1J3HA

Crystal structure of apoenzyme camp-dependent protein kinase catalytic subunit
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
342
structure length
329
Chain Sequence
GSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic Features of cAMP-dependent Protein Kinase Revealed by Apoenzyme Crystal Structure
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
total genus 88
structure length 329
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1j3hA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1j3hA02
2X6EA 4CD0A 2FSMX 4DFLA 5L8JA 1OL6A 4LL0A 4AW1A 4PPBA 5F20A 2OXDA 5HNGA 3N4UA 4Z55A 3KL8A 5KZ0A 2GNLA 3GXLA 4L68A 3H30A 4BZNA 2R7IA 4HPUE 3TT0A 3W2PA 4D0XA 4ZLOA 1RE8A 5IA5A 3W10A 1U59A 1PXLA 1ZYCA 5IA4A 4AN3A 5EW9A 4MD9E 3LXKA 4F1OA 1NVSA 3BGPA 2CLQA 4TWPA 4KBAA 1P14A 3GI3A 5TE0A 4CXAA 4QMPA 5IEYA 4I6BA 2HCKA 1W83A 4JLCA 3T9TA 2IVUA 4U79A 2XK3A 3FXXA 4HNFA 5DR9A 3HKOA 2PULA 4K8AA 3H9FA 3JVSA 4RIWB 4LYNA 4RJ6A 2VTLA 3P23A 4RVKA 3ZLYA 5A14A 3TDVA 2JAVA 5CAVA 1CTPE 3HA8A 4FK3A 4HGEA 3EKNA 5AP3A 3FUPA 5HIDA 1RW8A 3RAIA 2RFSA 4BTFA 3DB6A 3LMGA 3TKIA 3EHAA 4MWIA 4I92A 2RIOA 4GV1A 4UZDA 1R39A 3P9JA 2FO0A 4DG3E 5M4IA 4AX8A 2OK1A 5JFVA 4EOJA 4R5SA 1UWJA 3ZLSA 4UN0C 3NVMB 4H3PA 3MH2A 4XP2A 1W98A 2UZEA 5BNJA 2JC6A 3FMEA 4FK6A 4MX9A 5CVFA 4I6FA 4L45A 4Z9LA 4FA2A 2PWLA 5DVRA 2QHMA 2Z7SA 3A8XA 4FEVA 3EWHA 5EHYA 3LAUA 4YURA 2W9FB 1OGUA 4TYHB 4WSYA 3OW4A 5M44A 2HW7A 4YLKA 5JQ5A 1VJYA 3AT2A 5M07A 5EM5A 3CKWA 2OJJA 2JEDA 3F3UA 5AEPA 5CAOA 3DBFA 3C51A 3C0IA 3DTCA 2O2UA 3W2RA 4PL4A 4PUZA 2PZPA 3NCGA 3IW6A 5HBHA 1ND4A 2VTRA 4I20A 3ZO2A 3NEWA 3UMWA 4BWKA 4YC3A 4CFNA 2QO9A 2C30A 3R0TA 4L7FA 5JSMA 1GZNA 4EK3A 1SZMA 4BDCA 3BHHA 3DXPA 3QQLA 3PTGA 3EFJA 3WZUA 1J91A 2C6IA 2QOCA 5K5NA 3L8PA 5J1VA 2UZVA 4I6QA 5DG5A 2PVJA 3RTPA 3QRJA 1OM1A 3FLWA 3AQVA 3TNQB 2OJIA 4W4VA 2UW0A 4I0TA 4GU9A 3FPMA 1R0EA 3DA6A 2OIDA 1XH4A 4NM5A 5FM2A 3IOPA 5GJGA 2P33A 3RALA 5KMLA 3KXZA 4ANQA 2J0KA 4BCHA 5C1QB 4HCVA 5LMBA 3OWLA 4MBIA 1H26A 1VYWA 4JG7A 4PX6A 5HVYA 4YO6A 1XKKA 1XQZA 4R3CA 4GUEA 2GDOA 3P7CA 3U87A 2GFCA 1U5RA 4XG8A 3D9VA 5LVLA 2PHKA 2V7OA 3AG9A 1O6LA 1H1WA 4FIEA 1Q24A 4KD1A 1JWHA 4D5KA 1JKSA 4LGDA 5K3YA 1KE5A 4E8AA 4X3FB 5EQEA 4BC6A 2WMTA 1GNGA 4EHEA 2EXCX 5JGDA 1ZMUA 1ZYLA 3RWPA 2A27A 2QOOA 2PUPA 2JIVA 5IISA 3KXNA 2R3HA 2VTSA 4M66A 4E20A 4HZRA 3BYSA 2XK8A 3I60A 3CGFA 3EN7A 4MXZA 2WQNA 4MD8E 3T8OA 3OY3A 3DLSA 3DNDA 3IW4A 5HX6A 3FWQA 3VHEA 3JY9A 4J71A 4C2WA 3NUPA 3ENHA 4DGOA 4EOLA 3AD6A 2R3QA 2C6DA 4ASDA 3UIBA 4DEEA 3MESA 3ROCA 1RJBA 4KRCA 4YZDA 1OKVA 2HWOA 4I5HA 4NL0A 4TT7A 5IQHA 5HZNA 2I0HA 1PYEA 5JFSA 4FUXA 2XH5A 3P79A 4C62A 2VRXA 2PUNA 2GMXA 5HTBA 4IADA 2GS7A 4PF4A 2WMBA 2XEYA 3KF4A 4X3FA 4PY1A 4OBQA 2DUVA 2OH0E 3FY0A 4BR3A 3F3TA 3VRYA 2PE0A 2C6KA 4YNOA 4D4SA 4MNEA 4U40A 5HX8A 3LJ1A 3G2FA 5HGIA 2FGIA 3PRFA 2VTPA 4QTAA 3HA6A 2WTKC 3SKCA 3COMA 1UVRA 5KMNA 3EQGA 3HECA 1M52A 3N51A 4GIHA 4YLJA 4JNWA 4AOIA 3ORLA 4LG4A 3KQ7A 4I41A 4AF3A 3ALNA 4Q2AA 3HDNA 2Y4IB 3R7YA 4CZYB 4FEQA 3PXFA 5F9EA 4C3FA 4FL3A 5KBRA 5IA0A 3A7IA 3FZRA 3CSVA 2RL5A 2NNWB 4ALVA 4BDJA 4F1MA 2UW4A 3BYMA 5EH0A 1PXOA 2XNPA 3KXGA 2Y9QA 2OO8X 3CR0A 3HV3A 3NUXA 3SRVA 5IA1A 3ZUVA 4WNKA 3GB2A 4YJRA 5HVJA 4ZZOA 3MPTA 4HGLA 4LOQA 5I9WA 4LL5A 3CC6A 2YCQA 3FQHA 4YC6A 3WZDA 3VQHA 1Y6BA 3UTOA 2OXXA 2GNFA 2X7FA 4IDTA 3W2OA 4CQEA 3E8NA 4R78A 4FVRA 1SMHA 3ZS5A 3DJ7A 3R83A 1PXJA 3TM0A 2P3GX 3PVUA 1HCKA 1R1WA 4ZY5A 5DOSA 4MK0A 4HZSA 4B4LA 4D2RA 2EUFB 4ARKA 4DH7A 4JX3A 2RSVA 3UVRA 5CAUA 1OBGA 4F9CA 4ACGA 1H28A 2XEZA 3WYYA 2BROA 2VWVA 3P1AA 2R3RA 4FKVA 4MF0A 3NSZA 5C8MA 3QGYA 4KKEA 2ZOQA 3T3VA 3TUDA 3UOJA 4A9SA 4PTGA 5KHWA 3SGCA 1P2AA 2JDOA 2WMXA 1Q8ZA 2YA9A 1DS5A 3FLNC 5BVEA 4QP9A 1I09A 3KMUA 5HU9A 4KSPA 5EQYA 2E9OA 1QL6A 3HV6A 4NEUA 4P5QA 3ATTA 1APME 5HCZA 2ACXA 2HAKA 2JBPA 3ZC6A 3QZGA 5M55A 2GNHA 4IWDA 2VN9A 3MV5A 3SW4A 1JNKA 2G9XA 2FH9A 4TN6A 4KBCA 5FXRA 1BX6A 2C69A 3ZTXA 3ZXZA 4BWXA 4CZTA 2UW8A 4RLLA 3N9XA 3QTUA 4JT3A 3EZVA 5AUZA 3A4PA 4QP7A 4JDJA 5T68A 2QOBA 4BDHA 5CANA 5KNJA 2GPHA 2R3PA 2VNYA 2ZB0A 3SHEA 4LV5A 4QMLA 4Y72A 5IMXA 3OT3A 4ZTNA 4C4FA 5I3OA 2PVKA 2XF0A 3WBLA 4O81A 1UKIA 1UU9A 3MIYA 4BGHA 5HLNA 4PTCA 3VBQA 1UU3A 3II5A 3RM7A 1XH8A 3ORXA 3AC1A 3R04A 3LFSA 2RFNA 4I93A 5FQDC 1M2QA 2R3LA 2F49A 3HUBA 5HE0A 5KUPA 2VD5A 4K2RA 2OFUA 4JI9A 4PTEA 3SOAA 3PIYA 4Z7HA 3V8TA 2ZM3A 5L2SA 3KXMA 5AWMA 4XOZA 4NJ3A 5E1SA 3P4KA 4WSQA 3FSFA 2W5HA 4JJRA 3N4TA 5DYJA 4BYJA 4DBNA 2ONLC 2JGZA 2CDZA 5GZ8A 2ZV7A 3ODZX 2G2IA 4O0UA 3G0FA 4CFUA 3R9NA 3TV4A 2VWIA 4D4VA 5J8IA 2WEVA 3CLYA 3IG7A 4C8BA 3NNVA 3FC1X 1MQ4A 1YXSA 1YRPA 3D2IA 3AT4A 3OW3A 4F0GA 4R7HA 2IW8A 1XH7A 1JSUA 4O0VA 4DEHA 1WBWA 5AJQA 3DBQA 3LW0A 3GCQA 4ASZA 5I5ZA 5DT3A 4BDDA 3RK5A 5EI6A 4WIHA 3L8XA 4FV3A 3HV7A 2NP8A 3LIJA 5DHJA 5H8EA 3QUPA 3LXNA 3VUDA 4WO5A 2BRBA 5J95A 4AUAA 4D1SA 4WOVA 2XKCA 2QCSA 4BHNA 1H1QA 2E9UA 3GCPA 4V0GB 4D0WA 5AA8A 3NUAA 4XX9A 4F99A 3ZO4A 4HVSA 2IG7A 2PE2A 3W8QA 2R3JA 3I7BA 4FIIA 3I0QA 3VW6A 2H9VA 3NR9A 1DI9A 3QQGA 2YIXA 3ZEWA 