2VNYA

Structure of pka-pkb chimera complexed with (1-(9h-purin-6-yl) piperidin-4-yl)amine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 105
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vnyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vnyA02
2W5HA 5H9BA 3PLAE 1FGIA 4GJ3A 4IZ7A 3PY1A 5AR4A 4C33A 2HZ4A 2XRWA 2J90A 5B2KA 2OLCA 4XHKB 5AMNA 4GYGA 4PV0A 3BYOA 2XK7A 4L8MA 3Q6UA 4HYIA 4CZTA 2R3FA 4O6LA 2A0CX 5IUGA 2GNGA 3Q96A 1Q97A 3QZFA 3ULIA 4GKIA 4MK0A 4R3CA 1O6KA 3P7BA 1VR2A 5CSXA 4YJNA 2XNNA 2HOGA 3IGGA 4K11A 1JBPE 2E9UA 1W0XC 2G2FA 5KMNA 4V05A 3D5WA 5L8LA 5HD7A 3IW8A 5AEPA 5EKNA 4CVAA 2WZJA 4FUXA 3MA6A 4IB1A 2G1TA 4IE9A 1J1CA 2BROA 4I5CA 3QTQA 2ZV8A 3PXZA 4IJ9A 2BILB 3OY1A 4IVCA 5D7VA 3UO5A 1TKIA 4IX4A 5B0XA 3KXNA 3CEKA 1P2AA 1OIRA 4ZSJA 4IM3A 3BCEA 4DG3E 5C1QB 4FV8A 4MBLA 4BBMA 5HBJA 4FIJA 4QD6A 3FMLA 3FJQE 4LOPA 2I0YA 4UMQA 2GNJA 2P2HA 3EYGA 3VO3A 2QR8A 5HG8A 3VS1A 4O7TA 4ANOA 1RW8A 4I4FA 3ORNA 4ARKA 2PVHA 2QR7A 1FPUA 3GU6A 3PJ1A 2YN8A 4XUFA 1M52A 1PKDA 5IZFA 3FXWA 1E1XA 4LRJA 3EYHA 2YACA 4KD1A 5EYKA 4KIKA 4EHZA 4ZSAA 4BDKA 1LUFA 1OI9A 5EW8A 2ZVAA 1SNUA 4RG0A 3VN9A 5AP6A 5BYZA 4YNOA 3II5A 4ASXA 5FXSA 2CNQA 2FSLX 3H0ZA 3H0YA 4IWDA 1H8FA 2IVVA 4G3EA 4AW1A 1Q3WA 3V6RA 2C47A 4AZVA 2RFNA 1Y8YA 5DG5A 2RFEA 2WMRA 4FSRA 1HCKA 4AN9A 2OSCA 2J0JA 2QO9A 4W9WA 3ZRMA 3SG9A 2QOOA 4C38A 4M3QA 2VGPA 1HOWA 3KMUA 2P55A 3MA3A 1URWA 2GPHA 5FEQA 5J1WA 5HIBA 1MP8A 4RBLA 4MF1A 3U4WA 2IPXA 5EHLA 4NEUA 3FKNA 3CPCA 2XKEA 3QUPA 2VO0A 3NUUA 4NZWB 2HY0A 1UV5A 2YAAA 4ASEA 3PIYA 4CKIA 4O2ZA 4F64A 2BAKA 3RCJA 2ZM3A 2VRXA 4WRSA 4P4CA 3C4ZA 2R3IA 3CY3A 5AAEA 3HKOA 2WIPA 5DNRA 3OWPA 4U40A 3ANRA 3SOCA 2QOQA 5KMLA 4Z55A 5CEKA 2VNYA 3U6IA 1ZARA 3HGKA 4HYSA 3WYYA 3CR0A 4X0MA 4AZFA 2UW0A 4J99A 4R7IA 1ZMWA 5FEEA 1Q41A 3DKOA 3ORIA 3V8WA 4L6QA 4JBQA 1BL6A 3EWHA 2YCSA 3EQDA 4MXZA 5EI8A 3UIUA 4ZLZA 3UODA 5AUTA 4WG3A 1NVRA 2Y6OA 2F49A 3UVPA 4E5BA 3PZEA 1U5RA 3SOAA 3V5LA 1ZOEA 3CC6A 4FV9A 3VUIA 3QKMA 4GG5A 4EORA 3KGAA 4LFIA 2YLEA 3MPMA 4FKSA 5DEYA 5EW3A 3UE4A 3VUHA 4M7IA 4CQGA 3DXQA 2XK9A 2PZRA 2PHKA 2GHLA 3DB8A 3RI1A 4F1MA 4LGGA 1F0QA 4QP4A 4R7HA 4QTCA 4O0YA 4I5MA 3R9DA 3BQRA 3UGCA 1DM2A 3VS2A 2CKEA 2QOFA 2P33A 3FBVA 5HKMA 3V5PA 3ZYAA 4ANBA 2R3LA 4BFMA 2W1CA 3IW4A 3ERKA 3LM5A 1TVOA 3ZEPA 2CGXA 3NCZA 3WF9A 2X39A 3PVGA 5AV4A 4O81A 3D7TB 1JKKA 4UN0C 4FNWA 2QOCA 4QPSA 5E8SA 2HWPA 4JI9A 5J8IA 5IEVA 3TV7A 3AMAA 4EK4A 2OXXA 4QQCA 3UVRA 2ZAZA 4JNWA 1Q8UA 3L9NA 3UNKA 2W1GA 5J5SA 2QO2A 2V5QA 5CSWA 1PYEA 4D2RA 3OEFX 4C4HA 4QQJA 3KRXA 4GW8A 4CV8A 3THBA 2Q83A 1QMZA 3EL7A 4HVHA 4IAAA 4BDDA 2OK1A 1V0BA 1VJYA 3PJ2A 3PSDA 5CU4A 1JOWB 2VUWA 3BWFA 3SQQA 3ZOSA 2CLXA 2P3GX 5AIKA 5AIRA 4IDTA 2WMQA 5A4EA 5M08A 3ORLA 4X3FC 2NRUA 5J79A 2QD9A 2ITWA 3OWJA 4CLIA 2VTAA 3ZCLA 3ROCA 3BV3A 3CIKA 4FZAB 4BHNA 4UMPA 1Z57A 3LJ2A 4FL2A 2W7XA 3FDNA 3DKCA 4G6LA 4OBPA 1K2PA 4X2NA 3DV3A 3NNUA 4I1ZA 4C3PA 4AS0A 1GY3A 1ND4A 1Z9XA 4EKKA 2JGZA 5ANGA 4FVQA 4GIIA 5HBHA 4KA3A 3VRZA 5HQ0A 5JFWA 2CMWA 4M12A 5M06A 2WO6A 1G5SA 3QQFA 5BMSA 1WCCA 4RA5A 4GK2A 3T8OA 5CAQA 3VQHA 5KMKA 4FV6A 4IFGA 4AFEA 3FY2A 1SM2A 4YJQA 4AOIA 4FTJA 3NNXA 4C4FA 4E4LA 5LVPA 3OCTA 3HMMA 4XLIA 3KXHA 3MFUA 4A7CA 4LI5A 2PK9A 3NVMB 3VBWA 1CM8A 3GNIB 5T3QA 2VNWA 3TL8A 3HAVA 2WELA 1YDRE 1YWNA 4JG7A 1REKA 1J91A 2XMYA 1KWPA 1JSTA 3OT8A 5HE2A 3ZBXA 1PXOA 4GH2A 3D7ZA 3Q9YA 2JDTA 4BDEA 2XEZA 2ZDTA 5C03A 3AC3A 3AGLA 4N4SA 3EKNA 4BCIA 3CQUA 3U9NA 3ZSHA 4ERWA 2H96A 2BIKB 2HYYA 4I23A 1FGKA 2W1EA 4AT4A 4C3RA 4DFBA 3PE2A 4K2RA 5EYMA 3VS0A 5I9WA 4Z3VA 2LGCA 3OWLA 4XNEA 5TKDA 2OIBA 2BRBA 4PDPA 4QTBA 3WOWA 1FVTA 3E3BX 3UOJA 4IAYA 2VWUA 3FMNA 3G15A 2BALA 4FZ6A 4LMNA 5HHWA 5ANDA 3CY2A 5F1ZA 5I9VA 4MVFA 4WHZA 3CQEA 5KHWA 2ITXA 2WU7A 4BCOA 5ICPA 3HRFA 3DAEA 5HESA 3DT1A 3EQFA 3R2YA 3SHEA 3A62A 4RJ5A 2DYLA 3MY0A 3DFAA 4B4LA 2I0VA 3MY5A 2VU3A 3OFMA 4UXQA 1OVEA 4IX5A 3QCXA 2F7EE 4HNFA 1OKYA 3H3CA 3R1QA 4KBKA 3EHAA 3GI3A 3O96A 4F4PA 4ASZA 3RHKA 4LUDA 2PVFA 2YDJA 2XEYA 4Y5HA 4YC6A 4GT5A 5DHJA 2XIYA 4LOQA 4A9UA 4E8AA 3C5IA 2ZB0A 2WOTA 2OH0E 2VTIA 3MB7A 3R8ZA 5KNJA 2G15A 2RG5A 2FO0A 3OF0A 5EHYA 1YVJA 4FKUA 3ENMA 4EH2A 4NTTA 3KREA 4YHJA 3A99A 3FAAA 4QQTA 5FTQA 5HCXA 3QHWA 3F2RA 3MJ1A 1YI3A 4PL5A 1U59A 3V8TA 4EK6A 2DWBA 4ZTHA 3ORXA 4D2SA 3MI9A 5I5ZA 3NYVA 2WQMA 3TNHA 4JR3A 3TNQB 5J7HA 4KBCA 3UJGA 3VHEA 3LQ3A 3C4FA 4M66A 5ANOA 3LCTA 1HCLA 3LFEA 4XX9A 4NSTA 5AP5A 5EHOA 4XOZA 5IQFA 4CKJA 3VJNA 3MH3A 1ZYDA 1PXJA 3PSCA 1UU3A 3EN7A 2HW7A 3KULA 5CWZA 3KF4A 4YLJA 3FMDA 4JXFA 4A4OA 5HTCA 2VD5A 3KRWA 5E8VA 1JKTA 2RL5A 3CJFA 5A6OA 2CN5A 1W98A 5DR9A 4CEGA 4FX3A 1UNHA 4LYNA 1PXNA 1YXTA 3FI3A 3HYHA 2X7OA 3EIDA 1BUHA 4W8DA 3COMA 4KKGA 5CAOA 4FV0A 3GGFA 1R0EA 1RJBA 4B99A 3CP9A 3CBLA 4FEQA 1XH4A 5H3QA 4P7EA 3PY3A 2HENA 4YC8A 3EQRA 3RPOA 5M56A 4FKJA 3HX4A 4OGRA 5H8BA 1PY5A 2YFXA 3O71A 1OKWA 3I60A 5E7RA 3R8PA 3UBDA 1FQ1B 2W1DA 3QU0A 3GXLA 4G17A 4FSNA 3LCSA 2OGVA 3RP9A 3QQKA 2OBJA 2X8DA 1ZYSA 3NYXA 2WQNA 4PDSA 5IU2A 3H9OA 2XA4A 3PPKA 4RLKA 4W4XA 