA 4I3ZA 2WTIA 1GY3A 1SZMA 3D5UA 3ROCA 4C8BA 1IAJA 3NNUA 2R3JA 4YZDA 3QL8A 3UGCA 1W0XC 3MA6A 2OF2A 3UOKA 3M11A 4CFUA 3MIAA 5M55A 1WBPA 4FTIA 3V5TA 4IZAA 3VBXA 1GIHA 2Z7LA 4O7NA 3POOA 1M17A 3F7WA 3NNVA 5DGZA 4TZRA 5EM6A 4O2ZA 5FGKA 4C61A 3PSBA 3FZTA 3Q60A 4FC0A 3UJGA 3CIKA 3WYXA 3CP9A 4BCGA 1IR3A 3CKXA 4BYIA 2YIQA 4H1JA 3PYYA 4ANMA 4FI1A 1PKDA 3MFSA 3IONA 5K3YA 4BCIA 4O7TA 3NUNA 2WXVA 2YM5A 3PRFA 5JFXA 1PMUA 4NCTC 4ZY6A 4C4IA 3R63A 2R3KA 3Q53A 2XK8A 1RW8A 4FEQA 2HWPA 4CZYB 4FUXA 3ZBXA 3Q52A 4M69B 4O22A 2BIYA 3RINA 5C9CA 5IMEA 3RPOA 5BNJA 3ORLA 3LM5A 2OO8X 2GQGA 5IQHA 4FICA 1JQHA 2GS7A 3VRYA 5FG8A 4QP8A 4L3LA 4ZSLA 4HGEA 3G90X 1NVRA 3MESA 3QX4A 2X7FA 2J7TA 4CRSA 4Y46A 3SC1A 3ZYAA 2BRNA 1J7UA 3VS6A 5E8XA 3C4EA 4R5SA 3GUBA 1A9UA 3FMKA 3Q4ZA 4B8LA 4ANOA 4BTJA 4EZ3A 2CNUA 4H05A 4BWKA 4GFGA 3PA3A 3SAYA 3TEIA 4F0FA 3FMHA 3VJNA 3ZSGA 2Z02A 4FSUA 4L3PA 3QQUA 4AZSA 1B39A 4IADA 1ZZ2A 3R00A 5E90A 4EOIA 2J51A 2Y6MA 4ITHA 4M97A 5L6WL 1QPCA 2FB8A 4NIFA 3DTWA 4GU9A 3UNKA 4R1YA 4MNFA 5ETIA 3EOCA 3C0IA 4CZUA 5A6NA 3DBDA 4JAIA 5IU2A 1Q8YA 4I94A 3RAKA 3VS5A 2BAJA 4QTCA 4CGAA 3VHKA 5H2UA 1FQ1B 5A46A 3QCYA 4OTFA 3ODZX 1O9UA 3BU3A 1PHKA 4O7LA 4HCVA 3NUYA 3U8WA 5JSMA 2CKOA 4O6LA 4MWIA 4LMNA 4WNOA 5AA9A 3NWWA 3OMVA 5K0KA 1Q99A 3FI4A 5CNOA 3OTUA 3BZ3A 2QHMA 2C0IA 3RK7A 3VWAA 4FG9A 2DWBA 4A9TA 3V6SA 3FLQA 3JXWA 3PIYA 4QP7A 3MY5A 2PL0A 3QF9A 4RPVA 4BCKA 3GU8A 4HOKA 1RDQE 2UZBA 3PLSA 3ZO3A 3ZFYA 3LXKA 5HI2A 3CE3A 4FEVA 3LJ0A 3PDTA 1FBNA 2R0IA 3AC5A 1MRYA 2B9JA 3M1SA 4KIPA 3K54A 4RJ5A 1XHAA 2YJRA 3ZLWA 4RIOA 3PUPA 3U87A 5L8JA 5BYYA 3QRIA 3HEGA 4YJSA 5CS6A 2BKZA 3AT4A 1YHWA 4H39A 3G2FA 4FT3A 4E5BA 3MY0A 3II5A 2OZAA 1BKXA 4ASDA 4M14A 2W1EA 2HZIA 4OTWA 4TWOA 4AN9A 4AZVA 5CU0A 5J1WA 1PXNA 5E91A 4RWKA 2X7GA 5C8NA 5KMMA 1SVHA 3JY0A 2UZOA 4FIGA 4IEBA 4TYIA 3TXOA 4I5CA 5AUZA 4F1OA 4EYMA 2X8IA 3KXGA 3NCGA 4AW2A 3MS9A 5JZJA 5AUUA 3C4CA 2GQSA 4UMPA 3FE3A 3F66A 2JLDA 1OITA 4USFA 4MYGA 1JNKA 4ZSEA 2ITVA 1ZYSA 4FKTA 2WKMA 2VWBA 3HP2A 4OBQA 3ORTA 2O64A 3NRMA 3KXXA 4GRBA 4DEGA 4EUUA 4BRXA 5HQ0A 3H0ZA 2W1DA 4F0IA 4PMTA 2X8EA 3I5NA 1GNGA 2C6LA 4JIKA 3NDMA 4F9YA 2WMUA 4JVGA 1FINA 4J99A 4Y83A 5H8GA 3LMHA 4W4WA 5CY3A 4QMWA 2NP8A 4FSYA 3LCKA 1FGIA 3DZQA 4OT5A 3UP2A 5DPVA 4IFGA 1XBBA 4EOOA 1URWA 1VJYA 4NM0A 3DA6A 4YC3A 4ONAA 5DFPA 2Z8CA 3PXFA 4MXOA 5AP5A 3HX4A 3BRBA 3C5UA 4N4SA 4S33A 3PJ8A 4X2NA 4BICA 1XH9A 4C02A 4L7SA 4ACHA 1PXIA 3CS9A 3FUPA 3LIJA 3R9NA 2VTQA 4TN6A 2IW8A 2JEDA 2X4ZA 5LARA 4IIRA 5ICPA 2J2IB 4N6ZA 4QP6A 2PMLX 3QFVA 4R3PA 2WO6A 3FZRA 5EQEA 1ZYDA 4JLCA 5GJFA 1ZXEA 3BX5A 5HCXA 3R8PA 3RNYA 5JGDA 4X2GA 4AS0A 1M2RA 3HV6A 3KRXA 2J0KA 2GSFA 4JR3A 5LVNA 4O84A 4V0GB 2JAMA 2WELA 1JSTA 3BLHA 1ND4A 3MH3A 4K1BA 5GZ9A 2XS0A 3DLSA 4O27B 2RGPA 3VUHA 4BGGA 3ORMA 5EYKA 4V01A 1YOLA 2QU6A 3FQEA 3P78A 2UZUE 3ORIA 5AEPA 5E1EA 3EMGA 3CLYA 1E1XA 2Y4PA 4XRJA 3UOLA 3QLFA 4AFJA 4WNMA 1JOWB 4FTUA 2VO7A 5IPJA 4LUDA 3W8LA 4DH5A 4KIKB 2CKPA 1DI9A 2W1ZA 4BR3A 3VRZA 2H6DA 2VO3A 3BEGA 2QG7A 4OW8A 4MBJA 4GUBA 4FSNA 4BDAA 5AX9A 4GK3A 4YTHA 5AJQA 2PMIA 5IH6A 3TUCA 3EFLA 4EK6A 3BBTB 5HD4A 1HOWA 4BWXA 5AP3A 4DFLA 4DF3A 2ITTA 4ACGA 2UW9A 3ITZA 2BZHB 3IECA 2UW6A 4I22A 4KABA 4NJDA 4ANLA 5J1VA 3IW6A 4RX7A 4NYEA 3RMFA 4GFOA 5FM2A 4FT5A 5HIDA 4HCUA 4RZVA 4FX3A 3BWFA 3R7YA 3RCJA 3N4VA 2UVYA 1BYGA 2PK9A 1YI4A 3NLBA 4Z16A 4XEYA 5FTGA 1MQ4A 1OIQA 4G6OA 2E9VA 3ZS5A 3HECA 3TT0A 1KE5A 4XNEA 1WBOA 4F63A 1F5QA 4IX5A 3FWQA 