1J3HA

Crystal structure of apoenzyme camp-dependent protein kinase catalytic subunit
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
342
structure length
329
Chain Sequence
GSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Dynamic Features of cAMP-dependent Protein Kinase Revealed by Apoenzyme Crystal Structure
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 88
structure length 329
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1j3hA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1j3hA02
2BHHA 5EM8A 4BDGA 2OI4X 2WTKB 4I6HA 5DEYA 2H9VA 2HXLA 4RC2A 5K5NA 3UIBA 3FLYA 3R7OA 4C38A 3WZKA 3GQIA 4B4LA 3LFEA 2DQ7X 2UZVA 4FOBA 3KCKA 3ERKA 3LLTA 3UGCA 3OWKA 4RIYA 5KZIA 3S2PA 2FH9A 1PYXA 3FZ1A 1Q41A 3NW5A 2HY81 2HCKA 4GUBA 4IFGA 4YJPA 5D11A 3VJOA 4MH7A 3ATTA 4DEDA 1OPJA 2WOUA 5EQPA 4IXPA 4H3QA 2GFSA 2W7XA 5EKOA 4A9YA 2EVAA 1OI9A 4M69A 4QQTA 5HORA 1ZZ2A 3EH9A 5JT2A 2DUVA 3B2WA 1ND4A 4C61A 3HAVA 4L44A 2BROA 2ACXA 3NAXA 4ONAA 1U59A 2ZOQA 3LJ1A 4MNEB 2H6DA 4DGNA 5JFSA 3LKMA 2WMTA 4QTEA 4FKTA 3A7HA 2WEIA 1TQMA 5DHJA 4CNHA 2QO9A 2XKFA 1A06A 4LQMA 2VO0A 4ASDA 4DGOA 5E8VA 5J9YA 3FPQA 3TG1A 5AX9A 1OUKA 2XUUA 2YCRA 1E1XA 1VZOA 2EXCX 3L8VA 4GU9A 3OW4A 1YVJA 4XV9A 4GRBA 1VYWA 2J0LA 4ZZMA 4I5PA 5TE0A 5KBQA 4IM2A 2C0TA 3WF5A 4WHZA 4U97A 1JBPE 3E93A 4FI1A 3D7TB 3OWLA 4FNZA 4ALUA 4F9WA 3VUGA 4LRJA 4TYGA 4F1OA 4OTDA 4B8LA 3V8TA 4OGRA 4G3FA 3EL8A 2UW8A 4K2RA 4OTIA 4AGCA 4FIGA 2CPKE 4FKRA 3UO4A 4FEUA 2VWYA 4RMZA 4Q9SA 3TXOA 2A1AB 3VUDA 3JYAA 4K6ZA 1W84A 5E9EA 3O7LB 4L8MA 3VS5A 5LVMA 3NUUA 4RVTA 1I09A 4II5A 1WBWA 2JDOA 3V51A 2PULA 3MTLA 4FODA 4DFZE 4RJ8A 4RFYA 3HRBA 5GNKA 4DLIA 1YHSA 2BVAA 2R3MA 3R01A 5J5TA 4IAKA 3V5JA 4DFBA 4TYJA 2REIA 4EJ7A 2O2UA 2J90A 4FZ6A 3UQGA 3LAUA 5L2QA 3AC8A 4O7SA 3L9LA 4Y95A 5D7VA 5ANGA 4RX7A 2PPQA 2OH0E 2J4ZA 5AAFA 4O38A 4BVUA 4BWKA 1BL7A 4TPTA 3ZCLA 2X9EA 2QLQA 1SMHA 2R3LA 2UW6A 1IA9A 3FI3A 3I6UA 4MTAA 4QMTA 5H9BA 4YZNA 3QTIA 4BGGA 3E8DA 4H39A 4U8ZA 4XYFA 4Q2AA 3S1HA 2BRBA 3PWDA 5AIRA 1B6CB 2GHMA 3QRUA 3KXGA 1SNUA 4UMUA 4R77A 2YZLA 3WZDA 4JG7A 4C62A 4C8BA 2A27A 2VO3A 5CXZA 4JG6A 3EQRA 4QMVA 4YTIA 5L8LA 3ZDIA 3FMKA 3T3UA 2F9GA 1Q24A 3EZVA 3MH1A 4IZYA 4LGHA 4BGHA 5BVFA 3C7QA 1OB3A 2YM8A 2QOQA 2XRWA 4IX5A 4EC8A 3ORZA 4CV9A 3DDPA 3F2AA 4FT0A 3B2TA 4KBCA 4ZJVA 3I5NA 1ZARA 3SV0A 3GU7A 5D9HA 4EOOA 2VAGA 1OGUA 4RFMA 5EQYA 4DTBA 2XBJA 3G5DA 4NM0A 4XOZA 4IB1A 3KY2A 4AT5A 3GXLA 1OIYA 3CTHA 3FJQE 4FT5A 4WD5A 4XP2A 1OKVA 2PMLX 3KRXA 5HG7A 4I21A 4I41A 3RHKA 2QOOA 1W98A 3BV2A 5DBXA 4WO5A 4YNEA 5G6VA 3ZLXA 1KE8A 1LP4A 3CTJA 4KRCA 4U9AA 4MXAA 5EM7A 4JQ7A 4XH6A 1W0XC 4ZTMA 2HW7A 3BGQA 5AP1A 5EI6A 1W7HA 4F70A 2YABA 4QNYA 5A3XA 3H0YA 2B55A 2YEXA 3VW8A 2XIXA 5J7HA 2ITQA 4DBXA 3EKKA 2IVTA 3IDCA 3Q4UA 4KKGA 2VX0A 5IQBA 2PZ5A 3ENMA 1Q61A 4MBJA 4YHJA 1ZYDA 2IO6A 3GENA 1KV2A 3A8XA 4HVDA 3F69A 4F9CA 3OCSA 2C3LA 4AAAA 3H10A 2YDIA 4GIIA 5CX9A 2OK1A 2QI8A 4C7TA 4A9TA 3D7ZA 2C47A 2C6IA 2R3IA 2C69A 3PRFA 5D7AA 3RTPA 5CF4A 4G3GA 4IAAA 4PY1A 4GYGA 5ETAA 5IQAA 4UB7A 3SG9A 1UNLA 2PVJA 3OCGA 3A2CA 3CGOA 3G6GA 3QTSA 5AM7A 4N57A 4DYMA 3OEZA 5KKRB 3E62A 4Y73A 2QOLA 2VX1A 2Z2WA 1ZLTA 2C6TA 3EQBA 3NPCA 4GK4A 1LEWA 3MB7A 3GC8A 5CAPA 3LXKA 4D0XA 2RG5A 2UZEA 4P7EA 5F4NA 3LFQA 4HJOA 1FOTA 3Q96A 4QRCA 4RA5A 2I7QA 3HUBA 4L45A 4JI9A 5CVFA 4FIIA 2W0JA 5L6PA 4O96A 1JSUA 4LV5A 3BEAA 4YPDA 3ZRMA 4DEAA 4D4RA 4AX8A 4ZEGA 2O64A 3FHRA 2GS2A 3QC4A 2OZAA 2UZBA 3IOPA 4OTPA 4QPMA 3FDNA 2JKQA 4G3DA 2BILB 2ITZA 2RFDA 4ASZA 2NPQA 4O91A 3PTGA 5CXHA 5FDXA 3W2SA 4EJNA 2E9OA 4L42A 4L46A 5IDNA 5C4KA 4C3FA 2Y6OA 2CCHA 4KIQA 2XZSA 4Y5HA 1Q8ZA 3PP0A 4JAIA 5HCYA 4PRJA 3TV7A 5IA0A 5LMAA 5DFPA 4F9AA 4TWPA 4O83A 5CVGA 4ANLA 4IX6A 5E8ZA 3SGCA 1YHVA 5BUIA 5ANEA 2OICA 4MD7E 4BCNA 2OXXA 3O0GA 3JPVA 5KX8A 1GJOA 5CZHA 1WBNA 2WKMA 4MQ2A 3VS4A 3PY3A 4FV6A 3Q5ZA 3O51A 2OO8X 3OOMA 2BCJA 2FGIA 3OBGA 1ERKA 2BZJA 3G33A 1PXPA 4ID7A 4QQJA 2PYWA 4IADA 3VO3A 2R7BA 4YC3A 4P5QA 4RJ3A 4I22A 1H07A 4DH7A 3SHEA 3P08A 5IMXA 3C0HA 2DS1A 3A7FA 3JVRA 2QOHA 4TNDA 5E91A 3MGYA 3FXZA 5AP4A 4X21A 5DI1A 5E8SA 5CY3A 3NUPA 3ETAA 2PSQA 2RGPA 1KE9A 5IG1A 2QC6A 2W17A 4O21A 4D0WA 4LGDA 3ZM9A 4AFEA 3IECA 2X39A 2JDRA 3FQSA 3LCOA 3MVJA 5EHOA 4BDIA 3NUSA 4FTTA 4PF4A 4QNAA 4GJ3A 2YDKA 3UC3A 4DEBA 4D9TA 3FLSA 5A54A 1NT2A 4FEXA 5B2LA 2W5HA 5EW3A 3ZC5A 4A9RA 5HTBA 3Q32A 1UV5A 4ZZNA 1JAMA 4NEUA 3V5PA 1H1WA 3RP9A 4UZHA 4DH8A 1IRKA 1M14A 2W06A 3MH2A 4NJDA 2HZ0A 2OF4A 2Y4IC 3DBDA 3VBYA 2E9UA 2PTKA 4YTFA 5CSPA 2NNWB 2VTOA 2W1FA 5DT0A 3BHUA 3PE1A 1GIHA 1KWPA 1MRVA 3ACJA 3NR9A 3UNZA 5HQ0A 2Y9QA 3LFSA 4XG3A 2WZJA 4KIKB 5GJGA 5ACBC 2OG8A 4NWMA 5A4LA 3Q04A 5CEKA 4Y5QA 3MFTA 2R64A 4HPUE 3N9XA 3O50A 3PJCA 4RJ6A 4TTHB 4ACCA 3ZBFA 4QP3A 4EORA 2RIOA 1H08A 1J3HA 4BDJA 5IA4A 1YWNA 4FIFA 3P9JA 2IW6A 4FTRA 4JVGA 3U87A 3RAHA 4F4PA 2C3JA 3CLYA 4FBXA 3FUPA 4YZCA 4QMNA 3UOKA 2AYPA 4UXLA 5DNRA 1AQ1A 1TKIA 2PMIA 4ANOA 4GIHA 5CU6A 3IONA 5CT7A 4DTKA 4X7QA 4IB5A 4OTQA 3R1QA 1E1VA 2WQBA 2A19B 4AW2A 3UOLA 4E5BA 4BZDA 4EOPA 3JY0A 4YZDA 5CU0A 4WNMA 