2EUFB 2OZAA 4FVRA 4BCPA 5KMOA 4RZWA 3AMYA 4TWPA 5AV2A 3VBQA 4XYFA 2WQBA 3IKAA 2I1MA 4FTAA 3P08A 3NAYA 2PUUA 4E4XA 5AA8A 3PXQA 3ALOA 3BV2A 5LCKA 4YBKA 3ZLXA 2QG7A 4HOKA 4C8BA 4DH3A 2SRCA 3P86A 5FBOA 3ZEWA 3HZTA 3UTOA 4XMOA 2ESMA 1BLXA 5JRSA 3W2PA 4DEGA 4M67A 4EUUA 5FTGA 5AUUA 4C57A 4D2PA 4LL0A 2PVKA 5J87A 3QTWA 4G34A 2G2HA 3FWQA 3B8QA 2QC6A 5IH6A 1PF8A 2J50A 1E9HA 3QQGA 3ID6C 4KS8A 4QYHA 4UWCA 4X3FB 4DEIA 4USFA 3QFVA 2ETRA 3EQPA 3Q4CA 3EQGA 4KIKB 4KIQA 4NW6A 4NM0A 4PTCA 3AMBA 4EH8A 2KULA 3AOXA 3PXKA 3Q32A 2A27A 3QWKA 5CLPA 5HG5A 4BTFA 3W1FA 1PMVA 4YZCA 2O8YA 4H58A 4HGLA 4BGGA 1L8TA 3WF8A 2F7XE 4DEEA 3G90X 4QYGA 4ZOGA 3O8TA 4ZP5A 1VYZA 2CDZA 1ZMVA 2R3KA 2X81A 3OOGA 3DXPA 3R8UA 5GNKA 3GU8A 1Q8WA 3FLWA 3LXPA 3VUMA 2OZOA 3PXYA 4GJ2A 4CTBA 2ITUA 3I6UA 3IQ7A 4S30A 5E8WA 2UZNA 4XV2A 3RPSA 3V5QA 5K4JA 3U54A 4D4SA 4OTDA 4M69A 4S32A 4UY9A 5GZ8A 5IPJA 5AAFA 3NUYA 3GC9A 2OU7A 4WUNA 3V04A 5HO7A 3RTPA 4CMUA 3DBQA 4G5PA 3WARA 2YCFA 2VWZA 4NH1A 3O51A 3ZLYA 4QMYA 1ZYJA 4MHAA 5CSPA 5J5TA 2I0EA 5BVOA 3SW4A 4ZTMA 2E9VA 4RRVA 2FSOX 3ZSIA 2GQRA 1PMNA 4TT7A 4UMUA 2JBOA 5AV1A 4FT9A 4J95A 3UC3A 1Q61A 5AR2A 4H39A 1H1RA 2PE2A 4IAFA 3TACA 3DAJA 4F9CA 3IECA 1Q3DA 4FSYA 4XRJA 3PSBA 2XS0A 1XBBA 1OZ1A 3UPXA 3Q9WA 3UO6A 5KUPA 2A4LA 1YWRA 4FTLA 2YCQA 3CGOA 2QOLA 2YDKA 3SDJA 2Z8CA 3V51A 2VWVA 4FKPA 1JQHA 3DTWA 4AU8A 3PZHA 4F6SA 2IZRA 1JKSA 1DI8A 5JN2A 3D4QA 1NVQA 2UW6A 3VS3A 3ZZEA 5JFVA 5A4QA 3Q9ZA 4APCA 1PXLA 4F6UA 3Q4UA 5ACBC 3SVVA 5CANA 4QP3A 4ZMFA 3EKKA 3DKFA 3HMNA 5HNGA 5BUIA 3P7CA 4R1VA 1S9JA 2YM7A 4AUAA 2JDVA 4IANA 3R7IA 3GCPA 3F3WA 2VO6A 2CKPA 3ZHPC 5L3AA 4FTUA 2C0TA 3MTLA 1JKLA 3QXPA 4YZBA 4CV9A 3QAME 2Y9QA 3R22A 4FIHA 3MTFA 5DT0A 3HVCA 3R7EA 4FTTA 4S31A 3U9CA 3E8DA 3QD2B 4FSMA 4KB8A 4AZSA 3FHIA 1NT2A 1OL5A 1Y91A 2WEVA 3G6GA 5FXQA 3C5UA 2XK3A 2BFYA 3UG1A 5HU9A 4DCEA 2ZMDA 3EFWA 2XJ2A 2PMOX 2YA9A 5EYCA 5E8YA 4C4IA 4L42A 2QU6A 3VBVA 4AF3A 5C8KA 4CYIA 4EL9A 4IMYA 5J1VA 4ACCA 5E8XA 3WIKA 4OT6A 1KOAA 3RM7A 4DFNA 4OTRA 4DAWA 4RZVA 2J51A 3RAHA 4EZ7A 5CU6A 3BU6A 3QCYA 4ZLOA 1M2PA 3ZU7A 3TUDA 4CCUA 3LCDA 3C4XA 4ITIA 2B9IA 2PVJA 3E8NA 5AUYA 4D28A 2W0JA 3Q4ZA 4CSVA 4G16A 5ACKA 4IZ5A 4RX9A 4BTMA 3ORMA 4CFUA 4RC4A 5E8ZA 5HI2A 4QMXA 1B6CB 5IKWA 1BYGA 4K6ZA 2XNBA 5EG3A 3LFDA 2VO7A 4V0GB 2QU5A 5HCZA 3PJ3A 5HVJA 4UYAA 4QPAA 2WMVA 5JZJA 2O2UA 5AM7A 4OLIA 1OPKA 3QTIA 4RWIA 4GG7A 1YI4A 1E1VA 4ANNA 5DOSA 2HXQA 1F3MC 2XM9A 2PZPA 4P90A 1LEWA 4DFLA 3U8WA 4MNEB 2V62A 3QD3A 4RFZA 4BZDA 3AT3A 2O63A 3ORZA 4FTKA 3RPRA 3B2TA 3A4PA 2C6MA 3H30A 4PPAA 2YERA 2JFLA 4M84A 4EK3A 1H1PA 2XBAA 2QOHA 4RQKA 3HLLA 2J7TA 5KMIA 2C3KA 3SG8A 3VUTA 1SNXA 3ZO4A 2X1NA 2I7QA 4LM5A 4F9YA 2XUUA 5AFVA 3MSSA 5HIEA 1KE5A 3K3JA 2Z02A 4HVDA 2W96B 4GV1A 3BHUA 3Q4TA 5AR3A 4DN5A 3TIZA 4YZNA 4YJPA 2R3GA 2HZNA 3IDBA 3AC4A 2C6KA 3C9WA 1OUYA 1J3HA 2IVUA 3QZGA 1UU8A 2GNHA 3OEZA 1WMKA 4PPCA 5IQAA 3SGCA 5LMKA 2YIXA 4FIGA 2BHHA 3BU3A 3KB7A 3FMMA 3UYSA 4EOPA 4PL3A 1OGUA 4PP9A 3R7YA 4EJ7A 1ZMUA 1MUOA 3EQCA 3M11A 4NUSA 3I81A 4WNMA 2BZIB 1PHKA 4C61A 2RF9A 4AXAA 4EUTA 2WHBA 2JBPA 5I9UA 4IAKA 3UQCA 2OO8X 4RWJA 2WXVA 1MRUA 3C13A 3QTRA 4OT5A 3WF5A 5HNIX 4FEXA 2ETMA 2YM5A 2C6LA 4RT7A 5E8UA 5DVRA 4H3QA 3LJ1A 2YZLA 2Y6MA 3BYVA 3KRLA 3LFQA 5DWRA 3VRYA 3BGZA 2BZHB 3DU8A 2F2UA 1OBGA 3WZJA 4NM3A 4RA4A 4TW9A 3H9FA 1KE8A 5HE3A 4PMSA 4ZJIA 4FG9A 1WBSA 2WMUA 4I5HA 4L3LA 4I94A 5BUEA 2V7AA 2BHEA 3VS7A 1I09A 2JLDA 2B4SB 4QPMA 2VTOA 5FG8A 3ZFMA 2PPQA 2V55A 3ET7A 3MVMA 4FTQA 4IAIA 4MTAA 2ZJWA 5B2MA 3JYAA 1OL7A 3E7OA 3DNDA 1PKGA 5JKGA 4CMTA 3FI2A 1K3AA 3PRIA 2O64A 4DBNA 2XK8A 4YMJA 3Q04A 5EQPA 3GU7A 5BNJA 5HLNA 4PRJA 3BGQA 4FT5A 5AAGA 5K5XA 1YXSA 5M07A 4C02A 3HUCA 5T68A 2BKKA 1CMKE 2GDOA 1YHWA 3NWWA 1LR4A 5BVDA 1UNGA 2UW5A 4M13A 5IA2A 3LFBA 4H05A 4FTNA 3BYSA 3VUGA 3DK7A 3LFNA 4RVLA 3HECA 5JK3A 3LKMA 5IQGA 3FZOA 4FTCA 5TT7A 4AP7A 2QURA 3CS9A 4WNKA 3ZH8A 5IMEA 5LJJA 1OB3A 3DKGA 3ORPA 2VTRA 4O0TA 4OAVB 5K5NA 3ZO2A 3VULA 3NIZA 3ZFYA 5KO1A 2R3NA 3FLSA 4BKJA 3HL7A 4DEAA 3R02A 4GVJA 2CKQA 3T3VA 3BE9A 4ZS4A 5A6NA 5M4UA 2ITPA 3JPVA 2AC3A 3GBZA 2VTTA 3F6XA 3UMXA 3U51A 1WVYA 4E73A 3VS4A 2QHNA 4O86A 2CSNA 3FC1X 4MKCA 4CRLA 2WTDA 4G3CA 2C6IA 3QTSA 2R3HA 5IA0A 2OJJA 3EZVA 3OMVA 4NFNA 4O7YA 4YLLA 3LFCA 4HNIA 4WNPA 4Y8DA 2GNFA 2ACXA 3KXZA 3GCVA 3ZFXA 2C6TA 3BE2A 5ANEA 4NYEA 3IW5A 1NXKA 4ZY4A 2A19B 2B9FA 4BI2A 3C4WA 2PVNA 4QYFA 3UP2A 4O7SA 4U81A 4AT3A 2G2IA 2J2IB 4FL1A 4UZDA 2CGWA 3LW0A 4O27B 3W10A 3ZTXA 4X21A 4BIDA 3AGMA 3W2CA 3W55A 4C58A 3BEAA 4ACHA 5CEPA 3FEGA 3QKLA 4G9CA 3A61A 3ACKA 3LPBA 3PUPA 4MX9A 3QUDA 5BVWA 3RZBA 4RQVA 4EJNA 3ORTA 4YJSA 5DIAA 3GP0A 1M14A 3FZSA 1OIYA 3NDMA 2XK6A 3NS9A 4ACDA 3ACJA 3R8VA 4ACGA 2PZYA 3O23A 1R78A 5LMKC 2IJMA 4II5A 3IGOA 2J6MA 5AR7A 1UU7A 4ZTNA 5HNBA 3UIXA 4ANSA 5IF1A 3AD6A 3R1YA 4IB0A 3DLSA 4D1ZA 4TNBA 1S9IA 4BGQA 4KIPA 5D7AA 5CYIA 2YZAA 3G51A 3MPAA 3MB6A 3MV5A 4Y95A 4DA5A 3PRFA 4YHFA 2YIQA 1PYXA 4NIFA 5EOLA 3OHTA 3D0EA 4RJ4A 5ETIA 3TTIA 3FLYA 3U55A 3LAUA 4TYEA 1R1WA 3SRVA 4QP1A 3FQSA 