4DINA 2VO0A 4ZK5A 4F9AA 2WOTA 4FE2A 3LFFA 4MBJA 4AN9A 3PP1A 1H4LA 2G01A 4U43A 3LCDA 3QXOA 3KRXA 4O0RA 5CXHA 4O7ZA 3FJQE 3DDQA 3SA0A 1OZ1A 4E73A 1H01A 3TKHA 2OLCA 4L52A 2R3KA 1WVYA 2YN8A 2XRUA 4E26A 4Z3VA 2I7QA 4MAOA 1R78A 2PMLX 3RK9A 4XH6A 3P08A 4FSTA 3E92A 4I0RA 3R73A 4FT9A 4YJVA 5TR6A 2BAQA 2X9FA 4QPMA 2R64A 3QTXA 5FBNC 3FMHA 1H27A 3VS7A 2BZKB 1YHWA 2NRYA 4RJ5A 5CNNA 3V5TA 4D2SA 4KABA 2GNGA 4EWQA 5EHOA 1DAWA 1FVVA 1WBOA 5BVKA 3UPZA 3ULIA 2B52A 4O84A 4QMSA 4RVLA 5EM8A 5IH5A 1F3MC 4YZNA 3V5LA 3H0YA 4AE6A 3BHYA 1K2PA 4ANLA 1ZYJA 1BL6A 4ZTLA 4FBXA 5FTOA 4USFA 4DCAA 2PVLA 4YSJA 3OHTA 1SVGA 3ZFYA 3QAME 4RWIA 5HICA 4NKSA 4IVAA 3RAWA 4G17A 5KE0A 5L2WA 4C4IA 2BR1A 4CLIA 4IM3A 4IM2A 4ANSA 4G1WA 1PXIA 4AT4A 3CP9A 2CCHA 2C5OA 3Q4ZA 3A7GA 5IF1A 4P5ZA 4UYAA 4R1VA 5KCVA 4M3QA 3ZBFA 1QPEA 3QYZA 4AA4A 4F6UA 5HKMA 4CG9A 2GNJA 5FG8A 2C6MA 4FT5A 4X3FC 4K1BA 4L67A 1DI8A 1K9AA 4XOYA 5FP6A 5AP7A 3LM5A 1PHKA 5D9HA 4BHZA 1OPJA 3FQSA 1XH6A 5EOLA 2QQ7A 4DLJA 3MB7A 1OUYA 1VYZA 5ANKA 5K4IA 2ITVA 3COIA 5H8GA 3G9LX 5JN2A 1F5QA 1LPUA 3R21A 4ZTSA 3NZ0A 3HMNA 3ODYX 4PL5A 2DWBA 3QGWA 4MXYA 3DCVA 1Q8UA 5CSXA 4CQGA 2VGOA 4P90A 2Q0NA 5BX0A 5AIRA 3GGFA 4CLJA 4FX3A 2VAGA 2HY0A 5HI2A 3FYJX 3IKAA 5E8XA 5AR5A 5FTGA 2O64A 4HCUA 2JAMA 3A61A 3MA3A 4O2ZA 4YJUA 2BRGA 3R71A 3ZEPA 4F70A 5AX9A 1BUHA 2VZ6A 3TTIA 2BFXA 3NLBA 4ZZNA 3LJ0A 4CTCA 4ZMEA 1AQ1A 2X2MA 3GNIB 1MRYA 2YDJA 4E4LA 4FV5A 3UVPA 5A4CA 4RIYA 2WMQA 1REKA 3VAPA 4JG8A 5DMZA 3EQPA 2XM8A 3UO4A 4DGNA 2QG7A 3ZM4A 3NYNA 4U8ZA 4IDVA 5DR2A 3BCEA 4M8TA 2XKEA 3DQWA 4HYSA 4GT3A 3RCJA 3ZO3A 1URCA 4D2TA 1PMEA 3I4BA 2XK4A 3ELJA 4ANOA 3PXZA 2HXLA 4NCTA 5M08A 4RX5A 3WF7A 3KA0A 1W84A 4UMUA 4FSMA 4FV1A 4FKJA 1FMOE 4RC3A 2GTNA 5AM6A 3TJDA 2YCRA 1WBVA 2WZJA 3HVCA 3A4OX 3FZ1A 3MSSA 4LMUA 4D55A 5KMMA 3VS2A 4FTLA 1H0WA 1FVRA 4RJ4A 3GCVA 3ZRMA 4IACA 5J1WA 2X0GA 1U4DA 1WBSA 3EJ1A 2GQGA 2XVDA 5EW8A 3PSCA 3ULZA 5LWMA 4HYHA 2FSOX 2Z7QA 4EJ7A 3QD2B 4D2WA 4WG4A 3V6RA 5I9VA 2H96A 4DE4A 3VUHA 4G5PA 2I0YA 3R8LA 1SVHA 4G16A 3VUIA 2BAKA 4L00A 3R7EA 4A9RA 2GHLA 3OCSA 4ZS0A 4QP3A 5IDNA 4D1ZA 2X8DA 2GHMA 3E64A 3NPCA 5EM6A 3I5NA 4NM3A 4BZDA 4CV9A 3LCTA 4DTKA 3ERKA 2ETMA 4JR3A 4I5PA 1U46A 4UWCA 5EYDA 4O7TA 3GQLA 3D7TB 4MTAA 5CSVA 4EYJA 4EI4A 5HO7A 3D7ZA 3UIUA 3OWJA 4S31A 2W1FA 3QRUA 4Q5EA 4FV2A 3QLFA 4AWIA 2NO3A 2XK6A 2YERA 5AADA 4FSRA 3OBJA 4IAAA 3V04A 3WIGA 4A4OA 4JAIA 1YKRA 4C02A 2OJGA 4XV3A 3VRZA 5DFPA 3ZH8A 2XYNA 1Q3DA 5EYMA 3HL7A 2RG5A 2XNOA 3DU8A 3QWKA 3ZZEA 4NU1A 4DEBA 3MW1A 2BMCA 4OAVB 4AW5A 5G6VA 4X6QC 3TACA 3W55A 4A4LA 3FEGA 4FNYA 5EYCA 1J3HA 4O1PA 2F7XE 4BFMA 4EOQA 4RWKA 5LWNA 4YJNA 2OJ9A 2IW9A 4E6DA 4TNDA 4C4JA 2PK9A 4FC0A 4DFXE 5C4KA 4TXCA 5B0XA 4EC8A 3B8RA 3RVGA 4U44A 3QA8A 3ZHPC 3EKKA 3QTIA 1XWSA 4D2VA 2Z02A 4FUYA 5L6PA 5DRBA 3WF8A 3CY2A 3Q5ZA 2QOHA 3FSKA 2RKUA 2OWBA 4IAYA 3Q52A 5LCKA 1YDTE 4MQ1A 4QMVA 4CCBA 4FTNA 3D83A 5IUIA 4RFMA 4DG0E 1YI3A 3C7QA 2VWXA 4XRJA 4CT1A 4QT1A 4DFNA 2ZMDA 3VWAA 3Q2JA 5EK7A 3A60A 3QKMA 4MVFA 3CXWA 4FG9A 3NNWA 5DT4A 2W06A 2ZYBA 4EK4A 2QKWB 5KZIA 1V0PA 3R1SA 4APCA 1T46A 4FT3A 2IW6A 2YM3A 5CF6A 3PWDA 3VVHA 4M84A 2V22A 3F3ZA 5BQ0A 1Q61A 3BYOA 3LLAA 3UOKA 2PUUA 3PDTA 1MRVA 4GFOA 3HV4A 5CU6A 3A99A 3GFWA 4F9WA 3BYVA 4ZSEA 5JEBA 4R3PA 3F5XA 3W2QA 4CV8A 2ZJWA 5A46A 3DTWA 2YWPA 4HVHA 1FOTA 4V05A 2CGVA 3F3VA 3A8WA 5LXMA 2CKOA 4MD7E 4O7VA 2R7BA 2GS2A 1YXTA 3EQDA 3R6XA 3LMHA 3BHVA 3HAVA 1OIUA 4QP6A 2YM4A 3NX8A 3HLLA 4DGGA 2VTJA 3EN4A 4WD5A 4W8DA 4IAIA 4BDIA 5J5TA 3NRMA 3FY2A 4AZSA 5JKGA 2W1CA 5CU2A 4R77A 4TTHB 4OTWA 5DWRA 5GJFA 3QQHA 2YAAA 5DN3A 4MNFA 3KVWA 2XBJA 4S32A 5EKOA 1A9UA 3TG1A 4HVGA 4HGTA 4DBXA 3HDMA 4ZJJA 5CWZA 4MXOA 3QLGA 5AV2A 1UU7A 4CVAA 2B9FA 4KKGA 3ZLXA 2Y6OA 2OIQA 5BVDA 3R7IA 3A7HA 4X2KA 3PP0A 4F09A 5C4LA 4YP8A 4GL9A 2B9JA 5JRSA 3ZCLA 1M2RA 2WTJA 2GNIA 4KAOA 2PZ5A 3ZLWA 3FMNA 2X8IA 5KKRC 1H1SA 3MPMA 4RX7A 4KIOA 4U3YA 1ZY5A 4YTCA 1OL7A 3PVBA 1OKZA 4N6ZA 4NJDA 4GK3A 4UB7A 3FE3A 4EH5A 1ZRZA 3P5KA 3F9NA 5KX8A 2WU7A 4PDOA 2VWUA 4FTIA 4QTCA 3QD4A 3SQQA 4DEIA 2H8HA 4IAFA 3GT8A 3BU3A 3NS9A 4AZFA 4KIQA 3MFSA 1GZKA 1MP8A 3NAXA 1OL5A 4JBVA 3QKLA 4G6LA 4BCIA 4A9YA 5J5SA 4AXAA 3QCQA 5CVHA 4AW0A 4IAZA 4NTSA 5E8YA 5I4NA 2C5XA 3VIDA 4BCPA 5IQDA 1W82A 1YXXA 4O22A 2WMAA 3FHRA 3C1XA 1YXUA 1IG1A 4D58A 3G6GA 1UNGA 5L3AA 3FZOA 3Q96A 4DFYA 4K0YA 3G15A 3DJ5A 3OMVA 5CAPA 3LCOA 4ACHA 5IEVA 2BHHA 2YIWA 2VWWA 2W17A 4FODA 2I0EA 4RIYB 5DEYA 3KFAA 3OY1A 3BWJA 4F64A 2ZMCA 3L8VA 3IQ7A 1Y8GA 1ZMVA 4EH8A 4L42A 1MRUA 1OIQA 1ZY4A 2EXMA 3V01A 5EQPA 3LQ8A 2OF4A 2X2LA 4S34A 5ETCA 1I44A 3MY5A 3W1FA 4EQMA 5IQFA 3R1NA 4ZSLA 1OKWA 4CFMA 4A06A 4C4EA 4XP3A 1UNHA 3PY0A 2B9IA 2FUMA 4M0YA 4H36A 4BF2A 1URWA 5FP5A 4Q9ZA 3QD3A 2P55A 3R7UA 5B2LA 4QO9A 3MN3A 3KY2A 3PPKA 2PY3A 3KGAA 5HEZA 3D5VA 4IB5A 3R8ZA 4BWPA 4O86A 3PUPA 3CE3A 2OF2A 2P2HA 5IEXA 2ITQA 3PJ3A 5CI7A 3V5PA 2BVAA 2J7TA 3K3JA 4GIIA 3ACKA 4NW5A 4BGGA 4EOOA 4QNAA 2UZOA 4CGAA 4HCTA 4CFWA 4GYIA 3QHRA 4OW8A 2W1HA 5HNBA 5JFWA 4WBBB 4QRCA 4CRLA 4G2FA 1FMKA 3B2WA 5HLWA 1F0QA 3F69A 3PA3A 4FKIA 3B2TA 