1J3HA

Crystal structure of apoenzyme camp-dependent protein kinase catalytic subunit
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
342
structure length
329
Chain Sequence
GSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Dynamic Features of cAMP-dependent Protein Kinase Revealed by Apoenzyme Crystal Structure
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 329
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1j3hA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1j3hA02
4GVJA 1G8SA 3KF4A 4G3CA 5JZJA 2C1BA 4TNDA 2Z7RA 4V01A 4WBBB 2XVDA 5CF4A 4HNFA 5CZHA 5HCZA 3FLNC 2ZVAA 3IK3A 5TKDA 4E4LA 5EYMA 3SVVA 1HCKA 3SW7A 1XR1A 4ID7A 4O27B 4ZZOA 3OBJA 5IEVA 5KKRB 3PA5A 4V04A 2E2BA 3PJ2A 2UZDA 4K9YA 1HOWA 3DLSA 3COIA 2XKCA 3A8XA 1LPUA 4EHZA 4XH6A 5E8UA 5C8MA 4XP3A 3F5GA 2Z60A 5LWNA 3VHEA 3MH0A 2GHMA 4O0TA 2BUJA 3A7IA 3ZFMA 4Q9SA 5F9EA 2R3OA 1CKJA 3ROYA 4XOZA 1YOJA 3RJCA 3JS2A 4NYEA 2CCHA 3NYXA 4U40A 4RA4A 3Q5ZA 4FKQA 5IQDA 4NL0A 4YBKA 5HI2A 4H39A 3MYGA 3BU6A 3WZKA 4FG8A 3MVMA 3QZHA 1X8BA 2GSFA 1M2PA 1ZYLA 2G2IA 1IASA 3C4ZA 3QRTA 5HU9A 4IWPA 4NH1A 5L6PA 5BUEA 2HAKA 3PLSA 3KRWA 4FL2A 5HE0A 4GT3A 1YQJA 4GMYA 5CENA 5BMSA 3AGMA 2C3LA 5CXZA 3EQRA 5CAQA 3WZJA 3ORIA 4YJNA 1PXJA 3NLBA 5HX8A 2WPAA 4DGOA 3LXLA 3HAVA 2OG8A 2GNIA 3KCFA 4U97A 5KBQA 1KWPA 4IEBA 3LQ5A 1OIYA 4LL0A 3NNWA 2BRGA 2BHEA 5CEQA 4C8BA 4UX9A 2W7XA 4BTMA 5FTOA 3T3UA 2HZ0A 1KUTA 2PMLX 2X7OA 3R30A 1ZMVA 1JVPP 4UMPA 3CGOA 4HGLA 3RP9A 4I4FA 3S00A 3R8LA 2LGCA 3I4BA 1TQIA 4DGLC 5AV4A 2ZJWA 1W83A 1PXKA 2UVYA 5DOSA 4L9IA 1H00A 4YJVA 4XCUA 5JT2A 2F9GA 5ANKA 3H9FA 3UQGA 2R3PA 2J50A 4FV0A 4F64A 3R9RA 3HV3A 4W4YA 2UZBA 4FKIA 4DG3E 3N4TA 5DT4A 4FBXA 2XIRA 2P55A 2HXLA 3SRVA 5GIOE 4FIJA 4KWPA 5B2KA 3T9TA 5A9UA 4FVQA 4AF3A 4C4IA 2R0UA 4JS8A 3EOCA 4XNEA 4YO6A 3LFDA 3PE1A 2XNGA 1MQ4A 3QX2A 4R3PA 3QQKA 5FXQA 3WYYA 3VUIA 1VZOA 2FVDA 3CTQA 3LVPA 1OKYA 4H36A 1FOTA 3KMWA 1OPJA 1QPCA 3VJNA 4DA5A 4ENXA 4G34A 