2VNYA

Structure of pka-pkb chimera complexed with (1-(9h-purin-6-yl) piperidin-4-yl)amine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
total genus 105
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vnyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vnyA02
3UVQA 2YDIA 2GS7A 2ZV2A 4RVTA 3JVRA 5FTGA 4YP8A 4CVAA 4M0ZA 5EM5A 3BI6A 3HV3A 3AC3A 4MXAA 3FKNA 4APPA 2C6OA 4NJDA 4EQMA 4LMNA 4BICA 3HGKA 5D41A 4O6LA 1W8CA 2XJ1A 4M7IA 4XLIA 4QP2A 2WMUA 3DV3A 5JEBA 3F7WA 4AE9A 2QOQA 3RWPA 5AX9A 4RJ4A 4RFMA 4AP7A 5LARA 1H28A 3R63A 4RX5A 3CEKA 2H6DA 4N4SA 3ZO4A 4FV9A 4ALUA 3QQFA 3HX4A 3AC1A 3G15A 3OS3A 1Q8WA 4IIRA 2WOTA 1PMUA 4LL5A 4MNEA 2X39A 4QRCA 4BWPA 4C4GA 3RCJA 4E3CA 4MWIA 5CF4A 4GCJA 5AV1A 5LJJA 4DGLC 3MSSA 4MBIA 2XF0A 3OEZA 4IHPA 4IWOA 1FVRA 3QUDA 5EW8A 4I22A 2I7QA 4FKSA 4X2FA 2PVRA 3QRKA 4RJ7A 4V0GA 3V5JA 4A9UA 4WSYA 4XBUA 4FKVA 3KRRA 3MFUA 2OIDA 3UPZA 3LLAA 5LWNA 2GNIA 4ZTNA 2UZWE 4QYYA 3MWUA 2EUFB 3LXNA 1U5QA 2OW3A 2V5QA 3FUPA 3K5UA 4FIHA 4YJPA 3VIDA 4EYMA 2OXDA 3F3VA 4RQKA 4E4MA 4WHZA 5CYIA 4PPBA 4NZWB 3WZUA 4P2KA 5AM7A 3SG8A 4Q9ZA 4WSQA 3AC8A 4R1YA 4J53A 4B8LA 5M53A 2X7OA 2BVAA 5BNJA 4RX9A 5EYKA 4EQCA 3DPKA 3ZOSA 4PP7A 1QPJA 1H0VA 1UU7A 2AC5A 3OUNB 4UN0C 2IWIA 4FZAB 5CXZA 3UO4A 4GEOA 3R8LA 4RX8A 5CI6A 2YCFA 4NFNA 4OUCA 5DT0A 4EH7A 5IUHA 5DRDA 2ACXA 3W1FA 5CT7A 1YXUA 3K5VA 3LFDA 5K5NA 3SA0A 3VS3A 4EBWA 3Q52A 2LAVA 4UWYA 3BE9A 3FSFA 2OFVA 2YAKA 4P5QA 2XB7A 4YJUA 1JKKA 1CKIA 3MY5A 5HNGA 4GJ3A 4PDOA 4YU2A 4ZZNA 4ERWA 3I81A 5EDPA 1VJYA 4K18A 4E6QA 4YHJA 1WZYA 2G2FA 4FEXA 4R3PA 3VC4A 3KY2A 5DH3A 2W7XA 1WVYA 3Q60A 4BKYA 5HGIA 5CEQA 3UZRA 1G8AA 2P55A 1O6LA 3F5PA 1W84A 4MXCA 2C5VA 2NPQA 5JGAA 2Q0BA 1YI3A 3EL7A 4O7RA 4YO6A 4MTAA 4AG8A 1PY5A 3MS9A 4YZCA 2XP2A 4NCTA 5F4NA 2BDJA 3R7OA 4JT3A 2R0UA 3M2WA 2R3PA 3R1YA 4EC9A 3GU5A 4C02A 2BHHA 3UQFA 5ETFA 3ZBFA 4BDDA 2XM9A 2R3OA 3P7BA 2FVDA 1DAYA 5TT7A 3TNQB 2R3GA 3B8RA 3KKVA 5A3XA 4E26A 2ERZE 4PMSA 2X2MA 1NA7A 1T45A 2PY3A 3Q4UA 4YJOA 3QD4A 4B7TA 4E5WA 4XRLA 5TF9A 3TIZA 2RG6A 4O1OA 5HE0A 2X6EA 4CLJA 5IMXA 3PPZA 5HOAA 5FEQA 3H4JA 4D28A 3QA0A 4OBQA 3LFBA 3LJ2A 3ZONA 5CSXA 2PULA 3E64A 3QCYA 3FBVA 3QCQA 4Y73A 5BVEA 4HVGA 5KMNA 1Q97A 1ZYDA 3ZC6A 5IH5A 4WBBB 5JFVA 4FUXA 4K8AA 4AACA 2XIRA 3NCGA 1RJBA 5E8SA 2C0OA 3VW8A 3MY0A 3R04A 4CFMA 4DGMA 3COHA 3MPAA 3RPSA 3KULB 3UNJA 3WILA 2VTMA 4ORKA 3H10A 3CPCA 4TW9A 4HVDA 1Q24A 4U8ZA 3M1SA 4RT7A 4ZTQA 5AEPA 2XBAA 3VUKA 3MJ1A 4Y5HA 5H9BA 4DFZE 3W2SA 1I09A 4F1OA 1MRYA 4Z3VA 1U4DA 2HY0A 3O8PA 5E91A 4IB0A 1J1CA 1WAKA 2GNFA 3FMKA 4DFNA 1Z9XA 4EI4A 4CTBA 2X0GA 1MRUA 4ANLA 1I44A 2Z2WA 1E1XA 5FBNC 3I7CA 3DBCA 3ORXA 4NM3A 4EWHA 3ALOA 3GGFA 2VV9A 2X2LA 2QR8A 5ANJA 3WZJA 3VUGA 1NVQA 4PDYA 2Y8OA 3PUPA 3FEGA 2UZEA 4R6VA 4TYHB 4BHZA 1J7IA 3AG9A 3NLBA 3OP5A 4FTJA 5EQPA 1R39A 4RQVA 4O22A 2R3IA 3A62A 2FA2A 3MY1A 3Q04A 4IB3A 5EYDA 5E7RA 2PUIA 4JRNA 4AGUA 4IB1A 1JWHA 2G15A 2XNGA 3GQIA 4UWCA 2UW5A 2G01A 5IUIA 3IW8A 3FI2A 1HCKA 4Y83A 2NO3A 2NRYA 3KCFA 4YZ9A 2R3NA 3PA5A 3F61A 2IW8A 4DEEA 4EHVA 2HZNA 5F1ZA 3ATTA 3LFFA 2EXEA 3CJGA 4GV1A 2W99B 5AMNA 1FMKA 4V05A 3TKUA 3VUDA 4AW2A 5ACBC 2BFXA 2CN5A 5J9YA 4D4RA 5IPJA 4QP3A 1WBSA 5C8NA 4ERKA 2EU9A 2WMVA 2C30A 1APME 4LI5A 1JQHA 3GVUA 3IW6A 3MBLA 4L3JA 4W4XA 4ENYA 4USFA 3OWLA 4AAAA 3A7GA 1H01A 1XBCA 5LCKA 4MWHA 4YR8A 4JAJA 4AZFA 4QP9A 1VZOA 4IM0A 4O0UA 4YLLA 5EW3A 3ORMA 4X6QC 5K3YA 5FP5A 5LMKC 2BZIB 3DQWA 4D4YA 1YDRE 4OTWA 5E9EA 4QMPA 1PYXA 3QRJA 5AP0A 4DBXA 2G2HA 4R1VA 5KE0A 5HU9A 3KK9A 4EEVA 3MH0A 5DR6A 5L2WA 4DCAA 4FV7A 2ZVAA 2R9SA 4AN9A 2PMOX 4QTEA 4BR3A 3C5IA 3C0IA 1ZXEA 3GU8A 4RZVA 3NUPA 3LW0A 4AXAA 4ZLYA 3KRXA 1Z5MA 4FSUA 4LRJA 4EONA 3UG1A 4B99A 1ZRZA 3PE2A 2J90A 2PSQA 3NX8A 3QTRA 4RIWA 1TQIA 5DOSA 2QKRA 4U80A 4RWKA 4KWPA 3TTJA 3TNWA 2H9VA 5AA8A 3UPXA 2W1EA 4E6AA 2AYPA 5CEIA 3PG3A 4MQ1A 5AM6A 3V6RA 3D83A 4FV1A 2IZSA 4ZTSA 4L7SA 2R3HA 2C5YA 2R5TA 2C1AA 3F2NA 5EHYA 2B9JA 3O50A 1LEWA 3R21A 2F49A 4U3ZA 4QMNA 5HBJA 3IPHA 4JQ7A 2B1PA 5E8ZA 2XCHA 2B52A 3BBWA 4UMTA 3WF6A 5JQ8A 4YHTA 1O6KA 2C3LA 4YJQA 5IQGA 3R7IA 5AR2A 3PYYA 2V7AA 5CLPA 3WZDA 3NIEA 1HCLA 4FGBA 2Y9QA 5JGBA 3NYXA 4JDIA 1JOWB 4G5PA 1H1PA 4TWOA 3ZSGA 4BIBA 1QPEA 3QQHA 3SKCA 2X6DA 3RK9A 5GZ9A 4FT9A 4BZOA 4CV9A 3LFEA 2WQOA 1YDSE 5EI6A 5AP1A 3F82A 5CI7A 2XYNA 1J7UA 3U8WA 4DEHA 2VN9A 3ZC5A 5EYMA 5D10A 2R3KA 4MNEB 2C6DA 3TEIA 4YNOA 3IW4A 4O84A 3C51A 1XKKA 2BTRA 2ITXA 4L45A 1WCCA 4CNHA 2UW6A 1SNUA 3FLZA 4N6ZA 1JVPP 2RFNA 5ANEA 4BCJA 2B9IA 5ETCA 3HRFA 4UX9A 2WAJA 4V0GB 1OL7A 2C1BA 3EQBA 5E90A 4QP1A 1VYWA 4AN3A 4ANSA 1RDQE 2QO2A 3DU8A 4QYFA 4BKJA 4EK8A 4D2RA 2SRCA 2BKZA 4FNXA 4Z55A 4KIOA 3I5ZA 3BV2A 3VS7A 2DYLA 3C4XA 3UGCA 4B8MA 2UUEA 1SNXA 4R7HA 3V3VA 2IG7A 4APCA 4AA4A 1UVRA 4BI2A 4C4EA 1UNHA 2PMIA 1Q62A 3IQ7A 3C4EA 4O7NA 5C01A 2ITPA 1A9UA 5IEXA 3SXSA 2BMCA 5FTOA 4JIKA 4Z16A 2X8EA 4FVRA 3G6GA 4WA9A 5HVYA 2PE1A 3MH3A 5K4JA 5T68A 3NCZA 3VBQA 1FBNA 1WBPA 2YABA 3E88A 1YHWA 3NYOA 5A9UA 5C26A 3QC9A 4EH9A 1E1VA 4DAWA 3CBLA 3EOCA 3FZSA 3PIXA 4A9TA 