1YHVA 3ZONA 3CPCA 3SDJA 3SVVA 4O0XA 5CXZA 4PDSA 3ORPA 2BHEA 4AACA 4II5A 5KMJA 2JFMA 4RJ7A 1YOLA 4PMPA 4UX9A 3NIEA 3QRIA 1Q8TA 4QMTA 4BRXA 1SNXA 4BDAA 5HBEA 2JDRA 2SRCA 3ROYA 3RJCA 1OKYA 3FDNA 4USEA 5ICPA 5L4QA 2UW7A 3WZJA 2F4JA 4FTTA 2VO3A 1OITA 4QPAA 4MKCA 3KN5A 3U4UA 3AXWA 5CF8A 3GU8A 4ACCA 4QTEA 1Q62A 3WE4A 4J97A 4L3LA 2DS1A 3QBNA 1KUTA 1JLUE 4NW6A 4KA3A 2R2PA 2ZV8A 3L9PA 1Q4LA 1GIHA 1ZYDA 4BBFA 2BIKB 2UW3A 4FTQA 4NM0A 2IZUA 3CPBA 4I24A 3F88A 5A6OA 1QPDA 1ATPE 1G8AA 3F61A 4YJPA 3MY1A 4FEXA 4CMTA 5LVOA 4F63A 3VW8A 5LMKA 4AT5A 3MFTA 2VO7A 4J99A 4IWOA 5H9BA 5HE3A 3WILA 5CSPA 3OCGA 2QO7A 4ZTQA 4CFXA 3NYOA 1ZMWA 5IUHA 4TWNA 2UVZA 3GOPA 3UGCA 5D12A 4BIBA 1GZOA 4O0SA 2LAVA 3S2PA 5J87A 4XJ0A 3UQFA 2QOIA 4FSQA 3E93A 3GU5A 4B0GA 4I94A 2JKMA 3G6HA 5KHXA 2AUHA 3TZ9A 4DH5A 1XR1A 2CHLA 3FXWA 4FOBA 4FTJA 3PXKA 4W4XA 5IH6A 1ZLTA 4ANBA 4D28A 3LVPA 4FZ7A 4ZXTA 4RVMA 3PLAE 1U5QA 1PMUA 5AP0A 1WAKA 3SV0A 3OXZA 4GRBA 2JFLA 3POZA 3OD6X 2XBAA 3PJ2A 1W8CA 1ZXEA 3R02A 4QMMA 4FV8A 4RG0A 5AR7A 3TTJA 4ZTRA 3OXTA 4QQCA 3AMAA 3R8MA 3QZIA 3NUYA 2UV2A 3LJ2A 3RNYA 3SRVB 5AV0A 3KC3A 3HMOA 5GZ9A 5EI2A 4AS0A 5EOBA 4EUTA 5LOHA 5DH3A 4TPTA 4EONA 4UWYA 2YM5A 4I5CA 1TQMA 4X21A 2JKKA 3FLQA 2XJ0A 4X3JA 4FZAB 1IA9A 2C1AA 3TZ8A 1G5SA 4I21A 1FINA 3AC3A 1Z9XA 5E8TA 2NPQA 2EB2A 5CU0A 4W8EA 4NCTC 4FIFA 3IW5A 4QNYA 3R7VA 2HW6A 2C3IB 5I9ZA 2R3NA 1ZWSA 4RBLA 3ACJA 3DBCA 5DRDA 4DGLC 3BE2A 3JY0A 4ID7A 2W96B 4HYUA 3KXHA 4YO4A 3NNXA 4YZBA 5IPJA 1OPKA 4JRVA 4FVPA 4QP1A 4Y8DA 4E5AX 1JVPP 4UXQA 2CCIA 4M69A 2ERKA 4KIPA 2XA4A 3S4QA 3VUMA 2V55A 4FTAA 3CQUA 3PY1A 2WMUA 4GW8A 4CFFA 4G6OA 5JZNA 3FHIA 5D10A 4G3DA 2WQEA 2XIYA 4EBWA 5HD4A 4FYOA 1PKDA 3CQEA 4EKLA 4FNZA 5E8VA 5AR4A 1UNLA 5FD2A 3GFEA 3QCSA 5KMKA 3IONA 3LXLA 3UE4A 2YAKA 3EN6A 3G5DA 4H1MA 4YGAA 4AZVA 5FTQA 4BI1A 4ZSJA 3NGAA 3R28A 3VO3A 2JKQA 3HGKA 2QD9A 3T3UA 3O8UA 2YFXA 3AC5A 5CASA 2OICA 3HNGA 5BYYA 4QYEA 3E62A 1XJDA 2WD1A 2O5KA 2YACA 4IFGA 1LR4A 4YMJA 4IMYA 4EBVA 4ONAA 4MWHA 4O0TA 5J79A 1PKGA 3SAYA 5CNOA 4F4PA 3I1AA 2CKEA 5TKDA 4LUEA 3KRJA 4R7BA 4GT4A 5ETFA 3F3WA 2WMSA 3BPRA 3LKMA 1YI4A 2Y0AA 2WQOA 4M69B 4QMQA 3F66A 2IO6A 1T45A 1K3AA 4H05A 4BKYA 4OAUC 5GJDA 4XLVA 3QCXA 4QYHA 4N6YA 5DA3A 2C5YA 1P5EA 3P0MA 4A4XA 1J1BA 4RT7A 3BKBA 4FEWA 3UYTA 4NK9A 3OTVA 2OH4A 2XIZA 2UZDA 4AU8A 5JZJA 3CD3A 3RCDA 3E7OA 4IX5A 4M12A 1TQPA 2PVNA 4YHFA 5M4UA 1A48A 3Q9ZA 2I40A 2GQSA 2QOQA 4Y83A 4EZ5A 2LGCA 3NNUA 2ITTA 2A1AB 2J90A 2W99B 4FTRA 4UMTA 3BBWA 4KS8A 4N0SA 3L9NA 3QUEA 3A2CA 4D5HA 2WXVA 2QO2A 3PLSA 4IVBA 4O2PA 3Q4UA 1DAYA 3OWKA 1PRYA 3R00A 5E91A 3GU6A 4RGJA 5GZAA 5HORA 3UNKA 2R0IA 3GUBA 3MPAA 3FLYA 2X39A 3F7ZA 1IAHA 4ORKA 4JG6A 1BKXA 2C0TA 1NVRA 3EL8A 4X2NA 2B55A 4J95A 1HCLA 2HWPA 4OBPA 3FKNA 4ZLZA 1UV5A 3KULA 3MI9A 4OTHA 4F7JA 4C58A 5M56A 5L2IA 2HOGA 2AYPA 2C5NA 3FMDA 2OFVA 3VBVA 4TYEA 3MIAA 3NUNA 4GFMA 2X7GA 3MTLA 5J9LA 2C6EA 1HOWA 3OUKA 2HZIA 2BDFA 3E8EA 1WZYA 2W7XA 3TV6A 3E3BX 4CKJA 2CNVA 3TZ7A 4FGRA 3BLQA 1OPLA 4RMZA 3TNPC 2C47A 4QQTA 4MXAA 5E4HA 1QPCA 5JQ8A 3SG9A 4C35A 3BWFA 3BEGA 4NM7A 4XUFA 4EK8A 4B9DA 4KB8A 5JGAA 4IWQA 4DFUA 3WARA 4BIEA 4O38A 2QOKA 2ZV2A 2YITA 4JOAA 5BYZA 4FSYA 5IA2A 3PE2A 5K0XA 1BI8A 4YJSA 4GS6A 3IS5A 4X2GA 2B4SB 4ZTHA 2QKRA 3ET7A 3UO6A 4G3GA 5CQWA 4EK5A 4O7YA 1YOMA 5F95A 1PXMA 5H2UA 4BN1A 3LFAA 4XBRA 5BPYA 3PZHA 1TQIA 4FI1A 2UZBA 3H9RA 3NUSA 2PMOX 2EU9A 5EM7A 1ZAOA 4K33A 3G0EA 3RPSA 2ITPA 1BYGA 3H9OA 4FG8A 2A4LA 4M67A 4U5JA 5DNRA 3THBA 2JIUA 3SXSA 5AV1A 3ZU7A 5CEOA 5AV4A 4GVJA 3MVMA 4AA5A 3V8WA 4I3ZA 3ZZWA 3VUTA 2Y4PA 2YHVA 4AP7A 2XMYA 2GQRA 4U41A 4BTMA 5FWKK 4NUSA 5JMSA 2REIA 4IZ5A 3W33A 1E1VA 2CPKE 4YPSA 2CMWA 2E9NA 4AOTA 4XG9A 5KMIA 3LQ3A 4PNIA 3AMBA 3BV2A 5A4EA 2JIIA 2ONLA 4C0TA 3QA0A 3DK6A 3WI6A 1ZZ2A 3ZMMA 4RQKA 5DI1A 3GC9A 3MJ2A 4DGMA 5LMAA 3R63A 4CZUA 4KINA 3P7BA 3R7GA 4PDPA 4EH2A 3AMYA 2A2AA 3CCNA 2PZIA 5D11A 5FXSA 2OZAB 1GIIA 4O96A 2C6TA 4U3ZA 1KE7A 5HG7A 5CEMA 3F2NA 3BLHA 4K77A 3PG1A 5IG1A 4ITHA 2OU7A 5C26A 5HU3A 3QTQA 2VX1A 4RC2A 4DEGA 5FDXA 2QC6A 2WTVA 5CX9A 3K3IA 3MVHA 4FL2A 4AFJA 1OI9A 4K11A 3M11A 4KRDA 4C36A 3O7LB 4RFYA 2KULA 2BKKA 5AP6A 1BLXA 4O82A 2P0CA 5CEPA 2BTSA 2C0OA 1NXKA 1JSTA 2XYUA 2WQMA 4FMQA 3ZXTA 4RIXA 5ETAA 4YC8A 2BTRA 2YM8A 3K5VA 3ZRLA 2FSTX 3HP2A 5I9XA 5HO8A 2XS0A 3OCTA 3CBLA 4AT3A 3TUBA 2AC3A 2YLFA 5DIAA 1VR2A 3UBDA 1NA7A 2WIPA 3QQJA 4XP0A 3E87A 5EFQA 5C01A 3RPVA 2ITOA 3ZUTA 3S0OA 2CNQA 3DJ6A 4EH6A 3OEFX 5CU3A 1B6CB 4L9IA 4XV9A 1B38A 5FXQA 4YZCA 2NRUA 2I1MA 2VNWA 4UXLA 1XH5A 4X2FA 2PUIA 4L6QA 3RZBA 3OVVA 3ZDUA 2O65A 2GU8A 4YPDA 3UNJA 3H4JA 2JD5A 3A62A 3S3IA 5ANJA 2IZSA 3N4VA 3F2RA 4EL9A 2CN8A 2RFEA 4PRJA 4TYJA 4CKIA 4FNXA 3U51A 5JGBA 2RG6A 2XNBA 2G15A 4ASEA 2XIKA 4Y85A 2BDWA 3FAAA 4PP7A 5C8NA 2J5FA 1H25A 1WBPA 4HJOA 5LJJA 4JQ7A 4ENXA 5IQIA 4ERKA 4WBOA 4E4MA 2X9EA 3DFAA 1QCFA 2CNUA 2IJMA 4C4HA 3LXPA 2BILB 4ZJIA 4ANMA 3IGOA 4EOPA 4EHVA 1B39A 4L46A 4GCJA 1JKLA 4OTPA 5A54A 5BMMA 5HCXA 3GVUA 2YIQA 4UYNA 2VTQA 1CKJA 3KRWA 3QTWA 4WKQA 4YBJA 4CEGA 2WTWA 2C5VA 2QI8A 2XJ1A 5HVKA 1LP4A 2GCDA 