4IZYA 4Z7HA 3TDVA 2OZAA 1KV1A 3D5XA 3R8MA 2E9VA 3WBLA 2EXEA 2FSMX 4YBJA 4RIYB 3BHYA 4DFUA 3NVKI 2BDJA 4HGTA 4PL4A 1ZZLA 1OKZA 2CGWA 4FG7A 5C9CA 4ZZMA 4HVDA 3FI4A 3QUPA 2G01A 2VO0A 3FUPA 3CS9A 4G1WA 4F9WA 3GP0A 4D2RA 5BVEA 2WMQA 3GC0A 4UEUA 3TUCA 3FE3A 5DH3A 4F70A 4L42A 2OJFE 4EZ7A 3FXWA 4PMPA 2VNYA 2Y0AA 2UW4A 1Q8ZA 4FC0A 2ETRA 2GU8A 4FL3A 5JFWA 1Y6AA 4G6LA 3CD3A 3ZEPA 3TUBA 5CU3A 1H8FA 4CNHA 1OUYA 1YXUA 2F7EE 2W17A 2C0OA 5E1EA 4GJ2A 1WBPA 4FSUA 5EQYA 2ZM4A 4A4LA 4BC6A 2BDWA 2ITXA 3O7LD 2J2IB 4QPSA 3D5WA 4YTFA 3CE3A 3OZ6A 2W5BA 3R1NA 1TKIA 3BHVA 2G15A 1F5QA 2OXDA 4NM5A 4D1SA 3NPCA 4D9UA 3QQUA 3GUBA 5EFQA 3LQ8A 3MH2A 4D2TA 3B2TA 4DAWA 3EN4A 5CI6A 3PVUA 3I7BA 4MXXA 2JBOA 1QCFA 3R7EA 3DCVA 5JZNA 4IDVA 3ENMA 4FV4A 4LG4A 4UZDA 4XG4A 3KVWA 3W2QA 2R5TA 3G2FA 1OIUA 4CGAA 1MUOA 2XBAA 5AP3A 4FZDB 3DTWA 2AUHA 3DZOA 4D2WA 2I40A 1J91A 4YUQA 2YITA 2YAKA 4QP8A 5LCJA 5IQGA 2F7XE 4RPVA 2H6DA 3GENA 4N70A 4QPMA 5CWZA 5HQ0A 2IPXA 3K3IA 4PWNA 4FT0A 2XM9A 2J7TA 3OT3A 5HNBA 4C3PA 4ZSJA 4GYGA 4IIRA 4QMUA 3FXXA 3D2KA 2B55A 4I4EA 3BQCA 5AP4A 2C5XA 4EWHA 4S31A 3W2CA 1OECA 2RIOA 3FBVA 4APCA 5BYLA 4EOMA 2X6EA 4MQ2A 3LPBA 3NUPA 1GIIA 3DNEA 2W1FA 4IFCA 5FQDC 2UZEA 4BL1A 2YIXA 2YFXA 4JX3A 2R7BA 3E62A 3NUSA 2OXYA 3VS2A 5LVPA 1GJOA 1U54A 1LEZA 4X3FA 4I23A 2IVUA 4BCNA 3VUTA 2XIZA 4O0SA 5BPYA 2A2AA 3LFSA 3UTOA 4CYIA 1IAJA 2AC3A 4M12A 4XG9A 5GZ8A 3F69A 2ITVA 4BIBA 2XJ2A 3RZFA 4O84A 4NFNA 3HMOA 3UQFA 2UZUE 4DHFA 5KMMA 2CLXA 4XBUA 2ONLC 2WKMA 2FUMA 2OIDA 4MXYA 3PIYA 5E8SA 2PZPA 5DNRA 5EK7A 2QG5A 3IO7A 3KGAA 5L8JA 3I6WA 3OCBA 3VVHA 4KUJA 3QTZA 1K2PA 3DXNA 3EN7A 4ITHA 4YJUA 5HNGA 2A4LA 5J95A 3U6JA 2AC5A 1JWHA 4U3YA 1PMNA 4F1TA 4DBXA 2ITPA 4FIFA 2Q0NA 4LFIA 2IN6A 4UXLA 2VU3A 5C1QB 3WYXA 4TL0A 2VTOA 2W96B 4ANSA 2C30A 4HVGA 1OUKA 3AT2A 3FC2A 2R3GA 2XH5A 4FSQA 4G5JA 4IAYA 4BTJA 3DV3A 4PPAA 4AU8A 3R7OA 1U54B 4Y73A 4B0GA 4X3FB 3NSZA 3DK6A 1UV5A 1CMKE 4GFGA 5H9BA 3B8QA 5TOZA 3ZZWA 3ZRLA 3NUXA 3NW7A 