2RFDA 3O71A 4QMTA 1G3NA 1OKVA 5EOBA 4U3YA 3M11A 4BB4A 4FL1A 3AMBA 4S34A 1ERKA 2XRUA 3BLQA 3FLWA 2A27A 2I0EA 3GB2A 1PMEA 4FTNA 3VAPA 3FI8A 4KBKA 4R77A 4FSMA 3PY1A 4FC0A 2JITA 4XG9A 2Q83A 4YJTA 5CWZA 4FV3A 5FLFA 4IZ5A 1IG1A 4EH2A 1WMKA 1QPDA 3TG1A 1UWHA 5TKDA 3OTUA 2XCKA 4YJRA 4USDA 5BPYA 2WIPA 4IX4A 4EC8A 2VWXA 4AT3A 1H07A 4TYGA 5HI2A 3RAIA 5KZ0A 2OLCA 3GBZA 5HU3A 2I0HA 2E2BA 3WF5A 3FY2A 5C4LA 3C9WA 2GS6A 2XMYA 5BYZA 4X3FA 3VS6A 1M14A 4O7WA 1ZWSA 3EN4A 3ZUUA 2WEIA 2ITZA 3DZOA 5FXQA 3U4WA 4OT5A 2WQEA 4IMYA 4BCOA 3MESA 1YI6A 3JY0A 5EHLA 2CSNA 3FMLA 2PU8A 4CFNA 3O17A 1U54A 1R3CA 1P2AA 3K2LA 4YTHA 3VS5A 4C38A 4O83A 4HGSA 2J5FA 4EJNA 2C68A 4K11A 4CT2A 3G5DA 2WU6A 3OCBA 3ANRA 4FSRA 4I6HA 5AV2A 1JBPE 4WKQA 4RPVA 5HTCA 1YI4A 3G6HA 5DNRA 5T6KA 1Q99A 5HKMA 3K3JA 3PLAE 3MB7A 2X7GA 2KTYA 5I0BA 1B6CB 5DHJA 1OIUA 2PE2A 2YM8A 4J95A 4RJ3A 5J7HA 4ZS4A 2RF9A 4L44A 3THBA 3FMJA 4D1ZA 4LFIA 1W0XC 3WBLA 4I41A 2UW9A 4QYHA 4BDAA 4DFBA 4O0YA 2OK1A 1TVOA 4JQEA 3AC4A 4BCPA 4EUUA 2EVAA 2F7XE 2WB8A 3OWKA 4DLJA 1IAHA 2OG8A 5EDRA 2W1FA 4ZSLA 5LVNA 5IQEA 3DKGA 2ITUA 3OC1A 4U79A 3FC2A 5AP6A 4EL9A 3R2BA 4UY9A 1UV5A 4HGEA 4ZSJA 4CKJA 4DTKA 2JD5A 3C5UA 3OOMA 2I0YA 1ZOGA 3FI3A 2CGWA 4QMQA 3C13A 3BU3A 2W4JA 2QOHA 3QCXA 4K2RA 5AFVA 3GU4A 3HZTA 1YWNA 4TYIA 5DPVA 4QPAA 3TV4A 2YACA 4NIFA 4W9WA 4HGLA 5FUTA 2WTVA 4FZDB 5IH4A 1ZYSA 4KUJA 2OO8X 3MFTA 1CMKE 4XV3A 5AA9A 4JXFA 2A4LA 4R3CA 5F95A 3AD6A 3NUUA 5E92A 5LMKA 3TT0A 2XNNA 4RRVA 3G0FA 4QTCA 4F08A 3ORTA 5CVHA 2ETKA 3MDYA 5CSPA 4EWQA 3HKOA 4KBCA 4KSPA 4FYOA 3PDTA 3KXHA 4G3CA 2GTNA 3HA6A 4QNAA 4QQTA 2HXQA 3TKHA 2WTKC 4GKHA 4E4LA 2XKFA 3DLZA 3ERKA 4RFYA 3MFRA 3FZRA 2C5OA 3VWAA 2JBPA 2X4ZA 4O2PA 4UXQA 1OUKA 3F3ZA 3KFAA 2WFYA 4GK2A 4HW7A 3SHEA 4YLJA 3Q2JA 3ZUVA 2Z7QA 1DM2A 2UW4A 2QG5A 5AP7A 5AR5A 3PWDA 4PTCA 1V0BA 2RFEA 4C34A 5IA3A 2WQMA 4ENXA 5JSMA 2FSLX 4FKQA 4RJ6A 2P3GX 3LQ8A 3GCPA 4UALA 4K9YA 3G9LX 3IO7A 4BWKA 3C0HA 2JGZA 2OH4A 4FK6A 2XNBA 5BYLA 3NSZA 4M14A 2NRUA 3EYHA 3OMVA 4RIXA 3MYGA 3TJCA 4QTDA 3KMMA 4KKGA 3MPMA 2HZ4A 3HMNA 4XMOA 3U51A 2BKKA 3F9NA 3IW7A 3H9RA 3HRBA 3RAKA 2B53A 5JFWA 4J96A 3SW7A 4KD1A 3VS0A 4W4WA 5A54A 3QRTA 5L8JA 3R8PA 4X21A 2IZRA 4HCUA 3ZSHA 3COMA 2YZLA 4FSTA 4DA5A 3RGFA 4DGGA 2OXXA 4FEQA 5AR3A 1Q8UA 4CTCA 2GQRA 4MVFA 2ZDUA 4MHAA 1R0EA 2VX0A 2JFLA 2RSVA 4GIHA 4EK5A 3UZPA 2QU6A 2JAMA 4ZK5A 3U55A 3QTQA 3QD3A 4C3RA 3ORNA 1M17A 4BDJA 1E9HA 2QOOA 3HV4A 2XEZA 3E7VA 4NCTC 5LVPA 2P2HA 3ET7A 4I0RA 4FG8A 2O63A 2CHLA 4HZSA 4IAAA 4GT3A 5JFXA 1ZMUA 4ANNA 4CSVA 4DE4A 4WRSA 2OJFE 4BDEA 3WE8A 4DHFA 3UO5A 2Q0NA 4NEUA 1M2QA 2UW7A 3DY7A 3PE1A 4B6LA 4LOPA 1L8TA 4YBJA 5FDXA 2VTOA 4C4HA 4TNDA 2PUUA 3SW4A 2YIXA 3JPVA 3QL8A 4YC6A 1FMOE 3KRLA 2ZV7A 2PMNX 4C2WA 1PYEA 2XKDA 3SRVA 3RJCA 3MA6A 3FAAA 4ITHA 2OU7A 2VUWA 2Y6OA 2OF4A 3EQRA 2IVUA 4DFUA 1JSTA 3IOKA 4AT5A 3C50A 4FIIA 4DTBA 3BBTB 3CP9A 4FV5A 4DH1A 1URCA 4UXLA 3MA3A 2O5KA 1NXKA 4BI1A 3AT2A 4FV0A 4L43A 3BRBA 4ZY4A 2QHMA 5M4FA 2GFSA 3ZO1A 5DE2A 5AADA 4E7WA 4WUAA 4G5JA 4RGJA 1JNKA 5FD2A 4JAIA 5J9ZA 3HA8A 4GRBA 2QO9A 3Q5IA 3T3UA 4DEDA 4YMJA 3FMNA 3BELA 2LGCA 4BFMA 4E20A 3PIYA 3RM6A 5EM8A 3UP2A 3OVVA 3EKNA 5IQCA 4TN6A 3ZBXA 3U87A 3ZS5A 5A4TA 3F2RA 3TIYA 3JUHA 4FEVA 4RG0A 4PP9A 2BDFA 4QP7A 3ZLYA 4RIOA 2HCKA 2JKQA 5E1EA 1KE5A 3PXKA 4ZP5A 3I4BA 3HECA 1PXNA 4U0IA 3ZRMA 4G3DA 4BDFA 4F6SA 4FKTA 3Q4ZA 4FTTA 2OIBA 2JC6A 4E6CA 3KF7A 4W4VA 3FV8A 3F88A 1P14A 4I23A 4Y85A 4NUSA 4QQJA 2PZYA 3EQHA 2PZ5A 3MIYA 4FK3A 2OZAA 4OW8A 1YXVA 2X2KA 5HICA 3R9RA 4TY1A 4BDBA 3B2WA 4IVAA 3RZBA 3WF7A 4BTJA 3NAXA 2YISA 1OPLA 4BL1A 5KX8A 3W2PA 3CR0A 3LCTA 3HLLA 2BPMA 1VR2A 4EK3A 4FEUA 4ZY6A 4IM2A 2VAGA 3SV0A 2XNPA 5L4QA 4H58A 2YZAA 2E9OA 5IUGA 2VTLA 4RC2A 5D12A 4AOJA 4FEWA 3G33A 2WMQA 4OTPA 4GK4A 2IW9A 4ZLZA 3KK8A 4FSQA 4U6RA 2R7BA 1K9AA 1U54B 1OPKA 2B55A 5A46A 5L6OA 4G31A 4BGGA 3OT8A 4DEBA 1P4OA 5HD4A 3ODZX 3Q5ZA 5LCJA 3NAYA 3PVGA 4PQNA 4XOZA 5DBXA 4E93A 5A6OA 4V01A 3FQSA 5EDQA 4EHGA 5DEWA 5HBEA 2OJ9A 1BX6A 4IAIA 3A99A 4LUEA 4ANQA 1PXOA 4NT4A 3OWJA 5D7VA 5HQ0A 4CFXA 4L53A 5BVDA 4ASDA 2OKRA 3EQIA 4IE9A 3SXRA 2VTRA 3OFMA 2BRNA 4FT0A 4P5ZA 4AW1A 4GKIA 4F64A 1GZOA 4Z7GA 2XK7A 4FSZA 4IQ6A 2UZNA 2CKQA 1A06A 4XG6A 4WNOA 2BAQA 4FG7A 4Y8DA 4DGOA 1ZYLA 3LXKA 1J91A 4NKAA 5JFSA 5CX9A 4H3PA 1QL6A 5IQDA 1PW2A 3NGAA 1WFCA 4FSWA 5DYJA 1XBAA 5AWMA 1PXIA 2J5EA 2JDRA 3PJ8A 4JQ8A 4UMUA 4H3QA 4PY1A 5I3RA 3EMGA 4ZSGA 3QC4A 5GJFA 4C33A 5LMBA 4EZ5A 2UVXA 1H1SA 4GH2A 5KNJA 1KWPA 3WYXA 3ZLXA 4D9UA 1W98A 3H30A 2QNJA 5AR4A 4O7TA 1YWRA 1ZMWA 4F4PA 2XM8A 3D9VA 3LMGA 1ZZLA 3EZRA 4FG9A 4F6UA 3B8QA 2Z8CA 2JDOA 3HDMA 4RFZA 3SXFA 1H0WA 1UU3A 4W8DA 5HE3A 4WBOA 4F7LA 2CNQA 4YSJA 1K3AA 5J87A 3D5UA 4ID7A 4PPAA 3F5GA 3FLNC 3DK7A 3PZHA 4FTLA 3DBFA 4YJVA 4WD5A 3T3VA 3KL8A 5CSHA 5BVKA 3QRUA 4D0WA 3MVHA 4IW0A 4RZWA 4GVJA 3Q4TA 3DXQA 3WOWA 2CMWA 1PXLA 1UKHA 4C3PA 3L8XA 2W1HA 2ZB0A 3F2AA 3HDNA 2F7EE 4O91A 4ASZA 1JSUA 2UZLA 3CTQA 5L6WL 4BCQA 5E4HA 4L9IA 2C3IB 3QBNA 2OJJA 2ZV8A 5IA0A 3DKFA 3BE2A 3QYWA 5HO8A 3P9JA 4BCIA 