5JEBA 3A7IA 4ZS4A 3JY9A 5J1VA 1ZMWA 3NEWA 3QQGA 5IA1A 2X7GA 1LR4A 1T45A 4N6YA 4XEYA 2XK9A 2X4ZA 3EN9A 1W8CA 3AD6A 4BZNA 4BF2A 1E9HA 1PXLA 1P4OA 2E9VA 3QTXA 5AP5A 1WCCA 2WMBA 3MPAA 4GFMA 4ITIA 4JDKA 4ZZOA 3FL4A 4GH2A 3PZHA 4D2RA 5BMSA 3CPCA 4AOJA 4GS6A 4YSMA 2P2IA 3NCGA 2IW9A 2ZMDA 3DOGA 5HIBA 3ROCA 3OT8A 3V8WA 3QX2A 1XWSA 4BKZA 3LXNA 2DWBA 4O6LA 2GU8A 4MXCA 2J50A 1K3AA 3DBCA 4FUXA 3WIKA 3RBWA 4CG8A 3QQLA 4MBLA 1PXMA 4YJNA 4F63A 5IF1A 4JDHA 3FI4A 5E1SA 3MJ1A 3LM5A 3L9MA 5IA3A 5TF9A 4HYSA 4RJ7A 3OXIA 3R63A 1YW2A 3PJ2A 3OMVA 4G6LA 4MAOA 4XG8A 3MVLA 3R9HA 1OM1A 4C2WA 4EEVA 5AADA 4IX3A 4YMJA 1F0QA 1P5EA 3HP5A 3P0MA 2BTSA 3ALOA 3R2YA 4B0GA 4PMPA 2CNUA 3OP5A 1SVGA 2C6KA 2WAJA 1YRPA 3E8NA 3EFWA 4I23A 3SKCA 1M2PA 2ZMCA 2XK4A 3OY3A 4CLIA 4Q9ZA 4KAOA 3FAAA 2IZSA 3ODYX 2WU6A 4PL3A 2ZM3A 3NX8A 3V5QA 5EQEA 4V0GB 4PL5A 4HNIA 1S9JA 3AC1A 4MVFA 4P5ZA 1Q8WA 4FZ7A 2CGUA 5LXMA 3U9CA 4A4LA 3AT3A 5ANJA 2UZNA 2YM6A 2XNBA 3UOJA 2WTVA 2XIYA 2JGZA 4EBWA 3G90X 4PP9A 3RM7A 1VEBA 1BKXA 2UW4A 4PUZA 2QOKA 5M08A 2O5KA 1H8FA 5H3QA 3ZS5A 4FUYA 2JDSA 5AV2A 1IAJA 4MKCA 3BGPA 4JQEA 4YJRA 3VBXA 4DE4A 3ZTXA 4A7CA 2BDFA 2J0JA 4C4HA 3EQDA 4NYEA 4O1OA 5KMOA 3E7OA 3NNWA 2VX3A 3COMA 2W1DA 2FUMA 2QOIA 3AD5A 4L9IA 3QUEA 3KQ7A 3AC4A 3R8UA 5CF6A 2X6EA 3PPKA 4DEHA 3FMMA 5LWNA 3TZ7A 4GKHA 1AD5A 2BZHB 3C4XA 4PDSA 3S3IA 3HYHA 2OIQA 4XRJA 2ZYBA 5CI7A 2Y8OA 3BI6A 5EOLA 4BCGA 4UMRA 1OL2A 2G15A 4BIBA 3R83A 3HMPA 4FV3A 5EW9A 2P2HA 5A4QA 2E2BA 4FICA 4CLJA 1KE6A 1O9UA 3G9LX 3I6WA 3QL8A 3UMXA 2BDWA 3KXHA 3ZFXA 4M7IA 2WFYA 4G9CA 5DT3A 4Q5EA 1KE7A 2YAKA 4IB0A 3WI6A 4OTFA 1SNXA 5IUGA 5M51A 4IAIA 5CT0A 3DJ6A 3QKLA 1J91A 1ZY4A 2OJJA 4X0MA 5HNGA 1RQQA 4OTRA 3I81A 2Q0BA 3UG2A 4PTEA 4UMQA 3NIEA 3HMIA 4N4SA 3H9OA 4U42A 3H4JA 2BFYA 3VS7A 1YXUA 4EH7A 4EC9A 4GYIA 4EH9A 2XJ0A 3PXFA 3W16A 5LMKA 4G2FA 4QP8A 5CAUA 4QP9A 4HGSA 1KOBA 2OXDA 2PMOX 2RF9A 5IUHA 4CTCA 1YDRE 2JIVA 2I0VA 2XIRA 4EOIA 2X7FA 3ULZA 3EIDA 4AWIA 3QQJA 3GCPA 1BX6A 3MH3A 4F7SA 4F1MA 1NW1A 4MXXA 4X3FA 3IGOA 1Y6AA 3EZRA 4LMNA 4ANNA 5IA2A 1J1CA 4FKQA 4G9RA 3FZRA 2XA4A 3C5UA 1M17A 3OOGA 4H58A 2HZ4A 5EDPA 3Q9YA 5FXQA 5CVHA 5J87A 3PLAE 4ERWA 2UZOA 1AGWA 4FKJA 3EWHA 4IJ9A 2OIBA 4YUQA 3PXQA 2R4BA 3Q60A 4BCKA 2JFLA 2G2HA 4WRSA 3FI8A 1P14A 4TN6A 4I6BA 3PG3A 4YTHA 2VN9A 4S34A 4D2PA 4C4JA 5BVOA 1YKRA 3VHKA 3HKOA 3MY1A 4IVDA 3ZYAA 2XNMA 4QP1A 2XF0A 3FSFA 4FV9A 2R3FA 2VGPA 3CQWA 3E3BX 3PG1A 4X2NA 3PP1A 4KBKA 4QYEA 5DR2A 2BIKB 3C4WA 2PVMA 3SXSA 5IH5A 2X8EA 4AUAA 4D4VA 4WT6A 1PY5A 3FMLA 3UG1A 1ZAOA 5KHXA 1Q5KA 3G2FA 2IZRA 5DR9A 5EG3A 3F66A 4RC3A 3LFBA 4BY9E 3W2CA 1TQIA 4C4EA 3GFEA 3F2RA 4MXYA 4DEEA 5CZIA 4D1XA 1DI8A 2IVVA 2FSOX 2QLUA 2YCSA 2Y4IB 2VTPA 2F7ZE 5AP7A 4CFNA 4FK6A 3W2PA 2PZIA 2QG7A 4LYNA 3N51A 4L01A 4ACHA 2UUEA 2BDJA 3VS1A 4G6NA 2ITWA 4PL4A 3LHJA 5LCKA 3UVRA 4IWOA 1YXXA 2OJ9A 3RWQA 4Z3VA 4P90A 4RVLA 3KU2A 4PPBA 5IQGA 2PMNX 5IQEA 4O27B 2XEZA 4BFMA 4U7ZA 2WIPA 4BB4A 3A4OX 3UQFA 5GJDA 4DCAA 5TT7A 1RW8A 4F0GA 4AA0A 2EU9A 3H30A 4ZY5A 4AP7A 4RVMA 4EYMA 2I40A 1G5SA 2J5EA 3UPZA 3RK7A 4IAZA 5AV3A 2YM5A 4KINA 4FA2A 3JR1A 1OVEA 3U6IA 2EB2A 1XH8A 3WZEA 4M12A 4JDIA 4FTNA 4PWNA 3BE2A 4FX3A 3NW7A 4FIJA 4QYFA 4TXCA 4FSRA 4YHTA 3UIMA 1LEZA 3W1FA 1IASA 1XH4A 4AZEA 2ESMA 2XNPA 3R8ZA 4D1ZA 2C5YA 4PNKA 4L43A 2J0MB 3TJCA 2ITUA 4YR8A 4QMSA 5AM6A 4UWYA 3HDNA 3EB0A 1QPDA 2YIQA 2B9JA 2YIYA 3QZFA 4TZRA 4HOKA 4O7TA 2FSTX 4NM7A 2WMUA 3VS6A 5I9VA 1R78A 4ZLOA 3QZIA 1FGIA 1U5QA 2XNEA 5E8XA 3ZUVA 2WTCA 3AT4A 3NNXA 4I94A 4CZUA 4MWHA 3VBWA 2B9FA 3ZO4A 5KMIA 3BLRA 3MBLA 4K9YA 3FLZA 5I9YA 2BRNA 3UODA 3B8RA 5AUWA 5JN2A 2WMXA 4R3CA 3BQCA 3SOAA 2GTNA 3KCFA 2Y7JA 4EOKA 5BUEA 4L3PA 2Z02A 3U55A 2YLFA 3KKVA 3NRMA 1V0OA 5CTPA 2IPXA 4AW5A 1K2PA 2QOCA 2WHBA 4FNWA 4CCBA 5C8KA 2J7TA 4O86A 4QQ5A 1UNHA 4NL0A 5CEQA 4GT3A 4NIFB 2GDOA 3WZUA 2HK5A 3EQIA 3RM6A 4O7WA 2XMYA 3LFDA 2IVSA 3EOCA 5L2SA 2YCFA 3KXNA 3V5LA 3CBLA 4FKLA 4A4XA 2VTSA 2X81A 3SRVA 3FMJA 4CKJA 5LVPA 3AMYA 4S32A 4O22A 2ZM4A 3R00A 5AJQA 2XIZA 4AW0A 4BCFA 5K0XA 2QU5A 4X6QC 3VHEA 3D4QA 3ORPA 4NTSA 5CSXA 3RJCA 1MRUA 3EQFA 4FSMA 3D94A 4DT9A 5L3AA 3AMBA 2ITTA 5J9LA 2FB8A 4BL1A 1FVTA 5IU2A 2X9FA 2YJSA 3E63A 5AUUA 2EXMA 4IC8A 5L6WL 4RIOA 3ZFMA 3KK8A 1TVOA 1PXJA 2C0OA 2OJGA 2WQNA 2XKCA 3KK9A 3VUKA 4YTCA 5JMSA 4BHZA 4E6DA 3CEKA 5JQ5A 4BTMA 3CCNA 1ZWSA 3DAJA 3AQVA 3GC9A 4FTQA 4BICA 3ZRKA 5IQCA 5TR6A 4ENYA 1NVRA 3DJ7A 2C1AA 3DNDA 4PTGA 5HKMA 4RZVA 4E6QA 4PV0A 2R9SA 2FYSA 3SOCA 4EK4A 3U51A 5HTCA 3VW6A 2J9MA 2H96A 2HXQA 3CKWA 3TKIA 2BUJA 3S95A 3FZTA 4W8DA 1ZYCA 2WMQA 2IZUA 4X2GA 2C6LA 4CZYB 2I0YA 2WMSA 3FPMA 3PXKA 5G1XA 4C58A 5CANA 4ALVA 2AC3A 2FSLX 2ZAZA 5F9EA 3V6RA 3RPRA 4KNBA 4QMYA 4RZWA 2QKWB 5I9UA 2ZJWA 5IPJA 3OUNB 4ACDA 3K54A 2C6DA 3Q9WA 4QQCA 5I0BA 3V04A 3NYNA 3KN6A 4EOMA 4CEGA 4ANBA 4LGGA 1H01A 4O7YA 3LXPA 3ALNA 2VUWA 4KS7A 2ZV2A 1BI8A 2X8DA 4O7VA 3NVKI 4IX4A 4O2PA 5A6NA 5ITAA 4MD8E 3UNJA 4CFFA 3R2BA 4R1YA 5CI6A 5DEWA 4GFOA 4CYIA 4F0FA 3SD0A 4MNFA 3UYSA 3ULIA 4UMPA 2YM4A 3IQ7A 3VVHA 1UKHA 4NH1A 3QTZA 4LL0A 3ZC6A 2GNHA 1UU8A 