4QMXA 1DI8A 4U81A 1NA7A 4W4VA 5AA8A 4L00A 1CKIA 3KQ7A 5HBHA 4EH2A 5K0KA 1YWRA 4WSYA 2R3LA 3CIKA 2OI4X 5HG8A 2IW8A 3GFWA 4O86A 5AR4A 5E9EA 3KK8A 3DJ5A 4X2GA 4C36A 3HMNA 4QMPA 5DA3A 5A54A 2VGOA 2Q0BA 1JKKA 5JSMA 3Q52A 4ORKA 1A9UA 4BYIA 5JEBA 3RAKA 4M66A 4RX5A 2X6DA 3TTIA 4FV6A 4FG9A 4IVDA 2YM4A 4JAIA 3BLRA 3RPOA 4RMZA 4YJPA 2JKQA 5E92A 5AUXA 1JKTA 2WMWA 4KIPA 4P90A 3QFVA 5BVNA 1YI3A 4FKWA 1VR2A 3GCQA 1GY3A 3EJ1A 2O0UA 3F5PA 3OOMA 5E8XA 4PMSA 2J0MB 3WZDA 5IQFA 3QD3A 5E8YA 3O8UA 1YOMA 2JIVA 2QU5A 4E5AX 5LQFA 2R7IA 5BMMA 5CEIA 3OT8A 3AC1A 5F4NA 3UYTA 4AA0A 3L9NA 4CZYB 1WBOA 2VTIA 2BRBA 2UW5A 3KFAA 4TWOA 4DEAA 5J1VA 5HIDA 4FKOA 5BVOA 4O2ZA 3CLYA 4C3RA 2RGPA 3O96A 4FIIA 4KIKB 5HCYA 1STCE 3HEGA 3EQGA 1BMKA 4YZCA 4ACHA 4JOAA 4DEIA 3PE2A 5AAEA 4QTAA 5H3QA 3ULZA 5EKNA 1Q24A 3QZFA 3Q3BA 3VUHA 4BIEA 4LRMA 4YO4A 3NUAA 4HCUA 3ZHPC 3HRFA 2PE1A 4OR5A 2WEIA 1R0EA 2W9ZB 2XP2A 3P23A 1OBDA 3VNTA 3R71A 3VS1A 3MI9A 4BKJA 4BDKA 3NZ0A 4DINA 3PXKA 4C4GA 5AR3A 3M42A 4MCVA 3LQ3A 3WI6A 4F1OA 2C6EA 3WE8A 2WMUA 5CI7A 5CEMA 5A4CA 2HW7A 4MAOA 5ETFA 4EEVA 5AAGA 4LI5A 4WG4A 4JDHA 2XEYA 4GG5A 4FTCA 5J9LA 2HY81 2C6KA 4GV1A 2W4OA 5FEDA 4CCBA 4IHPA 2O5KA 2OH4A 4ZTMA 5CSVA 5KMJA 4YC8A 3PYYA 3A8WA 3OFMA 4HZRA 3UIXA 4DFBA 4YC6A 4JIKA 5E8TA 2YCRA 4FOBA 3R73A 3BYSA 2XRWA 2YWPA 3F61A 4LGHA 2PU8A 4ENYA 2WTKC 2R3KA 4IAIA 4WKQA 4PL5A 4DTKA 1OPKA 4FZFB 3ZLSA 1B6CB 4FTLA 3JPVA 2GDOA 4PMMA 1EH4A 5DR6A 1V1KA 2BFYA 4QOXA 5DIAA 2VTSA 4O91A 5A6NA 2IZUA 4BKZA 3LXKA 4NU1A 4BCPA 1RW8A 4FGRA 4AN3A 4MVFA 4EKLA 3MFUA 4UMUA 3PG1A 3TJDA 4BWXA 3DK7A 3F3TA 3Q9XA 5BNJA 4EJ7A 2J6MA 4GJ3A 4AW5A 1KV2A 3K2LA 4F6UA 3HA8A 2R3JA 3G5DA 4AQCA 1IA9A 3RINA 1M17A 3UNKA 4GIHA 2XKDA 4NKAA 4TWNA 5HCXA 1XBCA 3V5WA 5M57A 1QMZA 3SQQA 3GC8A 2BVAA 3TZ8A 3C5IA 3ROCA 3ETAA 4Q5HA 1CDKA 4QP7A 4I5CA 4AW0A 2XEZA 3C0GA 4XV9A 3UDBA 5BVFA 1AQ1A 4FNXA 2OWBA 4WNOA 3FMHA 5DMZA 4JX7A 2CKEA 3NAXA 3DXQA 1BX6A 2QOCA 4MEDA 5IA2A 4KIQA 4J8MA 4OTDA 5GJFA 