5CTPA 4OBOA 4CGAA 4RJ8A 4NCTA 3QRKA 1XWSA 3BQCA 4L01A 5A54A 2JDOA 3W32A 4HVIA 4WOVA 3IS5A 3B2WA 4DH8A 2VO3A 4OR5A 1XH9A 1CKJA 2ZMCA 3FI4A 5K0XA 2GTMA 4C34A 2JKQA 3A4OX 5E91A 2QHMA 2Z7SA 3GT8A 2BZJA 2VAGA 1YXVA 2BTSA 3D2IA 2VTJA 2VTMA 4O1PA 5HD4A 2QQ7A 4ZJJA 4O7LA 1NVSA 4IHPA 2ERZE 3EL8A 4O0SA 3GQLA 1OL1A 2W9FB 3AC5A 3KMMA 3U87A 3LVPA 4GK4A 4L9IA 1DI9A 2B1PA 1WZYA 3D2KA 3OROA 4M69B 4FTRA 3NW7A 3IOPA 4F08A 3TM0A 1M7NA 4F0IA 5FRIA 4XRLA 3A7JA 3EH9A 2WNTA 4G1WA 4JRVA 4GSBA 3F2AA 4IWPA 3ZC6A 1NW1A 4LL5A 2PUNA 3LMIA 4Y85A 5DGZA 2B9HA 3D83A 2JKMA 2NNWB 4ALVA 3BWJA 1QL6A 4ZS0A 4EH9A 3HDNA 2BDFA 1KV1A 3F66A 4HGSA 2ZM4A 4YZDA 3HMIA 3HV7A 2A1AB 3TJDA 1A06A 3DK6A 4G5JA 4AW2A 5HX8A 4TYIA 5FDXA 3PVBA 3DZOA 1YWVA 3FQEA 3OCBA 4U44A 4DEBA 4ITJA 4YP8A 4B9DA 1GZKA 4GUBA 3HP5A 4C35A 5A9UA 2DQ7X 3LE6A 3NRMA 4PDOA 3T3UA 3MGYA 3BBTB 2C0IA 3W8LA 4UWBA 4L46A 4FSTA 3C4EA 3I5ZA 2OFUA 4X2GA 2BIYA 1ZOHA 2PMIA 3HRCA 2E9OA 5CF8A 3F7WA 4FMQA 2IW8A 1Q4LA 3HP2A 3KL8A 4I6QA 2R4BA 3A7GA 3F69A 3Q9XA 3QCQA 2QOIA 4X3JA 4DGGA 3TTJA 4TWCA 5AP1A 4JG8A 2YJSA 3FC2A 4BZOA 5AV3A 1XHAA 5ANIA 3UNZA 3VAPA 3L8PA 5D1JA 5L4QA 3GCSA 4BTKA 4BCQA 4C4EA 4QMZA 5DN3A 2XCHA 2CLQA 4L43A 4DFZE 3FZPA 2WKMA 3RK7A 4BDJA 3TCPA 1W83A 1Q62A 2QG5A 5JH6A 3O8UA 3COKA 4HGEA 3CTJA 4X2JA 4I22A 2QOKA 4AT5A 2UUEA 2HZIA 4NM7A 1ATPE 4KABA 5LOHA 3NAXA 3FKOA 4BWPA 4RIOA 4RMZA 3QALE 3QXOA 3WF6A 3QTZA 2Y4IC 1OIQA 3OBGA 3V3VA 4BDCA 4CQEA 1BX6A 2XNEA 3IW7A 3ZXTA 4BBEA 4NKAA 3Q6WA 4R5SA 2WGJA 4BDFA 3Q5IA 3LQ5A 1KE6A 4E5AX 2V0DA 4QMSA 3ZMMA 2I40A 1V0PA 4ZSEA 4IZAA 4YPSA 2A2AA 2W1FA 4IFCA 3D14A 1U5QA 4DF3A 3I7CA 2NRYA 4F65A 3FI8A 3N4UA 5HGIA 2C1AA 4WKQA 3Q52A 5CALA 3RHXA 4FEWA 4BC6A 1AQ1A 1MRYA 4BDHA 2BRMA 4DTKA 3LFSA 3PP0A 4NCTC 4PNKA 5IQEA 5HORA 1UU9A 4G6NA 1H27A 3R1SA 2QKWB 5M53A 3KFAA 5DR2A 4BYIA 4J53A 1Y57A 4Y72A 4CYJA 1WBPA 5HZNA 1LEZA 2XVDA 5AUXA 3UO4A 4DG2E 3BYMA 3QRJA 4FI1A 2ZM1A 4RIYB 4MD7E 4HVSA 4WBBB 3BX5A 1UA2A 2BUJA 3PJCA 4FIFA 4KS7A 1OUKA 2HK5A 2J5FA 2XB7A 1QCFA 2C5VA 3ANQA 5DYJA 3ZDIA 5C9CA 1M17A 4I20A 5FTOA 1V1KA 4M14A 4ACMA 4O21A 1Q8ZA 4NU1A 4GU6A 3VIDA 1O9UA 2PE0A 3C0GA 2XNMA 3ITZA 4Z7GA 3CPBA 2ZB1A 3F2NA 4KNBA 3SXSA 4YO4A 3EQHA 3P78A 2HZ0A 5BVKA 4E26A 4EHVA 3EN5A 3TJCA 4RIWA 2P4IA 3MFTA 4MCVA 3OXTA 4G9RA 3HEGA 3V5TA 2EWAA 5IDPA 4FKLA 5E8TA 4FIEA 2XYUA 4H1MA 4V01A 3QD0A 2XIRA 3QRTA 5CT0A 5AR5A 3B8RA 3COIA 4UX9A 1SMHA 3FMEA 2BRNA 4C0TA 4RWKA 5CEQA 2GSFA 3S4QA 4R3PA 4J71A 5M51A 3IOKA 3QRIA 4FKVA 3U6HA 2GQSA 4XV3A 4F9WA 2C3LA 4OTQA 4ZSGA 2W1HA 4L68A 3QTXA 5T6KA 5KBRA 1VZOA 1GNGA 1IAHA 1SVGA 1XH6A 1XH5A 3HV5A 5CEOA 3CD3A 3QBNA 3N9XA 3QYZA 4LQMA 3PPZA 2E9PA 2BRGA 4KSQA 4IW0A 4AAAA 5AA9A 1U54A 2E2BA 3ULZA 4F99A 5CASA 3G6HA 5L6OA 5AP4A 4YJVA 4YNEA 3CJGA 4ZK5A 5IQDA 4GFOA 3OC1A 4EYJA 3KU2A 4FKGA 2XKFA 3HV4A 4R3RA 1A48A 4U97A 4O7ZA 3V5WA 4XOYA 4ASDA 5JGBA 3DDQA 5D41A 3LCKA 4E3CA 4GVAA 3T9TA 1GAGA 3TZMA 4FKTA 1OM1A 4LUEA 4XP3A 4UZHA 3UDBA 4O7VA 5H2UA 2BAQA 4ITHA 1H00A 3UNJA 4F6WA 2YLFA 3MH1A 3F3VA 3O0GA 4Q5HA 2Y0AA 3TNWA 4G2FA 3AQVA 3JS2A 3TZ8A 4MYGA 3W2QA 3IK3A 5ETAA 1XQZA 3I0QA 4MXAA 3AXWA 2ONLA 5CNOA 4MXYA 4OTGA 5KKRC 4EOSA 5CAPA 2X4FA 4HGTA 3OY3A 3QL8A 4MXCA 4GUEA 4I6HA 3NR9A 3E7VA 3VUDA 3RCDA 3ZUVA 2VZ6A 4FKOA 3L9PA 2X4ZA 4OTWA 4WIHA 2IO6A 3UOHA 2PYWA 4TYHA 3MIYA 5JRQA 1DS5A 3POOA 3RPYA 4Q5EA 4BVUA 1H1QA 2DS1A 4O7RA 4QRCA 4CG9A 3R63A 3H4JA 4I92A 2R64A 5A14A 4F7SA 3PIZA 4QP2A 5EDQA 1WBWA 3QQLA 5AP0A 1CTPE 2JC6A 1OPLA 4GS6A 1J7IA 2AYPA 4O82A 4BCGA 3OVVA 3CCNA 3WZUA 5AP3A 3KCKA 3FZ1A 1Q5KA 3OXZA 5LMBA 5HEZA 5JT2A 3W18A 2WAJA 3LXNA 4U9AA 1A9UA 2GS6A 1H0WA 2RGPA 4BZNA 5JFXA 3PG1A 3MW1A 2IW6A 3QD4A 3H10A 3KQ7A 5AWMA 4O0VA 3GC7A 3S00A 3N4TA 1GOLA 3NUPA 4FICA 3TEIA 5HX6A 3VC4A 2YCRA 3F3TA 2C6EA 1U4DA 4Y83A 4BKYA 4FGBA 2P2IA 3QYWA 2UZTA 4ZTQA 3DB6A 1Y8GA 4JIAA 1KV2A 4QMTA 1GZNA 4RSSA 4WSYA 5KZIA 4QMUA 2C0OA 4FODA 4Q2AA 4FOBA 4BBFA 1ERKA 2OJIA 2Y7JA 4AGUA 2R2PA 3DDPA 2B53A 4CG8A 2WMXA 2Y4IB 3A2CA 4D4YA 3NIEA 4EH7A 3QC9A 2WQEA 4UMRA 1K9AA 1IASA 1CSNA 1YDSE 2PTKA 2XM8A 2XKDA 3JVSA 4JQEA 4PF4A 4N6ZA 5J95A 3LHJA 4I93A 2W99B 5E92A 4YSMA 3DJ6A 4RPVA 2OKRA 3I6WA 3KK9A 3R00A 4NIFB 3KXGA 5K0KA 4A9YA 4NL0A 3VS5A 5FDPA 5IA1A 5I9YA 5J9LA 3BKBA 3PP1A 2V7OA 4JJRA 4MEDA 4NW5A 5F9EA 3TZ9A 2H8HA 2OXYA 4HPTE 2OH4A 1BKXA 2XZSA 2CKOA 2XJ1A 2QONA 3KK8A 1AD5A 3KXXA 5IUIA 2UVYA 3TKUA 1VYWA 4DH5A 3C4CA 1UWJA 4UMTA 4KKHA 5IQBA 3UOKA 4RFMA 4D9UA 4C59A 4YPDA 4D2TA 4QP8A 1ZXEA 5L8JA 3BRBA 4ZIMA 3MVHA 5DBXA 3OZ6A 3BU5A 2F7ZE 5HIDA 4NT4A 4FL3A 2X9EA 3PFQA 2XYNA 5FM2A 3GEQA 3FLNC 2VTNA 5HO6A 3EZRA 3DZQA 4EK5A 1WBOA 5HU3A 2WTJA 4DHFA 3R9OA 3NUXA 2P0CA 2R5TA 2XIZA 5IA3A 4DG0E 2BTRA 4JQ7A 4U3ZA 3I0OA 3EN9A 2ONLC 2X6EA 3P0MA 4EQCA 4AGWA 2IG7A 3A7HA 1EH4A 3IONA 5L2TA 4AG8A 2VX1A 4CFWA 4DFUA 1Y6AA 2GTNA 3R8MA 5TE0A 1PW2A 4NJDA 3PY0A 4DTAA 1W82A 2B7AA 3G9NA 4K8AA 5C8MA 4RVTA 2Z2WA 3IW6A 2W9ZB 4B8LA 1TQMA 2ITYA 1ZWSA 4LV5A 5EKOA 4UB7A 5CY3A 5JMSA 4DYMA 2GFCA 3PVWA 4U43A 5H8GA 2BZKB 3KY2A 4GK3A 5EQYA 5CEMA 4X6RA 