3W2OA 4KWPA 2FO0A 2FSLX 3OEZA 3ZONA 2CPKE 1ZAOA 3EN7A 3PSCA 3EIDA 4RFZA 4ALUA 3NEWA 4KIQA 4UY9A 3MPAA 5E8VA 4YZ9A 3TACA 4B7TA 4QNAA 4EONA 2PTKA 2C69A 4FKIA 1H00A 4XCUA 3HLLA 3TZ7A 2YACA 3POZA 4B6LA 3RVGA 2I1MA 1CKJA 3H3CA 5FP6A 2E9NA 2DYLA 4L6QA 4ASEA 2W4OA 3EQHA 3PG1A 4WNPA 4ZP5A 4O86A 4APCA 3IG7A 4QQ5A 5DA3A 5EM7A 5J87A 4IZ5A 2HOGA 1LUFA 3R71A 4GFMA 3ZXTA 4JI9A 1MP8A 4BIBA 3R7EA 4FK6A 4MH7A 4RSSA 3A2CA 2QURA 1QPJA 2J90A 3GCSA 4ZTHA 3KL8A 5CSHA 4MWHA 2QI8A 5TE0A 5LXMA 3DKOA 3OTVA 5FXQA 3UQCA 2OIDA 5ETFA 4L52A 2P3GX 1PXJA 5AAFA 4CKIA 3W33A 4O7VA 4EORA 3TDWA 3SV0A 2XK4A 1GIJA 2OJ9A 4ZJIA 3EQGA 3UQFA 5BMMA 2IVVA 4LUEA 3DB8A 1Y8GA 4MAOA 4BI0A 2G2HA 2SRCA 1WFCA 2H34A 2H9VA 3RAIA 3KGAA 1YKRA 5HCZA 3NYNA 3DJ6A 3WF8A 4RFYA 5A9UA 4UZDA 4A4LA 2R3GA 3CQEA 2PVRA 3WE4A 1BL7A 3WZKA 5CU3A 2PVNA 1W83A 5I9UA 4GKHA 3UOHA 5TT7A 3MPTA 1LR4A 5DWRA 2R9SA 3BYOA 3RKBA 2O63A 3W2QA 3LFBA 2XH5A 2XYNA 4FG8A 1HCLA 3DKFA 2B1PA 4NK9A 5CVGA 3V01A 4AUAA 3ELJA 5L2SA 4U43A 5FLFA 4O7SA 4YSJA 4XX9A 4C4HA 3A61A 3ZO2A 4DLJA 4NWMA 2BRHA 3HUCA 4FSWA 1YXSA 2YDIA 1BI8A 2XIRA 4RIYB 4ZSGA 5JN2A 1IA9A 1NY3A 2WIHA 3Q96A 2OWBA 4U40A 2AYPA 2OG8A 4EHVA 4JQEA 3FC1X 2PVHA 3F5PA 1YI3A 3QCQA 4FMQA 2FSTX 5HE3A 3UZPA 2PMOX 1JSVA 3PXRA 4ZSJA 3QA8A 3T9IA 5CAOA 1H0WA 2WU7A 1BLXA 4QYFA 5AR5A 3KREA 2OW3A 4X6QC 3ACJA 2WFYA 3L9NA 5TF9A 1OIUA 4QMMA 4LOPA 2OXDA 2P55A 2JGZA 4L01A 4D9UA 3Q4TA 1XO2B 3ZU7A 3QQHA 4J95A 4JDHA 4MXZA 3DGKA 3CY3A 1OGUA 1QPEA 2JIUA 2ACXA 3BELA 3RGFA 5AP4A 2XK3A 2WQMA 4AE6A 4E4XA 3JVSA 3DCVA 4EZ5A 1ZWSA 3R21A 1Z57A 4BHNA 4IJPA 4BI1A 4LGHA 4QP3A 3OBGA 3TIYA 3VUTA 3SRVA 5AIRA 3KRJA 4H1MA 2F2CB 2WOUA 4CLJA 3VF8A 3WF7A 4XG9A 3HMPA 5J7HA 4E6QA 3CCNA 4XH6A 4D4SA 4CEGA 2XJ0A 2WTDA 2E2BA 4QD6A 4D0WA 4BDGA 2PMNX 2RSVA 3EQCA 3F88A 3WZJA 3E63A 3CQWA 4TRLA 3P4KA 4RIXA 4EH8A 3CY2A 4FTOA 1MQBA 4F7JA 3MJ2A 1O6YA 2JAVA 4AW0A 4P5ZA 1UKHA 3SHEA 5J9LA 2O65A 5AR2A 3NR9A 3TI1A 2OJJA 2P33A 4DCAA 1ZYLA 3E8DA 1Q3DA 1JPAA 4KS8A 5HORA 3KXZA 3S4QA 5IA2A 3F6XA 4ZS4A 2BTSA 1NT2A 4R3CA 4U79A 4ZZNA 4CFMA 2PE1A 4X6RA 4NU1A 5FEDA 5M09A 3FZSA 4YNEA 3V04A 3AMBA 4JBVA 2OFUA 3OOGA 4FTJA 4B9DA 2PE0A 4BB4A 4TL0A 4O38A 3EYGA 4APPA 2BTRA 3FI2A 2J50A 3DJ5A 2ZAZA 4G3FA 4YNOA 2RFSA 5EK7A 3WF6A 4LV8A 1H4LA 2VTLA 5CEOA 1M52A 3D4QA 3HKOA 2R3QA 4FNYA 5DH3A 3S00A 4YPSA 4EOQA 4RC2A 4Q9ZA 4E6CA 5DBXA 4AA0A 2UZNA 4AOTA 4AWIA 5HG7A 4CNHA 4NH1A 4DFYA 2PU8A 2XIKA 3QRUA 2WMWA 5JK3A 1R0EA 3DNEA 5B2MA 3KQ7A 4BL1A 5DT4A 4AGWA 1GAGA 4QYHA 3TKHA 3GCVA 4QMVA 4OTRA 2FVDA 4FEUA 3Q9YA 5CEMA 4NIFB 4LM5A 4RJ4A 3Q6WA 3AD5A 3LQ8A 1XH4A 3UO5A 1I09A 1UNLA 3SW4A 5EH0A 4ZLOA 3TJCA 3SDJA 4BZNA 3V5PA 3E8CA 5BVDA 5K0XA 5EDRA 3TM0A 5AV1A 1L8TA 3OROA 2GNLA 2XIXA 5HZNA 1SM2A 4QMLA 5EOBA 3U6HA 4F9AA 4MXCA 5BUIA 2YAKA 3L8VA 4YJVA 4DLIA 4LI5A 4CTBA 4ERWA 1OL7A 4IHPA 1J1BA 1YXTA 3IK3A 3NAXA 4XLVA 5IUIA 2WQNA 5DLSA 1JVPP 1KWPA 1H27A 1Q8TA 3QBNA 4IB0A 3VS4A 4ENYA 5GINE 3NW7A 4ZY5A 4JXFA 1PRYA 3PVGA 4KKHA 4U3YA 3A7HA 3QZHA 3ZRMA 1PYEA 2ZMDA 4FZ6A 5FEEA 4W4VA 4YGAA 3SG9A 2E9OA 4EEVA 5CU6A 3CXWA 2BRBA 4U3ZA 4AP7A 4Q9SA 4E5WA 3HRFA 4GJ3A 4HYSA 4CD0A 4EKKA 4F0GA 3BHUA 4E7WA 2LAVA 2ZM3A 1FVTA 4BN1A 2W1HA 4FSQA 3TKIA 1E9HA 2OZAB 5E8ZA 4R7BA 2C5NA 4J98A 4HZSA 2PUUA 4S30A 3QX2A 5BVFA 3O7LD 2ITZA 4X2KA 1KSWA 4PDOA 4ORKA 5JKGA 4ZS0A 3R8MA 1CMKE 5JGAA 2YIWA 1RQQA 2JKMA 4K77A 3EQIA 4DBNA 3D94A 4TWCA 2BZKB 4PL5A 4K6ZA 3L8XA 5L2TA 3A7JA 2VX3A 5JFSA 5AUWA 2KULA 4L00A 