3BLHA 3BU5A 2PE0A 3R1NA 1BL7A 5HLWA 4CT1A 2YN8A 5BVOA 1PXPA 2GTMA 2CDZA 4U9AA 2PMLX 2C47A 3VUTA 3N4TA 3KN6A 5E1SA 1SZMA 4U45A 2PL0A 4TRLA 2CLQA 4H39A 4YGAA 3EFKA 4IAYA 1SYKA 4JVGA 4OBOA 5AP2A 3UC3A 2YIRA 2RL5A 3TZ7A 3GFWA 4RIXB 1H1QA 2F4JA 1IR3A 2BRMA 3TL8A 3VF9A 4CZTA 2E9VA 4L46A 3LFCA 3S1HA 2RGPA 4ZJVA 3RMFA 5C8KA 1UKIA 4OR5A 2BAJA 1OECA 1OITA 3ZMMA 3ID6C 3Q9YA 2WKMA 2WD1A 1KV2A 5KHXA 5GIOE 1YOJA 1NW1A 3OXTA 5TO8A 2VGOA 1STCE 3FMHA 3ULZA 4IC8A 4RMZA 2GHGA 2IJMA 2YDJA 3QUPA 2C4GA 2YIQA 1YKRA 3HP2A 3BYOA 5AUTA 2WTWA 3Q6WA 4G6LA 3F5XA 4CD0A 4J7BA 4J71A 4FTKA 3R6XA 1ATPE 4TWPA 3DDQA 3IKAA 5AP3A 2VTNA 1X8BA 4FF8A 4D1SA 2FB8A 1R0PA 4PTEA 4EKLA 4RIYB 2PVFA 2B4SB 3D4QA 3H9FA 3DXNA 3WIKA 3R9DA 2YFXA 2GCDA 4EJ7A 4G9RA 5C1QB 1Q5KA 2O65A 4GU6A 4QO9A 4I5PA 4XJ0A 4X3FC 4O7SA 3QQUA 2XA4A 3N4VA 4BBMA 2Z7LA 3RM7A 3GT8A 4OBPA 4AZVA 4Q5HA 4BDHA 2R4BA 4E5AX 3HV5A 5F94A 2B54A 1UU9A 4R3RA 2E9UA 3RVGA 5DGZA 1PHKA 3AC5A 5HNIX 4HYHA 3ZH8A 4IX3A 3O8UA 4KB8A 5DT4A 3UYTA 5CAUA 3POOA 5IDNA 4J52A 4FE2A 4GL9A 4QQ5A 5ITAA 2HZIA 5LVOA 3SRVB 1QMZA 4PNIA 4BY9E 2Y7JA 3JS2A 4V04A 4W9XA 4IADA 3TXOA 2OH0E 5JRQA 2BTSA 5BVWA 4YTIA 4I5CA 5GZAA 1YQJA 2WOUA 3SOAA 3L9PA 3QGYA 4JL9A 4MD7E 5IQIA 4QMMA 4MD8E 4DG0E 3LCSA 5FXRA 5GZ8A 1IA9A 2QG7A 1OGUA 1KE6A 3PG1A 1Q8YA 3E92A 3NPCA 3A7JA 4I92A 4HNIA 2EWAA 4FIEA 2Z02A 4ZS0A 1MUOA 2W1IA 2DS1A 4IZYA 2VTTA 4YTFA 5A6NA 1F5QA 4BWXA 4ZY5A 3CJFA 4RJ8A 5AUZA 4OTHA 2ITWA 4IDVA 4LOOA 3QHWA 2BZHB 3FZPA 4FKIA 4BDKA 3GI3A 4KSQA 4AWIA 2DWBA 2BR1A 3NMUF 4EH8A 3DTCA 1YXSA 3HEGA 4DT9A 4OLIA 3KMUA 2WGJA 2VTIA 5DIAA 4FNYA 5B2MA 3EFWA 2O2UA 3W10A 4L6QA 3KEXA 4KIKB 2UV2A 3QFVA 5EI8A 1YVJA 3PPJA 2UW3A 4JDKA 1PKGA 4IFGA 2XNOA 3NNVA 5FM3A 2PVMA 2BZJA 3EHAA 4QT1A 2CJMA 4I93A 5AV4A 3QHRA 3PJ3A 4XG4A 3BV3A 3KCKA 2OZAB 4DCEA 3FPMA 1AGWA 1H8FA 3LJ1A 3ORPA 3C4WA 5DWRA 3VF8A 4AGDA 4Q5EA 3MPTA 4HNFA 4NM7A 3HAVA 2JDTA 3A7IA 1JKTA 3RAHA 4FR4A 2FH9A 3R1SA 4PX6A 3N9XA 3OZ6A 4XX9A 5KKRC 3NS9A 4D5HA 4DITA 5CZHA 3UOKA 4C62A 2GPHA 3HMIA 4YHFA 2H8HA 3D0EA 3R8UA 4EOKA 3COIA 4AW0A 2PVHA 2PVLA 1BKXA 5J79A 3RHKA 3SOCA 3LAUA 4ZIMA 3RTPA 4ALVA 5HIEA 3QQGA 5KZIA 3V51A 4O0VA 4CMOA 4DINA 1XBBA 4BHNA 3OXZA 2C5NA 4MF0A 4PV0A 3VJNA 3DOGA 3U6JA 4RWIA 4BKZA 3PSBA 3OD6X 4JIAA 4BF2A 3LCKA 4YO4A 4I4FA 4MBLA 2R64A 1XHAA 2UW8A 3ZFYA 3ZYAA 3OEFX 3R9HA 5DMZA 4GVAA 4UZHA 2C0TA 3PXQA 5CQWA 3TN8A 5IQAA 4XCUA 4FKGA 4ANBA 4RWJA 2HW6A 3U4UA 3FQHA 2OJGA 2VD5A 3E3BX 3ORIA 4S32A 4YJSA 3CIKA 4H36A 3DA6A 4EOOA 4GYGA 1Q4LA 4D2SA 5C4KA 4JR3A 4BVUA 3FSKA 3FI4A 4QMXA 5IF1A 4DH8A 4H05A 1J3HA 3GOPA 1ZYJA 2YJRA 1Y6AA 3GQLA 1UNGA 3PLSA 4IAZA 2O8YA 3NZ0A 4LV8A 4YZDA 2Y6MA 3TZMA 5L2IA 5AIKA 4TKSA 3OROA 4UBAA 3U9CA 3W8LA 3VVHA 3UG2A 2O64A 3MTLA 4CV8A 3HMPA 3VBTA 3W16A 2OSCA 5E8VA 3VHEA 1OKWA 3A8XA 2WMRA 1VEBA 3OCTA 1XH4A 2C6KA 2GNHA 5CVGA 3KVWA 4XP0A 3DNEA 2G1TA 5E8XA 5C9CA 5KCVA 4DF3A 3TZ8A 2WTKB 3UTOA 2J0LA 3HRCA 4I4EA 4RA4A 3GCSA 5ACKA 3SLSA 3V5TA 1XH8A 3BQCA 4K77A 3BWJA 3NEWA 1PF8A 2B9HA 4KNBA 5H2UA 4PMPA 5HTBA 3D2KA 2VRXA 3VBYA 5KO1A 5IA2A 1YOLA 2QI8A 3E93A 5K0KA 4IFCA 1Y8YA 3DBEA 4MD9E 4O27B 3VRZA 4IVDA 4EH5A 4BYIA 1IEPA 2I6LA 3FZTA 5AP5A 3RALA 4DEAA 1REKA 2IVVA 4FOCA 4R8QA 1OL1A 1UU8A 3A7FA 3DB6A 3OBJA 3R22A 4I24A 5HG9A 3TNHA 4I6BA 1ND4A 4XG3A 3RNYA 4ONAA 4F7NA 3AT3A 4EUTA 5BX0A 3K54A 2PVJA 2ZAZA 4MXXA 5D9HA 4GSBA 4KIQA 4F0IA 3MH1A 2RG5A 1OB3A 3GCUA 4E1ZA 1W83A 3AOXA 5M07A 2V0DA 4PNKA 2YWPA 3C0GA 5BVNA 1GY3A 1RQQA 4FTIA 1G8SA 4OAVB 1BYGA 4AZEA 3OCSA 4EORA 3PTGA 3DS6A 4G3EA 4KA3A 5HESA 2W0JA 4DN5A 4M69A 3LFAA 4GIIA 2PPQA 4DLIA 3NYNA 3CGOA 2X4FA 4U42A 3DFCB 4UZDA 3L1SA 5EK7A 5GHVA 3UJGA 3GCQA 5K4IA 5KMMA 5M44A 4ZMEA 3SDJA 5H8GA 4RLLA 5GIPE 2FSTX 4L42A 4MXYA 4NJ3A 5AAFA 1GZNA 3MH2A 4U7ZA 1SVGA 2PUPA 1H4LA 3PJCA 3GC0A 4HJOA 3PSDA 2BHEA 4CRLA 2REIA 5E8WA 3DJ6A 2YITA 4U97A 5A4EA 4CXAA 4BBEA 2QR7A 3DAJA 3ZHPC 4FSYA 2PVNA 4QP4A 3HAMA 3DAKA 2R2PA 3I0QA 1NVSA 2ITQA 3P78A 4EZ3A 3F69A 2ITYA 3W2QA 4BGHA 3DTWA 2VTQA 2X9EA 1DI8A 2XIKA 4NM5A 3BHTA 4R7IA 1Z57A 3RI1A 2UZVA 2XEYA 4F9YA 1EH4A 4LUDA 4ZAUA 4FV6A 3P7AA 5HEZA 5HX6A 3LM5A 5CANA 5I9YA 1H1RA 4AU8A 2XIYA 2A1AB 1OPJA 3KB7A 3Q53A 2UZUE 3E5AA 3FMDA 2J7TA 4AFEA 4X6RA 4G17A 4CGAA 4HPUE 2CGVA 5CS6A 3IDCA 5DFPA 2OICA 5DG5A 4UMRA 1RW8A 4QD6A 4A9RA 1GZ8A 2HZ0A 2GHLA 3TI1A 3NUAA 5IG1A 3QLFA 3QWKA 4I94A 2WU7A 5ANIA 5EQEA 4I1ZA 1PKDA 3BQRA 3BCEA 5IEVA 3AGLA 2UVYA 4AA5A 5IKWA 4FTOA 2P33A 3R9NA 4F09A 3F3UA 3QD0A 5DVRA 5TE0A 2W4OA 3P1AA 3FMEA 4RA5A 3UIMA 2W5HA 3FQEA 2WMSA 3H9OA 3VUHA 2Z7SA 3FXWA 3VJOA 3WYYA 3QTIA 3ZEWA 3U6HA 3EH9A 3QZGA 3AMAA 3IECA 5HORA 4IBMA 3I0OA 2QOFA 2V22A 3RCDA 2QODA 4DG2E 4G3GA 2I1MA 1PMNA 3OHTA 4IWDA 4QYEA 3G90X 1YDTE 5HCZA 3W8QA 2QCSA 3AMYA 3DT1A 3SX9A 5CAQA 5CU0A 4M8TA 1S9JA 3R00A 3EWHA 4NWMA 4PRJA 3VS4A 1GIIA 3R1QA 4EQUA 5KBQA 5JN2A 2IZUA 2W1GA 4JBQA 5EM7A 2ONLA 5L8LA 1MQBA 3O7LB 4DH5A 3PWYA 3I79A 1XH5A 2QHNA 3ITZA 5I3OA 3A60A 3PVBA 4RC3A 5HBHA 4EOPA 1BL6A 4MXOA 3KN5A 5BUJA 2IZTA 2Y0AA 3FZOA 3NUSA 2JKKA 2JKMA 3U9NA 