5M55A 4FV5A 3G0FA 2QLUA 3WZDA 4DINA 5EK7A 4XP0A 4OBQA 4I0SA 3CQWA 3WIGA 3ODZX 4XG3A 2HW6A 2JITA 3NUNA 3ZBFA 1ZYLA 1VEBA 2GNIA 4GMYA 2OF4A 3D7TA 2Q0BA 5GIOE 2W1IA 5EM5A 4F1TA 2XRUA 4RFYA 2UW4A 3EMGA 3HMOA 2O3PA 4RLLA 4YBJA 3ZLWA 4MWIA 2GNLA 5D12A 3R9NA 4FG7A 1XJDA 2H6DA 3WE8A 4D1XA 3VVHA 2Y8OA 1WVXA 3ZRLA 3TUBA 4F63A 5DR6A 2VTSA 4HPUE 4MD8E 2X7GA 3QKKA 2H9VA 3OCSA 1ZLTA 3Q2MA 2HY81 2OXDA 2QKRA 2YABA 2OICA 4I41A 5FLFA 4ALUA 3RM6A 3GFWA 4I0TA 4EHEA 4FTIA 3UPZA 4YTFA 3ORKA 4M8TA 5HLWA 1GIHA 3QLFA 3KC3A 3L9MA 3FPQA 2W4OA 4EWQA 1H28A 4AGCA 3FYJX 5L2SA 2G01A 4EZ5A 5HBEA 1YHVA 5CF6A 4PL4A 1BMKA 4F9AA 4U45A 5TO8A 5KKRB 4YURA 4X6QC 4IC8A 4AACA 1RQQA 3ZM9A 4ZLYA 2QODA 4FSUA 3RJCA 1W8CA 2ETKA 3GCQA 1OBDA 4O84A 3QTUA 1H1WA 4N6YA 4XH6A 3MESA 2VN9A 4AFJA 3V5JA 3RGFA 3ETAA 4F1OA 2C1BA 4FV1A 4E93A 3C50A 4FA2A 3QGWA 2DUVA 3ATSA 3D94A 2UZOA 4BN1A 3DNEA 4UV0A 2OWBA 3G2FA 2C68A 5EYDA 4K0YA 2YISA 1IR3A 4U3YA 4AOJA 2BR1A 3NW6A 4XEYA 4CFNA 4ZTRA 2HIWA 4APPA 2BVAA 4XCUA 4EHGA 1PXMA 3TN8A 4BGHA 4LRMA 4F70A 1UWHA 2W4KA 4GT3A 2OG8A 4U79A 4O0UA 1W84A 5GIPE 1UNLA 4K77A 2EXCX 4EOIA 2C5NA 1G3NA 3AT2A 1YOMA 3I4BA 4OTIA 4YGAA 4O2PA 4XG2A 5FP5A 5A4LA 3PTGA 5G6VA 4PMPA 2IVTA 3ZUTA 3NYOA 4D5KA 1KUTA 1REJA 4PY1A 4HYUA 3R6XA 3SLSA 1SZMA 1OIUA 2C3IB 4FSZA 3R71A 2BPMA 4ID7A 1OITA 5EI2A 1H07A 2IZSA 1PMUA 3AC2A 3OW3A 1YXXA 3VW8A 2Z7RA 5C27A 5DFPA 1I44A 3EJ1A 5E9EA 1YXUA 2WMTA 3FE3A 2VX0A 2FSMX 3F5UA 3KN6A 1STCE 3WBLA 4A9TA 3FLZA 2CCHA 4QOXA 2X8EA 4AX8A 5K3YA 4ORKA 3F82A 2J0IA 1H08A 2WMWA 5AX3A 4R77A 4D9TA 4K18A 4JDHA 5BUJA 4DBXA 2Z7QA 5LWMA 3HAMA 4AOTA 3M1SA 3NX8A 4MQ1A 4NWMA 4J96A 4XBUA 3ROYA 5IQIA 4U0IA 3D5UA 5JGAA 3DJ7A 2HWOA 4TL0A 3QQUA 2YHVA 2UVXA 4MNFA 4E6QA 5I0BA 4FG8A 2VTHA 1J7UA 3W8QA 5CU2A 1Q8TA 3BYUA 4TN6A 3TZ7A 2WD1A 3W2RA 2X8IA 1CKIA 3MYGA 3QX4A 3QQHA 3CGFA 3UMWA 3KCFA 4UALA 4HCUA 4ZZOA 3OS3A 4EEVA 2Q0NA 1MQBA 5FP6A 4DT8A 1OKZA 4RIXA 5CU3A 3M2WA 2WTIA 3FL4A 4HZSA 4YTIA 2PVYA 4FEVA 4O22A 5GHVA 3LQ8A 2UZDA 2YM8A 2UZLA 3E8CA 5I9ZA 4QTAA 4ANQA 5JEBA 3O7LD 4LOOA 4ZMEA 4CNHA 2UW7A 3DY7A 4CXAA 2IZTA 1PXIA 1U46A 3A7IA 4ERKA 2J9MA 3TIYA 3TV6A 2PWLA 2YIYA 2R3PA 3KA0A 4I5PA 4BICA 1XBAA 3JY9A 3NNVA 1GIJA 3S95A 2X2LA 2CGUA 2X0GA 1PMEA 3GFEA 1W7HA 4GFGA 4J7BA 3I5NA 4QP9A 5AUZA 5TOZA 5CSHA 4ZTLA 4DEHA 1YQJA 3DBEA 1OPJA 2HXLA 4FV2A 5AUVA 5DLSA 4BTJA 4M68A 3KULB 4MAOA 5TF9A 1NY3A 3FSFA 4H3BA 4I6BA 5JQ5A 4PUZA 3MN3A 3LM0A 3DS6A 3R9RA 2PMLX 1WFCA 2XJ0A 2OIDA 1RDQE 4EOQA 4GL9A 2IVSA 2F57A 4JS8A 2WB8A 1O6YA 4WBOA 3UZTA 4FF8A 4A4XA 4XLVA 5HOAA 4DCAA 3F9NA 3VUKA 4YJTA 4WO5A 4MH7A 4QP7A 2ITQA 2PVMA 2IW9A 3E64A 4TYHB 5J9ZA 2FVDA 4OW8A 4K33A 4C2WA 2EB3A 3VF9A 1OKVA 3F3UA 1ZZ2A 3I7BA 3R83A 3DQWA 3W2SA 3C1XA 4YZ9A 4O0RA 3G33A 3BZ3A 1FMOE 1UKIA 2ZV9A 3CTHA 3LMGA 2BDWA 4ENYA 4RJ7A 4FV3A 3NUSA 3FY0A 1YOJA 4J8MA 3PA3A 5EFQA 4YO6A 4TNDA 3FSKA 3MFSA 3KVWA 5LVNA 3VNTA 4BDGA 4D4RA 3LXLA 4EOKA 4N57A 1SVHA 2OZAB 1TQPA 2RG6A 2XH5A 4QMMA 4KAOA 3TV4A 4CRSA 2PUIA 2YDIA 5GINE 2WMSA 3R30A 2GU8A 3NZ0A 5HICA 2OFVA 3OCGA 2B55A 2F4JA 3BLQA 3E8EA 3S2PA 4FZ7A 4AE9A 4RC2A 5FM3A 3GVUA 4FSWA 5KCVA 4TWNA 2Y4PA 3A8WA 3K5UA 3K54A 4W4WA 2QCSA 3ZM4A 5IUHA 3I79A 3NCGA 3JY0A 4FKIA 4U6RA 1PXKA 1YDTE 2VGOA 3DBFA 3MJ2A 3QCSA 5E90A 4C36A 3SV0A 4DH7A 5EM8A 3F5PA 1MRVA 3TUCA 3ZC5A 4Z16A 5LXMA 4D2WA 4BCHA 3QF9A 2YIWA 5EQEA 4X3FA 5M09A 3NW5A 3D9VA 5CEIA 3POZA 3TT0A 4G3DA 1CDKA 2GS7A 3NLBA 5CT7A 4FNZA 2XK4A 1YHSA 4R5YA 3RVGA 1XH8A 2XNOA 5BYYA 2GCDA 3TKHA 3OT3A 3GB2A 3M42A 3ZONA 4CFVA 3CLYA 2R3JA 4IVDA 5EM6A 1NA7A 1APME 4QYEA 3QHRA 3E62A 4J1RA 5I9XA 4R6VA 1BL7A 5LVOA 3BIZA 3QWJA 5EOBA 4IAZA 5DI1A 3C0IA 4IX6A 5M4IA 1Z5MA 1OMWA 4IEBA 5EM7A 4AGDA 4F0GA 2VX3A 5CF5A 3UZPA 4AA5A 3BHHA 3DQXA 5FWKK 3VQUA 4EH3A 5K4IA 4FE2A 4YR8A 2XNGA 4IWOA 4AW0A 4L52A 4FYOA 1XH7A 2OJGA 2QNJA 3P23A 4JAJA 4OUCA 3SD0A 2C4GA 5LVMA 3GOPA 5BVFA 4F7NA 5CAVA 2ZV2A 1BI8A 4FUYA 2UW3A 2QO7A 4JDKA 2ITOA 3PIXA 4XG9A 4XP2A 4S2ZA 1YKRA 4EWHA 3LJ0A 4FT0A 3F5GA 3QRUA 4TWOA 4XJ0A 1UKHA 3VBYA 3PA4A 2YWVA 1M7QA 5CS6A 5DA3A 3RNYA 3RWQA 1ZZLA 3ZRKA 3A8XA 3MIAA 4E6DA 3OUKA 4KRDA 2XNPA 2CJMA 4F7LA 5TR6A 5AP2A 4GKHA 3R9HA 3Q3BA 3FL5A 3NMUF 2QOBA 5L6PA 4KUJA 3GOKA 1T46A 2W5AA 2WTCA 4EH6A 4EKLA 2ZYBA 5JGDA 5C26A 2C69A 1G8SA 4YZMA 1MQ4A 3HA6A 3VHKA 4WG4A 1FBNA 1R39A 4OAUC 4EZ3A 5HE0A 3ZS5A 4PP7A 4XV1A 5A3XA 1WBTA 2NPQA 3A7FA 5IDNA 1IEPA 4X7QA 4JIKA 2R3RA 4ZZNA 3VS6A 3Q53A 4TYGA 2YAKA 4KWPA 2JAVA 3OP5A 1Q99A 4CT2A 3ATTA 3S3IA 2BRHA 5AX9A 5B2LA 4USEA 2REIA 4U8ZA 3EB0A 2J0MB 3WI6A 3IPHA 5IMXA 5EW9A 2X6DA 3RALA 2JFMA 5ITAA 4DITA 3BELA 3DK3A 2J5EA 4L3PA 3LZBA 5E1SA 4B7TA 4J8NA 1FINA 2JDSA 2OIQA 2ZV7A 3DXNA 5EDPA 4BL1A 3RPVA 2WMAA 4K1BA 5FD2A 5DPVA 1M2RA 4JBPA 4MF0A 2HAKA 3WILA 1KE7A 4KRCA 2WTKC 4KIOA 3R0TA 4M15A 4IXPA 4LGDA 5CI6A 4WD5A 3JVRA 3LIJA 2PU8A 2W17A 4CCBA 4OTHA 3ZSGA 2CNVA 3NYNA 4V04A 2HELA 2R3MA 4IDVA 1ZYCA 2R3QA 1XR1A 2W06A 3AD4A 3F3ZA 4MQ2A 5M44A 1GZOA 5CAUA 1IA9A 2WFYA 4HW7A 3O17A 4IQ6A 3OW4A 1QPJA 4PQNA 2JIVA 5E4HA 1P5EA 5C8NA 4ENXA 