3HX4A 1KSWA 4O2ZA 4IJPA 2XJ1A 3PDTA 2CGWA 5AFVA 4F1TA 2CKEA 3TKUA 3R9RA 5T6KA 3O23A 4E4XA 1X8BA 3C50A 1WBOA 2PVKA 4ITHA 2PE2A 4DAWA 3C5IA 1WVWA 1YI3A 2VTLA 3LFNA 3Q2JA 5JFXA 1QMZA 4GUEA 4EK5A 5CEMA 1OBDA 1M7QA 3T9IA 1XJDA 1G3NA 3PXZA 4TWCA 4TYIA 2VU3A 3ZXZA 1JKTA 3MIAA 4D2VA 4GSBA 3KN5A 2V5QA 2QCSA 3RGFA 3QKMA 4LUEA 4OBOA 4QYYA 2PVYA 4TYHB 2VTMA 4GJ2A 4JRNA 5C8MA 3UMWA 4Z7GA 2V22A 2WTIA 4IBMA 4LOQA 1R3CA 1SM2A 1ZY5A 4NCTA 5FRIA 5B2MA 1UWHA 2A4LA 3ZSGA 2JDTA 1IR3A 4MK0A 4DGLC 3VRZA 2R0UA 3QXPA 3QALE 1PXNA 5CAOA 3MIYA 1PYEA 2YJRA 4FNYA 1LPUA 3VULA 4BDAA 4D2SA 4QMUA 3RCJA 4BDHA 2XCKA 4DG2E 4IM3A 1OBGA 2FVDA 4HCUA 3MFRA 2GQSA 4AZVA 2EWAA 4EZ5A 4GVAA 1YOJA 4AOTA 5HCXA 1JOWB 4FOCA 4NCTC 1MP8A 2UW0A 3R6XA 5HNBA 1W82A 4I20A 3R7IA 3I0OA 2X1NA 4FL1A 4YLJA 3S0OA 1Q3DA 1V0BA 4UXQA 4RRVA 3FKLA 5AV0A 3Q9ZA 3GC0A 4QMZA 4DA5A 3BELA 2YA9A 3VBQA 4RBLA 2BFXA 2XNNA 4FV4A 5I4NA 3CC6A 2VV9A 5DA3A 4C59A 4BYIA 4JG8A 3JXWA 4Y83A 3ATSA 3DZQA 2YFXA 1PHKA 4UZDA 4QMLA 4M68A 2JBPA 5TOZA 4EH3A 4Z16A 4Q5HA 3UYTA 3GU8A 1IA8A 3TZ9A 3PXYA 2CN5A 2YAAA 3DPKA 5FDPA 3IW4A 4R1VA 4ASEA 4QPAA 3NLBA 4GU6A 4BTJA 4CV8A 1CM8A 3DK6A 4UBAA 5HE2A 3UO6A 5JFWA 3GGFA 3QQFA 3G15A 3EKNA 4OTWA 3VS3A 3QCSA 2A2AA 2BZKB 4JLCA 2R7IA 4I0TA 3BHYA 5AA8A 2CHLA 3PXRA 3Q2MA 5EW8A 3MJ2A 2WELA 2PWLA 3MB6A 3PVBA 4IVAA 3B8QA 5HHWA 1XQZA 1FQ1B 2PVNA 3I0QA 4J1RA 1YI4A 4O0TA 5AUVA 1V1KA 4PMMA 5HESA 1UVRA 3I1AA 4LV8A 4ZS0A 4GCJA 4WNOA 4O0YA 2EB3A 3ZO3A 4D28A 4A9SA 4ANMA 4DINA 2EXEA 3NZ0A 4YPSA 2XYUA 2PZRA 5FM3A 5HLNA 5E7RA 5M4FA 4XMOA 4WSYA 5D10A 2CKOA 5AAEA 4WNKA 3VWAA 4XV1A 3QTQA 2JIUA 4EZ3A 4PDPA 4CMOA 4AZTA 4E5WA 4EH2A 3POOA 5BVWA 3RPSA 4FKIA 4AS0A 1MRYA 1ZYSA 4WBBB 5H2UA 4FEQA 3DQWA 3RNYA 5J5SA 3FEGA 3BRBA 3UVPA 4I93A 3MS9A 2YLEA 2XVDA 3ODZX 4Y85A 4CFMA 3PJ3A 3QTUA 3WF7A 3PJ1A 3UO5A 3K3JA 2VRXA 3UP7A 3LIJA 5D41A 4ZTSA 4E4NA 3E88A 2PU8A 2VWBA 5DIAA 4BC6A 3VBTA 1PKGA 1HCKA 3M42A 3EN5A 4DCEA 3D2IA 5A14A 2X4FA 1GZKA 2C4GA 4DFLA 2YITA 4G16A 4K0YA 1FMOE 5DGZA 2RFSA 4I6FA 4I3ZA 3NVMB 2GNFA 4RIXA 3ZO2A 3ZUTA 1M7NA 4OR5A 4O82A 2PL0A 3ANRA 2QOBA 4NTTA 4OLIA 5HVJA 1OITA 3SXRA 4KIOA 3H9RA 2XCHA 4W9WA 3FXWA 2XS0A 3KMMA 3LM0A 1Q4LA 2WGJA 4YURA 5IDPA 3R1YA 5BVDA 3Q53A 2ETMA 3U4WA 4H1JA 2WEVA 4FT3A 4DGMA 1R0EA 3F61A 2Z7QA 2RKUA 3PUPA 3WYYA 2PUPA 5JKGA 3FYKX 4M3QA 4FKSA 1DI9A 3SQQA 4G31A 2OJIA 5IMEA 2Y4PA 1OIUA 2WTJA 3G6HA 3BYMA 5FP6A 2F4JA 4NT4A 3LCKA 4X2JA 3QD3A 3CR0A 1ZMUA 3KULA 4EK3A 3QCQA 2RFEA 4K11A 3ZLYA 2QR8A 5AUXA 3QD4A 5M55A 2XB7A 4JOAA 4U45A 3QGYA 1UU7A 5GINE 2X2KA 4AE9A 2Z7RA 1DS5A 1CDKA 3QUPA 4ENXA 2R3PA 4F0IA 4GVJA 4IE9A 3FL5A 4ZOGA 3AT2A 5C27A 3THBA 3ZZEA 2GNGA 5CSWA 4J7BA 3KVWA 5FG8A 5AUTA 4ORKA 3F2NA 4BCJA 2GNIA 5EHLA 4OAVB 4YC6A 3ZU7A 5HO6A 4IFCA 5EYKA 4RIYB 2XP2A 3BYOA 3KXZA 3R1SA 4FKOA 4M14A 5A46A 5HTIA 3VF8A 1G8AA 4UN0C 1WMKA 1OKWA 2C5OA 4RIWA 3VQHA 5HNIX 4F99A 1H4LA 3PSBA 5HLWA 3L1SA 3R7GA 5HI2A 1H0WA 3HVCA 4O7RA 1OPKA 3HV6A 4G34A 4ITJA 4I5HA 4EOSA 4L3JA 1VJYA 2YCQA 3RMFA 4M69B 3F3TA 3NUXA 4E1ZA 4QT1A 3FKNA 2CKPA 2J6MA 2X2MA 3LFAA 4D9UA 3FI2A 4FVQA 4FTUA 4YLLA 3D9VA 2CDZA 2LGCA 3OXTA 4E6AA 3KFAA 3PPZA 3NNVA 5JRQA 3PSDA 4OUCA 4DHFA 2HELA 3R1NA 3QX4A 3E5AA 2OW3A 3RVGA 3VJNA 2XJ2A 1OL5A 5EDRA 5FBNC 4DFYA 4P2KA 4E3CA 5LCJA 5IQIA 3M1SA 2JAVA 4XP3A 2W1CA 2Y6MA 3A61A 5E92A 4FL2A 3GQLA 4FG8A 5H8GA 4ANSA 1BYGA 5CSVA 3FC1X 4LG4A 2B1PA 1WVXA 3QF9A 4I1ZA 2ITOA 3MFUA 2O8YA 4DLJA 4GK3A 4W4YA 2YISA 3QD2B 4RG0A 3IOKA 4G3CA 3NYOA 3PZEA 5HCZA 2CNVA 4CVAA 4P4CA 5AP0A 1Q8TA 1QPCA 1Y8GA 5JGBA 3Q4TA 3VS0A 3W33A 3GFWA 5ANOA 3WF8A 4JJRA 3R7UA 2UZUE 4EKLA 3ID6C 3IW6A 5L8JA 5M4IA 3HUCA 1YOMA 3OWPA 1FVVA 3RCDA 3PA3A 3QLFA 3BQRA 2VTRA 4IZAA 4NZWB 3VIDA 3C0GA 5CEPA 3TACA 2JEDA 4RWJA 2A0CX 2W5AA 3BU5A 3NUYA 1XH7A 3JS2A 3V6SA 2ERZE 2O3PA 1V0PA 3F5PA 5FM2A 5C9CA 3IG7A 1WBSA 3G0FA 4LRKA 4NKSA 2R3HA 2VWUA 5IA5A 2C30A 3CKXA 4JR3A 3TUBA 2JKOA 1OL7A 4C37A 1CKIA 2XNGA 3HV3A 5E4HA 3LXLA 3EFKA 2BRGA 3C4ZA 2ITPA 4UYNA 5HVKA 2C6MA 3UIXA 3QXOA 4WG3A 4V01A 3DKFA 5LARA 4FTMA 4ZTHA 5E1EA 2ZM1A 2BRHA 3ORIA 4XBRA 2JITA 4PNIA 2J51A 3DK7A 4FV8A 3MN3A 2ZV9A 4MBIA 3TNWA 3VAPA 4FSWA 1J7LA 1IAHA 3DKOA 4J95A 4JX3A 5E8UA 5FP5A 1HOWA 3DTWA 3BU6A 3FC2A 1H25A 3PE2A 3LMIA 2XK8A 5ETCA 4R3RA 3RALA 3R8MA 4BBEA 5EDQA 2OFVA 4EH6A 2B54A 3F82A 5A4TA 4DG0E 5CU2A 4O0XA 2XM8A 1REKA 5FXRA 1STCE 5EKNA 4FTKA 4MF1A 4A06A 1OZ1A 3LQ3A 3LLAA 5FTGA 4EWHA 5H8EA 3CY2A 3NS9A 3U4UA 3E8EA 3QRIA 4TKSA 4ALWA 3D2KA 3EQGA 4BCPA 1DM2A 4HZRA 2QO2A 4NFMA 5CS6A 4AN3A 3D0EA 4EONA 4WG4A 4L7FA 5KUPA 4GT4A 4KKEA 4HYHA 3DBFA 5ANIA 4PMSA 4ZIMA 3ZLWA 1FBNA 2W96B 4A9UA 1DAWA 1H27A 3Q5IA 4BDFA 4DFUA 3EN6A 3P7AA 3TL8A 2CKQA 3IK3A 1IG1A 1XH9A 3CD8A 4FSNA 3IO7A 4J98A 1YWRA 5HOAA 2UW9A 5A4CA 2GTMA 5C1QB 3QYZA 2PZPA 3PVGA 2XEYA 4IAFA 5DG5A 4X6RA 4YBKA 2WMWA 2BAKA 4GK2A 2W05A 4O0SA 4HZSA 5J79A 2R3RA 4ZXTA 5T3QA 3L8SA 3UE4A 4QP6A 1JVPP 2CGXA 3EJ1A 4GG7A 4IAYA 2IW8A 3W2OA 4AA4A 4CT2A 4FSQA 2HENA 3LFFA 5FEDA 3PFQA 3ZXTA 2I1MA 2WO6A 3DAEA 4I4EA 3IDBA 4MNEA 3T8OA 1NVQA 2HAKA 2B52A 2YWPA 3CJGA 