1WBTA 2WHBA 3A4OX 4C4IA 2RIOA 3G51A 5ANOA 4TWNA 3UOLA 2QONA 3TUCA 5IQBA 2VWZA 4FKWA 4BIEA 2WMBA 2V7OA 2C5XA 2CCHA 4MYGA 4EH3A 4QMLA 2CNVA 1BLXA 5JZNA 5HD7A 4AUAA 4GFMA 4L68A 3TWJA 5D1JA 4F70A 4TNBA 1AQ1A 3PZEA 2VWVA 3F66A 1UNLA 2OFUA 2QC6A 2ZYBA 4MKCA 4FTMA 5AP4A 2ZOQA 3BHVA 1ZAOA 3C4FA 5IQHA 4L00A 3P5KA 3Q96A 2CCIA 2BROA 3D14A 4QMSA 3A8WA 5LVLA 1XH7A 2WMAA 2OZOA 3VO3A 3P4KA 2XH5A 1DS5A 3JR1A 4JG6A 3ZLSA 5ETIA 5EW9A 1XR1A 3TDWA 5M57A 2W1DA 3E87A 4O6EA 4MQ2A 2JLDA 5TOZA 4C59A 4CFWA 5M4IA 3PP0A 4FSNA 3SD0A 3QZIA 3GU7A 4N0SA 2C3JA 3UBDA 4BTFA 4QPSA 4H3BA 4A9YA 3DCVA 1BUHA 4RIWB 3CY3A 5HX8A 3ZSIA 1YHVA 1B39A 2DQ7X 3ATSA 2YA9A 1CTPE 3POZA 2BRGA 2EXCX 1Q41A 2VTJA 3D7TA 3TKIA 3CTHA 5L2SA 4ZSEA 1U46A 4IAFA 4BC6A 4C4FA 4XEYA 2CLXA 4JX3A 4UMQA 5L2TA 4F65A 2VWIA 4M97A 4EOJA 3BGPA 3QTXA 1NVRA 3ZXTA 4FTUA 2PUNA 1GIHA 3QCSA 2QLQA 2OBJA 3VULA 2YIYA 4OTQA 3NRMA 4S33A 4F1TA 4FZFB 3DK6A 3PSCA 4BCHA 2ITOA 4C58A 3UODA 5JGDA 1FGIA 4XV2A 3UP7A 4DH7A 4O38A 4O0RA 2HXLA 4ACHA 2X1NA 5KMLA 2J2IB 4L01A 3DNDA 1V0OA 4D4VA 1OBDA 2OGVA 2ZMDA 1M52A 2ZM1A 3LXPA 3NNWA 3UIBA 4AGCA 4YZNA 1KUTA 3CQWA 3QLGA 3S3IA 3GC9A 4DEGA 3DAEA 3OY3A 4ASEA 4Z9LA 3DK3A 3VQHA 3D5WA 4B4LA 3FYJX 3NUNA 3TACA 5KMKA 3EQFA 2VWYA 3IGOA 1U5RA 4EH4A 1R1WA 2YM3A 4F7JA 1G5SA 5EKNA 3SG9A 4QP6A 4YZBA 3ZM9A 4IX5A 4Q2AA 4O7LA 2WNTA 4A4XA 3P86A 3ZRLA 3FL4A 1WBNA 5JT2A 3ENMA 3LXLA 3R7EA 3EJ1A 4TYJA 3VNTA 4DGNA 5DR2A 2C69A 5K9IA 4GT4A 3L8VA 5IMEA 3BEAA 3IOPA 5ANDA 5LVMA 3I60A 1OL2A 4EOIA 2W96B 4C36A 3TUBA 4I0TA 5M56A 1FPUA 3LLTA 3CCNA 1BI7A 2XUUA 3FDNA 4QNYA 4YUQA 2DUVA 5M4CA 4YNEA 3NIZA 1JKSA 4YC3A 1O6YA 4AOTA 1XWSA 2VO7A 3GU6A 3BKBA 1XJDA 2VX1A 4M13A 2AC3A 5CF5A 5A4LA 3LCDA 4TXCA 1TKIA 4EYJA 4HYSA 2XKEA 2YHVA 4L7FA 4WUNA 4H1MA 4O0TA 4KABA 4GFOA 4M69B 5CQUA 3SGCA 4QMWA 5J8IA 4MK0A 4FVPA 1YRPA 4PF4A 3O96A 4CYJA 4TL0A 4NH1A 2FSMX 3IONA 4ANMA 4HYIA 4QTBA 5IH6A 4OTDA 3EQGA 2QOBA 3F3TA 4C61A 4P4CA 3ZDUA 3FHRA 3IDBA 2X8DA 4G6NA 4USEA 4OT6A 3HV6A 4L67A 2R3FA 4UEUA 3HV7A 4L52A 3P23A 4O0SA 5FG8A 4F63A 2G2IA 5FEDA 3CKWA 3OG7A 1IA8A 3MVMA 2WO6A 4FTQA 4IC7A 3MN3A 4LQMA 2Y4PA 2OWBA 3PP1A 4IXPA 4M68A 2PTKA 5I5ZA 5LQFA 5H8BA 5CNNA 5M09A 4Y95A 4O0WA 5AJQA 4CG9A 3Q32A 2V55A 3ODYX 3R7GA 4X3FB 3UOHA 3U54A 4D1XA 2P2IA 2X81A 1XH6A 3AD5A 2W05A 3DKCA 5J1VA 5HIBA 4O82A 2PWLA 4G6OA 1MRVA 3PVUA 4OTIA 3VS2A 2W1ZA 1Q3DA 2VU3A 1QCFA 3CQUA 3DDPA 4FT7A 4NW5A 5GINE 3NVKI 3R73A 5AV0A 3LJ0A 5G1XA 4FBXA 3S00A 3VQUA 2W4KA 3CD3A 3D2IA 3V5LA 4ZSAA 3SC1A 2GHMA 3QQLA 4I5HA 3QKMA 5DI1A 3VHKA 2C6TA 3KXGA 3ACJA 4BTKA 3ZFXA 4AZWA 3FE3A 2IVTA 1NY3A 3E8DA 3EN9A 4ZZMA 4AN2A 4I3ZA 1YWVA 2R0IA 4FV2A 4FODA 1XQZA 1OBGA 4KINA 1Y6BA 3RK5A 1L3RE 4AW5A 4NFMA 4ZTLA 4IZAA 3QTSA 4FMQA 2GFCA 4II5A 4EOMA 2O0UA 4UWBA 3MIAA 4FKUA 5I9ZA 2WZJA 3JVSA 1F0QA 3MI9A 4RVLA 2WXVA 4ZJIA 4JX7A 2R3LA 2A19B 2GDOA 2ITNA 2J9MA 3CY2A 3I6UA 2J0MB 4UYNA 3QTWA 4CYIA 4DYMA 4CKRA 4Y46A 3QF9A 4CMUA 4IACA 3D5XA 4FGRA 3S2PA 3TV7A 4J8NA 1J7LA 2PZPA 5BUIA 1RE8A 2ETMA 2R3MA 3UVPA 5ANKA 2H34A 4BGQA 5J5TA 4U81A 2XBJA 3Q2MA 4F1MA 3LFSA 1SMHA 4MAOA 3QD2B 3WE4A 4NIFB 3HYHA 2XK9A 2XRWA 4FT5A 4E5BA 4FIGA 1SVHA 4XNEA 4XV9A 3ZFMA 1F3MC 4B9DA 4C35A 5DR9A 4D55A 1OKZA 5AR7A 1SVEA 3H0ZA 2ITVA 3A61A 3FZ1A 1GAGA 3WIGA 3VUMA 5I9UA 4QMVA 4OTRA 3PXFA 2QVSE 3CS9A 4LV5A 2R3JA 2ERKA 5HG8A 3P0MA 2PVKA 5AV3A 3ENHA 3ZRKA 2EB3A 2NNWB 3QTUA 4R5SA 2WIHA 5DT3A 2F7ZE 3EL8A 5KKRB 4JBOA 3GCVA 4BTMA 3JXWA 3IG7A 3II5A 4L3PA 3E62A 4QP8A 4X2JA 2QOLA 2UZDA 3O8TA 3UO6A 2WQNA 4RVKA 3OXIA 5LMAA 3KGAA 5CXHA 4TT7A 5HHWA 3UNZA 2VZ6A 2XIZA 3C7QA 3L9MA 4J97A 4NM0A 1PXJA 2PK9A 3NNXA 5D7AA 2JKOA 3AQVA 3CC6A 2F57A 5HE1A 3R83A 2VO6A 5HG5A 4G9CA 3ZU7A 5IA4A 5EI2A 1SM2A 3IDPA 4DG3E 3UYSA 5IQFA 3V5PA 2AUHA 1GOLA 4WNKA 3CXWA 3R71A 4DH3A 3FHIA 2WPAA 4XP3A 4D2PA 4WIHA 4PL3A 3W32A 3TDVA 2A0CX 3KRWA 4FKOA 1ZY5A 2I40A 2ZDTA 3KA0A 4IJPA 3R30A 3RPVA 1REJA 3CLYA 3ZZEA 2PHKA 4GYIA 2HWOA 4IWQA 5T3QA 5AX3A 4QMZA 4KIPA 3VW6A 3REPA 5AUUA 2YLEA 4F6WA 3QALE 3D7TB 4ARKA 2BRHA 4GK3A 3C4CA 4HCTA 3V5QA 4BCGA 3DB8A 4WRGA 2JIUA 4AF3A 2YCRA 3PRIA 1MP8A 2XZSA 1JSVA 3C4ZA 5KHWA 5CTPA 4X7QA 1JLUE 4XG2A 2UZOA 4WO5A 1KOAA 1UWJA 5ETAA 3LQ5A 3D5VA 2JAVA 3QKKA 3KU2A 4NK9A 4KAOA 4AZTA 2GSFA 4M67A 3V04A 4YPSA 4GT5A 3VBWA 5BMSA 1WBWA 3G0EA 3KQ7A 4IVBA 5HO6A 2UW0A 5EQYA 2XS0A 3LHJA 2XK6A 3LPBA 4ALWA 3R8ZA 2QQ7A 1W82A 3OUKA 5EOLA 3W2RA 5CU3A 2YM5A 4CZYB 3UIUA 3SVVA 3PY3A 4CFFA 3GC7A 5FQDC 4EK4A 3Q4CA 4E4XA 3EB0A 5DRBA 4BDIA 2B0QA 4D4SA 4F9CA 3BYUA 1H25A 4D2WA 1URWA 3MFSA 5DA3A 4OTFA 3QXOA 4JBPA 3V01A 4B0GA 4IM3A 4EKKA 2C3KA 4OGRA 3O23A 5L6PA 2FUMA 4MCVA 4LL0A 1UA2A 4FNWA 3T9IA 2XK8A 1R78A 4FI1A 1ZZ2A 2O3PA 1CM8A 3CKXA 4JR7A 5EH0A 5FDPA 2BALA 3KXXA 3G2FA 4MH7A 4YBKA 4E73A 3O51A 4BRXA 3NDMA 3LM0A 3UMWA 2E9NA 4FIFA 5IISA 3PPKA 4K6ZA 4QPMA 4DT8A 3R7VA 4U40A 4ASXA 3EQPA 3A7HA 4PMMA 5KMOA 1O9UA 4GUEA 4E8AA 4QTAA 4C37A 5BMMA 3OY1A 3ORKA 2ETRA 3BHHA 4AX8A 3AT4A 2W9FB 3CD8A 2RKUA 3KRJA 4JI9A 3ACKA 3SQQA 3QWJA 4HCVA 4HZRA 3DGKA 4AT4A 1Q8ZA 1KE8A 