2CGUA 4U7ZA 4PV0A 1ERKA 4BCFA 5CALA 1H1RA 4ITJA 3ORNA 4AGCA 4JDHA 3DK3A 4TYIA 4YJQA 3V51A 3O8TA 3BE9A 4PDYA 2QHNA 3C4WA 4I4FA 5BVNA 4DTBA 5AUWA 1PXNA 3NWWA 3PRIA 3KMMA 3DKOA 2OXYA 2JLDA 4Y73A 3QFVA 2J9MA 3TXOA 1YDRE 3WOWA 4X7QA 2W1EA 4BTJA 1AD5A 3O2MA 5GIOE 4H3BA 3CEKA 4EH4A 4ZSGA 3VUGA 1CKPA 3GEQA 4ACMA 2J0MB 3OG7A 3ORMA 4GMYA 4L3JA 4AFEA 5AA9A 2UUEA 3TN8A 4U97A 4GVAA 3E7VA 4D4RA 4DH1A 2R0UA 2OJFE 3DAEA 4YTFA 3U6IA 3QCYA 2IPXA 2W4OA 4UWBA 4CFVA 2V0DA 3CY3A 4FG7A 2HZ0A 3LCSA 1L8TA 4WA9A 2BZJA 4WT6A 2B7AA 1NT2A 4B99A 3POOA 3P86A 4E3CA 5CZHA 3G51A 2C6LA 3PVWA 4BKJA 2ITNA 1CMKE 1YVJA 3E8CA 4DT8A 4FZFB 3T9IA 4GK4A 3LZBA 5AR8A 4ALUA 4K6ZA 5CF5A 1J7IA 2C3JA 3GENA 1LUFA 1VEBA 2Z60A 4S33A 4HVIA 5JK3A 4LUDA 3UIXA 4G31A 2ZAZA 4U9AA 4WNMA 3R01A 4FL1A 3REPA 3VN9A 1OB3A 1X8BA 3TNIA 4ZMFA 3ZRKA 3F5GA 4L43A 4E7WA 5A6NA 1Z5MA 3LQ5A 4QYYA 4U81A 5AIKA 4YSMA 5D1JA 2FYSA 3TUCA 1KV1A 5BUJA 3OXIA 4QP4A 4U80A 1ZYSA 5AFVA 3FQEA 3Q9XA 2WELA 4J52A 2CGWA 2QOLA 4JRNA 2BPMA 2JBOA 4GG7A 1YW2A 1Y8YA 2ERZE 4IB1A 2XP2A 3UG1A 2BUJA 3COKA 3K2LA 3UDBA 3KCFA 3QWJA 4EQCA 2W1DA 5BUIA 1OECA 2G2HA 1WVXA 3Q5IA 5LVNA 3AC8A 3E5AA 4WNPA 3EN9A 4F08A 4M97A 3JVRA 5LQFA 4QQJA 1WCCA 3RHXA 4C37A 5BVFA 4C3RA 4G5JA 2C0IA 4DFBA 5CYIA 4OGRA 4QMZA 2XCKA 2UZUE 2P2IA 3LFQA 4W4WA 4BBMA 5HHWA 4P4CA 3RPYA 2ITXA 3KREA 3O50A 4I4EA 3JYAA 4ZOGA 3UVQA 3U55A 1M14A 4CNHA 4TWCA 2R3MA 4D2PA 5HESA 4J1RA 4RC4A 5HOAA 5BUEA 2XK9A 3SD0A 4DH8A 3ETAA 4FTKA 4ZTMA 3O51A 2WTDA 3I6WA 3VNTA 1Q99A 3TWJA 2ZDUA 3LMIA 5I3RA 1XO2B 2RGPA 3FLZA 1H1PA 4BI2A 4IVCA 2FA2A 4G9RA 4UMQA 4BDKA 2XZSA 3M1SA 4C57A 3R9DA 1Q97A 5IQEA 4YTHA 4EQUA 1WFCA 3AC4A 3QX2A 4L44A 2B53A 4QMWA 4X0MA 2OW3A 4UALA 4USDA 3V6SA 3LLTA 3PXYA 4EEVA 4GYGA 5EDPA 3R2YA 3QRKA 4OR5A 4QMOA 3ATSA 3HZTA 5CEIA 3FXZA 3BI6A 1GIJA 2Q0BA 2R3OA 3FMLA 3WYXA 4XRLA 3CQWA 1OMWA 2YZAA 4O0WA 1SNUA 3DXQA 2F7ZE 2WO6A 3NW7A 2OZAA 3GP0A 4QMXA 4CT2A 5IDPA 2G1TA 2VX0A 4NIFA 2PTKA 3OOMA 2J0IA 4TYHA 2CN5A 3S00A 4BCOA 2BKZA 5CQUA 4C7TA 4JDKA 4BGQA 4L01A 2YEXA 1G8SA 4YUQA 3ZOSA 3NVKI 2XKFA 4DG2E 3BV3A 4XS2A 3OS3A 1KV2A 4GUBA 4YNEA 4W9WA 3RBWA 3RKBA 3V3VA 1KWPA 1L3RE 2ZM1A 4NTTA 1STCE 5HCYA 2ETRA 4PNKA 3DAJA 3EFKA 4QMUA 4EZ3A 3MFUA 4FKGA 3LCKA 3JXWA 3C4FA 1H08A 4IAKA 4OTFA 4RIXB 2CJMA 4ZSAA 2IZRA 2J50A 4IX3A 4M14A 2EVAA 5CS6A 3SOCA 4JS8A 4Q9SA 1ZOGA 3EL7A 4RFZA 1RDQE 3TCPA 2IVTA 3RM6A 3UYSA 3GCUA 2FSLX 5HE1A 4JBOA 3ZC5A 5GIPE 5EYKA 4ZY6A 4I1ZA 4ITIA 2VTNA 3CJFA 4LGGA 2J0JA 4AA0A 5AAGA 2QU5A 5ACBC 2IZTA 2O63A 2QR8A 1QMZA 4GG5A 3OZ6A 4FV6A 4L8MA 4GFGA 2YDIA 4I6HA 4ZIMA 2IVVA 5T3QA 2BDJA 3ORZA 2X4ZA 3D5WA 5BMSA 3CIKA 3VF9A 4A9UA 4FKRA 2WIHA 4FTUA 4G6NA 4BCMA 4E5WA 1PMNA 1ZOHA 4QTBA 4RZWA 3D94A 5ETIA 3RHKA 2JDSA 2XNNA 1KOBA 4NT4A 4MXXA 4XYFA 2PMIA 2UZTA 3P78A 4UMRA 4FTOA 5F4NA 4C2VA 2W9ZB 3QZFA 2HIWA 3UZPA 3PZEA 4RQVA 1R0PA 3E88A 5C9CA 3I79A 3R9HA 5CT7A 1Q3WA 3O8PA 5AAEA 3DQXA 5L6OA 4TKSA 2W4KA 3DV3A 3TZMA 1NVQA 3L8SA 4WHZA 2CSNA 3IECA 2F9GA 2JITA 4LM5A 1MUOA 5EKNA 3W18A 1H00A 1LEZA 4PPAA 2VTOA 1R3CA 3FI8A 4O91A 4GKHA 2FVDA 4R8QA 4BDFA 4BVUA 4OTRA 4B6LA 4CG8A 3PPZA 4LQMA 4NYEA 1MQBA 2XRWA 3H10A 1OVEA 4WNOA 5AP2A 4DAWA 2H6DA 4IW0A 2VGPA 4TZRA 2GFSA 3EQHA 3Q6WA 1S9IA 4QMYA 4ZS4A 4M7IA 4NWMA 2IVSA 4JR7A 3EZRA 3FMJA 4FSNA 4L53A 1O9UA 3RK7A 4F7SA 3UP2A 5E8ZA 3IO7A 5ACKA 3D5XA 3R8VA 3H0ZA 1JKKA 1UWHA 1BL7A 3OEZA 1M7NA 4IZAA 4XG3A 4CYJA 5HQ0A 3UZTA 4MNEB 5EDRA 1Y6AA 3MH1A 4IWPA 3Q9WA 4IHPA 1U54A 4EOMA 4J8NA 5ANEA 3F2AA 4XG6A 4A7CA 3QQFA 3ZO1A 2XM9A 2YM6A 4DN5A 4FR4A 4TL0A 5J7HA 2HYYA 4OTDA 4F7LA 3BRBA 5E92A 3JUHA 3U9CA 3S1HA 4S30A 5HG5A 2DYLA 5CSWA 4BICA 2BIYA 5J9ZA 3DK7A 4BB4A 2WKMA 3UQCA 3NW6A 4R6VA 3RMFA 2PMNX 2WPAA 3TNHA 4F0IA 1YDSE 3OOGA 5GNKA 3VQUA 5CEQA 3GC0A 2BRMA 3VUKA 3F5UA 3FI3A 4FKPA 5CY3A 4EH3A 4FICA 3V8SA 2BALA 5CLPA 5HBJA 2OIBA 3PPJA 4L7SA 1SVEA 5HD7A 3UNZA 4GT5A 3QKKA 3UZRA 5AMNA 3PJ8A 1YWVA 4QP8A 2WNTA 5FLFA 2O3PA 3H3CA 3ZYAA 3ID6C 4XBUA 4PMMA 3AD4A 2C4GA 3MDYA 3HRFA 4WG5A 4ZZMA 3Q9YA 1BMKA 2YCSA 5T6KA 2WU6A 3QQUA 4ENYA 4LMNA 1U54B 5E8WA 4IC8A 4N57A 3JR1A 1JKTA 3GU7A 4RZVA 1RQQA 3FKOA 2XNMA 4RIWA 5IU2A 3CGOA 4K18A 4A9TA 5F1ZA 3VF8A 3CJGA 3DPKA 3NUUA 4JDIA 4DLIA 4YU2A 2CKPA 4FIHA 3OP5A 2UZNA 4C33A 1PY5A 2J6MA 2QODA 2O0UA 3W16A 1GJOA 3TV7A 5K5XA 4DEDA 3BX5A 1KE9A 1KOAA 3DBDA 3O96A 5DLSA 2WQBA 2OG8A 4FIGA 5HG8A 3QUDA 5L2QA 4C59A 3EQCA 5ANOA 4EORA 4BL1A 2R4BA 3UG2A 2J5EA 4WRSA 4DTAA 2VWYA 4KNBA 3EYGA 5LCJA 3VBWA 4C34A 3U4WA 3TI1A 4IXPA 1CDKA 2YIYA 4H1JA 3I0OA 4QMNA 2UVXA 3UIMA 1Q41A 3QL8A 3BZ3A 3VJOA 4FGBA 4LRKA 2R3FA 4IJPA 2IN6A 5JT2A 1IA8A 2QG5A 3QC4A 1UKHA 2HK5A 3BELA 3PIXA 1XHAA 3GQIA 3ITZA 2XCHA 2Y6MA 3FV8A 3R8PA 3C4EA 2QONA 4UMPA 3DS6A 3IDCA 1JBPE 3QTSA 2C3KA 4FF8A 4LOPA 3DDPA 5JRQA 4AQCA 2VTIA 3PY3A 5CVGA 2PE1A 4H58A 3RI1A 4DT9A 2EXEA 1S9JA 3NDMA 3QXPA 4Y5QA 3OFMA 1PYXA 4KKHA 5AM7A 2B9HA 3WE8A 3VHKA 4KBKA 2J4ZA 2BZHB 4IH8A 4YR8A 2BAJA 1YWRA 2H34A 2RF9A 3MJ1A 4O6LA 5IQBA 4LRJA 2R3IA 2YLEA 4A07A 3DOGA 3NCZA 3MB6A 4GJ3A 2BCJA 2JDTA 2ITYA 3IW7A 2HELA 3QX4A 2W5AA 