4G3FA 1Q8YA 2ITNA 2QLQA 4M0ZA 5LWNA 2IWIA 4WUAA 2CN8A 2R7IA 1IAJA 1RE8A 1B38A 1GIIA 4MXXA 4N0SA 3UG2A 2C30A 5FGKA 1TQIA 3NEWA 4ZEGA 4YHTA 3LLTA 2B9JA 3WYXA 5DMZA 1P4FA 4FV7A 3L1SA 2VWBA 2RIOA 5IEXA 5FEDA 3KRJA 4D1SA 4V0GA 4GT4A 4O1OA 3KF7A 3FPMA 2EB2A 5ETFA 2PL0A 4GYIA 2PY3A 2E9NA 3C0HA 5DE2A 4CFXA 4RX5A 5IEYA 5CQUA 2PVRA 4QMNA 2XKCA 3GC8A 4EK8A 4BCJA 2FUMA 4FVPA 4MNEA 3OOMA 4KKEA 4PTGA 3R28A 3RWPA 4GEOA 5F95A 5DH3A 3RZFA 1H26A 1G8AA 3HA8A 3HV3A 5FQDC 5GJDA 3PXRA 1BI7A 5LARA 1JSUA 4JX3A 4M97A 4O7WA 4IJPA 3CE3A 4FIIA 2KTYA 3F7ZA 3U6JA 3FXZA 2YIRA 3L8VA 1IG1A 3E63A 3EQIA 3R2BA 5F4NA 4XBRA 5F94A 4L00A 1J7LA 4EOOA 2JKKA 2NO3A 3FYKX 5B7VA 4BCMA 4JRNA 1H1SA 3SXFA 2BCJA 3PA5A 4GU9A 1B39A 3UP7A 2WU6A 5K9IA 2BKZA 2H34A 4IIRA 3GENA 4BWKA 4ANMA 5GJGA 4AW5A 4J52A 5CZIA 1GZ8A 3KXMA 5HTBA 3FXXA 3R7VA 1KE9A 3MH0A 4NFMA 2EXMA 4ZXTA 2RKUA 2PVLA 2RFDA 3R21A 4TY1A 5KMJA 2UVZA 2BDJA 1ZOGA 2ERKA 2QI8A 2C5OA 2R9SA 4PMTA 4PWNA 4NM5A 4A06A 2WPAA 2YITA 3BPRA 4XV9A 2FH9A 1L3RE 4FV4A 4CMOA 2CHLA 4CTCA 3CKXA 3LXKA 3P5KA 4CFMA 3D5XA 4C62A 2X7FA 2BFXA 4UEUA 3FKLA 4IZYA 4W4VA 1YW2A 4PPBA 2AUHA 2YM4A 4ONAA 4Y46A 3RNIA 3VWAA 4BHZA 4XG7A 4EOMA 2CCIA 2XIKA 1QPEA 1WBVA 1FVRA 3IDPA 2W5BA 4Y73A 4ALWA 4EBVA 4ZJVA 4R7BA 4RGJA 1Q24A 4BIEA 3P9JA 3PPJA 3R8LA 3REPA 4F09A 4FT3A 5M4FA 4X2KA 3NSZA 2W05A 4S33A 4MD9E 4L7SA 2X9FA 5F20A 4MWHA 4JQ8A 4C4JA 4JAIA 4EONA 3JR1A 4RJ3A 2ITZA 4JBVA 3DGKA 5D11A 3RAWA 1CKPA 1F5QA 3DBCA 5DRDA 4BDAA 5D9HA 5CSVA 3BHYA 4QMLA 5AR8A 3PVUA 4DTBA 3LFFA 3TXOA 3UVQA 2JKOA 5CVFA 4FNYA 2OW3A 5HG9A 3FMHA 4L44A 4IC7A 2R0IA 5CF4A 3SKCA 4E6CA 4RIXB 5CI7A 5EDRA 4XS2A 3R04A 3AC1A 2XIXA 3FLQA 2OJFE 4WSQA 3SX9A 2FB8A 1OL2A 3NPCA 4WA9A 3R01A 5DRBA 4O0WA 4CFFA 4CT1A 1XBCA 4NKSA 5FUTA 3RMFA 1JNKA 3ZUUA 1ZRZA 3PYYA 4ZY6A 4S34A 3DTCA 4LRKA 2YEXA 4CZUA 3AG9A 3PLSA 4H1JA 3U4UA 4I21A 2B0QA 3HMPA 4O6EA 4RX7A 4FKQA 4FK6A 1JAMA 4R1YA 3V8SA 3EFKA 1X8BA 5AV0A 5CZHA 2XBJA 4L45A 1YRPA 2IN6A 5KHXA 3G9LX 2ITVA 2JIUA 2XCKA 5LVLA 2VWYA 4QMPA 4BCFA 2B52A 4FNXA 4B0GA 1FVVA 1URCA 2G9XA 3EFJA 5D10A 3HNGA 5HVYA 4PMMA 3RINA 1ZAOA 4RX8A 2R3OA 3PG3A 3ZXZA 3Q60A 3UIBA 4Q9ZA 4QMQA 3O7LB 3QGYA 4JR7A 3S0OA 2JIIA 3P79A 3K2LA 4D2VA 3P7AA 4A9SA 4QTEA 2OF2A 3GQIA 5IH4A 5L2QA 4NTSA 3E5AA 4O0XA 3DA6A 3V01A 3HUBA 1SVEA 3MVLA 3MBLA 3PXFA 4OTFA 3R7UA 4C7TA 4NJ3A 5JZNA 4L3JA 2FYSA 5AJQA 3LLAA 4KBAA 1JPAA 3TDWA 2X2KA 2FSTX 3BHVA 3UQFA 2UZUE 5ETCA 4FOCA 4BCNA 4JOAA 4D55A 4EC9A 5JSMA 3N51A 3LFAA 4IX3A 2PZIA 4H3PA 1H4LA 2C3JA 3FZRA 3NGAA 3A60A 3QA8A 3PJ8A 4ZTSA 5FXRA 5GZAA 1SYKA 2VWIA 4P2KA 1IA8A 4AZTA 2Z60A 2FA2A 3UQGA 4BF2A 3NUAA 1AGWA 4DGMA 2R7BA 4W8EA 4UYNA 2WTKB 4GRBA 3W33A 2YWPA 3ELJA 4FKRA 5H8EA 4FKWA 1H24A 4IB5A 3V6SA 3ODYX 3W16A 4DFXE 3DAKA 3DJ5A 3MPTA 4O91A 4HCVA 1Y6BA 4HYHA 4JL9A 3LMHA 3E88A 2UW8A 4FC0A 5J9YA 5ANJA 2PE1A 3CXWA 2W4JA 3TKIA 3UC4A 2YM6A 4NK9A 3FZTA 4G6OA 4K9YA 3VBTA 2GFSA 2GQGA 4U7ZA 4YJOA 2C6OA 3DBDA 4JT3A 1DAYA 1P4OA 1GJOA 4C4GA 3OXIA 2C5XA 3ALNA 4I24A 5A4CA 3QUEA 2O0UA 3BBWA 4BY9E 4UBAA 3EQBA 4AWIA 5L6WL 5BPYA 4MXOA 3FUPA 5HE1A 3SRVB 3HRBA 3SA0A 2F9GA 4LGHA 4YTCA 3KRRA 5JFSA 5EH0A 3C51A 3CTQA 5CXZA 3GUBA 4AQCA 2EU9A 2C5YA 3BHTA 4QP6A 4UXLA 3R1NA 3WZEA 2WIHA 4DLIA 5A4TA 4YJUA 4F0FA 2PZ5A 3N4VA 3BEGA 4EQMA 4I6FA 4P5ZA 4USDA 4AE6A 4FBXA 1YI6A 2XF0A 4FT7A 2JDRA 4H36A 4BI1A 3TNPC 4ZAUA 5CVGA 4DE4A 3F88A 1J1BA 4AA0A 3MS9A 2V22A 2J4ZA 3KN5A 2OJ9A 1ZY5A 3F61A 3FMKA 4J97A 5C01A 3RAIA 2XP2A 3EFLA 3OBJA 5LCJA 3UZRA 3VJOA 2F2CB 3WE4A 4QMOA 4UWYA 3ZZWA 1ZY4A 3TWJA 4F9BA 4E6AA 2O5KA 4G31A 4YU2A 5M4CA 2YJRA 5CNNA 1LPUA 2EVAA 3KVXA 5L2IA 3CKWA 5BVEA 4RC3A 4Z7HA 1PXPA 2J0LA 2BAJA 3E3PA 2WMBA 3KEXA 4ZSLA 4MBJA 4P5QA 4C2VA 1P14A 4HVGA 5HVKA 5I4NA 2JAMA 2UZEA 4DC2A 5AP7A 4A4LA 4EOLA 2CNUA 4RWLA 2UZBA 4JVGA 4XG6A 3ZDUA 3O8PA 4EBWA 5HLPA 5IISA 2BMCA 2O65A 4Q9SA 3SXRA 2WTWA 3GC0A 4IWQA 5LQFA 3TG1A 2JEDA 4JLCA 4ANLA 4DLJA 4G3GA 4AZWA 4E4NA 4M0YA 4WRGA 2IZUA 4YLKA 3AT4A 4OTPA 4U80A 3O50A 3CSVA 3QZHA 5LMAA 3R7GA 5BVNA 4O7NA 4FZFB 2R0UA 3L9LA 1JVPP 2RFSA 4QYYA 3DLZA 5KBQA 4LMUA 5IG1A 4QTDA 2PULA 2VV9A 5EI6A 3Q5ZA 5I3RA 5CQWA 5DT4A 4E20A 4PX6A 3RBWA 2C6DA 4O38A 3DOGA 4HZRA 5ANKA 4QMVA 4I4EA 5IQCA 4QNAA 2PUPA 3BLHA 3D5VA 5FBNC 4BB4A 1PJKA 2RSVA 4AN3A 4RVMA 4L67A 4IH8A 4X2FA 5C4LA 2NP8A 4QO9A 4I0RA 4IB3A 2VTPA 3MH2A 4HJOA 1KOBA 3IG7A 4DH1A 4DGLC 3EN6A 3IO7A 3GU5A 4BWXA 3VW6A 2VTQA 4JBOA 4WT6A 5IH5A 5J7BA 2WTVA 4FSQA 3T9IA 3RK5A 3MY1A 4A9RA 3RK9A 4YJRA 2WQOA 3QC4A 3CD8A 4E7WA 2X2MA 5AUWA 2AC5A 3TI1A 4FGRA 3EN4A 4TPTA 2ITTA 4JG6A 3L8XA 3W2OA 3PDTA 4FTMA 3D15A 4D58A 3GU4A 1JLUE 4L53A 5GJFA 3PWDA 4XG4A 3O2MA 3HV6A 4PTEA 4TZRA 5CENA 3Q2JA 4BR3A 2CPKE 3TNIA 3G5DA 4QT1A 5CXHA 4CKRA 2I6LA 4IACA 5CVHA 4FZDB 5KZ0A 2UZVA 3BGPA 4LV8A 4BDIA 4IBMA 5IQHA 4QMWA 5C4KA 3MVJA 3E87A 4FR4A 5KX8A 4TTHB 1QPDA 1WAKA 4AA4A 2GHGA 4RJ6A 3OUNB 2LAVA 4D0WA 4R78A 2PSQA 4DFYA 3OTVA 5CX9A 3WZKA 3E92A 5AADA 3ZO1A 4DGNA 4QNYA 1OL6A 5HG7A 4EYMA 4KINA 3FV8A 3VF8A 3EOCA 3DCVA 1H01A 3E93A 2B54A 3PE1A 