3CD3A 2YIRA 4NSTA 3VS3A 1WVYA 3HL7A 3PXKA 4G9CA 2YN8A 1H01A 3RNIA 4DYMA 2C6TA 4DGMA 2ZJWA 2A2AA 4NKAA 3N51A 3C50A 3F3ZA 4XV9A 5LMBA 1YOMA 3KC3A 2H8HA 4I6QA 3ZLSA 3FAAA 4EHGA 3E64A 3K2LA 4D2RA 3QC4A 4RA4A 5AUYA 1OKZA 2WEVA 2VZ6A 4MXYA 5M4FA 3IOKA 1IA8A 4IH8A 4M0ZA 2JDTA 4EBWA 5KX8A 3LLAA 3W8QA 3QA0A 3TZMA 3EKKA 2VWYA 4TYEA 3ZO4A 3QD3A 5GNKA 4FV7A 1Q24A 5B2KA 4OUCA 2CGXA 3I79A 1XBAA 3IKAA 4FZAB 4EYJA 3R04A 3HDMA 4QMSA 3RTPA 3A62A 4MD7E 4ZTRA 3R8LA 1QPDA 1XH8A 1AGWA 3FY0A 5AR8A 2B4SB 5CSVA 3QHRA 3P5KA 5ANIA 3RK5A 3ROYA 1O6KA 1W7HA 3LMGA 5CU2A 4DAWA 4JBQA 5BMSA 1S9JA 3VUGA 2VTMA 4IAZA 2ZMCA 3LXLA 3E5AA 3QKLA 2ZV9A 3MH0A 3ZHPC 4IFCA 2JKOA 4DH8A 4C57A 2R5TA 1W98A 3A4PA 4A9RA 1YXXA 2WMQA 4YC8A 1IG1A 4DFUA 3V3VA 3MA3A 3F9NA 3WBLA 3P0MA 2V22A 3H9RA 4DE4A 3O17A 4B4LA 3G5DA 3BE9A 4G17A 4BI2A 2G2FA 4M15A 2ERZE 2QOFA 4HNFA 4DFZE 2ITUA 4D4RA 3LJ1A 2B9FA 4I41A 1Q8WA 4PRJA 2FH9A 3EL7A 4FTCA 4AZTA 4CQEA 4E8AA 4R8QA 2Q83A 3C1XA 1H1WA 4ZAUA 5J7BA 4AE9A 5HTCA 5LCJA 2XNEA 5ANKA 3HAMA 5GHVA 1R1WA 2WEIA 3GFEA 3S95A 3QQJA 3O8TA 2HXQA 4ID7A 3L9LA 3E93A 4O6EA 1LP4A 1UA2A 4KA3A 2KTYA 2QKWB 4K33A 5K5XA 5E1SA 3VBTA 1M7QA 1U5QA 5AADA 4MTAA 3VBYA 2WQEA 4BCNA 5A4LA 4Z7GA 1M2QA 4N6YA 3O2MA 3UODA 2VWUA 4MX9A 3KRWA 4BDJA 1V0BA 3FC2A 2PSQA 4IB5A 4EK3A 4FV1A 2OK1A 2PVFA 4YLKA 3Q32A 4RX9A 2IN6A 3AC8A 4KBKA 4FV6A 3W2SA 5A4QA 4BCHA 3DDPA 3BLRA 2HY81 3DK6A 3FLNC 3FXWA 4X2JA 1H25A 2CMWA 3ENMA 5AR3A 5HG9A 4DN5A 2BAQA 3FZPA 2BCJA 3HUBA 4QQTA 3VF9A 5IQEA 4QMTA 4AQCA 4HGLA 4II5A 3UQGA 4M66A 5DR2A 5JEBA 5JQ8A 3P7CA 5F95A 3A7GA 4YP8A 5HNGA 3Q9WA 2IZUA 4PUZA 4DINA 4MD9E 3AC2A 4EQCA 3FV8A 2YHVA 3S1HA 3KULA 1UWHA 3ORZA 4JNWA 3TNIA 1YXUA 1FVRA 4XBRA 5DMZA 2ONLC 1T45A 4UMUA 4EH7A 3DLZA 4BF2A 5BQ0A 1H26A 2VGOA 4WD5A 2B52A 2YISA 3GENA 3VS1A 4BDCA 4BIDA 4U80A 2Z7RA 3ETAA 4C62A 4DEBA 4DG3E 2XVDA 4I21A 5FDXA 2GPHA 4CFWA 3N4UA 3SGCA 5JFVA 3OUNB 5HBEA 4AT5A 3MGYA 4W8EA 5E8YA 2PYWA 1R0PA 2VX1A 3TL8A 5IQCA 2GS2A 3CPBA 4IJ9A 4PY1A 4XG8A 3E88A 1YDSE 4FV9A 4NFMA 4PPAA 4WSQA 4XHKB 2GNHA 3HMIA 5F9EA 2OGVA 2V0DA 3QUEA 4CV9A 3QAME 4HVGA 4RG0A 2EU9A 3LW0A 4UN0C 3DT1A 5IQDA 4TNDA 5HX6A 2EXMA 3QHWA 1DS5A 2ZB0A 2VWZA 3PE1A 4QMPA 1BMKA 4OBPA 2GTMA 5HEZA 2HZ0A 1WZYA 3DDQA 4M84A 3CGFA 3SQQA 3UIXA 3R6XA 2EXEA 2BZIB 2GHLA 1P2AA 4UWBA 5CSWA 4E4LA 3EWHA 4YURA 2Q0BA 4OTDA 3LVPA 3BHVA 3FY2A 1PMEA 2IW6A 5LVOA 4G16A 5IA4A 5CTPA 1SYKA 4DEAA 3FJQE 1LPUA 4MBLA 4D5HA 4PMMA 4QMOA 5EQPA 3E62A 4CT2A 5CAPA 2WTKB 3CQUA 4HVDA 4PTCA 4D2VA 2UZWE 3PFQA 4FKUA 4WBBB 4FBXA 1REJA 5FM3A 5F94A 2CNVA 4F7LA 4FKGA 4UYNA 4JBPA 2IJMA 5IA5A 4EH2A 5CALA 2F49A 4UB7A 2XJ1A 4GMYA 4O0UA 3UDBA 4C0TA 2YIYA 2WIPA 3V6RA 4HJOA 3QQKA 5IISA 2HELA 4I0RA 3ZEPA 3FKLA 5IA1A 3TCPA 3HV4A 3LKMA 2P0CA 4XOZA 1IASA 3QRTA 5I9WA 3MDYA 3WYYA 3HMMA 3ORNA 3I0QA 4RRVA 4IVAA 5KMJA 3EQBA 5C27A 4TT7A 2WTWA 4WSYA 4ZTNA 3GXLA 5FBNC 2IZRA 5HNBA 4KRDA 5A14A 2YDJA 4EC8A 2JDRA 5EYMA 2FUMA 4QYEA 4B8MA 2C1AA 3OWKA 1CM8A 4BYJA 4Y5QA 2BUJA 2CCHA 3I7CA 3SRVB 3I5ZA 4QOXA 5CF4A 4F7SA 5I3OA 1YI6A 2UV2A 5C8MA 3H0YA 2EWAA 2QKRA 3BEAA 4S32A 4RQKA 4E4MA 4FE2A 2GQRA 5GJDA 3W32A 5CVHA 3CEKA 4L7FA 4YZMA 3UIUA 3I1AA 1APME 4DH1A 1H1PA 5EKOA 4RIXB 4WHZA 1YDTE 4EH4A 3ZM9A 1Q3WA 2W1FA 3FSKA 3OCTA 5LJJA 5IH5A 4A9UA 4IAKA 2PPQA 2X9FA 4BHZA 5AMNA 2H96A 4N57A 4AXAA 3BYVA 4ZLZA 2OJIA 2XKFA 5D11A 4I5MA 4U9AA 3GC0A 5HICA 5CX9A 3VW6A 3I6WA 5BVNA 2Z7SA 3B8RA 4IXPA 4PPBA 5HOAA 3F3VA 4M12A 3RP9A 