5FEQA 3R1YA 4M68A 3V5WA 2CGXA 2I6LA 4FIJA 4NZWB 5D41A 3KKVA 3A7FA 2C1BA 4CSVA 3TIZA 2GHGA 3NYXA 3W32A 4NIFB 5A3XA 3E63A 3FZPA 4F65A 3EQFA 4IJ9A 3RAKA 1CKIA 3U9NA 4FSZA 1TKIA 4JQEA 3VC4A 3QTZA 2YJRA 2Y7JA 4U42A 5M4FA 4MHAA 3U6JA 4CRSA 2GSFA 3AGLA 5K4JA 2UZWE 3FI2A 1Q8WA 3FMMA 3OTUA 5L8KA 4QTDA 2ZV9A 5A4LA 4FT7A 4Q5HA 2YABA 4F7NA 4ZLYA 3HRCA 2XK7A 2DQ7X 3D4QA 4WG3A 5HO6A 1YQJA 2PZRA 1FGKA 3R30A 4PP9A 3SXFA 3EFWA 4ZJVA 2WTCA 1XBAA 3WF9A 3MWUA 1YWNA 1PXPA 3NAYA 4IZ7A 3MYGA 2PVRA 3HP5A 4FKSA 5IUGA 4GH2A 2ETKA 3EYHA 5D7VA 1YOJA 3LFEA 4QD6A 1OIYA 1PJKA 2EWAA 4FSWA 4BCGA 3DKGA 3RZFA 2VTTA 2BRHA 3PG3A 4PL3A 1J7LA 3ENMA 2VV9A 4BDBA 4F9BA 4DF3A 1UA2A 5HTIA 1IAJA 3HAMA 4EJNA 4WUAA 4K9YA 4HPTE 3UOHA 5EW3A 5CU4A 2QURA 3KB7A 2B54A 1JSVA 1EH4A 3ANQA 3MH3A 4BYIA 4LRMA 3OCBA 3DBEA 3MS9A 4PWNA 3R9OA 4XNEA 3ZFXA 3KXXA 3VS1A 3SG8A 4RRVA 3LFDA 3HX4A 5E1EA 3BEAA 4XV1A 1NY3A 5CT0A 3BYUA 5ANDA 4YTIA 4ASXA 5IMEA 2OI4X 3KULB 1QPJA 1REJA 4I23A 3MTFA 3HRBA 3UQGA 4JAJA 3M42A 4FEUA 5ANIA 4E6CA 1JPAA 3GC8A 3Q60A 4U45A 2Z8CA 4J8MA 5IQCA 4O0YA 1PXKA 3ORIA 4JBQA 2C3LA 1IR3A 1WVWA 2HXQA 3V5QA 5B2MA 5IH4A 3VJNA 4FZ6A 2WGJA 3OUNB 2VTAA 3HYHA 1FGIA 4JIKA 4O1OA 4BZOA 5IKWA 2WTIA 2X7OA 3FKLA 3QYWA 3Q4CA 2VX3A 4J96A 4YJTA 2UZLA 5D7AA 2PVFA 3UJGA 5I9YA 2PL0A 4MQ2A 3OT8A 3PIZA 4R5YA 1Q5KA 3DLZA 2VUWA 3KEXA 5FBOA 4IC7A 5FEEA 2A19B 2C68A 3DZQA 3MY0A 3QZHA 5AAFA 3O23A 1Y57A 1Z57A 1VZOA 4RLKA 3KK9A 5DR6A 4DCEA 4GKIA 1KE6A 5BVWA 4RJ8A 3P7AA 3L9LA 2P4IA 3FZSA 4FKUA 3QALE 4NH1A 5DEWA 3EH9A 1WBTA 3IDBA 3PSDA 1ZOEA 3C5UA 2W1ZA 3WF6A 4H3QA 4TYGA 4NSTA 1GY3A 5HLPA 2BFYA 1OL2A 4KS7A 3R8UA 1XBBA 1CSNA 2WMRA 3FYKX 3MGYA 4LFIA 5HIBA 4EHGA 2PVMA 3FLSA 3LFCA 3TNWA 3U6HA 5IQAA 4IANA 3ZDIA 4C3PA 5LMKC 4BDEA 1P4FA 1OIRA 1LEWA 4QQ5A 1TVOA 4FKLA 4XLIA 3I6UA 4LV8A 4Y95A 4RA4A 3CTQA 3IPHA 3UODA 3G9NA 4GU6A 1JAMA 3PJCA 3G33A 3I7CA 3BGZA 3E3PA 4Y5HA 3WZEA 3DY7A 4E6AA 4JXFA 3UO5A 3ANRA 3WIKA 2OSCA 3U54A 2WEIA 3QC9A 4OUCA 4NKAA 2J0LA 4AGDA 3SX9A 3VS0A 4I5MA 4TY1A 3EB0A 3KCKA 3HMIA 3R7OA 1YXVA 3RPOA 2CKQA 1IEPA 3LFBA 4JBPA 4CCUA 4TNBA 3C9WA 4J53A 3LFNA 4XMOA 3EFLA 2YCFA 2W0JA 2XJ2A 4QPSA 3Q04A 4FV4A 1P4OA 2WHBA 3TKUA 4M13A 4FZDB 2ZB1A 3LPBA 3KVXA 3WF5A 3UC3A 3MBLA 4DYMA 5H3QA 4BKZA 2IWIA 4U6RA 2KTYA 1M7QA 3Q32A 4OTIA 4BCJA 3NIZA 3JPVA 1BI7A 1V0OA 2Y4IC 4I22A 5IQGA 4ZP5A 4ERWA 2R3GA 4IBMA 3PYYA 3O17A 3BHTA 4RSSA 3BQRA 3R2BA 4GEOA 1OBDA 3IW8A 4OTGA 3ALOA 3FL4A 3PVGA 3FPQA 3KMWA 4AGUA 1O6YA 4ACDA 4CTBA 5C8KA 4CKRA 2UW6A 5J9YA 3NW5A 1E1XA 4APPA 4BBEA 5J7BA 2Z7RA 2UW5A 5AUTA 5AP5A 3BHUA 3O71A 4YZ9A 1AGWA 4PPCA 4ZY4A 3A7JA 1KSWA 4X6RA 2XNGA 4FKWA 2I0VA 2X8EA 3BIZA 3EOCA 3ORKA 3HMPA 2VWZA 5L2TA 3VBXA 4AAAA 3MA6A 2XUUA 2YIRA 4E4XA 5BVOA 4ZAUA 3OBGA 4ZEGA 4RIOA 5AUXA 4PMSA 4W9XA 5ANGA 4FVQA 4O7WA 1Q8YA 2HZNA 5B2KA 2W1GA 2W5BA 2ZDTA 3C4XA 5AUVA 2X2KA 2OKRA 4QYFA 2QOFA 3DB8A 4IX6A 4XG2A 3KRRA 2JKOA 4Z16A 2OBJA 4FKQA 3Q4TA 2WMVA 5AP1A 3QRTA 3ZBXA 3GBZA 4V0GA 3ZSGA 4LI5A 4O21A 3FL5A 3C13A 4G3CA 3TEIA 5KBQA 3L1SA 2W4JA 4GSBA 4HOKA 4AOJA 2XIXA 4J98A 5DT0A 5CF4A 4OTQA 4EOIA 2YJSA 4D1XA 3EQRA 4AGWA 1G3NA 4D4YA 2VWBA 5K0KA 3FC2A 4YLLA 3EQBA 3K54A 5A9UA 1M17A 4JIAA 1V1KA 2GTMA 5IA3A 3VS3A 2OZOA 3EN5A 4DC2A 4DFZE 1WMKA 4RVTA 3IGGA 5TO8A 4P7EA 5I0BA 4XCUA 4O7NA 3UPXA 4HNIA 1JQHA 3FZTA 3NYVA 4CMUA 2E9VA 5AR2A 1J1CA 3MVJA 5M4CA 2X4FA 3K5UA 4EYMA 3AOXA 5AR3A 3PWYA 4JQ8A 4WUNA 1OUKA 2CLXA 3ZUUA 4FKOA 3DT1A 3CS9A 3S95A 3VS4A 4F6SA 2RFDA 4FKTA 4IEBA 3V5JA 2QR7A 5K9IA 1GOLA 1XH9A 4GJ2A 5ITAA 3NMUF 3B8QA 2QNJA 1GZ8A 4IX4A 1A06A 4AE9A 4MF1A 4BCNA 2F2CB 2XB7A 5IZFA 1JOWB 2V5QA 4XV2A 3Q6UA 5CTPA 3F6XA 5FRIA 2F2UA 2O8YA 5JFXA 3DKCA 3KK8A 4CYIA 2PVHA 3CKXA 3RINA 4AZEA 2HENA 4MEDA 4RX8A 3EQIA 3PXQA 4HVDA 5LVPA 5L8LA 3IK3A 3I81A 2W1IA 3L9MA 4TWOA 4O6EA 3MH0A 3TJCA 5AUYA 4Z7GA 3D14A 4C38A 3HEGA 3VBTA 4FSUA 4RWJA 5A4TA 4O7RA 3SLSA 4TRLA 2QLUA 3C4CA 5KMOA 2XIRA 2VU3A 4IB0A 3CD8A 4F6WA 2YWVA 3PJ1A 4M15A 3G90X 3CTHA 3BLRA 3F5PA 4C61A 4KIKB 3IOKA 5M51A 1Y91A 5AUUA 2VTHA 4KSQA 2XKDA 3OF0A 4B8MA 4CMOA 4EOKA 2WFYA 1PMVA 2Q83A 3C5IA 4HW7A 4F0FA 2X6DA 3GU4A 3Q2MA 1OL1A 3PE1A 4EK6A 2AC5A 5A4QA 1ZARA 4IB3A 3PA5A 2ESMA 3WZKA 4AZWA 2ITUA 3F7WA 3BGQA 2JDVA 1E9HA 1XBCA 3M2WA 4W4YA 4O7LA 1FQ1B 4D9UA 4NFMA 3W2CA 2UVYA 4GK2A 4C4GA 3KF7A 5AX3A 4DEAA 1PF8A 2E2BA 4EWHA 3KU2A 3ZFMA 4N4SA 3GOKA 4MBLA 4N70A 4OLIA 5CENA 4IIRA 4RA5A 4UEUA 5FUTA 2J51A 2GS6A 2WMWA 4YHTA 5I9UA 3O0GA 3FBVA 3RPRA 4HYIA 4FV9A 1SYKA 4JX7A 4YZMA 5DBXA 3I5ZA 4FTCA 3R22A 4G34A 3CTJA 4KIKA 5FDPA 2ITWA 4XHKB 4BY9E 2V62A 3UOLA 4RWLA 3C0GA 2YISA 4XG7A 2V7AA 4IM0A 4F9YA 4H39A 4DA5A 3W2SA 5E8SA 1M2PA 3E8DA 2HZ4A 2WTKB 4V04A 4WRGA 5AV3A 4AN2A 3HUCA 3SXRA 4IVDA 5AP4A 2YDKA 3DGKA 5FGKA 3BBTB 4BCKA 4DH3A 5KKRB 3TIYA 4B7TA 3MFRA 4P2KA 1YI6A 5BYLA 4PQNA 2XNEA 1FPUA 2A0CX 2B1PA 3R1QA 4J7BA 3TDWA 4EZ7A 4QOXA 3KN6A 2EB3A 2VTMA 4JL9A 5E7RA 4G3FA 2BRNA 4XG4A 5M53A 4AW2A 5EDQA 2VO6A 1ZZLA 4OBOA 2PPQA 3JS2A 4M0ZA 3UP7A 4DHFA 4EH7A 3Q53A 4LOOA 5CSHA 2YM7A 3OWPA 5TF9A 1YHSA 2G2FA 1W7HA 2WAJA 3OC1A 3PA4A 