3L9NA 4WOVA 5J7BA 4EBVA 2OIQA 1V0PA 3MTFA 4F0FA 2JIIA 2VTHA 3KF4A 4PPCA 3F6XA 5K5XA 1TQMA 2QOKA 3IW5A 3PJ2A 4PDPA 4M84A 3IK3A 3PVWA 1OVEA 4FNZA 5FGKA 3ZCLA 4CQGA 4EOLA 5CEMA 2V62A 2ONLC 5G6VA 5FTQA 4BN1A 2W06A 3NR9A 3OCGA 3DQXA 3NWWA 4IX6A 3QQJA 5AUYA 3FMMA 5HCXA 4GW8A 2YEXA 4BIDA 2VWWA 4WNPA 4DBNA 5AUWA 4BZDA 2VO0A 2ZMCA 2BDWA 5CU4A 4CCUA 4U44A 5BVFA 4Y5QA 4MF1A 4RC4A 4ZMFA 4I6QA 3WF9A 3BGZA 3M42A 1B38A 2YJSA 3MV5A 2GNJA 2UZBA 3GOKA 1V1KA 3ZEPA 4AFJA 3COKA 3LE6A 4O7ZA 4YLKA 3NNUA 3CE3A 3LFNA 4LYNA 3H0YA 4F0GA 5CENA 3UNKA 1HOWA 1PJKA 4JRVA 2XJ2A 4QYGA 5EM6A 2XKCA 3QAME 2B9FA 3QUEA 3OTVA 3Q9XA 2BUJA 4DEIA 4A7CA 5KMIA 4BCMA 5K0XA 2YCQA 4JS8A 4MX9A 5A4CA 1K2PA 2UVZA 3E8EA 3FYKX 5M55A 3UMXA 1OUYA 4RLKA 2ITTA 5FM2A 5ICPA 2HW7A 4JLCA 5JQ5A 3R01A 4GS6A 4JDHA 3TTIA 3RBWA 5HIDA 2EXMA 3H3CA 4OTGA 3BWFA 2CKPA 4GUBA 3VBXA 4FOBA 3TCPA 3OF0A 3V8TA 5H8EA 4EOSA 1KOBA 3ELJA 1YW2A 3W55A 1P5EA 3LQ3A 2P0CA 3RPRA 4MEDA 3ROYA 2HELA 4K33A 4ACDA 3NYVA 3VN9A 4AZSA 2BRBA 4YURA 2OJIA 3WARA 3LOKA 3RZFA 3ZUTA 2B7AA 4NYEA 4PDSA 4IVCA 3R2YA 5IA1A 3O0GA 3C1XA 2CNUA 2HWPA 3V6SA 2Y4IB 2YERA 3QQKA 2J50A 5E8TA 4HVHA 4ZOGA 5HE2A 1ZLTA 4O96A 3LZBA 4IJ9A 4R7BA 3GUBA 3O2MA 4X2KA 3R8MA 4N6YA 5L2QA 2XNMA 4DFLA 1YOMA 5GNKA 1NT2A 1Y91A 4RX7A 4FVQA 5AAGA 3WZEA 4QMUA 5TR6A 3W33A 4RSSA 3QXPA 2OF2A 2CN8A 4PL4A 3PXRA 1FQ1B 1TQPA 4PMTA 4D5KA 5HVJA 1FGKA 3GP0A 1H27A 1BMKA 2C6MA 2XJ0A 3MVLA 4C4JA 2HAKA 3KVXA 5HLNA 3UQCA 4O81A 3EFLA 2XYUA 4GU9A 3RNIA 5L3AA 5EHOA 1ZYCA 4QMOA 4I6FA 5M06A 1OI9A 3O7LD 5CSWA 3HL7A 4I0SA 4AE6A 4FTAA 4X2NA 4IDTA 4ZTHA 3ORZA 3GNIB 4WNMA 2C6LA 3P7CA 5J95A 5AUVA 3TV6A 3ANQA 1ZOEA 4GMYA 4JG8A 2CPKE 3LFQA 2ZB1A 3AD4A 3QX4A 1KE9A 4HOKA 5HCYA 2VX3A 2P4IA 2JDVA 3FKOA 4NTTA 2J0JA 1XH9A 3R7UA 1Y8GA 3BZ3A 5C8MA 5J9LA 3UE4A 1LR4A 5FXSA 3B2TA 4LRMA 3R9OA 5LXMA 4A4OA 3HMOA 2CKEA 4A06A 4MNFA 3RP9A 5CF8A 3FLSA 4CEGA 4IB5A 5KUPA 5C27A 4BI0A 3RINA 2C6IA 4GG7A 2IN6A 1JKLA 5CU6A 4XBRA 5DN3A 3Q6UA 2ESMA 3WI6A 4XG7A 2GU8A 4XS2A 3N4UA 4CFUA 1GNGA 2BIKB 4C0TA 1OL5A 2QO7A 3T8OA 4G34A 4ZLOA 3EFJA 4JBVA 3ULIA 2GNGA 4WG4A 1BI8A 5IZFA 2XK3A 4M15A 1CDKA 2F2CB 3ETAA 4O86A 4KBAA 4LGDA 3EN7A 2IPXA 5F9EA 1S9IA 2WTCA 5LWMA 2PZIA 1YXXA 5B2KA 3GC8A 1YXTA 3CSVA 3DXPA 4HGTA 4WG3A 2CGXA 2J4ZA 4PWNA 3TZ9A 4F9WA 4UB7A 2C6EA 5JRSA 3LMIA 4XH6A 4C8BA 3UIXA 2W1CA 5FWKK 5FP6A 4P7EA 1DAWA 1ZOHA 4CKIA 3LVPA 4GFGA 4QQCA 4UYAA 1QPCA 4ZZOA 3EKKA 3UOJA 1PXKA 3PXZA 4YJNA 1PMVA 2ZV9A 3QTZA 2Z7RA 4NU1A 4FZ6A 5HTIA 2FSOX 2YM7A 3K3IA 1ZARA 1LP4A 2HK5A 1KE7A 2X8IA 4EZ7A 4I5MA 3S95A 4NKSA 1CKJA 5CEPA 4HPTE 1JPAA 2W9ZB 3F7ZA 3W18A 4KRDA 5CALA 1PXMA 5CNOA 2JIVA 4XRJA 4HVSA 2ZM4A 4M12A 3RAWA 3S0OA 3FL5A 4YPDA 2VWUA 4GJ2A 1W7HA 3AXWA 4RVMA 4Y72A 3OOGA 2XK4A 3E8NA 4F9AA 2H96A 3QX2A 5EG3A 3BHYA 2VTAA 3BHUA 4HVIA 1OIQA 2R3RA 1H1WA 4S31A 2IW6A 2A2AA 3HP5A 3ZO3A 3AGMA 4EH6A 4EHEA 4LOQA 2EB2A 4KS7A 4D58A 2Z60A 3V5WA 3DFAA 4ZEGA 3QGWA 4TYEA 5C03A 1M2RA 4FL2A 5CZIA 4G1WA 3WZKA 5I9WA 4L3LA 5J1WA 4O1PA 4CQEA 1U59A 2JFMA 3L9LA 3N51A 3ZTXA 4A9SA 3UC4A 4KRCA 4O0XA 3EYGA 2QURA 4IH8A 3ZZWA 2FGIA 2HENA 4U41A 2BILB 1Y57A 1VYZA 3BYVA 3JYAA 4XHKB 5B0XA 2GNLA 5AR8A 5IA5A 4BYJA 4R78A 2RFSA 4U5JA 4PUZA 4D2TA 2Y4IC 4F7SA 2CKOA 1OIRA 3S4QA 2HY81 1P4FA 5FEEA 2QOIA 3RPYA 3EZVA 4KKEA 5CSVA 1OM1A 1T46A 3PA4A 3DZQA 3ROCA 3VS1A 4D0XA 3L8SA 2PVYA 4D9TA 3Q3BA 5J5SA 3BYMA 2JBOA 3QKLA 3TUDA 3BYSA 4JOAA 4P90A 4IAKA 3KC3A 4CFVA 3NUXA 3ZM4A 4ZTRA 4FKPA 3BIZA 3Q9WA 3QU0A 4FT3A 4XLVA 1J1BA 5HVKA 3BU6A 4E6DA 3KXMA 3I6WA 3BEGA 3AC2A 3FWQA 5JKGA 4G16A 4ZTMA 1FVTA 2VTPA 2VNYA 4K0YA 3FKLA 2E9PA 4XYFA 4QOXA 4WT6A 3CGFA 3EQDA 1CSNA 1DI9A 2HOGA 3NW5A 4CZUA 2WTDA 5GJDA 4ACGA 1Q8TA 5A14A 2QLUA 2WTJA 3CTJA 5IDPA 1OKYA 3U6IA 3V8WA 4HYUA 3I7BA 4N70A 5HNBA 4DFXE 5E8YA 1H08A 4M3QA 3GXLA 4FL3A 4GG5A 3BPRA 4ACCA 2JEDA 4S30A 2GQGA 4XP2A 5AIRA 1GJOA 4N57A 3FXZA 1GIJA 2YWVA 4BZNA 3EN5A 4W8EA 4ZJJA 4AS0A 4IEBA 3RPOA 3EN6A 5DLSA 1A48A 4RBLA 2VWBA 4C2VA 1IASA 4TPTA 3MGYA 3E8CA 2KULA 3BGQA 1LPUA 4O2ZA 2PYWA 4YC8A 3QYZA 1AD5A 3ALNA 4R5YA 4I20A 1H26A 3WF8A 3RHXA 4ACMA 3P79A 2YM4A 4QMYA 4TTHB 5KBRA 4E4NA 3PFQA 2IVSA 4O21A 5B7VA 5M51A 2BAKA 3VUIA 5L8KA 3TNPC 1FVVA 2XVDA 4FX3A 4LMUA 4BCNA 4J99A 1YHSA 4JNWA 4FTCA 1Q3WA 3D7ZA 2YAAA 4X0MA 1LUFA 3R0TA 1ZY4A 3R7YA 3IGGA 3LCOA 4JJRA 5H3QA 4ZXTA 5JZJA 4LM5A 4FIJA 4Z7HA 3I1AA 5CEOA 1OIYA 1PRYA 3PRFA 4CMTA 5AUXA 3NVMB 2UZTA 3BLRA 3MW1A 4DTAA 4O7VA 2BFYA 3FY0A 2F9GA 3NW6A 1FINA 3OW3A 4FICA 3KREA 4DC2A 3R28A 4FYNA 5JH6A 3EQCA 4XV1A 5CY3A 5ANGA 3E63A 4FA2A 2W5AA 3TJDA 3MB6A 4G2FA 1OMWA 4BCKA 5I9VA 3LIJA 3DBQA 3E3PA 4W4YA 4AQCA 3QZFA 5CAOA 2WTIA 4KKHA 4LGHA 2GQSA 1WBVA 3DKOA 5HZNA 1ZMVA 5D11A 4EK6A 2J51A 2XNEA 2CGUA 2WEVA 3FXXA 2J0IA 3MJ2A 4RIYA 3R8VA 3RK7A 1CKPA 4CG8A 3RKBA 2WMTA 4NL0A 5HO7A 1GZKA 4Q9SA 3PY0A 4M0YA 3D94A 4KS8A 3W2OA 4CLIA 3LKMA 1H24A 2I0VA 5HLPA 5JMSA 3OBGA 5BYYA 2YDKA 3KULA 3OT3A 1OZ1A 4LGGA 4XG8A 4AGWA 5BQ0A 4MXZA 4IWPA 4G3FA 4AOIA 3F3WA 3BX5A 3HMMA 1KSWA 4FKLA 2WMWA 4NSTA 3ZO2A 2VTSA 