5JZNA 2PUIA 2CSNA 2V7OA 4ZZOA 2I0YA 5FBOA 2C6EA 1P4OA 3PZEA 4FIHA 4TW9A 4XG7A 1OUKA 3EFJA 3HVCA 3QTRA 4Z55A 1XWSA 4BCPA 5AA8A 2UZLA 4XV1A 4FKLA 2ITNA 4RIWA 3QC9A 2JDSA 3A7IA 2F7XE 5CSXA 4CQGA 2F7ZE 4EBVA 3TNWA 1WBTA 4AOJA 3QALE 3PIZA 5DT3A 4FGRA 1GOLA 5D41A 1YHSA 5HKMA 2YLFA 2W7XA 4RLLA 3DPKA 4LYNA 5AP2A 3A60A 2QOQA 4NKSA 3MI9A 3GU5A 4EK4A 2HW7A 5AV0A 1Q62A 1U59A 4CTCA 3O7LB 3SVVA 2GHMA 3BLQA 5HLPA 4CKRA 4CFVA 2WNTA 4O7ZA 4AF3A 4PNKA 3IQ7A 4JDJA 2Y9QA 3F3WA 4ZOGA 3NPCA 4KKEA 3UVPA 2BRGA 4FV8A 2GNIA 4BDFA 5FD2A 1GJOA 1Q8UA 5KBRA 5AP0A 3RZFA 3MB6A 3FL4A 4C33A 3QZFA 3FKNA 5JFWA 2CKEA 2GDOA 3F2AA 1CKPA 2IG7A 2VTHA 4UXQA 5DVRA 3D7TA 2QOOA 5EHYA 2C5VA 2X7OA 3TV6A 2V5QA 4AX8A 5HO6A 2F2UA 4WRGA 2QODA 3UNZA 1WBNA 3L9MA 4F6WA 1YDRE 4L42A 4YU2A 2XNPA 4AG8A 4O83A 2GFSA 2PVYA 4KAOA 4G5JA 4YUQA 1UV5A 1A06A 4FZ7A 2A1AB 3W2CA 5FXRA 1VYWA 3FI8A 4AACA 4WIHA 3ULZA 4UZHA 4Y95A 2VTSA 4ZXTA 4JOAA 1BL6A 5BYLA 4DH7A 4Y85A 4QTAA 3C51A 4FZDB 4LV5A 1BX6A 2BMCA 4IW0A 3NW5A 3BYSA 1Q8ZA 3BHTA 2W1IA 3NUPA 5EDPA 3RM7A 3VBVA 4HW7A 3MBLA 4TXCA 5ETAA 3OCBA 3ZLYA 4DEIA 4DGNA 5GZ8A 3OWPA 4J52A 2BDFA 4F09A 4GG5A 4R77A 4NTSA 3FBVA 2WMXA 3HA8A 1H1QA 3DY7A 4FIIA 4BBEA 1YRPA 4OTPA 4FL1A 5M4IA 4FIFA 5IEVA 4TWPA 4W4YA 1YVJA 1WBWA 3PP1A 1OBGA 3IW5A 5L4QA 2E9UA 4S2ZA 4LGDA 4DFNA 3FMEA 3BU5A 3A8XA 3QRKA 5M06A 3U55A 3QTIA 2ESMA 4IWOA 3BQRA 2J5EA 1H08A 4I93A 3DQXA 4JG8A 1MRVA 4N0SA 4U45A 2VU3A 3DKGA 5E8UA 4BFMA 4L45A 1A48A 4QP9A 3N9XA 4QRCA 1H8FA 3FPQA 5J5TA 5L2WA 3CTQA 2W0JA 5K4IA 2YM6A 3KFAA 2UZTA 4K11A 5EFQA 2CCIA 4V04A 5CAUA 4HVSA 4WG4A 3D14A 4XG2A 4C2VA 1UKIA 2B53A 4FR4A 2W17A 4NL0A 2R3IA 2I7QA 3PVBA 3MSSA 3FLZA 3KVWA 5E8TA 5AR4A 3LFCA 3QUDA 1UWJA 2QOIA 4YLJA 2X81A 2BKKA 1OECA 4F64A 3EZRA 3F69A 1S9IA 3QRJA 4YJPA 4E1ZA 3LFQA 4EOSA 4CXAA 5CU4A 1ZRZA 4M0YA 4AAAA 2YM3A 5IA3A 5CAVA 4EWQA 5DG5A 3R9RA 3F61A 3NCZA 4G5PA 5HCYA 4EL9A 4FF8A 4I6BA 5IMXA 4K0YA 4QP1A 1XH5A 4EOKA 5AUXA 2WMAA 5LWMA 2HWOA 5CT7A 1JBPE 5I4NA 3GC9A 3IOPA 5HO7A 5AIKA 5L6PA 5ETCA 2ZV7A 3EFWA 2VV9A 3L8SA 2FSMX 3NSZA 3R01A 3F2NA 5AR7A 4BDKA 3V8SA 3GI3A 2WQOA 4YMJA 5HE0A 2UZDA 3T3UA 2QVSE 3G0EA 3TG1A 2A4LA 1OUYA 3COHA 1ZYJA 4LOQA 3QWKA 3C0HA 4R1VA 1ATPE 5AWMA 3DAEA 3FSFA 4QMNA 2X2KA 4OTQA 2BIKB 2R3OA 4I6FA 1F0QA 2VN9A 3GQLA 4CRLA 4EH3A 5ACKA 3TNQB 5AUTA 3GU4A 3OY3A 3OP5A 5HU3A 4DT9A 4FT9A 3JPVA 3LAUA 5L2IA 3VUKA 1TQPA 2C30A 5IUHA 3ACKA 3UBDA 3DAJA 4DT8A 3ORPA 1U5RA 2REIA 5AX3A 2WOTA 2YCRA 3R1SA 3PLAE 4DG2E 1E1VA 4AT4A 4C36A 3RPSA 3OD6X 3LMIA 3D15A 4PPCA 1W82A 5IQAA 4OGRA 1R39A 4AU8A 4XV3A 1M14A 3D5XA 3QGWA 4ACCA 3P9JA 4GV1A 4FV3A 4UWYA 4EH9A 2QLQA 3JS2A 4FOBA 3OC1A 1XJDA 3QD0A 3R7VA 4KINA 3FMNA 1ZYCA 3I4BA 3KU2A 3CBLA 2ZVAA 3QKKA 3AMAA 4HNIA 4EUTA 3OZ6A 4RWJA 4U44A 3FHRA 4OLIA 3QTWA 4BCQA 3ORXA 2C3JA 4D2PA 1P4FA 3KVXA 4FTMA 5GIOE 5T3QA 4CFXA 2X8DA 2WMTA 4CMOA 2EUFB 4HYIA 3SXSA 4GKIA 3DFCB 3ID6C 3ZEWA 2Z2WA 4XJ0A 3RJCA 3PXZA 3KN6A 4EZ7A 5CZHA 1TQIA 3IO7A 3GFWA 3FPMA 5ACBC 4Y73A 3B2TA 3OCSA 3KULB 4FT0A 1FPUA 1JKTA 3GNIB 5AFVA 4ALWA 3UMXA 1PXPA 3PJ1A 5I5ZA 2C5XA 4RX5A 3HRCA 4D0XA 4HCTA 3AGLA 2GFCA 4C38A 3MH1A 5A6OA 4RBLA 4K9YA 2VWXA 2WPAA 1JKLA 3TZ8A 1OPLA 3OUKA 5EQYA 2BPMA 5KMIA 4EHZA 4RVLA 3RALA 4GT5A 3E3BX 2WMSA 4DFXE 4N70A 3THBA 4EH5A 4M3QA 3BPRA 1GIIA 1TKIA 4KB8A 4U7ZA 5EYCA 3QCXA 2PE2A 2W9ZB 4XG3A 4DHFA 4ERKA 4IVDA 2HY0A 3UO4A 4FEXA 4GIIA 2OBJA 1JAMA 1URCA 1WBSA 3Q4CA 5A4EA 2JDVA 3ZLXA 4Q5HA 4ZMEA 2VUWA 2O5KA 2XNNA 4K8AA 4C4EA 4BC6A 4BTKA 3LQ3A 3IW7A 3TUDA 4PTEA 4D5KA