4R8QA 4D0XA 5A46A 4IM0A 4FYNA 4IADA 4EC8A 3FMJA 3IDCA 4EQUA 4JX7A 4ZZMA 3MDYA 1R0PA 3OG7A 4E1ZA 3I1AA 4RVKA 5IA4A 4GFMA 1XO2B 4EI4A 4PDYA 3P1AA 4DGOA 4U42A 3QZIA 3WF7A 3PWYA 4W9XA 4ZY5A 2ZDUA 5I3OA 1H25A 2W1ZA 2UW9A 3LCOA 4FK3A 4XG8A 5E1EA 4JDIA 3QLGA 3OD6X 1R3CA 2J0KA 3DPKA 4GIHA 4RIYA 4BIBA 3ZLSA 2OI4X 5L2WA 1T45A 3QA0A 4O96A 4U41A 2YM3A 5L8KA 3K3IA 2JD5A 4YTHA 3GCUA 2VWXA 2EXEA 5HCYA 3FHRA 5KE0A 5M57A 3KKVA 4L7FA 5KMMA 1OECA 2VWWA 3TDVA 3KMWA 5IA5A 1O6LA 3VBXA 3OWKA 3COHA 4RIWB 5BX0A 1YOLA 3G0EA 4TXCA 4WNOA 4I3ZA 5GZ9A 3MFRA 5HO8A 1XKKA 4JDJA 3FQHA 3P4KA 4B8MA 1QPCA 2GHMA 3AC8A 1WVWA 3LOKA 2WOUA 1FOTA 3NNWA 4LG4A 5BQ0A 3NVKI 1JSVA 1LP4A 4WG5A 4B6LA 1H0VA 4CZYB 3BI6A 3SAYA 3QX2A 2I0HA 5BMMA 2CGVA 4MBIA 1IRKA 5DT3A 4QQ5A 4AZEA 3UOLA 1PRYA 4E5WA 4D4VA 3L8SA 4IVAA 5DEWA 4TKSA 4YC3A 5AM6A 4YSJA 2GMXA 2WEIA 3BLRA 1M2QA 3JUHA 2HCKA 4IVBA 4BCKA 3QQJA 4TYJA 3H9RA 4N70A 4BI0A 1U54B 4PNIA 4HCTA 2QVSE 3SC1A 3OTUA 3MWUA 4C37A 4D5HA 3HDMA 2GS2A 4CD0A 1FMKA 3RAKA 3F5XA 3SW7A 4TRLA 5BYLA 1KSWA 3JXWA 4EH4A 3UIMA 4EH5A 2Z7LA 4BYJA 2PMNX 5CU0A 3DFCB 4BKZA 2UZWE 3C7QA 3R73A 4F7JA 4CLJA 1V0OA 4IM2A 1DAWA 4AN2A 2UV2A 2FGIA 3K5VA 5JQ8A 4A07A 4U5JA 4O83A 4J98A 3R7OA 5HTIA 4W4YA 4BRXA 4YUQA 4Z9LA 4DEDA 3UYTA 4Y5QA 4EOJA 2VTLA 3ZO3A 4FTOA 3RKBA 4C3FA 3ENHA 1JWHA 4BDBA 3S1HA 4FEUA 4DT9A 4E4MA 4GCJA 2ZOQA 1UVRA 4KSPA 1WBNA 5G1XA 3AD5A
chains in the Genus database with same CATH superfamily
2W5HA 5H9BA 3PLAE 1FGIA 4GJ3A 4IZ7A 3PY1A 5AR4A 4C33A 2HZ4A 2XRWA 2J90A 5B2KA 2OLCA 4XHKB 5AMNA 4GYGA 4PV0A 3BYOA 2XK7A 4L8MA 3Q6UA 4HYIA 4CZTA 3W0PA 2R3FA 4O6LA 2A0CX 5IUGA 2GNGA 3Q96A 1Q97A 3QZFA 3ULIA 4GKIA 4MK0A 4R3CA 1O6KA 3P7BA 1VR2A 5CSXA 4YJNA 2XNNA 2HOGA 3IGGA 4K11A 1JBPE 2E9UA 1W0XC 2G2FA 5KMNA 4V05A 3D5WA 5L8LA 5HD7A 3IW8A 5AEPA 5EKNA 4CVAA 2WZJA 4FUXA 3MA6A 4IB1A 2G1TA 4IE9A 1J1CA 2BROA 4I5CA 3QTQA 2ZV8A 3PXZA 4IJ9A 2BILB 3OY1A 4IVCA 5D7VA 3UO5A 1TKIA 4IX4A 5B0XA 3KXNA 3CEKA 1P2AA 1OIRA 4ZSJA 4IM3A 3BCEA 4DG3E 5C1QB 4FV8A 4JMQA 4MBLA 4BBMA 5HBJA 4FIJA 4QD6A 3FMLA 3FJQE 4LOPA 2I0YA 4UMQA 2GNJA 2P2HA 3EYGA 3VO3A 2QR8A 5HG8A 3VS1A 4O7TA 4ANOA 1RW8A 4I4FA 3ORNA 4ARKA 2PVHA 2QR7A 1FPUA 3GU6A 3PJ1A 2YN8A 4XUFA 1M52A 1PKDA 5IZFA 3FXWA 1E1XA 4LRJA 3EYHA 2YACA 4KD1A 5EYKA 4KIKA 4EHZA 4ZSAA 4BDKA 1LUFA 1OI9A 5EW8A 2ZVAA 1SNUA 4RG0A 3VN9A 5AP6A 5BYZA 4YNOA 3II5A 4ASXA 5FXSA 2CNQA 2FSLX 3H0ZA 3H0YA 4IWDA 1H8FA 2IVVA 4G3EA 4AW1A 1Q3WA 3V6RA 2C47A 4AZVA 2RFNA 1Y8YA 5DG5A 2RFEA 2WMRA 4FSRA 1HCKA 4AN9A 2OSCA 2J0JA 2QO9A 4W9WA 3ZRMA 3SG9A 2QOOA 4C38A 4M3QA 2VGPA 1HOWA 3KMUA 2P55A 3MA3A 1URWA 2GPHA 5FEQA 5J1WA 5HIBA 1MP8A 4RBLA 4MF1A 3U4WA 2IPXA 5EHLA 4NEUA 3FKNA 3CPCA 2XKEA 3QUPA 2VO0A 3NUUA 4NZWB 2HY0A 1UV5A 2YAAA 4ASEA 3PIYA 4CKIA 4O2ZA 4F64A 2BAKA 3RCJA 2ZM3A 2VRXA 4WRSA 4P4CA 3C4ZA 2R3IA 3CY3A 5AAEA 3HKOA 2WIPA 5DNRA 3OWPA 4U40A 3ANRA 3SOCA 2QOQA 5KMLA 4Z55A 5CEKA 2VNYA 3U6IA 1ZARA 3HGKA 4HYSA 3WYYA 3CR0A 4X0MA 4AZFA 2UW0A 4J99A 4R7IA 1ZMWA 5FEEA 1Q41A 3DKOA 3ORIA 3V8WA 4L6QA 4JBQA 1BL6A 3EWHA 2YCSA 3EQDA 4MXZA 5EI8A 3UIUA 4ZLZA 3UODA 5AUTA 4WG3A 1NVRA 2Y6OA 2F49A 3UVPA 4E5BA 3PZEA 1U5RA 3SOAA 3V5LA 1ZOEA 3CC6A 4FV9A 3VUIA 3QKMA 4GG5A 4EORA 3KGAA 4LFIA 2YLEA 3MPMA 4FKSA 5DEYA 5EW3A 3UE4A 3VUHA 4M7IA 4CQGA 3DXQA 2XK9A 2PZRA 2PHKA 2GHLA 3DB8A 3RI1A 4F1MA 4LGGA 1F0QA 4QP4A 4R7HA 4QTCA 4O0YA 4I5MA 3R9DA 3BQRA 3UGCA 1DM2A 3VS2A 2CKEA 2QOFA 2P33A 3FBVA 5HKMA 3V5PA 3ZYAA 4ANBA 2R3LA 4BFMA 2W1CA 3IW4A 3ERKA 3LM5A 1TVOA 3ZEPA 2CGXA 3NCZA 3WF9A 1TFFA 2X39A 3PVGA 5AV4A 4O81A 3D7TB 1JKKA 4UN0C 4FNWA 2QOCA 4QPSA 5E8SA 2HWPA 4JI9A 5J8IA 5IEVA 3TV7A 3AMAA 4EK4A 2OXXA 4QQCA 3UVRA 2ZAZA 4JNWA 1Q8UA 3L9NA 3UNKA 2W1GA 5J5SA 2QO2A 2V5QA 5CSWA 1PYEA 4D2RA 3OEFX 4C4HA 4QQJA 3KRXA 4GW8A 4CV8A 3THBA 2Q83A 1QMZA 3EL7A 4HVHA 4IAAA 4BDDA 2OK1A 1V0BA 1VJYA 3PJ2A 3PSDA 5CU4A 1JOWB 2VUWA 3BWFA 3SQQA 3ZOSA 2CLXA 2P3GX 5AIKA 5AIRA 4IDTA 2WMQA 5A4EA 5M08A 3ORLA 4X3FC 2NRUA 5J79A 3BLAA 2QD9A 2ITWA 3OWJA 4CLIA 2VTAA 3ZCLA 3ROCA 3BV3A 3CIKA 4FZAB 4BHNA 4UMPA 1Z57A 3LJ2A 4FL2A 2W7XA 3FDNA 3DKCA 4G6LA 4OBPA 1K2PA 4X2NA 3DV3A 3NNUA 4I1ZA 4C3PA 4AS0A 1GY3A 1ND4A 1Z9XA 3AKKA 4EKKA 2JGZA 5ANGA 4FVQA 4GIIA 5HBHA 4KA3A 3VRZA 5HQ0A 5JFWA 2CMWA 4M12A 5M06A 2WO6A 1G5SA 3QQFA 5BMSA 1WCCA 4RA5A 4GK2A 3T8OA 5CAQA 3VQHA 5KMKA 4QDVA 4FV6A 4IFGA 4AFEA 3FY2A 1SM2A 4YJQA 4AOIA 4FTJA 3NNXA 4C4FA 4E4LA 5LVPA 3OCTA 3HMMA 4XLIA 3KXHA 3MFUA 4A7CA 4LI5A 2PK9A 3NVMB 3VBWA 1CM8A 3GNIB 5T3QA 2VNWA 3TL8A 3HAVA 2WELA 1YDRE 1YWNA 4JG7A 1REKA 1J91A 2XMYA 1KWPA 1JSTA 3OT8A 5HE2A 3ZBXA 1PXOA 4GH2A 3D7ZA 3Q9YA 2JDTA 4BDEA 2XEZA 2ZDTA 5C03A 3AC3A 3AGLA 4N4SA 3EKNA 4BCIA 3CQUA 3U9NA 3ZSHA 4ERWA 2H96A 2BIKB 2HYYA 4I23A 1FGKA 2W1EA 4AT4A 4C3RA 4DFBA 3PE2A 4K2RA 5EYMA 3VS0A 5I9WA 4Z3VA 2LGCA 3OWLA 4XNEA 5TKDA 2OIBA 2BRBA 4PDPA 4QTBA 3WOWA 1FVTA 3E3BX 3UOJA 4IAYA 2VWUA 3FMNA 3G15A 2BALA 4FZ6A 4LMNA 5HHWA 5ANDA 3CY2A 5F1ZA 5I9VA 4MVFA 4WHZA 3CQEA 5KHWA 2ITXA 2WU7A 4BCOA 5ICPA 3HRFA 3DAEA 5HESA 3DT1A 3EQFA 3R2YA 