5EHLA 3VULA 3PSBA 4RPVA 3VS6A 4ALWA 2B0QA 2PVYA 3D5UA 3MVLA 1H8FA 3AT3A 4YHJA 3IDPA 3QQKA 5G1XA 3TL8A 5HIEA 5HTCA 2QVSE 3QU0A 3D7TA 4PMTA 1DM2A 2E9PA 2F57A 1KE8A 3LM0A 2R9SA 3HMMA 4OT5A 1H24A 4R7IA 5CZIA 4L3PA 3UC4A 5JH6A 5LVMA 3AGMA 2PU8A 5DGZA 4S2ZA 2OGVA 4RX9A 1IASA 1IRKA 4IE9A 5GHVA 4EHZA 1SM2A 3AC2A 3LE6A 3DAKA 4FTMA 4EKKA 2UW9A 4FOCA 3U8WA 3LHJA 5C27A 4ANNA 2WB8A 3RP9A 4BI0A 2BZIB 4G9CA 4R1YA 4UBAA 3D2KA 4JVGA 4KUJA 5M06A 3D15A 1UU8A 5GINE 2Z7LA 3D0EA 3F82A 3QHWA 4FNWA 5B7VA 2WOUA 3SC1A 3DNEA 4FYNA 4IQ6A 5CI6A 3FI4A 4FT0A 4V01A 4XEYA 3Q3BA 5H8BA 1FVTA 5EI8A 5HG9A 1CM8A 1NW1A 4U0IA 5TOZA 4E93A 1W0XC 1V0BA 3QTRA 2X81A 3AD5A 4KWPA 2PZYA 3GCSA 3O7LD 3VBYA 1FBNA 5FEDA 3BU6A 5LARA 3W8LA 4DITA 1H07A 5E9EA 3OROA 4EOSA 5DPVA 3RNIA 5L6WL 3BQCA 5TT7A 5HNIX 2ITZA 4MXCA 1PW2A 4QP2A 4TW9A 4EC9A 5KO1A 4O27B 4RJ3A 5EG3A 3EIDA 4AG8A 5DE2A 2PYWA 3DFCB 2Z2WA 4IZYA 4MH7A 4YJOA 4MYGA 4EUUA 2R5TA 4OT6A 3VS5A 1H0VA 1J7UA 4E6QA 2YZLA 2F7EE 2W05A 3DZOA 1O6KA 4AZTA 4MCVA 3ZM9A 3ZSIA 4IFCA 3HV5A 4O83A 4FV0A 3LOKA 2QU6A 4UY9A 3RGFA 5CAQA 4YBKA 4BDGA 3R9RA 4F1TA 4G3EA 3RAHA 4E5BA 4BCQA 5HE2A 3KRLA 3C50A 4E4NA 4BTKA 2C6OA 4NFNA 4E1ZA 4LGHA 3PFQA 5F94A 2HY81 2ZVAA 5M09A 4HGSA 1WBNA 4BIDA 3ZSHA 4B8LA 3COHA 2ZM4A 3QD0A 3QF9A 5E90A 3SW7A 2FB8A 1GAGA 3C4ZA 4UZHA 4D9TA 2J2IB 5CEKA 4EH9A 3DKFA 5E8UA 3RWQA 2QLQA 3EMGA 3ORTA 3DXNA 3UMXA 3BU5A 2Y8OA 3PXRA 4Y46A 3C0HA 3FMKA 4I0SA 4R3RA 3GC7A 4UV0A 5FM3A 4O7SA 4QYGA 2PSQA 4X2JA 5C03A 5M57A 4FV7A 2X1NA
chains in the Genus database with same CATH superfamily
2X6EA 4CD0A 2FSMX 4DFLA 5L8JA 1OL6A 4LL0A 4AW1A 4PPBA 5F20A 2OXDA 5HNGA 3N4UA 4Z55A 3KL8A 5KZ0A 2GNLA 3GXLA 4L68A 3H30A 4BZNA 2R7IA 4HPUE 3TT0A 3W2PA 4D0XA 4ZLOA 1RE8A 5IA5A 3W10A 1U59A 1PXLA 1ZYCA 5IA4A 4AN3A 5EW9A 4MD9E 3LXKA 4F1OA 1NVSA 3BGPA 2CLQA 4TWPA 4KBAA 1P14A 3GI3A 5TE0A 4CXAA 4QMPA 5IEYA 4I6BA 2HCKA 1W83A 4JLCA 3T9TA 2IVUA 4U79A 2XK3A 3FXXA 4HNFA 5DR9A 3HKOA 2PULA 4K8AA 3H9FA 3JVSA 4RIWB 4LYNA 4RJ6A 2VTLA 3P23A 4RVKA 3ZLYA 5A14A 3TDVA 2JAVA 2IF8A 1CTPE 3HA8A 4FK3A 4HGEA 3EKNA 5AP3A 3FUPA 5HIDA 1RW8A 3RAIA 2RFSA 4BTFA 3DB6A 3LMGA 3TKIA 3EHAA 4MWIA 4I92A 2RIOA 4GV1A 4UZDA 1R39A 3P9JA 2FO0A 4DG3E 5M4IA 4AX8A 2OK1A 5JFVA 4EOJA 4R5SA 1UWJA 3ZLSA 4UN0C 3NVMB 4H3PA 3MH2A 4XP2A 1G8KA 1W98A 2UZEA 3PFYA 2AEGA 5BNJA 2JC6A 3FMEA 4FK6A 4MX9A 5CVFA 4I6FA 4L45A 4Z9LA 4FA2A 2PWLA 5DVRA 2QHMA 2Z7SA 3A8XA 4FEVA 3EWHA 5EHYA 3LAUA 4YURA 2W9FB 1OGUA 4TYHB 4WSYA 3OW4A 5M44A 2HW7A 4YLKA 5JQ5A 1VJYA 3AT2A 5M07A 5EM5A 3CKWA 2OJJA 2JEDA 3F3UA 5AEPA 5CAOA 3DBFA 3C51A 3C0IA 3DTCA 2O2UA 3W2RA 4PL4A 4PUZA 2PZPA 3NCGA 3IW6A 5HBHA 1ND4A 2VTRA 4I20A 3ZO2A 3NEWA 3UMWA 4BWKA 4YC3A 4CFNA 2QO9A 2C30A 3R0TA 4L7FA 5JSMA 1GZNA 4EK3A 1SZMA 4BDCA 3BHHA 3DXPA 3QQLA 3PTGA 3EFJA 3WZUA 1J91A 2C6IA 2QOCA 5K5NA 3L8PA 5J1VA 2UZVA 4I6QA 5DG5A 2PVJA 3RTPA 3QRJA 1OM1A 3FLWA 3AQVA 3TNQB 2OJIA 4W4VA 2UW0A 4I0TA 4GU9A 3FPMA 1R0EA 3DA6A 2OIDA 1XH4A 4NM5A 5FM2A 3IOPA 5GJGA 2P33A 3RALA 5KMLA 3KXZA 4ANQA 2J0KA 4BCHA 5C1QB 4HCVA 5LMBA 3OWLA 4MBIA 1H26A 1VYWA 4JG7A 4PX6A 5HVYA 4YO6A 1XKKA 1XQZA 4R3CA 4GUEA 2GDOA 3P7CA 3U87A 2GFCA 1U5RA 4XG8A 3D9VA 5LVLA 2PHKA 2V7OA 3AG9A 1O6LA 1H1WA 4FIEA 1Q24A 4KD1A 1JWHA 4D5KA 1JKSA 4LGDA 5K3YA 1KE5A 4E8AA 4X3FB 5EQEA 4BC6A 2WMTA 1GNGA 4EHEA 2EXCX 5JGDA 1ZMUA 1ZYLA 3RWPA 2A27A 2QOOA 2PUPA 2JIVA 5IISA 3KXNA 2R3HA 2VTSA 4M66A 4E20A 4HZRA 3BYSA 2XK8A 3I60A 3CGFA 3EN7A 4MXZA 2WQNA 4MD8E 3T8OA 3OY3A 3DLSA 3DNDA 3IW4A 5HX6A 3FWQA 3VHEA 3JY9A 4J71A 4C2WA 3NUPA 3ENHA 4DGOA 4EOLA 3AD6A 2R3QA 2C6DA 4ASDA 3UIBA 4DEEA 3MESA 3ROCA 1RJBA 4KRCA 4YZDA 1OKVA 2HWOA 4I5HA 4NL0A 4TT7A 5IQHA 5HZNA 2I0HA 1PYEA 5JFSA 4FUXA 2XH5A 3P79A 4C62A 2VRXA 2PUNA 2GMXA 5HTBA 4IADA 2GS7A 4PF4A 2WMBA 2XEYA 3KF4A 4X3FA 4PY1A 4OBQA 2DUVA 2OH0E 3FY0A 4BR3A 3F3TA 3VRYA 2PE0A 2C6KA 4YNOA 4D4SA 4MNEA 4U40A 5HX8A 3LJ1A 3G2FA 5HGIA 2FGIA 3PRFA 2VTPA 4QTAA 3HA6A 2WTKC 3SKCA 3COMA 1UVRA 5KMNA 3EQGA 3HECA 1M52A 3N51A 4GIHA 4YLJA 4JNWA 4AOIA 3ORLA 4LG4A 3KQ7A 4I41A 4AF3A 3ALNA 4Q2AA 3BL9A 3HDNA 2Y4IB 3R7YA 4CZYB 4FEQA 3PXFA 5F9EA 4C3FA 4FL3A 5KBRA 5IA0A 3A7IA 3FZRA 3CSVA 2RL5A 2NNWB 4ALVA 4BDJA 4F1MA 4AXDA 2UW4A 3BYMA 5EH0A 1PXOA 2XNPA 3KXGA 2Y9QA 2OO8X 3CR0A 3HV3A 3NUXA 3SRVA 5IA1A 3ZUVA 4WNKA 3GB2A 4YJRA 5HVJA 4ZZOA 3MPTA 4HGLA 4LOQA 5I9WA 4LL5A 3CC6A 2YCQA 3FQHA 4YC6A 3WZDA 3VQHA 1Y6BA 3UTOA 2OXXA 2GNFA 2X7FA 4IDTA 3W2OA 4CQEA 3E8NA 4R78A 4FVRA 1SMHA 3ZS5A 3DJ7A 3R83A 1PXJA 3TM0A 2P3GX 3PVUA 1HCKA 1VLRA 1R1WA 4ZY5A 5DOSA 4MK0A 4HZSA 4B4LA 4D2RA 2EUFB 4ARKA 4DH7A 4JX3A 2RSVA 3UVRA 5CAUA 1OBGA 4F9CA 4ACGA 1H28A 2XEZA 3WYYA 2BROA 4DDGA 2VWVA 3P1AA 2R3RA 4FKVA 4MF0A 3AKKA 3NSZA 5C8MA 3QGYA 4KKEA 2ZOQA 3T3VA 3TUDA 3UOJA 4A9SA 4PTGA 5KHWA 3SGCA 1P2AA 2JDOA 2WMXA 1Q8ZA 2YA9A 1DS5A 3FLNC 5BVEA 4QP9A 1I09A 3KMUA 5HU9A 4KSPA 5EQYA 2E9OA 1QL6A 3HV6A 4NEUA 4P5QA 3ATTA 1APME 5HCZA 2ACXA 2HAKA 2JBPA 3ZC6A 3QZGA 5M55A 2GNHA 4IWDA 2VN9A 3MV5A 3SW4A 1JNKA 2G9XA 2FH9A 4TN6A 4KBCA 5FXRA 1BX6A 2C69A 3ZTXA 3ZXZA 4BWXA 4CZTA 2UW8A 4RLLA 