2W4OA 3RZBA 2WTWA 2UVYA 5I9ZA 5M4UA 2YIRA 3C51A 4MYGA 1PW2A 2CSNA 3MH0A 3PIXA 5M06A 1Q3WA 3F5GA 2VTTA 4DFXE 4OAUC 4ZSJA 5CASA 4IHPA 2GS7A 3NUNA 2OF2A 2J2IB 3VNTA 3WBLA 5A9UA 3A99A 3OVVA 4O0VA 3GOPA 4PMTA 4R5YA 4QTAA 5BVKA 2ONLA 4R7HA 3GT8A 3G9NA 5DVRA 3SDJA 3SA0A 4LM5A 4YNOA 2OSCA 3D7TA 3DFCB 4FSZA 1K9AA 4C36A 3PLSA 3CY3A 2KULA 3R9DA 3MA6A 3SW7A 1UU3A 4NSTA 5EYDA 3MPTA 5F94A 2PUUA 2R0IA 4D4YA 3R8LA 2CLQA 5ETFA 4M67A 2JKMA 5KZ0A 3ORKA 4J99A 1VYZA 1JKLA 3LVPA 4FVRA 4RJ4A 5BX0A 5JFVA 2IG7A 5IQHA 4WOVA 3GUBA 2OBJA 3ROYA 5EYMA 5AWMA 5I5ZA 5JZNA 3P86A 2F57A 3DGKA 4NUSA 3ORNA 2GHLA 2CMWA 3VBVA 5HE1A 2XYNA 4PPCA 4CKIA 2ONLC 4ZJIA 3QD0A 5JZJA 1FGKA 5L6OA 1T46A 3P7CA 1FMKA 3I60A 2I6LA 4HNFA 1QCFA 2VNYA 4ARKA 1WAKA 2OZAB 4X2FA 5HD7A 3QTRA 3OHTA 2XK3A 2ZVAA 4BDBA 3BPRA 4YBJA 5LVOA 2H8HA 4CGAA 4C4IA 4BI0A 5DLSA 4GKIA 2WMAA 4I24A 3DU8A 5HG9A 5CLPA 4BCHA 3NUAA 3Q9XA 3SG8A 2WMRA 3NYXA 3O17A 4J71A 5E8YA 4BWPA 4BYJA 1YXVA 5LMKC 2Q83A 3P7BA 3MPMA 4ZTQA 5EOBA 2OJFE 4KUJA 5DRBA 5HICA 1U5RA 5BMMA 5JGAA 1I44A 1Y57A 3VS2A 4AN9A 1KUTA 1H26A 2XK6A 4A4OA 3O8PA 5KMMA 3DBEA 4S33A 4OTGA 4X3JA 1PJKA 5ACKA 3FKOA 3U8WA 4CMUA 4DN5A 4F9BA 4X3FC 1OL6A 4QPSA 3IW7A 3WF9A 4TY1A 1JNKA 3LQ8A 4S30A 4ZMFA 3LCTA 4D2WA 3TNQB 3PSCA 3PA4A 3DTCA 3HV4A 3UDBA 5M4CA 3AC3A 4BR3A 5EM5A 5GJFA 3F5UA 3A62A 3OCTA 4KD1A 3QQHA 2NP8A 3GCUA 3R8VA 4AOIA 5KBRA 3DDQA 3R9NA 4EHGA 2NRYA 4IEBA 2FO0A 3FE3A 4F6WA 5JQ8A 3DA6A 3RHXA 5AAGA 4JBOA 3AXWA 1CTPE 4U40A 3BYSA 3QCXA 3R21A 4G5JA 4L67A 3ZRLA 4W9XA 1M2QA 3E64A 3NDMA 3FMHA 3DFAA 2PE1A 2P3GX 2YN8A 4DGGA 2C0IA 5CU3A 4FV1A 4XJ0A 3GOKA 3PVWA 3EYHA 3MY0A 3ORLA 1NVSA 3P79A 2XKDA 4IANA 3F3WA 4XS2A 4XV2A 4YZ9A 4RVKA 2ETRA 3DKGA 3R0TA 1PMEA 3P78A 5FWKK 4BDEA 1U46A 4BBMA 3TDWA 1Z5MA 2OGVA 2WPAA 5T68A 4LUDA 4UWBA 2GSFA 2UZDA 5D1JA 2IVUA 4D5HA 3V01A 2R5TA 3WILA 1GZ8A 5KCVA 3PIZA 4FG9A 5LJJA 4JT3A 3PPJA 1NA7A 2W4KA 4IWDA 3R71A 4JR7A 4C4FA 1ZYLA 1W83A 4IW0A 4ANQA 3QTWA 4JL9A 4JDJA 3RK5A 1U54B 3QRKA 4HGTA 3TZMA 3ZHPC 3LMHA 4CRLA 4W4VA 5HIEA 4F09A 1PMVA 2C6OA 3NIZA 2W1HA 4DH5A 5EYCA 5HIDA 3TZ8A 3L8XA 4G17A 4DEIA 4F6UA 1NY3A 2IN6A 4L7SA 2CN8A 2PUIA 1H1PA 4FSTA 2B7AA 5J7BA 3ZH8A 3ZONA 2RFNA 3BIZA 3UPXA 3WF6A 5K5XA 4LMUA 2V62A 4OT5A 2YWVA 4FZDB 5D12A 1B39A 4PX6A 4ZY6A 1SVEA 4K33A 4MX9A 4UYAA 2Y0AA 4OBPA 4QMXA 4Z7HA 5I9WA 3PRIA 2Z60A 3HMNA 4YU2A 3EFLA 3I7CA 4FV2A 1RE8A 1XHAA 5HBEA 2HZNA 4E26A 3BGZA 1H00A 5HBHA 2Z7LA 3DAKA 2F7EE 4YJUA 4TL0A 4WIHA 2J0IA 5I3RA 4MXOA 1Y6BA 3AMAA 4OT6A 4XLVA 4E6CA 4E7WA 2X0GA 3K5VA 4O7ZA 4LRMA 1P4FA 3RPVA 5ANDA 5CF5A 2FA2A 1Y8YA 4JAJA 2YM3A 3LMGA 4U0IA 3PVUA 4EYJA 1GZOA 2XNOA 2QODA 2R3JA 3BWJA 3E87A 4KRDA 5JSMA 2VWZA 4DF3A 3CP9A 2YIXA 4O6EA 4LL5A 5AR8A 2GFCA 2RG6A 3GC7A 2HIWA 2BIYA 5KKRC 3UQCA 2G2IA 3KRRA 4J53A 2YZAA 5DPVA 5CQWA 4O0UA 2ZV8A 3TNHA 5HX8A 2F2UA 3II5A 4IQ6A 3KB7A 1REJA 5FTOA 4R8QA 3UP2A 4FTJA 2RSVA 4ZTLA 4RX5A 3FLNC 3NYVA 3H9FA 4E4MA 3FV8A 4QMQA 4PP7A 2R3NA 2QD9A 4F65A 3BHVA 4GL9A 4FTOA 4ZLZA 3EL7A 3HDMA 3FLWA 3SC1A 3TCPA 3MWUA 3TEIA 5HLPA 4DG3E 3ZM4A 3D14A 3QAME 1Z9XA 4XG9A 2UW7A 4RJ5A 1ZMVA 2HZIA 3FQEA 3IPHA 4DH1A 4KB8A 3OW3A 3DXNA 3EQHA 4GMYA 4AU8A 3PJ8A 3V3VA 3ZEWA 1CMKE 5GZ8A 4ACGA 3GU6A 4CQGA 3S4QA 2OU7A 2NO3A 2ZB0A 3Q4ZA 4XRLA 4E93A 4R78A 2UW5A 1RDQE 3UNKA 5CSHA 2VTNA 4O7NA 2WQEA 5CU4A 5B7VA 3RPOA 4TWNA 4IH8A 1YWVA 4E73A 4QO9A 2VNWA 5BUJA 5IEYA 1MQ4A 2BPMA 4FKWA 1GOLA 2BMCA 1OMWA 2QVSE 4S2ZA 3V8SA 2R3OA 1XO2B 3IS5A 3R04A 2C68A 4AN2A 5K4IA 2Z7SA 1IEPA 2ETKA 4DH3A 2V0DA 3OFMA 5DN3A 5HBJA 3R7VA 3ORMA 4BTFA 3BX5A 3QRTA 4QMMA 3ZMMA 3LJ2A 2PVFA 3VN9A 4NJ3A 5AA9A 4FTCA 1PKDA 3DLZA 3KRLA 4AFJA 3HA6A 1JKSA 1A9UA 5EM6A 3E7VA 3AC2A 3QA0A 2XRUA 1YDSE 1OECA 3DBQA 4EWQA 4O84A 5M07A 3OZ6A 2VTQA 3HZTA 2VD5A 3DY7A 1XH5A 4GG5A 4EQMA 4G1WA 2VO6A 4APPA 2JDVA 1FPUA 3PY1A 3QWJA 4FGBA 1XH6A 2V7OA 4I0SA 2B9HA 1CSNA 4YJOA 4BIDA 4CTBA 3BLHA 3FSKA 4KIKA 4UMTA 3VRYA 3IW5A 3JUHA 5B0XA 3TTJA 4U6RA 3FHIA 3OXZA 4BHNA 5KMKA 4O7LA 4Y72A 4U41A 1WBVA 1PXOA 3QCYA 3TV6A 4EHEA 4EQUA 2I0EA 5A6OA 5CF8A 2SRCA 3SXFA 2JFMA 4C3RA 3AC5A 4EH5A 3FZPA 4IMYA 3PWYA 4XG2A 5DE2A 5IQFA 4BDKA 2HW6A 4EHVA 2P4IA 3EYGA 3QQKA 5BVNA 2JC6A 4R6VA 2O0UA 4HYIA 3Q4CA 4CFWA 2UZWE 3POZA 5LQFA 5K0KA 2PVHA 4D5KA 5L2TA 3OF0A 3KREA 1Q99A 4QOXA 4RSSA 3ITZA 3QLGA 4I5CA 4JBPA 4D58A 4WKQA 3MY5A 3QFVA 3E92A 3LCSA 4BTKA 2GMXA 5IKWA 3DB6A 3RNIA 3VC4A 4ZSEA 1URWA 3CS9A 3H3CA 3ZDUA 5CEOA 4UEUA 2X7OA 4DEGA 4I5MA 4L3LA 4FE2A 3AG9A 3CXWA 3R73A 3Q3BA 4QP7A 1HCLA 3L8PA 4K77A 4X3FB 4TWOA 5DH3A 1A48A 3HAMA 5BQ0A 3DCVA 2WQMA 3BBTB 2X8IA 3U9NA 2UV2A 3Q6WA 3PIYA 3W32A 3MFSA 2VTIA 3ZZWA 2WOTA 4EBVA 3WYXA 2HY0A 1H0VA 1NXKA 3A4PA 3RAKA 1OKZA 4C3PA 2XKEA 3TDVA 4V05A 4MF0A 2PVLA 3OG7A 2HWOA 3IDPA 4PDYA 2JD5A 1UWJA 2Q0NA 4XLIA 1WVYA 2P0CA 4EI4A 3QC9A 4MCVA 3GCQA 5DR6A 2VWVA 3V5TA 5DYJA 4GV1A 3GCSA 3GCVA 4CD0A 5M44A 4YO6A 4DITA 4XX9A 4O0WA 3F9NA 2C5VA 4BI2A 5M57A 2W1GA 3UOHA 4BIEA 3GU5A 4ZSAA 4LOOA 1CKPA 3ANQA 1F3MC 3DXQA 4K1BA 3EQCA 3EN4A 3ET7A 4IDTA 5M53A 3QYWA 3MTFA 4NFNA 4XG4A 4BGQA 4BN1A 5IISA 4M0ZA 