chains in the Genus database with same CATH superfamily
4E93A 4ACDA 2YA9A 4IB3A 5FWKK 3VS0A 4BCMA 1CSNA 3P08A 5M51A 4AOIA 2HYYA 1CTPE 1J7IA 4RA5A 3O96A 4ANSA 4DEHA 3MVJA 4KSPA 3D7ZA 1OMWA 1F3MC 2UZVA 4OBOA 3FLSA 2A19B 3QTUA 5KKRC 4G31A 3EQRA 3ANRA 5ANOA 3GU7A 3Q04A 1OB3A 5L6OA 1DM2A 3ENHA 3R1QA 5KUPA 4F4PA 2W1GA 4D1SA 3GP0A 3UYSA 4FEWA 5L8KA 4EKLA 5HVKA 5K5NA 1OIRA 4C4FA 5LOHA 2UVXA 5M56A 4J53A 4XYFA 3UNJA 4M67A 2YITA 4G3EA 2ZV8A 4DG0E 3TKUA 4MCVA 3D5VA 3MVHA 4KD1A 4J1RA 4PQNA 5C4KA 4CYIA 3LCDA 3QYWA 2QO2A 2YWVA 2W5BA 3G6GA 5HX8A 1SNUA 4C4GA 3WF5A 4D4VA 3IGGA 3KF7A 4R6VA 1LEWA 5CNNA 1PKGA 3OG7A 5EW3A 4TY1A 3LFFA 3UDSA 1ERKA 4BTFA 5DR9A 2VNYA 2C4GA 3IS5A 5DI1A 4ZEGA 5M4UA 5IG1A 3ANQA 4JG6A 2IVUA 2PVMA 4CYJA 2R7IA 4O2PA 1EH4A 3WILA 2VWWA 1Q41A 4GW8A 5AV3A 4FNZA 5D7VA 2XRUA 1OBDA 2XUUA 4G1WA 4L46A 4DHIB 3BV3A 3RAHA 3K3JA 3RI1A 4D28A 3TZ9A 4KRCA 4KIOA 3OWLA 3EN9A 3TV7A 4BKZA 3KMMA 3HMNA 3TNHA 1FMKA 4O4BB 2VTNA 5I9VA 4UV0A 4FGBA 4LMUA 4CCUA 2FGIA 3OF0A 4IWPA 4CLIA 4IQ6A 4NEUA 1ZMWA 3UIMA 1PJKA 3KCFA 4F9BA 3DXQA 3E87A 2HK5A 2JBPA 3LFSA 3W18A 3PG3A 3I60A 4L3JA 4WRSA 4L67A 3ZM4A 3MWUA 4I4EA 5A3XA 1SMHA 3OS3A 3QQGA 3BIZA 4BKJA 1J7LA 4E6AA 3SXRA 3ZCLA 2XA4A 3G33A 3U9CA 1KOAA 3C9WA 3UVRA 3EQPA 3E8EA 4QTBA 5CANA 2C3IB 3MJ1A 5IDNA 5KMNA 4ZTMA 2GMXA 3A7FA 2QR7A 3FLWA 4FT7A 3QTZA 3R73A 3TUBA 1BI7A 1Y57A 3Q6UA 2BHHA 3GOKA 5HNIX 3F3UA 3QWJA 3FXZA 4QYYA 4UMQA 2VTTA 5J8IA 2NRUA 1VYZA 2A27A 2YDKA 4ZIMA 4GVAA 4BDDA 2YCQA 3LHJA 1T46A 2I6LA 3EHAA 3WE8A 4G2FA 3R2BA 4RIWB 5J9YA 5CQWA 4DEDA 4BJJA 3K5UA 2ONLA 5D9HA 1P14A 3Q3BA 5KCVA 5I9YA 2VNWA 5CZIA 3VN9A 1XKKA 1UU3A 3BGZA 5BVKA 3EJ1A 4XS2A 5C03A 5TR6A 4I0TA 3LCOA 4MQ2A 5KZIA 4E73A 4YZNA 1ZLTA 2QG5A 2XEYA 5DOSA 1OZ1A 4CMUA 3A99A 3B8QA 3JVRA 3MN3A 4CMTA 4EK5A 5E8WA 2UW8A 3PPZA 2WMRA 3MVLA 4JT3A 3NX8A 4BZOA 5AM6A 3U51A 4QMQA 2Z7QA 4AN2A 4GG7A 4HPUE 1KE8A 1XH6A 4U8ZA 2JC6A 5HIBA 3IW4A 4TYJA 3CC6A 3CTJA 3RM6A 2J0LA 4FSZA 4W9XA 3PWYA 5L3AA 3O71A 4JL9A 5IDPA 3EH9A 3S2PA 2NNWB 2OLCA 4WG5A 3D7TB 2R3PA 4QNYA 3C4XA 1W8CA 3QXOA 1NXKA 4C3PA 5M07A 3D2KA 3CD8A 2XCHA 4O0SA 3T9TA 2Q0NA 1MRUA 5EM8A 5HLWA 3V8WA 1UU8A 2Y0AA 5J95A 3O8PA 5AV4A 2W06A 4GEOA 4YJTA 4C37A 4RMZA 3W2PA 3T3VA 3DZOA 1WCCA 1K3AA 4FTAA 4BCFA 3ZZWA 3ZC6A 3H4JA 2ITXA 4BDEA 3NYXA 4BTMA 1GZKA 1Z5MA 5B2LA 3F5XA 4D2SA 3Q5IA 4WT6A 4KUJA 3FQSA 2GNJA 5HG5A 3N4TA 5JH6A 1OL1A 3RCDA 3NS9A 3NGAA 3UVQA 3Q9XA 3RHXA 1FMOE 2ZFYA 1UU9A 2AC3A 2DQ7X 4QO9A 5KMOA 4DBXA 3R2YA 5FTQA 4FK3A 3BYUA 4DGGA 4IDVA 2P2IA 2XP2A 2QC6A 3HP5A 4NW5A 1WVWA 2GNGA 2IZSA 4FTRA 2V7AA 3P86A 2OH0E 1IRKA 4FTKA 1VEBA 4AGUA 1H07A 4X3FA 3VUDA 3BHHA 4U0IA 2XKCA 3BLAA 2ZDUA 2XM9A 4KBCA 2C47A 3OXIA 5I9ZA 4LGGA 1R78A 4I5PA 2CNQA 1ZARA 3RBWA 4M13A 4BKYA 4YZBA 4O81A 4FZFB 4KS7A 2BVAA 1JKKA 3WZDA 5EYDA 1K9AA 4GUEA 5EHOA 3R7GA 3TWJA 3PSDA 1Y6AA 2CN5A 2PZIA 2RFNA 3QU0A 4ITIA 4A9SA 4C58A 4DC2A 5IEYA 3TTIA 1KUTA 2VWVA 4I92A 3ZRLA 2X9EA 4XOYA 4DA5A 1SNXA 4EHEA 2C6KA 2WMVA 2C3LA 2G15A 4JR7A 3F82A 4QT1A 4QPAA 3PXQA 5E7RA 2W4JA 3QD4A 3BYMA 1ZMVA 5LMKC 4MD8E 3RPRA 1PF8A 2OICA 3MTLA 3UC4A 3KXMA 3DU8A 5H3QA 3VHEA 2VTPA 3I6UA 5CEKA 2XM8A 1FOTA 3SA0A 1YQJA 4BBMA 5DR6A 1O6LA 3UTOA 4F65A 3JUHA 3LQ5A 4DFBA 1W84A 2FA2A 1I44A 2XKDA 3D0EA 3HYHA 3LJ2A 4D58A 3V5QA 3NUUA 4AGCA 4MBIA 1R3CA 4EI4A 3DJ7A 4DTAA 4FTQA 2UZEA 4J8NA 5AAEA 3QQLA 3C0GA 3DBEA 2JDOA 1G8JA 3M42A 3E3PA 