3W2CA 5IU2A 4PTGA 3I5NA 3FC1X 5AAEA 2C0IA 5B2LA 2BZKB 3HUCA 3P08A 3DJ7A 5EFQA 3JY9A 4LRKA 3OWPA 3V8SA 2BCJA 3OW4A 5M4UA 4YSMA 2JDSA 4F99A 1IAJA 4U43A 4YZMA 3QRIA 2J0KA 2HYYA 2W17A 4D2VA 5LOHA 4C57A 5E8UA 3UVRA 2HIWA 5I4NA 4TYHA 3TNIA 4LG4A 2F2UA 3FLYA 4I21A 2ZM3A 1IRKA 4CRSA 4IANA 4MBJA 1WVXA 4FZ7A 5EKOA 4TWCA 3G9NA 3E7OA 4M66A 4RJ5A 4OAUC 2YLFA 4EOQA 2NP8A 3GFEA 3PJ1A 2G9XA 5CT0A 4J8MA 4FV4A 4X3JA 2VO3A 2VNWA 5CU2A 3KXNA 4UMPA 5KMJA 3EIDA 4A07A 4C3FA 2YIWA 5DEYA 1M7QA 4PL5A 5CAVA 2J6MA 5GJGA 3KMWA 3NW7A 4UV0A 2X9FA 2PZRA 3PA3A 4O7YA 2OXYA 3LMHA 4JDJA 3ZXZA 5BUEA 4TZRA 4H1JA 4KIKA 4FKJA 5CASA 2QU5A 5JK3A 5EYCA 3FPQA 5F20A 3CPBA 2GMXA 3HNGA 3GEQA 3ORLA 3HUBA 4FUYA 3F5UA 1H00A 3IS5A 2QKWB 3DLSA 1LEZA 3GENA 5FRIA 3VRYA 2BIYA 3DJ5A 4F9BA 3TM0A 3HVCA 4BBFA 3SAYA 2W5BA 4DFYA 3Q9ZA 1Q61A 2R3QA 4NW6A 4AA0A 3MVJA 3UZTA 1KV1A 3QA8A 3T9TA 3VBVA 5CF6A 4JG7A 4FTRA 3UDBA 1XO2B 3CQEA 4J98A 3FLQA 1MQ4A 4IZ7A 5M08A 5CAPA 4J1RA 5HG7A 3QZHA 3NUYA 3A2CA 3PXYA 4ITIA 1FOTA 2YCSA 3R02A 3ZDIA 4YTCA 3A4PA 4RWLA 5I9XA 2ZJWA 4FKRA 4ITJA 1WVWA 3ZLWA 3L8PA 4EHZA 2WELA 2OI4X 5A4QA 2FYSA 4FV8A 4S2ZA 2WMXA 5CEKA 4L8MA 4CCBA 4BDGA 4X2GA 3RWQA 4BCFA 1M7NA 3FJQE 4A4LA 1JAMA 2FO0A 1OL6A 3UQGA 4NTSA 2WQBA 3KXZA 4XUFA 5FBOA 3DBDA 2XIXA 5IEYA 2QOCA 2IO6A 3PIZA 4C7TA 4K1BA 2VGPA 2X7FA 1WBOA 3D15A 1M2PA 4XOYA 4ANOA 4BDCA 4WG5A 2GS2A 2QD9A 5CVFA 2YM6A 2R7IA
chains in the Genus database with same CATH superfamily
3UVQA 3TYKA 2YDIA 2GS7A 2ZV2A 4RVTA 3JVRA 5FTGA 2XARA 4YP8A 4CVAA 4M0ZA 4LV7A 5EM5A 3BI6A 3HV3A 3AC3A 4MXAA 3FKNA 4APPA 2C6OA 4NJDA 4EQMA 4LMNA 4BICA 4JMQA 3HGKA 5D41A 4O6LA 1W8CA 2XJ1A 4M7IA 4XLIA 4QP2A 2WMUA 3DV3A 5JEBA 3F7WA 4AE9A 2QOQA 3RWPA 5AX9A 4RJ4A 4RFMA 4AP7A 5LARA 1H28A 3R63A 4RX5A 3CEKA 2H6DA 4N4SA 3ZO4A 4FV9A 4ALUA 3QQFA 3HX4A 3AC1A 3G15A 3OS3A 1Q8WA 4IIRA 2WOTA 1PMUA 4LL5A 4MNEA 2X39A 4QRCA 4BWPA 4C4GA 3RCJA 4E3CA 4MWIA 5CF4A 4GCJA 5AV1A 5LJJA 4DGLC 3MSSA 4MBIA 2XF0A 3OEZA 4IHPA 4IWOA 1FVRA 3QUDA 5EW8A 4I22A 2I7QA 4FKSA 4X2FA 2PVRA 3QRKA 4RJ7A 4V0GA 3V5JA 4A9UA 4WSYA 4XBUA 4FKVA 3KRRA 3MFUA 2OIDA 3UPZA 3LLAA 3W0OA 5LWNA 2GNIA 4ZTNA 2UZWE 4QYYA 3MWUA 2EUFB 3LXNA 1U5QA 2OW3A 2V5QA 3FUPA 3BL7A 3K5UA 4FIHA 4YJPA 3VIDA 4EYMA 2OXDA 3F3VA 4RQKA 4E4MA 4WHZA 5CYIA 4PPBA 4NZWB 3WZUA 4P2KA 5AM7A 3SG8A 4Q9ZA 4WSQA 3AC8A 4R1YA 4J53A 4B8LA 5M53A 2X7OA 2BVAA 5BNJA 4RX9A 5EYKA 4EQCA 3DPKA 3ZOSA 4PP7A 1QPJA 1H0VA 1UU7A 2AC5A 3OUNB 4UN0C 2IWIA 4FZAB 5CXZA 3UO4A 4GEOA 3R8LA 4RX8A 5CI6A 2YCFA 4NFNA 4OUCA 5DT0A 4EH7A 5IUHA 5DRDA 2ACXA 3W1FA 5CT7A 1YXUA 3K5VA 3LFDA 5K5NA 3SA0A 3VS3A 4EBWA 3Q52A 2LAVA 4UWYA 3BE9A 3FSFA 2OFVA 2YAKA 4P5QA 3TMOA 2XB7A 4YJUA 1JKKA 1CKIA 3MY5A 5HNGA 4GJ3A 4PDOA 4YU2A 4ZZNA 4ERWA 3I81A 5EDPA 1VJYA 4K18A 4E6QA 4YHJA 1WZYA 2G2FA 4FEXA 4R3PA 3VC4A 3KY2A 5DH3A 2W7XA 1WVYA 3Q60A 2IEWA 4BKYA 5HGIA 5CEQA 3UZRA 1G8AA 2P55A 1O6LA 3F5PA 1W84A 4MXCA 2C5VA 2NPQA 5JGAA 2Q0BA 1YI3A 3EL7A 4O7RA 4YO6A 4MTAA 4AG8A 1PY5A 3MS9A 4YZCA 2XP2A 4NCTA 5F4NA 2BDJA 3R7OA 4JT3A 2R0UA 3M2WA 2R3PA 3R1YA 4EC9A 3GU5A 4C02A 2BHHA 3UQFA 5ETFA 3ZBFA 4BDDA 2XM9A 2R3OA 3P7BA 2FVDA 1DAYA 5TT7A 3TNQB 2R3GA 3B8RA 3KKVA 5A3XA 4E26A 2ERZE 4PMSA 2X2MA 1NA7A 1T45A 2PY3A 3Q4UA 4YJOA 3QD4A 4B7TA 4E5WA 4XRLA 5TF9A 3TIZA 2RG6A 4O1OA 5HE0A 2X6EA 4CLJA 5IMXA 3PPZA 5HOAA 5FEQA 3H4JA 4D28A 3QA0A 4OBQA 3LFBA 3LJ2A 3ZONA 5CSXA 2AQXA 2PULA 3E64A 3QCYA 3FBVA 3QCQA 4Y73A 5BVEA 4HVGA 5KMNA 1Q97A 1ZYDA 3ZC6A 5IH5A 4WBBB 5JFVA 4FUXA 4K8AA 4AACA 2XIRA 3NCGA 1RJBA 5E8SA 2C0OA 3VW8A 3MY0A 3R04A 4CFMA 4DGMA 3COHA 3MPAA 3RPSA 3KULB 3UNJA 3WILA 2VTMA 4ORKA 3H10A 3CPCA 4TW9A 4HVDA 1Q24A 4U8ZA 3M1SA 4RT7A 4ZTQA 5AEPA 2XBAA 3VUKA 3MJ1A 4Y5HA 5H9BA 4DFZE 3W2SA 1I09A 4F1OA 1MRYA 4Z3VA 1TFFA 1U4DA 2HY0A 3O8PA 5E91A 4IB0A 1J1CA 1WAKA 2GNFA 3FMKA 4DFNA 1Z9XA 4EI4A 4CTBA 2X0GA 1MRUA 4ANLA 1I44A 2Z2WA 1E1XA 5FBNC 3I7CA 3DBCA 3ORXA 4NM3A 4EWHA 3ALOA 3GGFA 2VV9A 2X2LA 2QR8A 5ANJA 3WZJA 3VUGA 1NVQA 4PDYA 2Y8OA 3PUPA 3FEGA 2UZEA 4R6VA 4TYHB 4BHZA 1J7IA 3AG9A 3NLBA 3OP5A 4FTJA 5EQPA 1R39A 4RQVA 4O22A 2R3IA 3A62A 2FA2A 3MY1A 3Q04A 4IB3A 5EYDA 5E7RA 2PUIA 4JRNA 4AGUA 4IB1A 1JWHA 2G15A 2XNGA 3GQIA 4UWCA 2UW5A 2G01A 5IUIA 3IW8A 3FI2A 1HCKA 4Y83A 2NO3A 2NRYA 3KCFA 4YZ9A 2R3NA 1W2FA 3PA5A 3F61A 2IW8A 4DEEA 4EHVA 2HZNA 5F1ZA 3ATTA 3LFFA 2EXEA 3CJGA 4GV1A 2W99B 5AMNA 1FMKA 4V05A 3TKUA 3VUDA 4AW2A 5ACBC 2BFXA 2CN5A 5J9YA 4D4RA 5IPJA 4QP3A 1WBSA 5C8NA 4ERKA 2EU9A 2WMVA 2C30A 1APME 4LI5A 1JQHA 3GVUA 3IW6A 3MBLA 4L3JA 4W4XA 4ENYA 4USFA 3OWLA 4AAAA 3A7GA 1H01A 1XBCA 5LCKA 4MWHA 4YR8A 4JAJA 4AZFA 4QP9A 1VZOA 4IM0A 4O0UA 4YLLA 5EW3A 3ORMA 4X6QC 5K3YA 5FP5A 5LMKC 2BZIB 3DQWA 4D4YA 1YDRE 4OTWA 5E9EA 4QMPA 1PYXA 3QRJA 5AP0A 4DBXA 2G2HA 4R1VA 5KE0A 4DDIA 5HU9A 3KK9A 4EEVA 3MH0A 5DR6A 5L2WA 4DCAA 4FV7A 2ZVAA 2R9SA 4AN9A 2PMOX 4QTEA 4BR3A 3C5IA 3C0IA 1ZXEA 3GU8A 4RZVA 3NUPA 3LW0A 4AXAA 4ZLYA 3KRXA 1Z5MA 4FSUA 4LRJA 4EONA 3UG1A 4B99A 1ZRZA 3PE2A 2J90A 2PSQA 3NX8A 3QTRA 4RIWA 1TQIA 5DOSA 2QKRA 4U80A 4RWKA 4KWPA 