3SHEA 3A62A 4RJ5A 2DYLA 3MY0A 3DFAA 4B4LA 2I0VA 3MY5A 2VU3A 3OFMA 4UXQA 1OVEA 4IX5A 3QCXA 2F7EE 4HNFA 1OKYA 3H3CA 3R1QA 4KBKA 3EHAA 3GI3A 3O96A 4F4PA 4ASZA 3RHKA 4LUDA 2PVFA 2YDJA 2XEYA 4Y5HA 4YC6A 4GT5A 5DHJA 2XIYA 4LOQA 4A9UA 4E8AA 3C5IA 2ZB0A 2WOTA 2OH0E 2VTIA 3MB7A 3R8ZA 5KNJA 2G15A 2RG5A 2FO0A 3OF0A 5EHYA 1YVJA 4FKUA 3ENMA 4EH2A 4NTTA 3KREA 4YHJA 3A99A 3FAAA 4QQTA 5FTQA 5HCXA 3QHWA 3F2RA 3MJ1A 1YI3A 4PL5A 1U59A 3V8TA 4EK6A 2DWBA 4ZTHA 3ORXA 4D2SA 3MI9A 5I5ZA 3NYVA 2WQMA 3TNHA 4JR3A 3TNQB 5J7HA 4KBCA 3UJGA 3VHEA 3LQ3A 3C4FA 4M66A 5ANOA 3LCTA 1HCLA 3LFEA 4XX9A 4NSTA 4BJJA 4AAYA 5AP5A 5EHOA 4XOZA 5IQFA 4CKJA 3VJNA 3MH3A 1ZYDA 1PXJA 3PSCA 1UU3A 3EN7A 2HW7A 3KULA 5CWZA 3KF4A 4YLJA 3FMDA 4DHJA 4JXFA 4A4OA 5HTCA 2VD5A 3KRWA 5E8VA 1JKTA 2RL5A 3CJFA 5A6OA 2CN5A 1W98A 5DR9A 4CEGA 4FX3A 1UNHA 4LYNA 3W0QA 1PXNA 1YXTA 3FI3A 3HYHA 2X7OA 3EIDA 1BUHA 4W8DA 4AXCA 3COMA 4KKGA 5CAOA 4FV0A 3GGFA 1R0EA 1RJBA 4B99A 3CP9A 3CBLA 4FEQA 1XH4A 5H3QA 4P7EA 3PY3A 2HENA 4YC8A 3EQRA 3RPOA 5M56A 4FKJA 3HX4A 4OGRA 5H8BA 1PY5A 2YFXA 3O71A 1OKWA 3I60A 5E7RA 3R8PA 3UBDA 1FQ1B 2W1DA 3QU0A 3GXLA 4G17A 4FSNA 3LCSA 2OGVA 3RP9A 3QQKA 2OBJA 2X8DA 1ZYSA 3NYXA 2WQNA 4PDSA 5IU2A 3H9OA 2XA4A 3PPKA 4RLKA 4W4XA 2EUFB 2OZAA 4FVRA 4BCPA 5KMOA 4RZWA 3AMYA 4TWPA 5AV2A 3VBQA 1OGYA 4XYFA 2WQBA 3IKAA 2I1MA 4FTAA 3P08A 3NAYA 2PUUA 4E4XA 5AA8A 3PXQA 3ALOA 3BV2A 5LCKA 4YBKA 3ZLXA 2QG7A 4HOKA 4C8BA 4DH3A 2SRCA 3P86A 5FBOA 3ZEWA 3HZTA 3UTOA 4XMOA 2ESMA 1BLXA 5JRSA 3W2PA 4DEGA 4M67A 4EUUA 5FTGA 5AUUA 4C57A 4D2PA 4LL0A 2PVKA 5J87A 5BV3A 3QTWA 4G34A 2G2HA 3FWQA 3B8QA 2QC6A 5IH6A 1PF8A 2J50A 1E9HA 3QQGA 3ID6C 4KS8A 4QYHA 4UWCA 4X3FB 4DEIA 4USFA 3QFVA 2ETRA 3EQPA 3Q4CA 3EQGA 4KIKB 4KIQA 4NW6A 4NM0A 4PTCA 3AMBA 4EH8A 2KULA 3AOXA 3PXKA 3Q32A 2A27A 3QWKA 5CLPA 5HG5A 4BTFA 3W1FA 1PMVA 4YZCA 2O8YA 4H58A 4HGLA 4BGGA 1L8TA 3WF8A 2F7XE 4DEEA 3G90X 4QYGA 4ZOGA 3O8TA 4ZP5A 1VYZA 2CDZA 1ZMVA 2R3KA 2X81A 3OOGA 3DXPA 3R8UA 5GNKA 3GU8A 1Q8WA 3FLWA 3LXPA 3VUMA 2OZOA 3PXYA 4GJ2A 4CTBA 2ITUA 3I6UA 3IQ7A 4S30A 5E8WA 2UZNA 4XV2A 3RPSA 3V5QA 5K4JA 3U54A 4D4SA 4OTDA 4M69A 4S32A 4UY9A 5GZ8A 5IPJA 5AAFA 3NUYA 3GC9A 2OU7A 4WUNA 3V04A 5HO7A 3RTPA 4CMUA 3DBQA 4G5PA 3WARA 2YCFA 2VWZA 4NH1A 3O51A 3ZLYA 4QMYA 1ZYJA 4MHAA 5CSPA 5J5TA 2I0EA 5BVOA 3SW4A 4ZTMA 2E9VA 4RRVA 2FSOX 3ZSIA 2GQRA 1PMNA 4TT7A 4UMUA 2JBOA 5AV1A 4FT9A 4J95A 3UC3A 1Q61A 5AR2A 4H39A 1H1RA 2PE2A 4IAFA 3TACA 3DAJA 4F9CA 3IECA 1Q3DA 4FSYA 4XRJA 3PSBA 2XS0A 1XBBA 1OZ1A 3UPXA 3Q9WA 3UO6A 5KUPA 2A4LA 1YWRA 4FTLA 2YCQA 3CGOA 2QOLA 2YDKA 3SDJA 2Z8CA 3V51A 2VWVA 4FKPA 1JQHA 3DTWA 4AU8A 3PZHA 4F6SA 2IZRA 1JKSA 1DI8A 5JN2A 3D4QA 1NVQA 2UW6A 3VS3A 3ZZEA 5JFVA 5A4QA 3Q9ZA 4APCA 1PXLA 4F6UA 3Q4UA 5ACBC 3SVVA 5CANA 4QP3A 4ZMFA 3EKKA 3DKFA 3HMNA 5HNGA 5BUIA 3P7CA 4R1VA 1S9JA 2YM7A 4AUAA 2JDVA 4IANA 3R7IA 3GCPA 3F3WA 2VO6A 2CKPA 3ZHPC 5L3AA 4FTUA 2C0TA 3MTLA 1JKLA 3QXPA 4YZBA 4CV9A 4F78A 3QAME 2Y9QA 3R22A 4FIHA 3MTFA 5DT0A 3HVCA 3R7EA 4FTTA 4S31A 3U9CA 3E8DA 3QD2B 4FSMA 4KB8A 4AZSA 3FHIA 1NT2A 1OL5A 1Y91A 2WEVA 3G6GA 5FXQA 3C5UA 2XK3A 2BFYA 3UG1A 5HU9A 4DCEA 2ZMDA 3EFWA 2XJ2A 2PMOX 2YA9A 5EYCA 5E8YA 4C4IA 4L42A 2QU6A 3VBVA 4AF3A 5C8KA 4CYIA 4EL9A 4IMYA 5J1VA 4ACCA 5E8XA 3WIKA 4OT6A 1KOAA 3RM7A 4DFNA 4OTRA 4DAWA 4RZVA 2J51A 3RAHA 4EZ7A 5CU6A 3BU6A 1VLRA 3QCYA 4ZLOA 1M2PA 3ZU7A 3TUDA 4CCUA 3LCDA 3C4XA 4ITIA 2B9IA 2PVJA 3E8NA 5AUYA 4D28A 2W0JA 3Q4ZA 4CSVA 4G16A 5ACKA 4IZ5A 4RX9A 4BTMA 3ORMA 4CFUA 4RC4A 5E8ZA 5HI2A 4QMXA 1B6CB 5IKWA 1BYGA 4K6ZA 2XNBA 5EG3A 3LFDA 2VO7A 4V0GB 2QU5A 5HCZA 3PJ3A 5HVJA 4UYAA 4QPAA 2WMVA 5JZJA 2O2UA 5AM7A 4OLIA 1OPKA 3QTIA 4RWIA 4GG7A 1YI4A 1E1VA 4ANNA 5DOSA 2HXQA 1F3MC 2XM9A 2PZPA 4P90A 1LEWA 4DFLA 3U8WA 4MNEB 2V62A 3QD3A 4RFZA 4BZDA 3AT3A 2O63A 3ORZA 4FTKA 3RPRA 3W0NA 3B2TA 3A4PA 2C6MA 3H30A 4PPAA 2YERA 2JFLA 4M84A 4EK3A 1H1PA 2XBAA 2QOHA 4RQKA 3HLLA 2J7TA 5KMIA 2C3KA 3SG8A 3VUTA 1SNXA 3ZO4A 2X1NA 2I7QA 4LM5A 4F9YA 2XUUA 5AFVA 3MSSA 5HIEA 1KE5A 3K3JA 2Z02A 4HVDA 2W96B 4GV1A 3BHUA 3Q4TA 5AR3A 4DN5A 3TIZA 4YZNA 4YJPA 2R3GA 2HZNA 3IDBA 3AC4A 2C6KA 4QEBA 3C9WA 1OUYA 1J3HA 2IVUA 3QZGA 1UU8A 2GNHA 3OEZA 1WMKA 4PPCA 5IQAA 3SGCA 5LMKA 2YIXA 4FIGA 2BHHA 3BU3A 3KB7A 3FMMA 2XANA 3UYSA 4EOPA 4PL3A 1OGUA 4PP9A 3R7YA 4EJ7A 1ZMUA 1MUOA 3EQCA 3M11A 4NUSA 4AQKA 3I81A 4WNMA 1XMLA 2BZIB 1PHKA 4C61A 2RF9A 4AXAA 4EUTA 2WHBA 2JBPA 5I9UA 4IAKA 3UQCA 2OO8X 4RWJA 2WXVA 1MRUA 3C13A 3QTRA 4OT5A 3WF5A 5HNIX 4FEXA 2ETMA 2YM5A 2C6LA 4RT7A 5E8UA 5DVRA 4H3QA 3LJ1A 2YZLA 2Y6MA 3BYVA 3KRLA 3LFQA 5DWRA 3VRYA 3BGZA 2BZHB 3DU8A 2F2UA 1OBGA 3WZJA 4NM3A 4RA4A 4TW9A 3H9FA 1KE8A 5HE3A 4PMSA 4ZJIA 4FG9A 3AKJA 1WBSA 2WMUA 4I5HA 4L3LA 4I94A 5BUEA 2V7AA 3NFGB 2BHEA 3VS7A 1I09A 2JLDA 2B4SB 4QPMA 2VTOA 5FG8A 3ZFMA 2PPQA 2V55A 3ET7A 3MVMA 4FTQA 4IAIA 4MTAA 2ZJWA 5B2MA 3JYAA 1OL7A 3E7OA 3DNDA 1PKGA 5JKGA 4CMTA 3FI2A 1K3AA 3PRIA 2O64A 4DBNA 2XK8A 4YMJA 3Q04A 5EQPA 3GU7A 5BNJA 5HLNA 4PRJA 3BGQA 4FT5A 5AAGA 5K5XA 1YXSA 5M07A 4C02A 3HUCA 5T68A 2BKKA 