3ULIA 3UPZA 3IDPA 3UIBA 2JKQA 3I7BA 4IE9A 5CVFA 3R7UA 1KV1A 4ANNA 1RE8A 2HW6A 5BUJA 4R78A 2WTVA 5KKRB 4YJRA 3UG1A 4OTGA 3GB2A 4AZWA 1Y91A 4RLKA 4FKRA 4GT4A 4FODA 3QZGA 5AM7A 3RWQA 4W8DA 3SLSA 4A9YA 4F1MA 2IWIA 4C4JA 2NO3A 2O8YA 4Q2AA 4XP3A 2CGVA 2JITA 4O0WA 1VR2A 1OPJA 2VTAA 3DBCA 4FL2A 4JDIA 4MKCA 3BBWA 1Q4LA 2GCDA 5FP5A 2O2UA 4G3CA 4YTCA 2OU7A 4IWQA 3U4UA 3G0FA 2UVZA 3BV2A 3MVMA 4MVFA 3MB7A 2VTRA 4P90A 4PF4A 3UOJA 4H3BA 3RPYA 3ZOSA 4CFNA 4ZJVA 2ZM1A 4W9WA 3DFAA 4AA4A 2OSCA 5HBHA 4LG4A 4FV5A 5J79A 5KBQA 3BGPA 3Q5ZA 3FYJX 3VVHA 4AN3A 1ZY5A 3WZUA 2Y8OA 3P7BA 4FV4A 5CLPA 2PULA 2P2HA 3FEGA 3ZC5A 2QOHA 3BU6A 3UE4A 2PZPA 2YLEA 3FI3A 4O0TA 5CT0A 2PVJA 4C3RA 4Y72A 4XBUA 4A4OA 2UW5A 3LPBA 2V62A 4FNWA 4GK4A 4TTHB 5A54A 4FYNA 3ZZEA 4ACMA 5HBJA 1JSUA 2R3NA 4QPSA 4G3GA 1PMNA 2OXXA 2ZV2A 4FIJA 2J0MB 3ZO1A 5HIEA 2NPQA 5IH4A 5BYZA 2PY3A 4O21A 4XP0A 5EI6A 4NZWB 4ARKA 5D7AA 2C5OA 3ZMMA 3MIYA 4PL4A 4Z9LA 3AC4A 3COKA 4PP7A 2VTOA 2QLUA 2W5HA 4M68A 5FUTA 3FMDA 3FZ1A 4X21A 2R64A 3NYOA 4E26A 4X3FC 2QOCA 1PYXA 3G15A 4P5QA 4O0VA 4QMXA 4XP2A 3NVKI 3W55A 2UW3A 2QNJA 2OJGA 3GC8A 4JRVA 2CKQA 3GEQA 3R0TA 4KNBA 4C35A 2OI4X 4JAJA 3PZHA 4IAAA 3P79A 2ZM4A 4RVKA 2X2LA 4BCJA 3MFTA 1IEPA 1U54A 4O91A 1IAHA 2WD1A 5CWZA 2XIYA 2F7EE 3QKMA 5CEQA 3UC3A 3ZFMA 2PHKA 4GIHA 2QOBA 3P7AA 4ANQA 5D12A 4FTLA 3B2WA 5HU9A 4YLLA 2QD9A 3OW3A 2OZOA 4FUYA 5ANGA 5LVPA 2J6MA 4UALA 2GHGA 3C4WA 5JMSA 1J1CA 4PP9A 4IM2A 2GTNA 4YBKA 2QR8A 4AW1A 1KE6A 4X0MA 3OOMA 3R83A 1PY5A 3G6HA 3ZSIA 2XNBA 3V5LA 1PXOA 4O7RA 4GH2A 4KSQA 4UBAA 5KMLA 1H28A 4PV0A 3VQUA 5HE2A 3DAKA 4FKPA 4C2WA 3CGOA 2W9FB 4FKOA 2OXYA 3R7IA 3Q2MA 3R22A 4IZYA 2JIIA 3G9LX 5IKWA 5J5SA 2BILB 4YHJA 3W0QA 2YFXA 3NFGB 4DHJA 1H1RA 2JFLA 1QCFA 4NW6A 5HTIA 1KE7A 4PDSA 2JBOA 1FGKA 3WZEA 5BVWA 4FIEA 2Y4IC 4H3QA 4O82A 4HGTA 5HVYA 2QQ7A 3QUPA 4C3FA 4F08A 4IAFA 3U4WA 3E92A 4D1ZA 3D83A 2XK9A 4IAYA 4H36A 1W2CA 5C01A 3TJDA 5CF5A 3AT2A 1SVEA 3SD0A 1OVEA 4U6RA 3PE2A 4OTHA 5HO8A 3UP7A 5CXZA 2J9MA 5I0BA 3EN5A 4FVPA 4USDA 4BDBA 4DGLC 2J5FA 2XNMA 4CVAA 4R7HA 5HGIA 4OAUC 2I0EA 3DOGA 4GVJA 2Z60A 3FYKX 3NFFB 4AFEA 4IVCA 5DYJA 3TIZA 3U6JA 1M7NA 1H1SA 3PJCA 4RFMA 4F1TA 5FDPA 3MV5A 3FQHA 2ITWA 4XLIA 5FRIA 2WQBA 4YSMA 4F78A 1YWVA 4NM3A 3AD6A 3R28A 4FYOA 5IQIA 2PZ5A 5HE1A 4F6SA 2RL5A 2HAKA 3AMYA 4AW5A 5CSPA 1PXMA 3HAVA 4ZMFA 5CEPA 3PPJA 3OVVA 2HXLA 5DIAA 3L1SA 3FHIA 2RKUA 4UX9A 1YXVA 2JD5A 4CG9A 3EYHA 5EW8A 5L8LA 3GOPA 3PVUA 1OL6A 3R7OA 3R9HA 4EQMA 4IDTA 4QP4A 1WMKA 3AQVA 4LRKA 3W10A 4C34A 5HG8A 1V1KA 5TOZA 5CASA 2XK6A 4F70A 3K5VA 2BR1A 1YW2A 1Q5KA 5JRSA 3TNPC 4EJ7A 1XQZA 3EN4A 1JKSA 1KOBA 3LXNA 2QU5A 4PTGA 2I40A 4OR5A 4PDPA 5K9IA 2QOKA 2CDZA 2QONA 3HZTA 3KMWA 3C13A 3DB6A 3SOAA 4F99A 1WBVA 2ITOA 2BZJA 2Y6OA 2EVAA 4TWNA 4E4NA 1OKWA 1U46A 1WAKA 3MPMA 3ZTXA 3DTCA 4WBOA 2PWLA 4MHAA 4WOVA 1XBCA 3H30A 4MNEA 5IQGA 3EB0A 3OXTA 1PW2A 4J7BA 5FQDC 1JWHA 3CJFA 4H58A 4DTKA 1BUHA 2HCKA 5TKDA 4JX3A 4LRMA 4EWHA 2LGCA 3QYZA 4FNXA 4FKWA 4D2WA 2VWIA 4RWLA 2B9HA 1J91A 3LM0A 5IZFA 3MW1A 3P23A 2OF4A 5C4LA 5EI2A 1QMZA 4JQ7A 3KY2A 4O7YA 3WIGA 4IB1A 3ZUVA 3F3TA 2ITPA 2OH4A 4TYHA 2R4BA 4FG7A 4K2RA 2X0GA 3VAPA 4UMTA 4FSMA 1H24A 3W0MA 1OL5A 3KXNA 5M08A 5G6VA 3DK3A 3AC3A 3NIZA 3MFUA 3WI6A 2I0HA 5KMKA 4CG8A 3ZFXA 5CEIA 1KE9A 1ZOGA 4GSBA 2I0VA 4GU6A 5EI8A 4CKJA 5AP1A 1M2PA 5DNRA 4I1ZA 4AXFA 2BALA 3PY1A 5B0XA 4BJJB 3A4OX 2F57A 4ENXA 5JQ5A 2RFEA 5F4NA 4AGDA 4JX7A 4FSRA 3QQFA 2NRYA 3QCSA 1XR1A 