3TTJA 3TNWA 2H9VA 5AA8A 3UPXA 2W1EA 4E6AA 2AYPA 5CEIA 3PG3A 4MQ1A 5AM6A 3V6RA 3D83A 4FV1A 2IZSA 4ZTSA 4L7SA 2R3HA 2C5YA 2R5TA 2C1AA 3F2NA 5EHYA 2B9JA 3O50A 1LEWA 3R21A 2F49A 4U3ZA 4QMNA 5HBJA 3IPHA 4JQ7A 2B1PA 5E8ZA 2XCHA 2B52A 3BBWA 4UMTA 3WF6A 5JQ8A 4YHTA 1O6KA 2C3LA 4YJQA 5IQGA 3R7IA 5AR2A 3PYYA 2V7AA 5CLPA 3WZDA 3NIEA 1HCLA 4FGBA 2Y9QA 5JGBA 3NYXA 4JDIA 1JOWB 4G5PA 1H1PA 4TWOA 3ZSGA 4BIBA 1QPEA 3QQHA 3SKCA 2X6DA 3RK9A 5GZ9A 4FT9A 4BZOA 4CV9A 3LFEA 2WQOA 1YDSE 5EI6A 5AP1A 3F82A 5CI7A 2XYNA 1J7UA 3U8WA 4DEHA 2VN9A 3ZC5A 5EYMA 5D10A 2R3KA 4MNEB 2C6DA 3TEIA 4YNOA 3IW4A 4O84A 3C51A 1XKKA 2BTRA 2ITXA 4L45A 1WCCA 4CNHA 2UW6A 1SNUA 3FLZA 4N6ZA 1JVPP 2RFNA 5ANEA 4BCJA 2B9IA 5ETCA 3HRFA 4UX9A 2WAJA 4V0GB 1OL7A 2C1BA 3EQBA 4DHZA 5E90A 4QP1A 1VYWA 4AN3A 4ANSA 1RDQE 2QO2A 3DU8A 4QYFA 4BKJA 4EK8A 4D2RA 2SRCA 2BKZA 4FNXA 4Z55A 4KIOA 3I5ZA 3W0MA 3BV2A 3VS7A 4ACMA 2DYLA 3C4XA 3UGCA 4B8MA 2UUEA 1SNXA 4R7HA 3V3VA 2IG7A 4APCA 4AA4A 1UVRA 4BI2A 4C4EA 1UNHA 2XANA 2PMIA 1Q62A 3IQ7A 3C4EA 4O7NA 5C01A 2ITPA 1A9UA 5IEXA 3SXSA 2BMCA 5FTOA 4JIKA 4Z16A 2X8EA 4FVRA 3G6GA 4WA9A 5HVYA 2PE1A 3MH3A 5K4JA 5T68A 3NCZA 3VBQA 1FBNA 1WBPA 2YABA 3E88A 1YHWA 3NYOA 5A9UA 5C26A 3QC9A 4EH9A 1E1VA 4DAWA 4BJJA 3CBLA 3EOCA 3FZSA 3PIXA 4A9TA 2RFDA 3O71A 4QMTA 1G3NA 1OKVA 5EOBA 4U3YA 3M11A 4BB4A 4FL1A 3AMBA 4S34A 1ERKA 2XRUA 3BLQA 3FLWA 2A27A 2I0EA 3GB2A 1PMEA 4FTNA 3VAPA 3FI8A 4KBKA 4R77A 4FSMA 3PY1A 4FC0A 2JITA 4XG9A 2Q83A 4YJTA 5CWZA 4FV3A 5FLFA 4IZ5A 1IG1A 4EH2A 1WMKA 1QPDA 3TG1A 1UWHA 5TKDA 3OTUA 2XCKA 4YJRA 4USDA 5BPYA 2WIPA 4IX4A 4EC8A 2VWXA 4AT3A 1H07A 4TYGA 5HI2A 3RAIA 5KZ0A 2OLCA 3GBZA 5HU3A 2I0HA 2E2BA 3WF5A 3FY2A 5C4LA 3C9WA 2GS6A 2XMYA 5BYZA 4X3FA 3VS6A 1M14A 4O7WA 1ZWSA 3EN4A 3ZUUA 2WEIA 2ITZA 3DZOA 5FXQA 3U4WA 4OT5A 2WQEA 4IMYA 4BCOA 3MESA 1YI6A 3JY0A 5EHLA 2CSNA 3FMLA 2PU8A 4CFNA 3O17A 1U54A 1R3CA 1P2AA 3K2LA 4YTHA 3VS5A 4C38A 4O83A 4HGSA 2J5FA 4EJNA 2C68A 4K11A 4CT2A 3G5DA 2WU6A 3OCBA 3ANRA 4FSRA 4I6HA 5AV2A 1JBPE 4WKQA 4RPVA 5HTCA 1YI4A 3G6HA 5DNRA 5T6KA 1Q99A 5HKMA 3K3JA 3PLAE 3MB7A 2X7GA 2KTYA 5I0BA 1B6CB 5DHJA 1OIUA 2PE2A 2YM8A 4J95A 4RJ3A 5J7HA 4ZS4A 2RF9A 4L44A 3THBA 3FMJA 4D1ZA 4LFIA 1W0XC 3WBLA 4I41A 2UW9A 4QYHA 4BDAA 4DFBA 4O0YA 2OK1A 1TVOA 4JQEA 3AC4A 4BCPA 4EUUA 2EVAA 2F7XE 2WB8A 3OWKA 4DLJA 1IAHA 2OG8A 5EDRA 2W1FA 4ZSLA 5LVNA 5IQEA 3DKGA 2ITUA 3OC1A 4U79A 3FC2A 5AP6A 4EL9A 3R2BA 4UY9A 1UV5A 4HGEA 4ZSJA 4CKJA 4DTKA 2JD5A 3C5UA 3OOMA 2I0YA 1ZOGA 3FI3A 2CGWA 4QMQA 3C13A 3BU3A 2W4JA 2QOHA 3QCXA 4K2RA 5AFVA 3GU4A 3HZTA 1YWNA 4TYIA 5DPVA 4QPAA 3TV4A 2YACA 4NIFA 4W9WA 4HGLA 5FUTA 2WTVA 4FZDB 5IH4A 1ZYSA 4KUJA 2OO8X 3MFTA 1CMKE 4XV3A 5AA9A 4JXFA 2A4LA 4R3CA 5F95A 3AD6A 3NUUA 5E92A 5LMKA 3TT0A 2XNNA 4RRVA 3G0FA 4QTCA 4F08A 3ORTA 5CVHA 2ETKA 3MDYA 5CSPA 4EWQA 3HKOA 4KBCA 4KSPA 4FYOA 3PDTA 3KXHA 4G3CA 2GTNA 3HA6A 4QNAA 4QQTA 2HXQA 3TKHA 2WTKC 4GKHA 4E4LA 2XKFA 3DLZA 3ERKA 4RFYA 3MFRA 3FZRA 2C5OA 3VWAA 2JBPA 2X4ZA 4O2PA 4UXQA 1OUKA 3F3ZA 3KFAA 2WFYA 4GK2A 4HW7A 3SHEA 4YLJA 3Q2JA 3ZUVA 2Z7QA 1DM2A 2UW4A 2QG5A 5AP7A 5AR5A 3PWDA 4PTCA 1V0BA 2RFEA 4C34A 5IA3A 2WQMA 4ENXA 5JSMA 2FSLX 4FKQA 4RJ6A 2P3GX 3LQ8A 3GCPA 4UALA 4K9YA 3G9LX 3IO7A 4BWKA 3C0HA 2JGZA 2OH4A 4FK6A 2XNBA 5BYLA 3NSZA 4M14A 2NRUA 3EYHA 3OMVA 4RIXA 3MYGA 3TJCA 4QTDA 3KMMA 4KKGA 3MPMA 2HZ4A 3HMNA 4XMOA 3U51A 2BKKA 3F9NA 3IW7A 3H9RA 3HRBA 3RAKA 2B53A 5JFWA 4J96A 3SW7A 1XMLA 4KD1A 3VS0A 4W4WA 5A54A 3QRTA 5L8JA 3R8PA 4X21A 2IZRA 4HCUA 3ZSHA 3COMA 2YZLA 4FSTA 4DA5A 3W0PA 3RGFA 4DGGA 2OXXA 4FEQA 5AR3A 1Q8UA 4CTCA 2GQRA 4MVFA 2ZDUA 3W0NA 4MHAA 1R0EA 2VX0A 2JFLA 2RSVA 4GIHA 4EK5A 3UZPA 2QU6A 2JAMA 4ZK5A 3U55A 3QTQA 3QD3A 4C3RA 3ORNA 1M17A 4BDJA 1E9HA 2QOOA 3HV4A 2XEZA 3E7VA 4NCTC 5LVPA 2P2HA 3ET7A 4I0RA 4FG8A 2O63A 2CHLA 4HZSA 4IAAA 4GT3A 5JFXA 1ZMUA 4ANNA 4CSVA 4DE4A 4WRSA 2OJFE 4BDEA 3WE8A 4DHFA 3UO5A 2Q0NA 4NEUA 1M2QA 2UW7A 3DY7A 3PE1A 1XMMA 4B6LA 4LOPA 1L8TA 4YBJA 5FDXA 2VTOA 4C4HA 4TNDA 2PUUA 3SW4A 2YIXA 3JPVA 3QL8A 4YC6A 1FMOE 3KRLA 2ZV7A 2PMNX 4C2WA 1PYEA 2XKDA 3SRVA 3RJCA 3MA6A 3FAAA 4ITHA 2OU7A 2VUWA 2Y6OA 2OF4A 3EQRA 2IVUA 4DFUA 1JSTA 3IOKA 4AT5A 3AKJA 3C50A 4FIIA 4DTBA 3BBTB 3CP9A 4FV5A 4DH1A 1URCA 4UXLA 3MA3A 2O5KA 1NXKA 4BI1A 3AT2A 4FV0A 4L43A 3BRBA 4ZY4A 2QHMA 5M4FA 2GFSA 3ZO1A 5DE2A 5AADA 4E7WA 4WUAA 4G5JA 4RGJA 1JNKA 5FD2A 4JAIA 5J9ZA 3HA8A 4GRBA 2QO9A 3Q5IA 3T3UA 4DEDA 4YMJA 3FMNA 3BELA 2LGCA 4BFMA 4E20A 3PIYA 3RM6A 5EM8A 3UP2A 3OVVA 3EKNA 5IQCA 4TN6A 3ZBXA 3U87A 3ZS5A 4DDGA 5A4TA 3F2RA 3TIYA 3JUHA 4FEVA 4RG0A 4PP9A 2BDFA 4BJJB 4QP7A 3ZLYA 4RIOA 2HCKA 2JKQA 5E1EA 1KE5A 3PXKA 4ZP5A 3I4BA 3HECA 1PXNA 4U0IA 3ZRMA 4G3DA 4BDFA 4F6SA 4FKTA 3Q4ZA 4FTTA 2OIBA 2JC6A 4E6CA 3KF7A 4W4VA 3FV8A 3F88A 1P14A 3UDTA 4I23A 4Y85A 4NUSA 4QQJA 2PZYA 3EQHA 2PZ5A 3MIYA 4FK3A 2OZAA 4OW8A 1YXVA 2X2KA 5HICA 4F78A 3R9RA 4TY1A 4BDBA 3B2WA 4IVAA 3RZBA 3WF7A 4BTJA 3NAXA 2YISA 1OPLA 4BL1A 5KX8A 3W2PA 3CR0A 3LCTA 3HLLA 3O5AA 2BPMA 1VR2A 4EK3A 4FEUA 4ZY6A 4IM2A 2VAGA 3SV0A 2XNPA 5L4QA 