3TUCA 4HGLA 4JIAA 3UZTA 3BE9A 2OIDA 1BMKA 3LZBA 4M84A 4V0GA 4AXAA 2R3QA 3FMDA 4W4WA 4EHZA 1JSTA 4AF3A 3OTUA 5AR4A 4B8MA 5C8NA 4YJTA 3W10A 4CZTA 1JWHA 4KA3A 2C6EA 2C5XA 2BRMA 5BYLA 3R30A 4NM3A 2W4JA 5TKDA 2VTJA 5IUIA 4FEVA 2VTHA 3OY1A 2B0QA 1QPJA 5IH4A 4RFZA 3NGAA 4ZAUA 3VF9A 1YI6A 2LAVA 4QD6A 2QOFA 1ZOEA 4PQNA 4U79A 4TRLA 3CIKA 3GVUA 1XBAA 3P23A 4L52A 5L2WA 4BBFA 2AUHA 3UIUA 3HMMA 3EFJA 3DZOA 4AZSA 4CXAA 4U81A 4BCQA 4NW5A 1XBCA 1OL1A 4GT5A 4USEA 2BALA 2VWIA 3R7YA 4F64A 3CGFA 4W8EA 3T3VA 3EN7A 2HYYA 2W1EA 3HGKA 4FSYA 4FVPA 5HU3A 3LE6A 3NSZA 1KOAA 4Z55A 1JKKA 4JBQA 4IWQA 3SX9A 3CQUA 3AOXA 5L4QA 4F7LA 1H1QA 2J5FA 5HZNA 4M66A 4YJVA 2BZIB 1XR1A 3KGAA 4C35A 3FZOA 3NW6A 4HGEA 1KV1A 2GCDA 4O0RA 4BCIA 3C4CA 1GIJA 4N6ZA 3MVHA 5CENA 1R0PA 4OTHA 5J8IA 3FYJX 4WA9A 5FBOA 2W5BA 3UTOA 4XNEA 4FT9A 4EK8A 5HO7A 3C1XA 2OZOA 3W2QA 3P4KA 3QZHA 4YC8A 3LJ0A 5E8WA 5BYYA 4HCTA 3KL8A 3ZSIA 4AT4A 2BHEA 4NU1A 1J1BA 2PY3A 4F6SA 3N4VA 3QQUA 4QYHA 2WU7A 3GNIB 2QURA 1PXKA 4JS8A 4EL9A 3A7GA 2P55A 3VUHA 1O6LA 3E8CA 4F08A 2B53A 1PXIA 1WBTA 2OWBA 1OIQA 3ORTA 2ZDTA 4H05A 1R1WA 3QRJA 4AACA 3P5KA 3CTQA 3TI1A 4C0TA 3LFCA 1P2AA 4G5PA 3F3VA 3UJGA 3CD3A 5ICPA 2VZ6A 3NAYA 5CNNA 2GNLA 4X2KA 5LMBA 4AT3A 4UWCA 4FC0A 4IVBA 4PPAA 4RX9A 3KXMA 2J0KA 2IZTA 2JKKA 5KNJA 4FGRA 4ZTRA 5FD2A 2V7AA 5K3YA 4IZ5A 2C3IB 3F7ZA 4EZ7A 2YDJA 3SRVB 5CQUA 5F95A 3G51A 4YZMA 3ZO1A 4EQCA 5KHWA 5FGKA 1OKYA 4QTDA 1L8TA 1EH4A 2OKRA 4C4GA 4IVCA 3GBZA 4HCVA 3Q52A 3QHWA 2WIHA 4TW9A 4C57A 2PE0A 3Q6UA 5C01A 3S00A 4YJSA 4YLKA 4CFVA 2ZDUA 3ACKA 3BKBA 4CCUA 3BCEA 2Z8CA 2UZTA 5FLFA 1BL6A 3FWQA 2QO7A 1OPLA 3OBJA 4R7BA 1QL6A 3D83A 5IEXA 3C4EA 4LOPA 3U6HA 3TIZA 4B7TA 4FV0A 5C26A 4AG8A 4AZFA 5HVYA 3UC4A 5BNJA 3TNIA 4AZWA 4MHAA 3P1AA 2O63A 4F7NA 2UVZA 2V55A 2XK7A 3QKKA 4RLLA 4FIEA 4OBQA 3N4UA 4TNBA 4UY9A 4JRVA 5I3OA 3WOWA 4KABA 1OUYA 3KC3A 4AGDA 4QMWA 5FXSA 1JQHA 3MYGA 3C0IA 4AW1A 3DKCA 2WB8A 2VTAA 4MD9E 2NRUA 3RK9A 4BCMA 3OCBA 3DNEA 5AR5A 2CCIA 3RINA 3UBDA 4BKJA 4I92A 4KSPA 4KBAA 3HRCA 5DOSA 2YHVA 3HP2A 1Q97A 3GP0A 5DT4A 5HX6A 5BYZA 3MESA 3TIYA 4O1PA 1WFCA 3KVXA 2UVXA 4C2VA 1YXTA 2UZLA 3HNGA 4Z9LA 3MSSA 3R28A 4H1MA 3W18A 3W2RA 3CQEA 5FEQA 4EUUA 4D2TA 2JLDA 3R02A 4O81A 3TT0A 4MQ1A 1PF8A 3N4TA 3U54A 4GW8A 5L2IA 3OWJA 4E8AA 2GQRA 3RKBA 1R39A 4QTBA 1F5QA 4K8AA 1YQJA 3BWFA 4FZAB 5E90A 1U54A 3HL7A 5EK7A 4RGJA 4D55A 4FR4A 4EK6A 3HLLA 3O8UA 3PA5A 3HV5A 5IQDA 2XH5A 4RLKA 3A8WA 3K3IA 2AC5A 4QTCA 5J9ZA 4IDVA 4I4FA 5M09A 2VO7A 3NCZA 5CALA 3ELJA 4L68A 4HPTE 5K9IA 3GI3A 5C03A 4C34A 4MXZA 3VUIA 2OFUA 3M2WA 4IWPA 5HEZA 2OXYA 2JIIA 4FSUA 4M15A 4RWLA 5AR7A 4CFXA 3GU4A 5AV4A 1DAYA 3MDYA 1GY3A 4FKVA 3ZEPA 2WMVA 2B9IA 3KF7A 1MQBA 3FY0A 1XKKA 2VWXA 3MW1A 5IH6A 3I7BA 2PHKA 3NWWA 4ACMA 4AE6A 4ZK5A 1J7UA 3ORXA 4FNXA 3WE8A 3DS6A 3BLQA 3TKHA 1CKJA 3FMEA 5KMLA 4J8NA 5KO1A 1FVRA 1H1SA 1Q62A 4M97A 4PTCA 3SAYA 5EI8A 5HE3A 4CFUA 4CSVA 3UZRA 4NIFA 4CQEA 1Q8YA 3BZ3A 5CNOA 4QMPA 4MWIA 4NM5A 4ZSLA 1PMUA 3F3ZA 4BDDA 4BI1A 4RWKA 3FY2A 3F88A 1YHWA 3W8QA 4E20A 1GIIA 1H1RA 3K2LA 3ZUUA 4KIPA 5F1ZA 3RPYA 3OC1A 4HYUA 3A60A 4JBVA 2G9XA 4IC7A 2PK9A 1Q8UA 3D5VA 3PY0A 3TTIA 4FF8A 3BU3A 3LCDA 5ETIA 3F7WA 3VUMA 3ZBXA 1RJBA 3F3UA 1UA2A 3BBWA 3UZPA 4ZY4A 4U5JA 2OLCA 1BI7A 4JX7A 1GNGA 5DWRA 4IM0A 4RX8A 4ZP5A 3WZJA 4J52A 3TM0A 5AIKA 3RAWA 2BTRA 4U43A 1ZZLA 4WUAA 5AX3A 2X6DA 3TN8A 4I0RA 4KSQA 3TUDA 2GS6A 3C13A 3HEGA 2XM9A 4K18A 4TT7A 5HGIA 4D4SA 2F7XE 2WTKC 2CJMA 2WXVA 3D5XA 4USFA 3FBVA 4FIHA 2IWIA 3L9NA 4U3YA 3OUKA 5JRSA 3ZOSA 5BVEA 2QKRA 3MVMA 3NMUF 4CKRA 2W1ZA 4H3PA 3LPBA 4FYOA 2GPHA 4QMOA 3QHRA 4KS8A 3AGLA 3QU0A 4IB3A 2W99B 4YP8A 3KMUA 4OW8A 4YZBA 4YSJA 1U4DA 3SLSA 4HVSA 1TQPA 4C33A 4DTAA 1O6YA 4ERKA 3R22A 4ZMEA 1APME 4CT1A 4UX9A 4AQCA 4G3EA 4RQVA 3DLSA 4WG5A 5LVLA 2KTYA 4CYJA 4ZSGA 3QGWA 4BWXA 4F9YA 4LI5A 4DT8A 3DT1A 4FKPA 5ANKA 1JLUE 2O65A 1M2RA 3QUDA 4QYGA 4A07A 4L53A 3MI9A 2QG5A 3HA8A 4EOLA 2ERKA 3VQUA 1VR2A 3RAIA 1L3RE 2H34A 4C02A 4FTIA 5GIOE 4B99A 4YO4A 3BV3A 4NKAA 4V04A 1B38A 5GZ9A 2QHMA 5EFQA 3NNUA 2QQ7A 2QU6A 2WNTA 3BYVA 5JH6A 3K5UA 1ATPE 2VGOA 4S31A 4YJQA 2JBOA 2QHNA 4ASXA 2YIWA 4FV5A 4JNWA 4CRSA 1PRYA 1ZOHA 5FUTA 3JVSA 4UALA 5LVNA 4XG6A 3I79A 4Y8DA 1BLXA 3KXXA 4B9DA 4Y46A 4DBNA 5CAVA 4HW7A 3BHTA 2E9PA 4IIRA 3IW8A 5J95A 3SW4A 4ZTNA 4FKGA 2C1BA 3U6JA 4E5AX 4FZFB 1ZXEA 3O96A 5GHVA 1UU9A 3O7LD 4GEOA 3CPBA 3PYYA 3DXPA 3WE4A 2PVRA 4M8TA 4TYEA 4RIXB 3WIGA 2QR7A 3AD4A 4FL3A 3W55A 2PUNA 5HU9A 4E4LA 5DMZA 2XIKA 5AP2A 3LQ5A 3HV7A 1PMNA 4GFGA 4R7IA 4UV0A 4U3ZA 4KKHA 4I6QA 4XP0A 4TYHA 5CYIA 5AP3A 4CMTA 4F7JA 4FV7A 3QA8A 3TJDA 1SZMA 3KRJA 4XV3A 5IEVA 4PDOA 5EH0A 5AUYA 4LFIA 3G0EA 1O6KA 3FLQA 1ZYJA 4H36A 3R8PA 5CEIA 4HVIA 5EHYA 3HRFA 5AR2A 4L00A 5FQDC 5H8BA 3T9TA 3SVVA 4H3BA 4EOJA 5GZAA 3KULB 3RI1A 4BCOA 2C5NA 5E8TA 4AGUA 3QZGA 2OH4A 3KEXA 4J96A 4EH8A 5F20A 3LW0A 5K4JA 3FZSA 3COHA 3LOKA 4AA5A 5CWZA 3BYUA 4ZLYA 4RT7A 5DRDA 3FXXA 3D5WA 4ZJJA 3FMNA 2ZB1A 4XHKB 2RL5A 5B2KA 5LOHA 5HO8A 2G01A 3GB2A 5TO8A 3DQXA 3C9WA 2GNJA 3O71A 4QP2A 4R5SA 1SVHA 5J1WA 2HWPA 2HOGA 