3FDNA 4ZTSA 3GT8A 5IQBA 1OKVA 4O0RA 3SG8A 1X8BA 3QGYA 3R1YA 4MK0A 3VBWA 3CSVA 3C5IA 3NZ0A 3SXFA 2R0UA 2C6MA 5KZ0A 3ZDIA 5AP6A 5BPYA 5EHLA 2RG5A 3AT3A 3ODYX 2RG6A 4U42A 1DAYA 3R8VA 3E7OA 3H9OA 4KKGA 4HYHA 5I3RA 5E92A 3ZBFA 2C0OA 3ZDUA 2BROA 3RK9A 3C4FA 4WO5A 3R1NA 4JRNA 4PMPA 1JLUE 4X3JA 2OKRA 4CT1A 3K3IA 3KA0A 3MH2A 5ANJA 2X1NA 2B54A 2CLQA 3SOCA 4YPDA 4D9TA 4NM5A 2GS6A 5DEYA 4GS6A 5AP7A 2XALA 4RWIA 1ZOHA 2JKKA 3V5WA 5HVJA 4J71A 4JIAA 3GQIA 4FKQA 4A07A 5BVEA 2FSOX 4IACA 1Q97A 3DV3A 4Y8DA 3DKCA 3PP0A 4MF0A 4FSTA 5F20A 4Q5EA 5H8EA 4O7WA 3C7QA 3BCEA 2BAKA 1OPKA 4OT6A 4G34A 2UW0A 3OFMA 5I9XA 3VQHA 5CF6A 4QYGA 3O5AA 3QTXA 4W4XA 4ALVA 3F7ZA 3VIDA 2BFYA 2R3FA 3QZIA 2R3LA 3E7VA 4FKSA 4D1XA 5H8BA 4ZK5A 5KE0A 3O51A 2VTIA 2J0JA 4JQ8A 4I24A 4K18A 4QMYA 3A8WA 2IO6A 3HNGA 3HDNA 2XNGA 4JDKA 4NT4A 5ANDA 3L8PA 3TTJA 2BRMA 3O8UA 5JGBA 2XNOA 4RVTA 2ZB1A 3DK7A 3H10A 3OY1A 3MTFA 3W1FA 3PFYA 3VC4A 4ZTLA 4EK8A 3JR1A 4X3FB 2F4JA 2OIBA 5BUEA 2YM7A 1UNHA 2E9PA 4UMRA 3VS7A 5IUGA 3Q9ZA 2VD5A 4F7NA 1G8SA 3AGMA 3LCSA 4FOCA 4M69A 4V05A 5M57A 1AQ1A 4I6HA 2J0IA 4PWNA 5E8SA 4RZWA 2V55A 3VUIA 2YABA 1ZMUA 4NUSA 2HZ4A 4G6NA 2YZLA 3D9VA 4MXXA 2C6IA 1HCKA 2B7AA 5M44A 5GJGA 3FKOA 4FTTA 4EOLA 4YZCA 1TQMA 2R3RA 2P4IA 2VX0A 4TNBA 2GU8A 3LZBA 5KHWA 4ZTQA 5LCKA 3CPCA 3KRLA 3O50A 4HGSA 3NVMB 5DEWA 2YJSA 4FTNA 3VNTA 4CSVA 1REKA 1UU7A 5EG3A 4E3CA 1UVRA 4IX4A 4PNIA 4A4XA 5KHXA 4QTEA 4OAVB 3BGQA 5JRQA 5AAGA 1PXLA 2OJFE 2IPXA 2BHEA 4YHTA 5ANEA 4HVHA 3R8UA 3F2RA 4ZSAA 3AOXA 3ATTA 3KCKA 3UMWA 2YWPA 1GZNA 4O1PA 1ZOEA 3ZSHA 5GZAA 5IF1A 4HZRA 3COMA 3FL5A 4XRLA 4O0XA 3O0GA 2RFDA 4G9RA 2Y4IB 2CGUA 3EKNA 3FXXA 3MFRA 4RX8A 3JY9A 4WKQA 4DGOA 3VUMA 4E20A 3WOWA 2X6DA 4FKVA 4ITJA 4FV2A 4YJUA 3AC1A 3E8NA 3OXZA 2QO7A 4AT3A 3U54A 5HD7A 3EQDA 3P1AA 4BCOA 3BWJA 2C6DA 2PUNA 5D1JA 3NUSA 3DBFA 3HGKA 3R8ZA 5A4CA 3PA5A 1CDKA 2PVKA 2YAAA 2AC5A 3F5GA 4IC8A 4MF1A 4ZY4A 2WHBA 2UW4A 2XBAA 4IC7A 4YJQA 2ZYBA 2VAGA 2YIXA 3ATSA 2R7BA 2WTJA 3EFKA 4IANA 3RAWA 4PMSA 2IZTA 1Y6BA 1ZY4A 4FVQA 3TV4A 3M2WA 5DE2A 4D4YA 1V0PA 2HZNA 4ASZA 3BE2A 1DI8A 1MUOA 4NM7A 4XUFA 5M4CA 5DRBA 1XMLA 4RJ8A 3NYVA 4Z7HA 4I4FA 3LXPA 1FVVA 1RJBA 4R7IA 3KKVA 4BY9E 4WNKA 2YCSA 4QTDA 3PRIA 2JIVA 3AD4A 4YC6A 5KNJA 3V51A 5EW9A 4ASXA 2XMYA 4WA9A 4IX3A 2C5YA 5CQUA 5FXSA 3GVUA 4Y5HA 4A06A 5BVOA 1B6CB 3CJGA 2CJMA 3G51A 5EKNA 1G5SA 3PY3A 5T68A 2FYSA 3PVWA 4RVMA 3MYGA 3D5WA 4BZDA 4GL9A 3DXPA 2YM8A 1K2PA 4IZ7A 4TPTA 1GZ8A 3BQCA 4J97A 4QMZA 4U41A 2XIZA 3ZUTA 2ETMA 3COIA 2HENA 4KBAA 4MQ1A 3PY0A 4WG3A 4D2TA 2AUHA 5A4TA 4O1OA 5H9BA 3NNXA 3OT8A 3C4ZA 3QTSA 3RPVA 2B0QA 3DNDA 3WF9A 1QL6A 2EB3A 1G3NA 4CCBA 3RHKA 1YHVA 3GCQA 3Q4UA 3JYAA 3KB7A 1YWRA 5KO1A 3UDZA 2ZDTA 3NW6A 3OT3A 3ZH8A 3RZBA 3EN6A 1ZZLA 2WMBA 1J3HA 3UZRA 4EOPA 4Z3VA 3PWDA 5FEQA 4R3RA 2W5AA 5IEXA 3NMUF 1Z9XA 2XJ2A 3QLGA 1PMVA 3NIEA 3TDVA 2DS1A 3GBZA 1XH7A 2W4KA 4XG6A 4F9CA 5AUVA 5G1XA 1U54B 3KK8A 3ERKA 2YM4A 3CR0A 5L2QA 5C1QB 5TO8A 3WIKA 1NVSA 2C68A 3VJOA 3GCUA 4AA5A 1AD5A 3IW8A 4G3DA 3PJ3A 1NVQA 5LQFA 3G9NA 3IGOA 2W96B 3OEFX 1OKYA 5FTOA 4BDIA 3DS6A 3HMOA 4FV0A 3REPA 4U5JA 2BFXA 1SVGA 2WTKC 4GK2A 3BKBA 3FMMA 2XRWA 4MXAA 5B7VA 5M53A 2XZSA 3KRRA 3KIOC 3DBQA 5EOLA 4U81A 4FVRA 2YERA 4P4CA 3RWPA 4FKJA 5CAQA 2XKEA 4QDVA 5DRDA 2VO0A 2W05A 4H3PA 1U4DA 4IWDA 2XYUA 3UO6A 4PX6A 3I81A 4YJOA 4HVIA 4NFNA 3HRBA 3AXWA 4V0GA 3ML1A 2BDJA 4DEEA 4I5HA 3U9NA 2ERKA 3WARA 3IDCA 3F5UA 4ANBA 2F9GA 2XEZA 5GIPE 5LMKA 2CGWA 