1CMKE 2GDOA 1YHWA 3NWWA 1LR4A 5BVDA 1UNGA 2UW5A 4M13A 5IA2A 3LFBA 4H05A 4FTNA 3BYSA 3VUGA 3DK7A 3LFNA 4RVLA 3HECA 5JK3A 3LKMA 5IQGA 3FZOA 4FTCA 5TT7A 4AP7A 2QURA 3CS9A 4WNKA 3ZH8A 5IMEA 5LJJA 1OB3A 3DKGA 3ORPA 2VTRA 4O0TA 4OAVB 5K5NA 3ZO2A 3VULA 3NIZA 3ZFYA 5KO1A 2R3NA 3FLSA 4BKJA 3HL7A 4DEAA 3R02A 4GVJA 2CKQA 3T3VA 3BE9A 4ZS4A 5A6NA 5M4UA 2ITPA 3JPVA 2AC3A 3GBZA 2VTTA 3F6XA 3UMXA 3U51A 1WVYA 4E73A 3VS4A 2QHNA 4O86A 2CSNA 3FC1X 4MKCA 4CRLA 2WTDA 4G3CA 2C6IA 3QTSA 2R3HA 5IA0A 2OJJA 3EZVA 3OMVA 4NFNA 4O7YA 4YLLA 3LFCA 4HNIA 4WNPA 4Y8DA 2GNFA 2ACXA 3KXZA 3GCVA 3ZFXA 2C6TA 3BE2A 5ANEA 4NYEA 3IW5A 1NXKA 4ZY4A 2A19B 2B9FA 4BI2A 3C4WA 2PVNA 4QYFA 3UP2A 4O7SA 4U81A 4AT3A 2G2IA 2J2IB 4FL1A 4UZDA 2CGWA 3LW0A 4O27B 3W10A 3ZTXA 4X21A 4BIDA 3AGMA 3W2CA 3W55A 4C58A 3BEAA 4ACHA 5CEPA 3FEGA 3QKLA 4G9CA 3A61A 3ACKA 3LPBA 3PUPA 4MX9A 3QUDA 5BVWA 3RZBA 4RQVA 4EJNA 3ORTA 4YJSA 5DIAA 3GP0A 1M14A 3FZSA 1OIYA 3NDMA 2XK6A 3NS9A 4ACDA 3ACJA 3R8VA 4ACGA 2PZYA 3O23A 1R78A 5LMKC 2IJMA 4II5A 3IGOA 2J6MA 5AR7A 1UU7A 4ZTNA 5HNBA 3UIXA 4ANSA 5IF1A 3AD6A 3R1YA 4IB0A 3DLSA 4D1ZA 4TNBA 1S9IA 4BGQA 4KIPA 5D7AA 5CYIA 2YZAA 3G51A 3MPAA 3MB6A 3MV5A 4Y95A 4DA5A 3PRFA 4YHFA 2YIQA 1PYXA 4NIFA 5EOLA 3OHTA 3D0EA 4RJ4A 5ETIA 3TTIA 3FLYA 3U55A 3LAUA 4TYEA 1R1WA 3SRVA 4QP1A 3FQSA 5CTPA 4OBOA 4CGAA 4RJ8A 4NCTA 3QRKA 1XWSA 3BQCA 4L01A 5A54A 2JDOA 3W32A 4HVIA 4WOVA 3IS5A 3B2WA 4DH8A 2VO3A 4OR5A 1XH9A 1CKJA 2ZMCA 3FI4A 5K0XA 2GTMA 4C34A 2JKQA 3A4OX 5E91A 2QHMA 2Z7SA 3GT8A 2BZJA 2VAGA 1YXVA 2BTSA 3D2IA 2VTJA 2VTMA 4O1PA 5HD4A 2QQ7A 4ZJJA 4O7LA 1NVSA 4IHPA 2ERZE 3EL8A 4O0SA 3GQLA 1OL1A 2W9FB 3AC5A 3KMMA 3U87A 3LVPA 4GK4A 4L9IA 1DI9A 2B1PA 1WZYA 3D2KA 3OROA 4M69B 4FTRA 3NW7A 3IOPA 4F08A 3TM0A 1M7NA 4F0IA 5FRIA 4XRLA 3A7JA 3EH9A 2WNTA 4G1WA 4JRVA 4GSBA 3F2AA 4IWPA 3ZC6A 1NW1A 4LL5A 2PUNA 3LMIA 4Y85A 5DGZA 2B9HA 3D83A 2JKMA 2NNWB 4ALVA 3BWJA 1QL6A 4ZS0A 4EH9A 3HDNA 2BDFA 1KV1A 3F66A 4HGSA 2ZM4A 4YZDA 3HMIA 3HV7A 2A1AB 3TJDA 1A06A 3DK6A 4G5JA 4AW2A 3BL9A 5HX8A 4TYIA 5FDXA 3PVBA 3DZOA 1YWVA 3FQEA 3OCBA 4U44A 4DEBA 4ITJA 4YP8A 4B9DA 1GZKA 4GUBA 3HP5A 4C35A 5A9UA 2DQ7X 3LE6A 3NRMA 4PDOA 3T3UA 3MGYA 3BBTB 2C0IA 3W8LA 4UWBA 4L46A 4FSTA 3C4EA 3I5ZA 2OFUA 4X2GA 2BIYA 1ZOHA 2PMIA 3HRCA 2E9OA 5CF8A 3F7WA 4FMQA 2IW8A 1Q4LA 3HP2A 3KL8A 4I6QA 2R4BA 3A7GA 3F69A 3Q9XA 3QCQA 2QOIA 4X3JA 4DGGA 3TTJA 4TWCA 5AP1A 4JG8A 2YJSA 3FC2A 4BZOA 5AV3A 1XHAA 5ANIA 3UNZA 3VAPA 3L8PA 2AEGA 5D1JA 5L4QA 3GCSA 4BTKA 4BCQA 4C4EA 4QMZA 5DN3A 2XCHA 2CLQA 4L43A 4DFZE 3FZPA 2WKMA 3RK7A 4BDJA 3TCPA 1W83A 1Q62A 2QG5A 5JH6A 3O8UA 3COKA 4HGEA 3CTJA 4X2JA 4I22A 2QOKA 4AT5A 2UUEA 2HZIA 4NM7A 1ATPE 4KABA 5LOHA 3NAXA 3FKOA 4BWPA 4RIOA 4RMZA 3QALE 3QXOA 3WF6A 3QTZA 2Y4IC 1OIQA 3OBGA 3V3VA 4BDCA 4CQEA 1BX6A 2XNEA 4AXFA 3IW7A 3ZXTA 4BBEA 4NKAA 3Q6WA 4R5SA 2WGJA 4BDFA 3Q5IA 3LQ5A 1KE6A 4E5AX 2V0DA 4QMSA 3ZMMA 2I40A 1V0PA 4ZSEA 4IZAA 4YPSA 2A2AA 2W1FA 4IFCA 3D14A 1U5QA 4DF3A 3I7CA 2NRYA 4F65A 3FI8A 3N4UA 5HGIA 2C1AA 4WKQA 3Q52A 5CALA 3RHXA 4FEWA 4BC6A 1AQ1A 1MRYA 4BDHA 2BRMA 4O4EA 4DTKA 3LFSA 3PP0A 4NCTC 4PNKA 5IQEA 5HORA 1UU9A 4G6NA 1H27A 1TZDA 3R1SA 2QKWB 5M53A 3KFAA 5DR2A 4BYIA 4J53A 1Y57A 4Y72A 4CYJA 1WBPA 5HZNA 1LEZA 2XVDA 5AUXA 3UO4A 4DG2E 3BYMA 3QRJA 4FI1A 2ZM1A 4RIYB 4MD7E 4HVSA 4WBBB 3BX5A 1UA2A 2BUJA 3PJCA 4FIFA 4KS7A 1OUKA 2HK5A 2J5FA 2XB7A 1QCFA 2C5VA 3ANQA 5DYJA 3ZDIA 5C9CA 1M17A 4I20A 5FTOA 1V1KA 4M14A 4ACMA 4O21A 1Q8ZA 2IF8A 4NU1A 4GU6A 3VIDA 1O9UA 2PE0A 3C0GA 2XNMA 3ITZA 4Z7GA 3CPBA 2ZB1A 3F2NA 4KNBA 3SXSA 4YO4A 3EQHA 3P78A 2HZ0A 5BVKA 4E26A 4EHVA 3EN5A 3TJCA 4RIWA 2P4IA 3MFTA 4MCVA 3OXTA 4G9RA 3HEGA 3V5TA 2EWAA 5IDPA 4FKLA 5E8TA 4FIEA 2XYUA 4H1MA 4V01A 3QD0A 2XIRA 3QRTA 5CT0A 5AR5A 3B8RA 3COIA 4UX9A 1SMHA 3FMEA 2BRNA 4C0TA 4RWKA 5CEQA 2GSFA 3S4QA 4R3PA 4J71A 5M51A 3IOKA 3QRIA 4FKVA 3U6HA 2GQSA 4XV3A 4F9WA 2C3LA 4OTQA 4ZSGA 2W1HA 4L68A 3QTXA 5T6KA 5KBRA 1VZOA 1GNGA 1IAHA 1SVGA 1XH6A 1XH5A 3HV5A 5CEOA 3CD3A 3QBNA 3N9XA 3QYZA 4LQMA 3PPZA 2X0OA 2E9PA 2BRGA 4KSQA 4IW0A 4AAAA 5AA9A 1U54A 2E2BA 3ULZA 4F99A 5CASA 3G6HA 5L6OA 5AP4A 4AXEA 4YJVA 4YNEA 3CJGA 4ZK5A 5IQDA 4GFOA 4QDEA 3OC1A 4EYJA 3KU2A 4FKGA 2XKFA 3HV4A 4R3RA 4LDTA 1A48A 4U97A 4O7ZA 3V5WA 4XOYA 4ASDA 5JGBA 3DDQA 5D41A 3LCKA 4E3CA 4GVAA 3T9TA 1GAGA 3TZMA 4FKTA 1OM1A 4LUEA 4XP3A 4UZHA 3UDBA 4O7VA 5H2UA 2BAQA 4ITHA 1H00A 3UNJA 4F6WA 2YLFA 3MH1A 3F3VA 3O0GA 4Q5HA 2Y0AA 3TNWA 4G2FA 3AQVA 3JS2A 3TZ8A 4MYGA 3W2QA 3IK3A 5ETAA 1XQZA 3I0QA 4MXAA 3AXWA 2ONLA 5CNOA 4MXYA 4OTGA 5KKRC 4EOSA 5CAPA 2X4FA 4HGTA 3OY3A 3QL8A 4MXCA 4GUEA 4I6HA 3NR9A 3E7VA 3VUDA 3RCDA 3ZUVA 4DHIB 2VZ6A 4FKOA 3L9PA 2X4ZA 4OTWA 4WIHA 2IO6A 3UOHA 2PYWA 3W0OA 4TYHA 3MIYA 5JRQA 1DS5A 3POOA 3RPYA 4Q5EA 4BVUA 1H1QA 2DS1A 4O7RA 4QRCA 4CG9A 3R63A 3H4JA 4I92A 2R64A 5A14A 4F7SA 3PIZA 4QP2A 5EDQA 1WBWA 3QQLA 5AP0A 1CTPE 2JC6A 1OPLA 4GS6A 1J7IA 2AYPA 4O82A 4BCGA 3OVVA 3CCNA 3WZUA 5AP3A 3KCKA 3FZ1A 1Q5KA 3OXZA 5LMBA 5HEZA 5JT2A 3PUFC 3W18A 2WAJA 3LXNA 4U9AA 1A9UA 2GS6A 1H0WA 2RGPA