2JAMA 4RIWB 5I9XA 5JK3A 4WSQA 3E3PA 2DYLA 1H24A 2BAJA 4N0SA 2C3KA 3HECA 4HVGA 1J7IA 3RZFA 1WBPA 1BUHA 3ZSHA 4FEWA 4EH4A 2ZV7A 5GIPE 3TV4A 4APCA 1WZYA 3MA3A 1JPAA 4BRXA 1UNGA 4FKUA 1MUOA 5C4LA 2R2PA 3O2MA 4XUFA 2W1IA 5FTQA 4MEDA 4RQKA 4XOYA 3REPA 1XBBA 2G2FA 4BKYA 5A4EA 4WNPA 1LUFA 4KWPA 3WARA 1YOLA 2ITYA 3GEQA 1QPEA 4EOQA 1Y91A 3IKAA 3QBNA 4R3PA 5FEEA 5HE0A 3C4FA 4XBUA 2ITNA 5AR3A 3DJ5A 1FINA 4FMQA 2ITVA 3OT3A 2QNJA 3R9OA 4U80A 5KE0A 5L8KA 3EQPA 2EUFB 1SYKA 4YGAA 1YXSA 4RC4A 3R7EA 2B4SB 3DV3A 3OTVA 5AMNA 1URCA 2R3KA 4B6LA 2X2LA 4YHFA 2GHGA 3DB8A 3QWKA 4JXFA 4DFNA 1G8SA 2CGVA 3KMWA 3BEGA 2IJMA 2W9FB 4FYNA 3RWPA 3A7JA 3TNPC 2I0HA 3I5ZA 2CLXA 3OROA 1YDTE 1JSVA 3IGGA 3KRWA 2WQOA 1H28A 4JIKA 3EMGA 4AGWA 1Z57A 3OEFX 2BKZA 1GZNA 3M11A 3VUTA 4CG9A 4RWIA 4FT7A 4XCUA 4D1SA 4BDCA 1KE5A 3KA0A 4W4XA 5IZFA 4N70A 2E9NA 2WTDA 4NW6A 3D5UA 5CAQA 5AV1A 4RPVA 3OD6X 2GQGA 1ZRZA 5AP6A 1ZOGA 3COKA 3D15A 3MV5A 4USDA 3ZLSA 3L9PA 4WUNA 4NK9A 2PZYA 3AGMA 3KF4A 4RA4A 2FSMX 2BKKA 4M0YA 5AEPA 5BPYA 3EHAA 5HG5A 2YACA 5HD4A 2G1TA 5AUZA 3OS3A 4J8MA 4G6OA 5LWMA 2P33A 4IZ7A 4EKKA 2CNQA 5KMNA 1S9IA 3HMOA 5EI2A 4EUTA 3V5WA 1M52A 3CJFA 4QP4A 4HVHA 2UW3A 4XG7A 2F2CB 3TWJA 4WRGA 4M13A 3CSVA 3O8TA 2XBAA 3COIA 2ITXA 3UVQA 4FG7A 4WBOA 3FQHA 5JGDA 1UKIA 5M56A 4U44A 3F6XA 5KMJA 3ENHA 4DC2A 4FTLA 5HG8A 2BAQA 2R3GA 2WD1A 3F5XA 1GAGA 2YM7A 4IACA 4BZOA 3DK3A 3H0ZA 2W9ZB 2VWWA 2YERA 4FTAA 3BHHA 3CE3A 3I4BA 1OIRA 2BR1A 4L6QA 2F49A 4JQ8A 3ZFYA 4J97A 4FK3A 2QONA 3W8LA
chains in the Genus database with same CATH superfamily
2BHHA 5EM8A 4BDGA 2OI4X 2WTKB 2X0PA 4I6HA 5DEYA 2H9VA 2HXLA 4RC2A 5K5NA 3UIBA 3FLYA 3R7OA 4C38A 3WZKA 3GQIA 4B4LA 3LFEA 2DQ7X 2UZVA 4FOBA 3KCKA 3ERKA 3LLTA 3UGCA 3OWKA 4RIYA 5KZIA 3S2PA 2FH9A 1PYXA 3FZ1A 1Q41A 3NW5A 2HY81 2HCKA 4GUBA 4IFGA 4YJPA 5D11A 3VJOA 4MH7A 3ATTA 4DEDA 1OPJA 2WOUA 5EQPA 4IXPA 4H3QA 2GFSA 2W7XA 5EKOA 4A9YA 2EVAA 1OI9A 4M69A 4QQTA 5HORA 1ZZ2A 3EH9A 5JT2A 2DUVA 3B2WA 1ND4A 4C61A 3HAVA 1XMMA 4L44A 2BROA 2ACXA 3NAXA 4ONAA 1U59A 2ZOQA 3LJ1A 4MNEB 2H6DA 4DGNA 5JFSA 3LKMA 2WMTA 4QTEA 4FKTA 3A7HA 2WEIA 1TQMA 5DHJA 4CNHA 2QO9A 2XKFA 1A06A 4LQMA 2VO0A 4ASDA 4DGOA 5E8VA 5J9YA 3FPQA 3TG1A 5AX9A 1OUKA 2XUUA 2YCRA 1E1XA 1VZOA 2EXCX 3L8VA 4GU9A 3OW4A 1YVJA 4XV9A 4GRBA 1VYWA 2J0LA 4ZZMA 4I5PA 5TE0A 5KBQA 4IM2A 2C0TA 3WF5A 4WHZA 4U97A 1JBPE 3E93A 4FI1A 3D7TB 3OWLA 4FNZA 4ALUA 4F9WA 3VUGA 1ST0A 4LRJA 4TYGA 4F1OA 4OTDA 4B8LA 3V8TA 4OGRA 4G3FA 3EL8A 2UW8A 4K2RA 4OTIA 4AGCA 4FIGA 2CPKE 3PUFC 4FKRA 3UO4A 4FEUA 2VWYA 4RMZA 4Q9SA 3TXOA 2A1AB 3VUDA 3JYAA 4K6ZA 1W84A 5E9EA 3O7LB 4L8MA 3W0OA 3VS5A 5LVMA 3NUUA 4RVTA 1I09A 4II5A 1WBWA 2JDOA 3V51A 2PULA 3MTLA 4FODA 4DFZE 4RJ8A 4RFYA 3HRBA 5GNKA 4DLIA 1YHSA 2BVAA 2R3MA 3R01A 5J5TA 4IAKA 3UDZA 3V5JA 4DFBA 4TYJA 2REIA 4EJ7A 2O2UA 2J90A 4FZ6A 3UQGA 3LAUA 5L2QA 3AC8A 4O7SA 3L9LA 4Y95A 5D7VA 5ANGA 4RX7A 2PPQA 2OH0E 2J4ZA 5AAFA 1W2DA 4O38A 4BVUA 4BWKA 1BL7A 4TPTA 3ZCLA 2X9EA 2QLQA 1SMHA 2R3LA 2UW6A 1IA9A 3FI3A 3I6UA 4MTAA 4QMTA 5H9BA 4YZNA 3QTIA 4BGGA 3E8DA 4H39A 4U8ZA 4XYFA 4Q2AA 3S1HA 2BRBA 3PWDA 5AIRA 1B6CB 2XAOA 2GHMA 3QRUA 3KXGA 1SNUA 4UMUA 4R77A 2YZLA 3WZDA 4JG7A 4C62A 4C8BA 2A27A 2VO3A 5CXZA 4JG6A 3EQRA 4QMVA 4YTIA 5L8LA 3ZDIA 3FMKA 3T3UA 2F9GA 1Q24A 3EZVA 3MH1A 4IZYA 4LGHA 4BGHA 5BVFA 3C7QA 1OB3A 2YM8A 2QOQA 2XRWA 4IX5A 4EC8A 3ORZA 4CV9A 3DDPA 3F2AA 4FT0A 3B2TA 4KBCA 4ZJVA 3I5NA 1ZARA 3SV0A 3GU7A 5D9HA 4EOOA 2VAGA 1OGUA 4RFMA 5EQYA 4DTBA 2XBJA 3G5DA 4NM0A 4XOZA 4IB1A 3KY2A 4AT5A 3GXLA 1OIYA 3CTHA 3FJQE 4FT5A 4WD5A 4XP2A 1OKVA 2PMLX 3KRXA 5HG7A 4I21A 4I41A 3RHKA 2QOOA 1W98A 3BV2A 5DBXA 4WO5A 4YNEA 5G6VA 3ZLXA 1KE8A 1LP4A 3CTJA 4KRCA 4U9AA 4MXAA 5EM7A 4JQ7A 4XH6A 1W0XC 4ZTMA 2HW7A 3BGQA 5AP1A 5EI6A 1W7HA 4F70A 2YABA 4QNYA 5A3XA 3H0YA 2B55A 2YEXA 3VW8A 2XIXA 5J7HA 2ITQA 4DBXA 3EKKA 2IVTA 3IDCA 3Q4UA 4KKGA 2VX0A 2XALA 5IQBA 2PZ5A 3ENMA 1Q61A 4MBJA 4YHJA 1ZYDA 2IO6A 3GENA 1KV2A 3A8XA 4HVDA 3F69A 4F9CA 3OCSA 2C3LA 4AAAA 3H10A 2YDIA 4GIIA 5CX9A 2OK1A 2QI8A 4C7TA 4A9TA 3D7ZA 2C47A 2C6IA 2R3IA 2C69A 3PRFA 5D7AA 3RTPA 5CF4A 4G3GA 4IAAA 4PY1A 4GYGA 5ETAA 5IQAA 4UB7A 3SG9A 1UNLA 2PVJA 3OCGA 3A2CA 3CGOA 3G6GA 3QTSA 5AM7A 4N57A 4DYMA 3OEZA 5KKRB 3E62A 4Y73A 2QOLA 2VX1A 2Z2WA 1ZLTA 2C6TA 3EQBA 3NPCA 4GK4A 1LEWA 3MB7A 4AXFA 3GC8A 5CAPA 3LXKA 4D0XA 2RG5A 2UZEA 4P7EA 5F4NA 3LFQA 4HJOA 1FOTA 3Q96A 4QRCA 4RA5A 2I7QA 3HUBA 4L45A 4JI9A 5CVFA 4FIIA 2W0JA 5L6PA 4O96A 1JSUA 4LV5A 3BEAA 4YPDA 3ZRMA 4DEAA 4D4RA 4AX8A 4ZEGA 2O64A 3FHRA 2GS2A 3QC4A 2OZAA 2UZBA 3IOPA 4OTPA 4QPMA 3FDNA 2JKQA 4G3DA 2BILB 2ITZA 2RFDA 4ASZA 2NPQA 4O91A 3PTGA 5CXHA 5FDXA 3W2SA 4EJNA 2E9OA 4L42A 4L46A 5IDNA 5C4KA 4C3FA 2Y6OA 2CCHA 4KIQA 2XZSA 4Y5HA 1Q8ZA 3PP0A 4JAIA 5HCYA 4PRJA 3TV7A 5IA0A 5LMAA 5DFPA 4F9AA 4TWPA 4O83A 5CVGA 4ANLA 4IX6A 5E8ZA 3SGCA 1YHVA 5BUIA 5ANEA 2OICA 4MD7E 4BCNA 2OXXA 3O0GA 3JPVA 5KX8A 1GJOA 5CZHA 1WBNA 2WKMA 4MQ2A 3VS4A 3UDTA 3PY3A 4FV6A 3Q5ZA 3O51A 2OO8X 3OOMA 2BCJA 2FGIA 3OBGA 1ERKA 2BZJA 3G33A 1PXPA 4ID7A 4QQJA 2PYWA 3W0SA 4IADA 3VO3A 2R7BA 