4H58A 2YZAA 2E9OA 5IUGA 2VTLA 4RC2A 5D12A 4AOJA 4FEWA 3G33A 2WMQA 4OTPA 4GK4A 2IW9A 4ZLZA 3KK8A 4FSQA 4U6RA 2R7BA 1K9AA 1U54B 1OPKA 2B55A 5A46A 5L6OA 4G31A 4BGGA 3OT8A 4DEBA 1P4OA 5HD4A 3ODZX 3Q5ZA 5LCJA 3NAYA 3PVGA 1W2DA 4PQNA 4XOZA 5DBXA 4E93A 5A6OA 4V01A 3FQSA 5EDQA 4EHGA 5DEWA 5HBEA 2OJ9A 1BX6A 4IAIA 3A99A 4LUEA 4ANQA 1PXOA 4NT4A 3OWJA 5D7VA 5HQ0A 4CFXA 4L53A 5BVDA 4ASDA 2OKRA 2IF8A 3EQIA 4IE9A 3SXRA 2VTRA 3OFMA 2BRNA 4FT0A 4P5ZA 4AW1A 4GKIA 4F64A 1GZOA 4Z7GA 2XK7A 4FSZA 4IQ6A 2UZNA 2CKQA 1A06A 4XG6A 4WNOA 2BAQA 4FG7A 4Y8DA 4DGOA 1ZYLA 3LXKA 1J91A 4NKAA 5JFSA 5CX9A 4H3PA 1QL6A 5IQDA 1PW2A 3NGAA 1WFCA 4FSWA 5DYJA 1XBAA 5AWMA 1PXIA 2J5EA 2JDRA 3PJ8A 4JQ8A 4UMUA 4H3QA 4PY1A 5I3RA 3EMGA 4ZSGA 3QC4A 5GJFA 4C33A 5LMBA 4EZ5A 2UVXA 1H1SA 4GH2A 5KNJA 1KWPA 3WYXA 3ZLXA 4D9UA 1W98A 3H30A 2QNJA 5AR4A 4O7TA 1YWRA 1ZMWA 4F4PA 2XM8A 3D9VA 3LMGA 1ZZLA 3EZRA 4FG9A 4F6UA 3B8QA 2Z8CA 2JDOA 3HDMA 4RFZA 3SXFA 1H0WA 1UU3A 4W8DA 5HE3A 4WBOA 4F7LA 2CNQA 3W0SA 4YSJA 1K3AA 5J87A 3D5UA 4ID7A 4PPAA 3F5GA 3FLNC 3DK7A 3PZHA 4FTLA 3DBFA 4YJVA 4WD5A 3T3VA 3KL8A 5CSHA 5BVKA 3QRUA 4D0WA 3MVHA 4IW0A 4RZWA 4GVJA 3Q4TA 3DXQA 3WOWA 2CMWA 1PXLA 1UKHA 4C3PA 3L8XA 2W1HA 2ZB0A 3F2AA 3HDNA 2F7EE 4O91A 4ASZA 1JSUA 2UZLA 3CTQA 5L6WL 4BCQA 5E4HA 4L9IA 2C3IB 3QBNA 2OJJA 2ZV8A 5IA0A 1VLRA 3DKFA 3BE2A 3QYWA 5HO8A 3P9JA 4BCIA 3BLHA 3BU5A 2PE0A 3R1NA 1BL7A 5HLWA 4CT1A 2YN8A 5BVOA 1PXPA 2GTMA 2CDZA 4U9AA 2PMLX 2C47A 3VUTA 3N4TA 3KN6A 5E1SA 1SZMA 4U45A 2PL0A 4TRLA 2CLQA 4H39A 4YGAA 3EFKA 4IAYA 1SYKA 4JVGA 4OBOA 5AP2A 3UC3A 2YIRA 2RL5A 3TZ7A 3GFWA 4RIXB 1H1QA 2F4JA 1IR3A 2BRMA 3TL8A 3VF9A 4CZTA 2E9VA 4L46A 3LFCA 3S1HA 2RGPA 4ZJVA 3RMFA 5C8KA 1UKIA 4OR5A 2BAJA 1OECA 1OITA 3ZMMA 3ID6C 3Q9YA 2WKMA 2WD1A 1KV2A 5KHXA 5GIOE 1YOJA 1NW1A 3OXTA 5TO8A 2VGOA 1STCE 3FMHA 3ULZA 4IC8A 4RMZA 2GHGA 2IJMA 2YDJA 3QUPA 2C4GA 2YIQA 1YKRA 3HP2A 3BYOA 5AUTA 2WTWA 3Q6WA 4G6LA 3F5XA 4CD0A 4J7BA 4J71A 4FTKA 3R6XA 1ATPE 4TWPA 3DDQA 3IKAA 5AP3A 2VTNA 1X8BA 4FF8A 4D1SA 2FB8A 1R0PA 4PTEA 4EKLA 4RIYB 2PVFA 2B4SB 3D4QA 3H9FA 3DXNA 3WIKA 3R9DA 2YFXA 2GCDA 4EJ7A 4G9RA 5C1QB 1Q5KA 2O65A 4GU6A 4QO9A 4I5PA 4XJ0A 4X3FC 4O7SA 3W0QA 3QQUA 2ZFYA 2XA4A 3N4VA 4BBMA 2Z7LA 3RM7A 3GT8A 4OBPA 4AZVA 4Q5HA 4BDHA 2R4BA 4E5AX 3HV5A 5F94A 2B54A 1UU9A 4R3RA 2E9UA 3RVGA 5DGZA 1PHKA 3AC5A 5HNIX 1G8JA 4HYHA 3ZH8A 4IX3A 3O8UA 4KB8A 5DT4A 3UYTA 5CAUA 3POOA 5IDNA 4J52A 3NFFB 4GL9A 4FE2A 4QQ5A 5ITAA 2HZIA 5LVOA 3SRVB 1QMZA 4PNIA 4BY9E 2Y7JA 3JS2A 4V04A 4W9XA 4IADA 3TXOA 2OH0E 5JRQA 4AXEA 2BTSA 5BVWA 4YTIA 4I5CA 5GZAA 1YQJA 2WOUA 3SOAA 3L9PA 3QGYA 4JL9A 4MD7E 5IQIA 4QMMA 4MD8E 4DG0E 3LCSA 5FXRA 5GZ8A 1IA9A 2QG7A 1OGUA 1KE6A 3PG1A 1Q8YA 3E92A 3NPCA 3A7JA 4I92A 4HNIA 2EWAA 4FIEA 2Z02A 4ZS0A 1MUOA 2W1IA 2DS1A 4IZYA 2VTTA 4YTFA 5A6NA 1F5QA 4BWXA 4ZY5A 3CJFA 4RJ8A 5AUZA 4OTHA 2ITWA 4IDVA 4LOOA 3QHWA 2BZHB 3FZPA 4FKIA 4BDKA 3GI3A 4KSQA 4AWIA 2DWBA 2BR1A 3NMUF 4EH8A 3DTCA 1YXSA 3HEGA 4DT9A 4OLIA 3KMUA 2WGJA 2VTIA 5DIAA 4FNYA 5B2MA 3EFWA 2O2UA 3W10A 4L6QA 3KEXA 4KIKB 2UV2A 3QFVA 5EI8A 1YVJA 3PPJA 2UW3A 4JDKA 1PKGA 4IFGA 2XNOA 3NNVA 5FM3A 2PVMA 2BZJA 3EHAA 4QT1A 2CJMA 4AXCA 4I93A 5AV4A 3QHRA 3PJ3A 4XG4A 3BV3A 3KCKA 2OZAB 4DCEA 3FPMA 1AGWA 1H8FA 3LJ1A 3ORPA 3C4WA 5DWRA 3VF8A 4AGDA 4Q5EA 3MPTA 4HNFA 4NM7A 3HAVA 2JDTA 3A7IA 1JKTA 3RAHA 4FR4A 4O4CA 2FH9A 3R1SA 4PX6A 3N9XA 3OZ6A 4XX9A 5KKRC 3NS9A 4D5HA 4DITA 5CZHA 3UOKA 4C62A 2GPHA 3HMIA 4YHFA 2H8HA 3D0EA 3R8UA 4EOKA 3COIA 4AW0A 2PVHA 2PVLA 1BKXA 5J79A 3RHKA 3SOCA 3LAUA 4ZIMA 3RTPA 4ALVA 5HIEA 3QQGA 5KZIA 3V51A 4O0VA 4CMOA 3AKLA 4DINA 1XBBA 4BHNA 3OXZA 2C5NA 4MF0A 4PV0A 3VJNA 3DOGA 3U6JA 4RWIA 4BKZA 3PSBA 3OD6X 4JIAA 4BF2A 3LCKA 4YO4A 4I4FA 4MBLA 2R64A 1XHAA 2UW8A 3ZFYA 3ZYAA 3OEFX 3R9HA 5DMZA 4GVAA 4UZHA 2C0TA 3PXQA 5CQWA 3TN8A 5IQAA 4XCUA 4FKGA 4ANBA 4RWJA 2HW6A 3U4UA 3FQHA 2OJGA 2VD5A 3E3BX 3ORIA 4S32A 4YJSA 3CIKA 4H36A 3DA6A 4EOOA 4GYGA 1Q4LA 4D2SA 5C4KA 4JR3A 4BVUA 3FSKA 3FI4A 4QMXA 5IF1A 4DH8A 4H05A 1J3HA 3GOPA 1ZYJA 2YJRA 1Y6AA 3GQLA 1UNGA 3PLSA 4IAZA 2O8YA 3NZ0A 4LV8A 4YZDA 2Y6MA 3TZMA 5L2IA 5AIKA 4TKSA 3OROA 4UBAA 3U9CA 3W8LA 3VVHA 3UG2A 2O64A 3MTLA 4CV8A 3HMPA 3VBTA 3W16A 2OSCA 5E8VA 3VHEA 1OKWA 3A8XA 2WMRA 1VEBA 3OCTA 1XH4A 2C6KA 2GNHA 5CVGA 3KVWA 4XP0A 3DNEA 2G1TA 5E8XA 5C9CA 5KCVA 4DF3A 3TZ8A 2WTKB 3UTOA 2J0LA 3HRCA 4I4EA 4RA4A 3GCSA 5ACKA 3SLSA 3V5TA 1XH8A 3BQCA 4K77A 3BWJA 3NEWA 1PF8A 2B9HA 4KNBA 5H2UA 4PMPA 5HTBA 3D2KA 2VRXA 3VBYA 5KO1A 5IA2A 1YOLA 2QI8A 3E93A 5K0KA 4IFCA 1Y8YA 3DBEA 4MD9E 4O27B 3VRZA 4IVDA 4EH5A 4BYIA 1IEPA 2I6LA 3FZTA 5AP5A 3RALA 4DEAA 4DHJA 1REKA 2IVVA 4FOCA 4R8QA 1OL1A 1UU8A 3A7FA 3DB6A 3OBJA 3R22A 4I24A 5HG9A 3TNHA 4I6BA 1ND4A 4XG3A 3RNYA 4ONAA 4F7NA 3AT3A 4EUTA 5BX0A 3K54A 2PVJA 2ZAZA 4MXXA 5D9HA 4QDEA 4GSBA 4KIQA 4F0IA 3MH1A 2RG5A 1OB3A 3GCUA 4E1ZA 1W83A 3AOXA 5M07A 2V0DA 3KIOC 4PNKA 2YWPA 3C0GA 5BVNA 1GY3A 1RQQA 4FTIA 1G8SA 4OAVB 1BYGA 4AZEA 3BLAA 3OCSA 4EORA 3PTGA 3DS6A 4G3EA 4KA3A 5HESA 2W0JA 4DN5A 4M69A 3LFAA 4GIIA 2PPQA