3N9XA 3QTUA 4JT3A 3EZVA 5AUZA 3A4PA 4QP7A 4JDJA 5T68A 2QOBA 4BDHA 5CANA 5KNJA 2GPHA 2R3PA 2VNYA 2ZB0A 3SHEA 4LV5A 4QMLA 4JMQA 4Y72A 5IMXA 3OT3A 4ZTNA 4C4FA 5I3OA 2PVKA 2XF0A 3WBLA 4O81A 1UKIA 1UU9A 3MIYA 4BGHA 5HLNA 4PTCA 3VBQA 1UU3A 3II5A 3RM7A 1XH8A 3ORXA 3AC1A 3R04A 3LFSA 2RFNA 4I93A 5FQDC 1M2QA 2R3LA 2F49A 3HUBA 5HE0A 5KUPA 2VD5A 4K2RA 2OFUA 4JI9A 4PTEA 3SOAA 3PIYA 4Z7HA 3V8TA 2ZM3A 5L2SA 3KXMA 5AWMA 4XOZA 4NJ3A 5E1SA 3P4KA 4WSQA 3FSFA 2W5HA 4JJRA 3N4TA 5DYJA 4BYJA 4DBNA 2ONLC 2JGZA 2CDZA 5GZ8A 2ZV7A 3ODZX 2G2IA 4O0UA 3G0FA 4CFUA 3R9NA 3TV4A 2VWIA 4D4VA 5J8IA 2WEVA 3CLYA 3IG7A 4C8BA 3NNVA 3FC1X 1MQ4A 1YXSA 1YRPA 3D2IA 3AT4A 3OW3A 4F0GA 4R7HA 2IW8A 1XH7A 1JSUA 4O0VA 4DEHA 1WBWA 5AJQA 3DBQA 3LW0A 3GCQA 4ASZA 5I5ZA 5DT3A 4BDDA 3RK5A 5EI6A 4WIHA 3L8XA 4FV3A 3HV7A 2NP8A 3LIJA 5DHJA 5H8EA 3QUPA 3LXNA 3VUDA 4WO5A 2BRBA 5J95A 4AUAA 4D1SA 4WOVA 2XKCA 2QCSA 4BHNA 1H1QA 2E9UA 3GCPA 4V0GB 4D0WA 5AA8A 3NUAA 4XX9A 4F99A 3ZO4A 4HVSA 2IG7A 2PE2A 3W8QA 2R3JA 3I7BA 4FIIA 3I0QA 3VW6A 2H9VA 3NR9A 1DI9A 3QQGA 2YIXA 3ZEWA 4DINA 2VO0A 4ZK5A 4F9AA 2WOTA 4FE2A 3LFFA 4MBJA 4AN9A 3PP1A 1H4LA 2G01A 4U43A 3LCDA 3QXOA 3KRXA 4O0RA 4FJVA 5CXHA 4O7ZA 3FJQE 3DDQA 3SA0A 1OZ1A 4E73A 1H01A 3TKHA 2OLCA 4L52A 2R3KA 1WVYA 2YN8A 2XRUA 4E26A 4Z3VA 2I7QA 4MAOA 1R78A 2PMLX 3RK9A 4XH6A 3P08A 4FSTA 3E92A 4I0RA 3R73A 4FT9A 4YJVA 5TR6A 2BAQA 2X9FA 4QPMA 2R64A 3QTXA 5FBNC 3FMHA 1H27A 3VS7A 2BZKB 1YHWA 2NRYA 4RJ5A 5CNNA 3V5TA 4D2SA 4KABA 2GNGA 4EWQA 5EHOA 1DAWA 1FVVA 1WBOA 5BVKA 3UPZA 3ULIA 2B52A 4O84A 4QMSA 4RVLA 5EM8A 5IH5A 1F3MC 4YZNA 3V5LA 3H0YA 4AE6A 3BHYA 1K2PA 4ANLA 1ZYJA 1BL6A 4ZTLA 4FBXA 5FTOA 4USFA 4DCAA 2PVLA 4YSJA 3OHTA 1SVGA 3ZFYA 3QAME 4RWIA 5HICA 4NKSA 4IVAA 3RAWA 4G17A 5KE0A 5L2WA 4C4IA 2BR1A 4CLIA 4IM3A 4IM2A 4ANSA 4G1WA 1PXIA 4AT4A 3CP9A 2CCHA 2C5OA 3Q4ZA 3A7GA 5IF1A 4P5ZA 4UYAA 4R1VA 5KCVA 4M3QA 3ZBFA 1QPEA 3QYZA 4AA4A 4F6UA 2XALA 5HKMA 4CG9A 2GNJA 5FG8A 2C6MA 4FT5A 4X3FC 4K1BA 4L67A 1DI8A 1K9AA 4XOYA 5FP6A 3W0PA 5AP7A 3LM5A 1PHKA 5D9HA 4BHZA 4QEBA 1OPJA 3FQSA 1XH6A 5EOLA 2QQ7A 4DLJA 3MB7A 1OUYA 1VYZA 5ANKA 5K4IA 2ITVA 3COIA 5H8GA 3G9LX 5JN2A 1G8JA 1F5QA 1LPUA 3R21A 4ZTSA 3NZ0A 3HMNA 3ODYX 4PL5A 2DWBA 3QGWA 4MXYA 3DCVA 1Q8UA 5CSXA 4CQGA 2VGOA 4P90A 2Q0NA 5BX0A 5AIRA 3GGFA 4CLJA 4FX3A 2VAGA 2HY0A 5HI2A 3FYJX 3IKAA 5E8XA 5AR5A 5FTGA 2O64A 4HCUA 2JAMA 3A61A 3MA3A 4O2ZA 4YJUA 2BRGA 3R71A 3ZEPA 4F70A 5AX9A 1BUHA 2VZ6A 3TTIA 2BFXA 3NLBA 4ZZNA 1XMLA 3LJ0A 4CTCA 4ZMEA 1AQ1A 2X2MA 3GNIB 1MRYA 2YDJA 4E4LA 4FV5A 3UVPA 5A4CA 4RIYA 2WMQA 1REKA 3VAPA 4JG8A 5DMZA 3EQPA 2XM8A 3UO4A 4DGNA 2QG7A 3ZM4A 3NYNA 4U8ZA 4IDVA 5DR2A 3BCEA 4M8TA 2XKEA 3DQWA 4HYSA 4GT3A 3RCJA 3ZO3A 1URCA 4D2TA 1PMEA 3I4BA 2XK4A 3ELJA 2ZFYA 4ANOA 3PXZA 2HXLA 4NCTA 5M08A 4RX5A 3WF7A 3KA0A 1W84A 4UMUA 4FSMA 4FV1A 4FKJA 1FMOE 4RC3A 2GTNA 2X0QA 5AM6A 3TJDA 2YCRA 1WBVA 2WZJA 3HVCA 3A4OX 3FZ1A 3MSSA 4LMUA 4D55A 5KMMA 3VS2A 4FTLA 1H0WA 1FVRA 4RJ4A 3GCVA 3ZRMA 4IACA 5J1WA 2X0GA 1U4DA 1WBSA 3EJ1A 2GQGA 2XVDA 5EW8A 3PSCA 3ULZA 5LWMA 4HYHA 2FSOX 2Z7QA 4EJ7A 3QD2B 4D2WA 4WG4A 3V6RA 5I9VA 2H96A 4DE4A 3VUHA 4G5PA 2I0YA 3R8LA 1SVHA 4G16A 3VUIA 2BAKA 4L00A 3R7EA 4A9RA 2GHLA 3OCSA 4ZS0A 4QP3A 5IDNA 4D1ZA 2X8DA 2GHMA 3E64A 3NPCA 5EM6A 3I5NA 4NM3A 4BZDA 4CV9A 3LCTA 4DTKA 3ERKA 2ETMA 4JR3A 4I5PA 1U46A 4UWCA 5EYDA 4O7TA 3GQLA 3D7TB 4MTAA 5CSVA 4EYJA 4EI4A 5HO7A 3D7ZA 3UIUA 3OWJA 4S31A 2W1FA 3QRUA 4Q5EA 4FV2A 3QLFA 4AWIA 2NO3A 2XK6A 2YERA 5AADA 4FSRA 3OBJA 4IAAA 3V04A 3WIGA 4A4OA 4JAIA 1YKRA 4C02A 2OJGA 4XV3A 3VRZA 5DFPA 3ZH8A 2XYNA 1Q3DA 5EYMA 3HL7A 3O5AA 2RG5A 2XNOA 3DU8A 3QWKA 3ZZEA 4NU1A 4DEBA 3MW1A 2BMCA 4OAVB 4AW5A 5G6VA 4X6QC 3TACA 3W55A 4A4LA 3FEGA 4FNYA 5EYCA 1J3HA 4O1PA 2F7XE 4BFMA 4EOQA 4BJJA 4RWKA 5LWNA 4YJNA 2OJ9A 2IW9A 4E6DA 4TNDA 4C4JA 2PK9A 4FC0A 4DFXE 5C4KA 4TXCA 5B0XA 4EC8A 3B8RA 3RVGA 4U44A 3QA8A 3ZHPC 3EKKA 3QTIA 1XWSA 4D2VA 2Z02A 4FUYA 5L6PA 5DRBA 3WF8A 3CY2A 3Q5ZA 2QOHA 3FSKA 2RKUA 2OWBA 4IAYA 3Q52A 5LCKA 1YDTE 4MQ1A 4QMVA 4CCBA 4FTNA 3D83A 5IUIA 4RFMA 4DG0E 1YI3A 3C7QA 2VWXA 4XRJA 4CT1A 4QT1A 4DFNA 2ZMDA 3VWAA 3Q2JA 5EK7A 3A60A 3QKMA 4MVFA 3CXWA 4FG9A 3NNWA 5DT4A 2W06A 2ZYBA 4EK4A 2QKWB 5KZIA 1V0PA 3R1SA 4APCA 1T46A 4FT3A 2IW6A 2YM3A 4O4CA 5CF6A 3PWDA 3VVHA 4M84A 2V22A 3F3ZA 5BQ0A 1Q61A 4BJJB 3BYOA 3LLAA 3UOKA 2PUUA 3PDTA 1MRVA 4GFOA 3HV4A 5CU6A 3A99A 3W0RA 3GFWA 4F9WA 3BYVA 4ZSEA 5JEBA 4R3PA 3F5XA 3W2QA 4CV8A 2ZJWA 5A46A 3DTWA 2YWPA 4HVHA 1FOTA 4V05A 2CGVA 3F3VA 3A8WA 5LXMA 2CKOA 4MD7E 4O7VA 2R7BA 2GS2A 1YXTA 3EQDA 3R6XA 3LMHA 3BHVA 3HAVA 1OIUA 4QP6A 2YM4A 3NX8A 3HLLA 4DGGA 2VTJA 3EN4A 4WD5A 4W8DA 4IAIA 4BDIA 5J5TA 3NRMA 3FY2A 4AZSA 5JKGA 2W1CA 3W0OA 5CU2A 4R77A 4TTHB 4OTWA 5DWRA 5GJFA 3QQHA 2YAAA 5DN3A 4MNFA 3KVWA 2XBJA 4S32A 5EKOA 1A9UA 3TG1A 4HVGA 4HGTA 4DBXA 3HDMA 4ZJJA 5CWZA 4MXOA 3QLGA 5AV2A 1TZDA 1UU7A 4CVAA 2B9FA 4KKGA 3ZLXA 2Y6OA 2OIQA 5BVDA 3R7IA 3A7HA 4X2KA 3PP0A 4F09A 5C4LA 4YP8A 4GL9A 2B9JA 5JRSA 3ZCLA 1M2RA 2WTJA 2GNIA 4KAOA 2PZ5A 3ZLWA 3FMNA 2X8IA 5KKRC 1H1SA 1W2CA 3MPMA 4RX7A 