2YCFA 4YHFA 2ITYA 2BDWA 5BX0A 3LFEA 4BIEA 3KK9A 3W2RA 4CFFA 4EC9A 3GGFA 3R9OA 3I0OA 3OCGA 3S3IA 4IBMA 4DCEA 3GU6A 2VTJA 4KIKA 1STCE 4L8MA 2YZAA 3UZTA 1OI9A 4HPTE 2CLXA 3GCPA 3UYTA 5K4JA 4RC4A 5T6KA 5CYIA 4X7QA 3HV5A 4WUNA 5C8KA 3ZRKA 2WB8A 1LEZA 4BVUA 3FMLA 5C26A 2JFMA 1OL2A 2O3PA 2XF0A 3H9FA 3O23A 3PTGA 4J8MA 4LL0A 4O96A 4YBJA 3T8OA 3SW7A 2CHLA 3D2IA 4C7TA 2A0CX 2RF9A 2VGPA 2PZYA 3OWJA 2W99B 3NAYA 2B9IA 4F6UA 4FA2A 4OTIA 3EL8A 1Y8YA 4E6DA 2WGJA 3V5JA 4NJ3A 4BGQA 4RQVA 3VS2A 2IVTA 4PL3A 5CI6A 3ZUUA 3PXYA 2XB7A 4F9WA 3PA4A 2G01A 2QHNA 3ALOA 3LOKA 2B55A 4MEDA 4DTBA 4JJRA 4LOOA 4XG4A 3V8TA 2HIWA 2UUEA 4L43A 4S31A 2DUVA 4TYGA 2C0TA 4DH3A 3HV7A 4A7CA 5CENA 4B0GA 5HHWA 1VZOA 2QO9A 3EQFA 2PUPA 1YOJA 3DQWA 4IX6A 4RT7A 4XMOA 4ZJJA 1YWNA 3HV3A 3BHYA 3IPHA 4I20A 4O4FA 4NTTA 4EH6A 4IVBA 3VBQA 1V0OA 2ETKA 3FLYA 4RJ3A 4FL3A 1CKIA 1NA7A 3W16A 2ZOQA 3EZVA 3HA6A 3Q2JA 4NCTA 3QD2B 4L44A 2R3MA 3W0NA 3AG9A 2J4ZA 4J96A 2IVSA 4D55A 3VULA 5CF8A 5E4HA 4TKSA 2XK7A 3UG2A 4QMUA 4GT3A 1KV2A 4QQCA 1OM1A 5JT2A 1GZOA 5IA0A 3S0OA 2R2PA 4MNEB 3FZOA 3KMUA 2W1CA 4S34A 4EQUA 2YEXA 4IM3A 5AV2A 4O0YA 4HYUA 3IDBA 2G1TA 4WUAA 4M7IA 4ZLYA 4PDYA 4UWCA 1PXKA 2CN8A 2GNFA 2PVLA 2UW7A 2X4FA 4LL5A 4RJ7A 4DITA 4L9IA 4M8TA 4YTFA 5E9EA 2EXCX 4G6LA 4GYIA 4YTIA 3GC7A 5ITAA 4C59A 2IW9A 4BBFA 1OIYA 4TYHB 5LVLA 3KN5A 2XCKA 2EB2A 5D10A 3ALNA 4ZZMA 3VO3A 4CZTA 5IQFA 1H0VA 1Q61A 5HTBA 5EDQA 3R30A 3DXNA 4AZEA 2G9XA 2VO6A 1WVXA 4P2KA 4YO6A 4EOJA 3U6IA 3L9PA 4RC3A 3ORKA 4I23A 4YJNA 5EM5A 3ZXZA 4RGJA 4XV2A 5F1ZA 1DAWA 2OIQA 1B38A 5J9ZA 5DN3A 2WAJA 2WZJA 2VRXA 4GCJA 3QXPA 4L68A 4QP2A 3VW8A 4IAIA 2XBJA 3ET7A 4LQMA 5CXHA 3PJ2A 3SKCA 3LLTA 3UPXA 3KXHA 4QPMA 3LE6A 3PPKA 3R02A 4RIYA 3LCTA 4X2FA 2C3KA 4AZFA 4YO4A 2ITQA 4LFIA 4EOMA 4UYAA 3QTQA 4QQJA 5CI7A 5HESA 3R9DA 4USEA 2R3HA 3KEXA 3TN8A 2WTCA 2O0UA 2C1BA 2Y7JA 3OBJA 3SX9A 1G8AA 2RIOA 4GYGA 2QOLA 4UXLA 4LRJA 4JG7A 4R5YA 3LFAA 3OHTA 4P7EA 4EJNA 3NUAA 2C6OA 4B99A 4JS8A 4BWPA 2QCSA 3LFNA 3MY1A 5HLNA 3CTHA 1NW1A 3FMJA 4RJ6A 4L53A 4BGHA 3PIXA 2X2MA 1TVOA 4I0SA 4IMYA 4CV8A 4IM0A 2OFVA 4JBOA 4GJ2A 1UNGA 4YR8A 3LFDA 4BDHA 4E5AX 3KF4A 5DT0A 4UEUA 4U97A 3BI6A 1P5EA 1L3RE 2X6EA 3OW4A 2ETRA 3CKWA 3NUXA 2WU6A 5LVMA 5LMAA 3NNWA 5LWNA 2X39A 5DHJA 2PZRA 2G2IA 4I3ZA 2WTIA 1GY3A 1SZMA 3D5UA 3ROCA 4C8BA 1IAJA 3NNUA 2R3JA 4YZDA 3QL8A 3UGCA 1W0XC 3MA6A 2OF2A 3UOKA 3M11A 4CFUA 3MIAA 5M55A 1WBPA 4FTIA 3V5TA 4IZAA 3VBXA 1GIHA 2Z7LA 4O7NA 3POOA 1M17A 3F7WA 3NNVA 5DGZA 4TZRA 5EM6A 4O2ZA 5FGKA 4C61A 3PSBA 3FZTA 3Q60A 4FC0A 3UJGA 3CIKA 3WYXA 3CP9A 4BCGA 1IR3A 4FRFA 3CKXA 4BYIA 2YIQA 4H1JA 3PYYA 4ANMA 4FI1A 1PKDA 3MFSA 3IONA 5K3YA 4BCIA 4O7TA 3NUNA 2WXVA 2YM5A 3PRFA 5JFXA 1PMUA 4NCTC 4ZY6A 4C4IA 3R63A 2R3KA 3Q53A 2XK8A 1RW8A 4FEQA 2HWPA 4CZYB 4FUXA 3ZBXA 3Q52A 4M69B 1G8KA 4O22A 2BIYA 3RINA 5C9CA 5IMEA 3RPOA 5BNJA 3ORLA 3LM5A 2OO8X 2GQGA 5IQHA 4FICA 1JQHA 2GS7A 3VRYA 5FG8A 4QP8A 4L3LA 4ZSLA 3BL9A 4HGEA 3G90X 1NVRA 3MESA 3QX4A 2X7FA 2J7TA 4CRSA 4Y46A 3SC1A 3ZYAA 2BRNA 1J7UA 3VS6A 5E8XA 3C4EA 4R5SA 3GUBA 1A9UA 3FMKA 3Q4ZA 4B8LA 4ANOA 4BTJA 4EZ3A 2CNUA 4H05A 4BWKA 4GFGA 3PA3A 3SAYA 3TEIA 4F0FA 3FMHA 3VJNA 3ZSGA 2Z02A 4FSUA 4L3PA 3QQUA 4AZSA 1B39A 4IADA 1ZZ2A 3R00A 5E90A 4EOIA 2J51A 2Y6MA 4ITHA 4M97A 5L6WL 1QPCA 2FB8A 4NIFA 3DTWA 4GU9A 3UNKA 4R1YA 4MNFA 5ETIA 3EOCA 3C0IA 4CZUA 5A6NA 3DBDA 4JAIA 5IU2A 1Q8YA 4I94A 3RAKA 3VS5A 2BAJA 4QTCA 4CGAA 3VHKA 5H2UA 1FQ1B 5A46A 3QCYA 4OTFA