3NRMA 4AUAA 3PIZA 4WT6A 4E93A 3SV0A 4L3LA 5HGIA 4JBPA 2FO0A 2YN8A 3C4XA 5JGDA 5KHXA 1SVGA 1IG1A 4BBEA 3PTGA 4G5PA 3QCQA 4TWPA 4P4CA 5CU2A 3PVGA 3WIKA 3LIJA 3NX8A 2XNPA 4CG9A 1UWHA 2Z7QA 3QC4A 4W8DA 2F7ZE 2GHGA 3KB7A 4C35A 1V0BA 3V5JA 5AFVA 1R78A 1KOAA 3SOAA 3HV6A 3LJ0A 3SXFA 3U4UA 5AUYA 3LCSA 4FF8A 3Q9WA 3PRFA 4I24A 1T46A 4OTQA 3LCKA 3VO3A 3WF8A 4OAUC 2UZWE 3FKOA 2R3QA 4E3CA 1YWNA 1NVQA 5L2WA 2RG6A 4IFGA 2PWLA 3I60A 3O23A 3EYHA 3LE6A 3A7JA 5FXSA 1IAHA 1JSUA 4ZSEA 3MWUA 5I9VA 5C26A 3KULA 4FODA 3VBXA 1WBSA 4KS7A 3F3UA 4DEHA 5IA4A 5FP5A 5HLPA 4C33A 4BZOA 5HO8A 2OJJA 4RWLA 5AX9A 1UVRA 4BHNA 3UPZA 4XP2A 3GFEA 4RX7A 3VN9A 4EH5A 3W10A 4BCOA 2CN5A 4B99A 3IW6A 2BZHB 4YLKA 4I5HA 1G8AA 1DAWA 2C1AA 3FY2A 5EDPA 2YLEA 4GS6A 5M53A 4FKRA 2XNEA 3TCPA 4JRVA 5EOLA 1YHSA 2OGVA 3TNQB 5JGAA 3MN3A 4U41A 3QL8A 3NIEA 4ANOA 4EWQA 1LP4A 3MY5A 4EI4A 2BILB 4YNEA 1PXIA 1PW2A 4JJRA 1OM1A 3BYOA 4F63A 4D0WA 4YLJA 4FYOA 3VS0A 4LOQA 3VWAA 3UP7A 1FGKA 3IW7A 3FMJA 5CSWA 4OW8A 3A61A 2VO6A 3P1AA 5C01A 4Y46A 3F3VA 3FMEA 3ZZEA 4CMOA 3BQRA 3TWJA 3GOPA 3L8XA 4U8ZA 4JAJA 4IQ6A 4M8TA 3KULB 2DWBA 2PE0A 3UG2A 4U44A 1V0OA 1MRVA 4DH1A 4NFMA 4I22A 3C5UA 3V01A 2VWXA 3BWJA 2GNFA 5BVKA 2FSOX 3LCTA 3PG3A 4CSVA 2PVNA 1SYKA 4LRJA 4RJ8A 1FVVA 1NXKA 5IUIA 1KE5A 3H3CA 2Y6MA 3EYGA 4X0MA 2ETKA 3AD5A 4EOJA 2JIUA 2XM8A 3KA0A 3BLQA 3MB7A 2NO3A 3ZSIA 3CCNA 2C6LA 5B2LA 5H8EA 4TYIA 2CNQA 4R5SA 3ZSGA 5LXMA 4OAVB 2GCDA 3DBCA 3LFCA 4TWCA 5AEPA 2HWOA 4ITIA 4OTGA 3EQHA 4RT7A 4UWCA 5KE0A 3R1YA 3ZMMA 1H1QA 1UNLA 1YWVA 2I1MA 2Y4IC 3DBEA 3FZRA 4X7QA 2PHKA 4EYJA 4F0GA 5JFSA 3MIAA 5KNJA 3QALE 2ZM1A 4UMRA 4C2WA 1Q3WA 4FX3A 4AX8A 2BZJA 2QONA 5K5NA 5CANA 5I9YA 3EZVA 3RALA 3ODYX 2NRUA 3AD4A 3GT8A 3Q04A 4QTEA 2ONLA 3NUUA 3UBDA 2P2IA 3LFAA 4QMSA 4D5HA 5I9XA 3DDPA 3UIMA 2WHBA 4X3FC 4F99A 2B9HA 4EHGA 4L7SA 3QTUA 5HKMA 3W55A 4GIIA 4DC2A 4UMTA 5AUWA 3RVGA 5AUUA 2Z02A 2W1HA 1P4OA 3ENHA 4G6NA 5CF8A 3LFNA 4GU9A 4ANNA 1W84A 4QP4A 4RG0A 3A7FA 3BPRA 