4KIOA 4DDIA 4U3YA 1ZY5A 4YTCA 3UDZA 1OL7A 3PVBA 1OKZA 4N6ZA 4NJDA 4GK3A 4UB7A 3FE3A 4EH5A 1ZRZA 3P5KA 3F9NA 5KX8A 2WU7A 4PDOA 2VWUA 4FTIA 4QTCA 3QD4A 3SQQA 4DEIA 2H8HA 4IAFA 3GT8A 3BU3A 3NS9A 1XMMA 4AZFA 4KIQA 3MFSA 1GZKA 1MP8A 3NAXA 1OL5A 4JBVA 3QKLA 4G6LA 4BCIA 4A9YA 5J5SA 4AXAA 3QCQA 5CVHA 4AW0A 4IAZA 4NTSA 5E8YA 5I4NA 2C5XA 3VIDA 2X0PA 4BCPA 5IQDA 1W82A 1OGYA 1YXXA 4O22A 2WMAA 3FHRA 3C1XA 1YXUA 1IG1A 4D58A 3G6GA 1UNGA 5L3AA 3FZOA 3Q96A 4DFYA 4K0YA 3G15A 3DJ5A 3OMVA 5CAPA 3LCOA 4ACHA 5IEVA 2BHHA 2YIWA 2VWWA 2W17A 4FODA 2I0EA 4RIYB 5DEYA 3KFAA 3OY1A 3BWJA 4F64A 2ZMCA 3L8VA 3IQ7A 2XAOA 1Y8GA 1ZMVA 4EH8A 4L42A 1MRUA 1OIQA 1ZY4A 2EXMA 3V01A 5EQPA 3LQ8A 2OF4A 2X2LA 4S34A 5ETCA 1I44A 3MY5A 3W1FA 4EQMA 5IQFA 3R1NA 4ZSLA 1OKWA 4CFMA 4A06A 4C4EA 4XP3A 1UNHA 3PY0A 2B9IA 2FUMA 4M0YA 4H36A 4BF2A 1URWA 5FP5A 4Q9ZA 3QD3A 2P55A 3R7UA 5B2LA 4QO9A 3MN3A 4DHJA 3KY2A 3PPKA 2PY3A 3KGAA 5HEZA 3D5VA 4IB5A 3R8ZA 4BWPA 4O86A 3PUPA 3CE3A 2OF2A 2P2HA 5IEXA 2ITQA 3PJ3A 5CI7A 3V5PA 2BVAA 2J7TA 3K3JA 4GIIA 3ACKA 4NW5A 4BGGA 4EOOA 4QNAA 2UZOA 4CGAA 4HCTA 4CFWA 4GYIA 3QHRA 4OW8A 2W1HA 5HNBA 5JFWA 4WBBB 4QRCA 4CRLA 3AKJA 2IEWA 1FMKA 3B2WA 4G2FA 5HLWA 1F0QA 3F69A 3PA3A 4FKIA 3B2TA 1YHVA 3ZONA 3CPCA 3SDJA 3SVVA 4O0XA 5CXZA 4PDSA 3ORPA 2BHEA 4AACA 4II5A 5KMJA 2JFMA 4RJ7A 1YOLA 4PMPA 4UX9A 3NIEA 3QRIA 1Q8TA 3AKLA 4QMTA 4BRXA 1SNXA 4BDAA 5HBEA 2JDRA 2SRCA 3ROYA 3RJCA 1OKYA 3FDNA 4USEA 5ICPA 5L4QA 2UW7A 3WZJA 2F4JA 4FTTA 2VO3A 1OITA 4QPAA 4MKCA 3KN5A 3U4UA 3AXWA 5CF8A 3GU8A 4ACCA 4QTEA 1Q62A 3WE4A 4J97A 4L3LA 2DS1A 3QBNA 1KUTA 1JLUE 4NW6A 4KA3A 2R2PA 2ZV8A 3L9PA 1Q4LA 1GIHA 1ZYDA 4BBFA 2BIKB 2UW3A 4FTQA 4NM0A 2IZUA 3CPBA 4I24A 3F88A 5A6OA 1QPDA 1ATPE 1G8AA 3F61A 4YJPA 3MY1A 4FEXA 4CMTA 5LVOA 4F63A 1ST4A 3VW8A 5LMKA 4AT5A 3MFTA 2VO7A 4J99A 4IWOA 5H9BA 5HE3A 3WILA 5CSPA 3OCGA 2QO7A 4ZTQA 4CFXA 3NYOA 1ZMWA 5IUHA 4TWNA 2UVZA 3GOPA 3UGCA 5D12A 4BIBA 1GZOA 4O0SA 2LAVA 3S2PA 5J87A 4XJ0A 3UQFA 2QOIA 4FSQA 3E93A 3GU5A 4B0GA 4I94A 2JKMA 3G6HA 5KHXA 2AUHA 3TZ9A 4DH5A 1XR1A 2CHLA 3FXWA 4FOBA 4FTJA 3PXKA 4W4XA 5IH6A 1ZLTA 4ANBA 4D28A 3LVPA 4FZ7A 4ZXTA 4RVMA 3PLAE 1U5QA 1PMUA 5AP0A 1WAKA 3SV0A 3OXZA 4GRBA 2JFLA 3POZA 3OD6X 2XBAA 3PJ2A 1W8CA 1ZXEA 3R02A 4QMMA 4FV8A 4RG0A 5AR7A 3TTJA 4ZTRA 3OXTA 4QQCA 3AMAA 3R8MA 3QZIA 3NUYA 2UV2A 3LJ2A 3RNYA 3SRVB 5AV0A 3KC3A 3HMOA 5GZ9A 5EI2A 4AS0A 5EOBA 4EUTA 5LOHA 5DH3A 4TPTA 4F78A 4EONA 4UWYA 2YM5A 4I5CA 1TQMA 4X21A 2JKKA 3FLQA 2XJ0A 4X3JA 4FZAB 1IA9A 2C1AA 3TZ8A 1G5SA 4I21A 1FINA 3AC3A 1Z9XA 5E8TA 2NPQA 2EB2A 5CU0A 4W8EA 4NCTC 4FIFA 3IW5A 4QNYA 2A98A 3R7VA 2HW6A 2C3IB 5I9ZA 2R3NA 1ZWSA 4RBLA 3ACJA 3DBCA 5DRDA 4DGLC 3BE2A 3JY0A 4ID7A 2W96B 4HYUA 3KXHA 4YO4A 3NNXA 4YZBA 5IPJA 1OPKA 4JRVA 4FVPA 4QP1A 4Y8DA 4E5AX 1JVPP 4UXQA 2CCIA 4M69A 2ERKA 4KIPA 2XA4A 3S4QA 3VUMA 2V55A 4FTAA 3CQUA 3PY1A 2WMUA 4GW8A 4CFFA 4G6OA 5JZNA 3FHIA 5D10A 4G3DA 2WQEA 2XIYA 4EBWA 5HD4A 4FYOA 1PKDA 3CQEA 4EKLA 4FNZA 5E8VA 5AR4A 1UNLA 5FD2A 3GFEA 3QCSA 5KMKA 3IONA 3LXLA 3UE4A 2YAKA 3EN6A 3G5DA 4H1MA 4YGAA 4AZVA 5FTQA 4BI1A 4ZSJA 3NGAA 3R28A 3VO3A 2JKQA 3HGKA 2QD9A 3T3UA 3O8UA 2YFXA 3AC5A 5CASA 2OICA 3HNGA 1ST0A 5BYYA 4QYEA 3E62A 4QDVA 1XJDA 2WD1A 2O5KA 2YACA 4IFGA 1LR4A 4YMJA 4IMYA 4EBVA 4ONAA 4MWHA 4O0TA 5J79A 1PKGA 3SAYA 5CNOA 4F4PA 3I1AA 2CKEA 5TKDA 4LUEA 3KRJA 4R7BA 4GT4A 5ETFA 3F3WA 2WMSA 3BPRA 3LKMA 1YI4A 2Y0AA 2WQOA 4M69B 4QMQA 3F66A 2IO6A 1T45A 1K3AA 4H05A 4BKYA 4OAUC 5GJDA 4XLVA 3QCXA 4QYHA 4N6YA 5DA3A 2C5YA 1P5EA 3P0MA 4A4XA 1J1BA 4RT7A 3BKBA 4FEWA 3UYTA 4NK9A 3OTVA 2OH4A 2XIZA 2UZDA 4AU8A 5JZJA 3CD3A 3RCDA 3E7OA 4IX5A 4M12A 1TQPA 2PVNA 4YHFA 5M4UA 1A48A 3Q9ZA 2I40A 2GQSA 2QOQA 4Y83A 4EZ5A 2LGCA 3NNUA 2ITTA 2A1AB 2J90A 2W99B 4FTRA 4UMTA 3BBWA 4KS8A 4N0SA 3L9NA 3QUEA 3A2CA 4D5HA 2WXVA 2QO2A 3PLSA 4IVBA 4O2PA 3Q4UA 1DAYA 3OWKA 1PRYA 3R00A 5E91A 3GU6A 4RGJA 5GZAA 5HORA 3UNKA 2R0IA 3GUBA 3MPAA 3FLYA 2X39A 3F7ZA 1IAHA 4ORKA 4JG6A 1BKXA 2C0TA 1NVRA 3EL8A 4X2NA 3UDSA 2B55A 4J95A 1HCLA 2HWPA 4OBPA 3FKNA 4ZLZA 1UV5A 3KULA 3MI9A 4OTHA 4F7JA 4C58A 5M56A 5L2IA 2HOGA 2AYPA 2C5NA 3W0SA 3FMDA 2OFVA 3VBVA 4TYEA 3MIAA 3NUNA 4GFMA 2X7GA 3MTLA 5J9LA 2C6EA 1HOWA 3OUKA 2HZIA 2BDFA 3E8EA 1WZYA 2W7XA 3TV6A 4LDTA 3E3BX 4CKJA 2CNVA 3TZ7A 4FGRA 3BLQA 1OPLA 4RMZA 3TNPC 2C47A 4QQTA 4MXAA 5E4HA 1QPCA 5JQ8A 3SG9A 4C35A 3BWFA 3BEGA 4NM7A 4XUFA 4EK8A 4B9DA 4KB8A 5JGAA 4IWQA 4DFUA 3WARA 4BIEA 4O38A 2QOKA 2ZV2A 2YITA 4JOAA 5BYZA 4FSYA 5IA2A 3PE2A 5K0XA 1BI8A 4YJSA 4GS6A 3IS5A 4X2GA 2B4SB 4ZTHA 2QKRA 3ET7A 3UO6A 4G3GA 5CQWA 4EK5A 4O7YA 1YOMA 5F95A 1PXMA 5H2UA 4BN1A 3LFAA 4XBRA 5BPYA 3PZHA 1TQIA 4FI1A 2UZBA 3H9RA 3NUSA 2PMOX 2EU9A 5EM7A 1ZAOA 4K33A 3G0EA 3RPSA 2ITPA 1BYGA 3H9OA 4FG8A 2A4LA 4M67A 4U5JA 5DNRA 3THBA 2JIUA 3SXSA 5AV1A 3ZU7A 5CEOA 5AV4A 4GVJA 3MVMA 4AA5A 3V8WA 4I3ZA 3ZZWA 3VUTA 2Y4PA 2YHVA 4AP7A 2XMYA 2GQRA 4U41A 4BTMA 5FWKK 4NUSA 5JMSA 2REIA 4IZ5A 3W33A 1E1VA 2CPKE 4YPSA 2CMWA 2E9NA 4AOTA 4XG9A 5KMIA 3LQ3A 4PNIA 3AMBA 3BV2A 5A4EA 2JIIA 2ONLA 4C0TA 3W0NA 3QA0A 3DK6A 3WI6A 1ZZ2