4YC3A 4P5QA 4RJ3A 4I22A 1H07A 4DH7A 3SHEA 3P08A 4QEBA 5IMXA 3C0HA 2DS1A 3A7FA 3JVRA 2QOHA 4TNDA 5E91A 3MGYA 3FXZA 5AP4A 4X21A 5DI1A 5E8SA 5CY3A 3NUPA 3ETAA 2PSQA 2RGPA 1KE9A 5IG1A 2QC6A 2W17A 4O21A 4D0WA 4LGDA 3ZM9A 4AFEA 3IECA 2X39A 2JDRA 3FQSA 3LCOA 3MVJA 5EHOA 4BDIA 3NUSA 4FTTA 4PF4A 4QNAA 4GJ3A 2YDKA 3UC3A 4DEBA 4D9TA 3FLSA 5A54A 1NT2A 4FEXA 5B2LA 2W5HA 5EW3A 3ZC5A 4A9RA 5HTBA 3Q32A 1UV5A 4ZZNA 1JAMA 4NEUA 3V5PA 1H1WA 2AEGA 3RP9A 4UZHA 4DH8A 1IRKA 1M14A 2W06A 3MH2A 4NJDA 2HZ0A 2OF4A 2Y4IC 3DBDA 3VBYA 2E9UA 2PTKA 4YTFA 5CSPA 2NNWB 2VTOA 2W1FA 5DT0A 3BHUA 3PE1A 1GIHA 1KWPA 1MRVA 3ACJA 3NR9A 3UNZA 5HQ0A 2Y9QA 3LFSA 4XG3A 3AKKA 2WZJA 4KIKB 5GJGA 5ACBC 2OG8A 4NWMA 5A4LA 3Q04A 5CEKA 4Y5QA 3MFTA 2R64A 4HPUE 3N9XA 3O50A 3PJCA 4RJ6A 4TTHB 4ACCA 3ZBFA 4QP3A 4EORA 2RIOA 1H08A 1J3HA 4BDJA 5IA4A 1YWNA 4FIFA 3P9JA 2IW6A 4FTRA 4JVGA 3U87A 3RAHA 4F4PA 2C3JA 3CLYA 4FBXA 3FUPA 4YZCA 4QMNA 3UOKA 2AYPA 4UXLA 5DNRA 1AQ1A 1TKIA 2PMIA 4ANOA 4GIHA 5CU6A 3IONA 5CT7A 4DTKA 4X7QA 4IB5A 4OTQA 3R1QA 1E1VA 2WQBA 2A19B 4AW2A 3UOLA 4E5BA 4BZDA 4EOPA 3JY0A 4YZDA 5CU0A 4WNMA 5JEBA 3A7IA 4ZS4A 3JY9A 5J1VA 1ZMWA 3NEWA 3QQGA 5IA1A 2X7GA 1LR4A 1T45A 4N6YA 4XEYA 2XK9A 2X4ZA 3EN9A 1W8CA 3AD6A 4BZNA 4BF2A 1E9HA 1PXLA 1P4OA 2E9VA 3QTXA 5AP5A 1WCCA 2WMBA 3MPAA 4GFMA 4ITIA 4JDKA 4ZZOA 3FL4A 4GH2A 3PZHA 4D2RA 5BMSA 3CPCA 4AOJA 4GS6A 4YSMA 2P2IA 3NCGA 2IW9A 2ZMDA 3DOGA 5HIBA 3ROCA 3OT8A 3V8WA 3QX2A 1XWSA 4BKZA 3LXNA 2DWBA 4O6LA 2GU8A 4MXCA 2J50A 1K3AA 3DBCA 4FUXA 3WIKA 3RBWA 4CG8A 3QQLA 4MBLA 1PXMA 4YJNA 4F63A 5IF1A 4JDHA 3FI4A 5E1SA 3MJ1A 3LM5A 3L9MA 5IA3A 5TF9A 4HYSA 1G8AA 4RJ7A 3OXIA 3R63A 1YW2A 3PJ2A 3OMVA 4G6LA 4MAOA 4XG8A 3MVLA 3R9HA 1OM1A 4C2WA 4EEVA 5AADA 4IX3A 4YMJA 1F0QA 1P5EA 3HP5A 3P0MA 2BTSA 3ALOA 3R2YA 4B0GA 4PMPA 2CNUA 3OP5A 1SVGA 2C6KA 2WAJA 1YRPA 3E8NA 3EFWA 4I23A 3SKCA 1M2PA 2ZMCA 2XK4A 3OY3A 4CLIA 4Q9ZA 4KAOA 3FAAA 2IZSA 3ODYX 2WU6A 4PL3A 2ZM3A 3NX8A 3V5QA 5EQEA 4V0GB 4PL5A 4HNIA 1S9JA 3AC1A 4MVFA 4P5ZA 1Q8WA 4AXEA 4FZ7A 2CGUA 5LXMA 3U9CA 4A4LA 3AT3A 5ANJA 2UZNA 2YM6A 2XNBA 3UOJA 2WTVA 2XIYA 2JGZA 4EBWA 3G90X 4PP9A 3RM7A 1VEBA 1BKXA 2UW4A 4PUZA 2QOKA 5M08A 2O5KA 1H8FA 5H3QA 3ZS5A 4FUYA 2JDSA 5AV2A 1IAJA 4MKCA 3BGPA 4JQEA 4YJRA 3VBXA 4DE4A 3ZTXA 4A7CA 2BDFA 2J0JA 4C4HA 3EQDA 4NYEA 4O1OA 5KMOA 3E7OA 3NNWA 2VX3A 3COMA 2W1DA 2FUMA 2IF8A 2QOIA 3AD5A 4L9IA 3QUEA 3KQ7A 3AC4A 3R8UA 5CF6A 2X6EA 3PPKA 4DEHA 3FMMA 5LWNA 3TZ7A 4GKHA 1AD5A 2BZHB 3C4XA 4PDSA 3S3IA 3HYHA 2OIQA 4XRJA 2ZYBA 5CI7A 2Y8OA 3BI6A 5EOLA 4BCGA 4UMRA 1OL2A 2G15A 4BIBA 3W0NA 3R83A 3HMPA 4FV3A 5EW9A 4I6LA 2P2HA 5A4QA 2E2BA 4FICA 4CLJA 1KE6A 1O9UA 3G9LX 3I6WA 3QL8A 3UMXA 2BDWA 3KXHA 3ZFXA 4M7IA 2WFYA 4G9CA 5DT3A 4Q5EA 1KE7A 2YAKA 4IB0A 3WI6A 4OTFA 1SNXA 5IUGA 5M51A 4IAIA 5CT0A 3DJ6A 3QKLA 1J91A 1ZY4A 2OJJA 4X0MA 5HNGA 1RQQA 4OTRA 3I81A 2Q0BA 3UG2A 4PTEA 4UMQA 3NIEA 3HMIA 4N4SA 3H9OA 4U42A 3H4JA 2BFYA 3VS7A 1YXUA 4EH7A 4EC9A 4GYIA 4EH9A 2XJ0A 3PXFA 3W16A 5LMKA 4G2FA 4QP8A 5CAUA 4QP9A 4HGSA 1KOBA 2OXDA 2PMOX 2RF9A 5IUHA 4CTCA 1YDRE 2JIVA 2I0VA 2XIRA 4EOIA 2X7FA 3ULZA 3EIDA 4AWIA 3QQJA 3GCPA 1BX6A 3MH3A 4F7SA 4F1MA 1NW1A 4MXXA 4X3FA 3IGOA 1Y6AA 3EZRA 4LMNA 4ANNA 5IA2A 1J1CA 4FKQA 4G9RA 3FZRA 2XA4A 3C5UA 1M17A 3OOGA 4H58A 2HZ4A 5EDPA 3Q9YA 5FXQA 5CVHA 5J87A 3PLAE 4ERWA 2UZOA 1AGWA 4FKJA 3EWHA 4IJ9A 2OIBA 4YUQA 3PXQA 2R4BA 3Q60A 4BCKA 4DDIA 2JFLA 2G2HA 4QDVA 4WRSA 3FI8A 1P14A 4TN6A 4I6BA 3PG3A 4YTHA 2VN9A 4S34A 4D2PA 4C4JA 5BVOA 1YKRA 3VHKA 3HKOA 3MY1A 4IVDA 3ZYAA 2XNMA 4QP1A 2XF0A 3FSFA 4FV9A 3O5AA 4F78A 2R3FA 2VGPA 3CQWA 3E3BX 3PG1A 4X2NA 3PP1A 4KBKA 4QYEA 5DR2A 2BIKB 3C4WA 2PVMA 3SXSA 5IH5A 2X8EA 4AUAA 4D4VA 4WT6A 1PY5A 3FMLA 3UG1A 1ZAOA 5KHXA 1Q5KA 3G2FA 2IZRA 5DR9A 5EG3A 3F66A 4RC3A 3LFBA 4BY9E 3W2CA 1TQIA 4C4EA 3GFEA 3F2RA 4MXYA 4DEEA 5CZIA 4D1XA 1DI8A 2IVVA 2FSOX 2QLUA 2YCSA 2Y4IB 2VTPA 2F7ZE 5AP7A 4CFNA 4FK6A 3W2PA 2PZIA 2QG7A 4LYNA 3N51A 4L01A 4ACHA 2UUEA 2BDJA 3VS1A 4G6NA 2ITWA 4PL4A 3LHJA 5LCKA 3UVRA 4IWOA 1YXXA 2OJ9A 3RWQA 4Z3VA 4JMQA 4P90A 4RVLA 3KU2A 4PPBA 5IQGA 2PMNX 5IQEA 4O27B 2XEZA 4BFMA 4U7ZA 2WIPA 4BB4A 3A4OX 3UQFA 5GJDA 4DCAA 5TT7A 1RW8A 4F0GA 4AA0A 2EU9A 3H30A 4ZY5A 4AP7A 4RVMA 4EYMA 2I40A 1G5SA 2J5EA 3UPZA 3RK7A 4IAZA 5AV3A 2YM5A 4KINA 4FA2A 3JR1A 1OVEA 3U6IA 2EB2A 1XH8A 3WZEA 4M12A 4JDIA 4FTNA 4PWNA 3BE2A 4FX3A 3NW7A 4FIJA 4QYFA 4TXCA 4FSRA 4FJVA 4YHTA 3UIMA 1LEZA 3W1FA 1IASA 1XH4A 4AZEA 2ESMA 2XNPA 3R8ZA 4D1ZA 2C5YA 4PNKA 4L43A 2J0MB 3TJCA 2ITUA 4YR8A 4QMSA 5AM6A 4UWYA 3HDNA 3EB0A 1QPDA 2YIQA 2B9JA 2YIYA 3QZFA 4TZRA 4HOKA 4O7TA 2FSTX 4NM7A 2WMUA 3VS6A 5I9VA 1R78A 4ZLOA 3QZIA 1FGIA 1U5QA 2XNEA 5E8XA 3ZUVA 2WTCA 3AT4A 3NNXA 4I94A 4CZUA 4MWHA 3VBWA 2B9FA 3ZO4A 5KMIA 3BLRA 3MBLA 4K9YA 3FLZA 1G8JA 5I9YA 2BRNA 3UODA 1G8KA 3B8RA 5AUWA 5JN2A 2WMXA 4R3CA 4LDTA 3BQCA 3SOAA 2GTNA 3KCFA 2Y7JA 4EOKA 5BUEA 4L3PA 2Z02A 3U55A 2YLFA 3KKVA 3NRMA 1V0OA 5CTPA 2IPXA 4AW5A 1K2PA 2QOCA 2WHBA 4FNWA 4CCBA 5C8KA 2J7TA 3ML1A 4QQ5A 1UNHA 4O86A 4NL0A 5CEQA 4GT3A 4NIFB 2GDOA 3WZUA 2HK5A 3EQIA 3RM6A 4O7WA 2XMYA 3LFDA 2IVSA 3EOCA 5L2SA 2YCFA 3KXNA 3V5LA 3CBLA 4FKLA 4A4XA 2VTSA 2X81A 3SRVA 3FMJA 4CKJA 5LVPA 3AMYA 4S32A 4O22A 2ZM4A 3R00A 5AJQA 2XIZA 4AW0A 4BCFA 5K0XA 2QU5A 4X6QC 3VHEA 3D4QA 3ORPA 4NTSA 5CSXA 3RJCA 1MRUA 3EQFA 4FSMA 3D94A 4DT9A 5L3AA 3AMBA 2ITTA 5J9LA 2FB8A 4BL1A 1FVTA 5IU2A 2X9FA 2YJSA 3E63A 5AUUA 2EXMA 4IC8A 5L6WL 4RIOA 3ZFMA 3KK8A 1TVOA 1PXJA 2C0OA 2OJGA 2WQNA 2XKCA 3KK9A 3VUKA 4YTCA 5JMSA 4BHZA 4E6DA 3CEKA 5JQ5A 4BTMA 3CCNA 1ZWSA 3DAJA 3AQVA 3GC9A 4FTQA 4BICA 3ZRKA 5IQCA 5TR6A 4ENYA 1NVRA 3DJ7A 2C1AA 3DNDA 4PTGA 5HKMA 4RZVA 4E6QA 4PV0A 2R9SA 2FYSA 3SOCA 4EK4A 3U51A 5HTCA 3VW6A 2J9MA 2H96A 2HXQA 3CKWA 3TKIA 2BUJA 3S95A 3FZTA 4W8DA 1ZYCA 2WMQA 2IZUA 4X2GA 2C6LA 4CZYB 2I0YA 2WMSA 3FPMA 3PXKA 5G1XA 4C58A 5CANA 4ALVA 2AC3A 2FSLX 2ZAZA 5F9EA 3V6RA 3RPRA 4KNBA 4QMYA 4RZWA 2QKWB 5I9UA 2ZJWA 5IPJA 3OUNB 4ACDA 3K54A 2C6DA 3Q9WA 4QQCA 5I0BA 3V04A 3NYNA 3KN6A 4EOMA 4CEGA 4ANBA 4LGGA 1H01A 4O7YA 3LXPA 3ALNA 2VUWA 4KS7A 2ZV2A 1BI8A 2X8DA 4O7VA 3NVKI 4IX4A 4O2PA 5A6NA 5ITAA 4MD8E 3UNJA 4CFFA 3R2BA 4R1YA 5CI6A 5DEWA 4GFOA 4CYIA 4F0FA 3SD0A 4MNFA 3UYSA 3ULIA 4UMPA 2YM4A 3IQ7A 3VVHA 1UKHA 4NH1A 3QTZA 4LL0A 3ZC6A 2GNHA 3PFYA 1UU8A 3HX4A 1KSWA 4O2ZA 4IJPA 2XJ1A 3PDTA 2CGWA 5AFVA 4F1TA 4BJJB 2CKEA 3TKUA 3R9RA 5T6KA 3O23A 4E4XA 1X8BA 3C50A 1WBOA 2PVKA 4ITHA 2PE2A 4DAWA 3C5IA 1WVWA 1YI3A 2VTLA 3LFNA 3Q2JA 5JFXA 1QMZA 4GUEA 4EK5A 5CEMA 1OBDA 1M7QA 3T9IA 1XJDA 1G3NA 3PXZA 4TWCA 4TYIA 2VU3A 3ZXZA 1JKTA 3MIAA 4D2VA 4GSBA 3KN5A 2V5QA 2QCSA 3RGFA 3QKMA 4LUEA 4OBOA 4QYYA 2PVYA 4TYHB 2VTMA 4GJ2A 4JRNA 5C8MA 3UMWA 4Z7GA 2V22A 2WTIA 4IBMA 4LOQA 1R3CA 1SM2A 1ZY5A 4NCTA 5FRIA 5B2MA 1UWHA 2A4LA 3ZSGA 2JDTA 1IR3A 2X0QA 4MK0A 4DGLC 3VRZA 2R0UA 3QXPA 3QALE 1PXNA 5CAOA 3MIYA 1PYEA 2YJRA 4FNYA 1LPUA 3VULA 4BDAA 4D2SA 4QMUA 3RCJA 4BDHA 2XCKA 4DG2E 4IM3A 1OBGA 2FVDA 4HCUA 3MFRA 2GQSA 4AZVA 2EWAA 4EZ5A 4GVAA 1YOJA 4AOTA 3AKJA 5HCXA 2A98A 1JOWB 4FOCA 4NCTC 1MP8A 2UW0A 3R6XA 5HNBA 1W82A 4I20A 3R7IA 3I0OA 2X1NA 4FL1A 4YLJA 3S0OA 1Q3DA 1V0BA 4UXQA 4RRVA 3FKLA 5AV0A 3Q9ZA 3GC0A 4QMZA 4DA5A 3BELA 2YA9A 3VBQA 4RBLA 2BFXA 2XNNA 4FV4A 5I4NA 3CC6A 2VV9A 5DA3A 4C59A 4BYIA 4JG8A 3JXWA 4Y83A 3ATSA 3DZQA 2YFXA 1PHKA 4UZDA 4QMLA 4M68A 2JBPA 5TOZA 4EH3A 4Z16A 4Q5HA 3UYTA 3GU8A 1IA8A 3TZ9A 3PXYA 2CN5A 2YAAA 3DPKA 5FDPA 3IW4A 4R1VA 4ASEA 4QPAA 3NLBA 4GU6A 4BTJA 4CV8A 1CM8A 3DK6A 4UBAA 5HE2A 3UO6A 5JFWA 3GGFA 3QQFA 3G15A 3EKNA 4OTWA 3VS3A 3QCSA 2A2AA 3KIOC 2BZKB 4JLCA 2R7IA 4I0TA 3BHYA 5AA8A 2CHLA 3PXRA 3Q2MA 5EW8A 3MJ2A 2WELA 2PWLA 3MB6A 3PVBA 4IVAA 3B8QA 5HHWA 1XQZA 1FQ1B 2PVNA 3I0QA 4J1RA 1YI4A 4O0TA 5AUVA 1V1KA 4PMMA 5HESA 1UVRA 3I1AA 4LV8A 4ZS0A 4GCJA 4WNOA 4O0YA 2EB3A 3ZO3A 4D28A 4A9SA 4ANMA 4DINA 2EXEA 3NZ0A 4YPSA 2XYUA 2PZRA 5FM3A 5HLNA 5E7RA 5M4FA 4XMOA 4WSYA 5D10A 2CKOA 5AAEA 4WNKA 3VWAA 4XV1A 3QTQA 2JIUA 4EZ3A 4PDPA 4CMOA 4AZTA 4E5WA 4EH2A 3POOA 5BVWA 3RPSA 4FKIA 4AS0A 1MRYA 1ZYSA 4WBBB 5H2UA 4FEQA 3DQWA 3RNYA 5J5SA 3FEGA 3BRBA 3UVPA 4I93A 3MS9A 2YLEA 2XVDA 3ODZX 4Y85A 4CFMA 3PJ3A 3QTUA 3WF7A 3PJ1A 3UO5A 3K3JA 2VRXA 3UP7A 3LIJA 5D41A 4ZTSA 4E4NA 3E88A 2PU8A 2VWBA 5DIAA 4BC6A 3VBTA 1PKGA 1HCKA 3M42A 3EN5A 4DCEA 3D2IA 5A14A 2X4FA 1GZKA 2C4GA 4DFLA 2YITA 4G16A 4K0YA 1FMOE 5DGZA 2RFSA 4I6FA 4I3ZA 3NVMB 2GNFA 4RIXA 3ZO2A 3ZUTA 1M7NA 4OR5A 4O82A 4AQKA 2PL0A 3ANRA 2QOBA 4NTTA 4OLIA 5HVJA 1OITA 3SXRA 4KIOA 3H9RA 2XCHA 4W9WA 3FXWA 2XS0A 3KMMA 3LM0A 1Q4LA 2WGJA 4YURA 5IDPA 3R1YA 5BVDA 3Q53A 2ETMA 3U4WA 3UDSA 4H1JA 2WEVA 4FT3A 4DGMA 1R0EA 3F61A 2Z7QA 2RKUA 3PUPA 3WYYA 2PUPA 5JKGA 3FYKX 4M3QA 4FKSA 1DI9A 3SQQA 4G31A 2OJIA 5IMEA 2Y4PA 1OIUA 2WTJA 3G6HA 3BYMA 5FP6A 2F4JA 4NT4A 3LCKA 4X2JA 3QD3A 3CR0A 1ZMUA 3KULA 4EK3A 3QCQA 2RFEA 4K11A 3ZLYA 2QR8A 5AUXA 3QD4A 5M55A 2XB7A 4JOAA 4U45A 3QGYA 1UU7A 5GINE 2X2KA 4AE9A 2Z7RA 1DS5A 1CDKA 3QUPA 4ENXA 2R3PA 4F0IA 4GVJA 4IE9A 3FL5A 4ZOGA 3AT2A 5C27A 3THBA 3ZZEA 2GNGA 5BV3A 5CSWA 4J7BA 3KVWA 5FG8A 5AUTA 4ORKA 3F2NA 4BCJA 2GNIA 5EHLA 4OAVB 4YC6A 3ZU7A 5HO6A 4IFCA 5EYKA 4RIYB 2XP2A 3BYOA 3KXZA 3R1SA 4FKOA 4M14A 4O4CA 5A46A 3VF8A 5HTIA 4UN0C 1WMKA 1OKWA 2C5OA 4RIWA 3VQHA 4AAYA 5HNIX 4F99A 1H4LA 3PSBA 5HLWA 3L1SA 3R7GA 5HI2A 1H0WA 3HVCA 4O7RA 1OPKA 3HV6A 4G34A 4ITJA 4I5HA 4EOSA 4L3JA 1VJYA 2YCQA 3RMFA 4M69B 3F3TA 3NUXA 4E1ZA 4QT1A 3FKNA 2CKPA 2J6MA 2X2MA 3LFAA 4D9UA 3FI2A 4FVQA 4FTUA 4YLLA 3D9VA 2CDZA 2LGCA 3OXTA 4E6AA 3KFAA 3PPZA 3NNVA 5JRQA 3PSDA 4OUCA 4DHFA 2HELA 3R1NA 3QX4A 3E5AA 2OW3A 3RVGA 3VJNA 2XJ2A 1OL5A 5EDRA 5FBNC 4DFYA 4P2KA 4E3CA 5LCJA 5IQIA 3M1SA 2JAVA 4XP3A 2W1CA 2Y6MA 3A61A 5E92A 4FL2A 3GQLA 4FG8A 5H8GA 4ANSA 1BYGA 5CSVA 3FC1X 4LG4A 2B1PA 1WVXA 3QF9A 4I1ZA 2ITOA 3MFUA 2O8YA 4DLJA 4GK3A 4W4YA 2YISA 3QD2B 4RG0A 3IOKA 4G3CA 3NYOA 3PZEA 5HCZA 2CNVA 4CVAA 4P4CA 5AP0A 1Q8TA 1QPCA 1Y8GA 5JGBA 3W0RA 3Q4TA 3VS0A 3W33A 3GFWA 5ANOA 3WF8A 4JJRA 3R7UA 2UZUE 4EKLA 3ID6C 3IW6A 5L8JA 5M4IA 3HUCA 1YOMA 3OWPA 1FVVA 3RCDA 3PA3A 3QLFA 3BQRA 2VTRA 4IZAA 4NZWB 3VIDA 1TZDA 3C0GA 5CEPA 3TACA 2JEDA 4RWJA 2A0CX 2W5AA 3BU5A 3NUYA 1XH7A