4TN6A 4EL9A 5IA0A 5DR9A 2BAJA 4EOLA 4ZAUA 2RFEA 4AGDA 2XS0A 4WSQA 2ZV9A 3Q60A 5IDNA 3V04A 4K0YA 3RK9A 4UXQA 1Q3DA 4FTRA 4C61A 1BLXA 4TZRA 4WNKA 4Y95A 4L67A 3HDNA 1R39A 3VAPA 4ZZNA 3OMVA 4A4OA 5IA5A 5AP0A 5J79A 1JAMA 2QQ7A 3GCUA 3O17A 4BCFA 4O7RA 3L8PA 5F95A 4F65A 5FM2A 2HZIA 3UVRA 3OCTA 1DAYA 2X2LA 4B4LA 3QQHA 3BU5A 1H01A 3KKVA 5C4LA 3W1FA 2JLDA 3H0ZA 4U43A 3HV4A 3PFQA 3UYSA 3MY0A 1S9IA 3UOKA 1WBTA 3AC8A 2I0EA 4AN2A 5BYYA 5EHYA 2B9IA 3KXHA 2BAKA 5DBXA 3ZUUA 2ITZA 2F4JA 5HOAA 2ITUA 3S0OA 3IW5A 2YIRA 5CT0A 4CFNA 3V8WA 2OU7A 3CTJA 3UOHA 1OBGA 3MFTA 5LWMA 4QMLA 2VV9A 2UW0A 5CEPA 1Q8TA 3CC6A 3H9OA 4EOOA 2VTAA 4HW7A 2Z2WA 4M7IA 3VBYA 4QMTA 1XHAA 4FMQA 5EDRA 3W33A 5HESA 1ZOGA 3BEAA 3FZTA 4QP9A 4NUSA 3PDTA 1H08A 4J96A 4FTQA 3GU6A 1S9JA 4D2VA 4QD6A 5JFXA 2XIYA 3G33A 3A7GA 3PSDA 4IZ5A 5ETCA 2GQGA 4C3FA 3PP0A 4G16A 3E64A 4QQCA 4IADA 5HVJA 5DGZA 4DFYA 5IF1A 2E9UA 1Q99A 2WMVA 3E93A 2YHVA 1YXVA 3KXMA 4RFYA 3UGCA 3QLGA 4D55A 3NS9A 4O0VA 2ITNA 4G9RA 2A19B 2PVLA 4FKUA 3KY2A 4IVCA 4RIWB 4DH8A 3QKLA 5IQIA 3UO5A 5DR2A 4K2RA 4GYIA 2FB8A 4WBOA 3D7TB 4ASDA 4KA3A 4UWYA 4EQUA 3CY3A 1UA2A 3JYAA 2RF9A 1GZOA 5FG8A 3FXZA 1ZARA 4ACDA 4M13A 2C0IA 1PY5A 1B38A 4ZLYA 3HUBA 4RA5A 2YIQA 3VS5A 1URWA 4FI1A 4WA9A 3F82A 2UW8A 1GZKA 3SXRA 1M2RA 5L8LA 3PA4A 5AV3A 2PVKA 3LCDA 3GU5A 4PDPA 3SDJA 2CGUA 4X2KA 5I9UA 5E8WA 4X2JA 3BRBA 5ANIA 3SA0A 5CNNA 3EIDA 4FUXA 2OXXA 2B53A 5ACKA 3II5A 4V05A 1RJBA 4ZTNA 2SRCA 5CX9A 3AT3A 5KBRA 3LXNA 2OICA 4CFWA 4RVKA 5A4QA 1OVEA 4KRDA 5AP6A 2R64A 3R1QA 2B1PA 5IEXA 3AT4A 5D10A 4GFOA 4KKEA 3GU4A 4HPTE 2C69A 2UVXA 5HIEA 4DGGA 3MJ1A 2OJGA 4E26A 5J5TA 4AT3A 4H3PA 3IW4A 2W1DA 3OG7A 3RHKA 2VWZA 3COMA 4DGNA 1APME 4PV0A 3SHEA 4JQEA 5E1SA 5HE2A 3DGKA 3RPYA 4IM0A 1F0QA 2J0JA 3QRUA 1E9HA 2ZV7A 3Q9ZA 4NM3A 3V5QA 4RWKA 1PRYA 1JNKA 5IH5A 4R3CA 1ZYJA 4JI9A 2XJ1A 2VX0A 4FSRA 3PPJA 3RZBA 3ZLYA 3TN8A 4BDJA 5A6OA 3R22A 4KBCA 2QG7A 3QTQA 2BRHA 4IACA 1U59A 4NW6A 4NZWB 4X3JA 5HVKA 3VBWA 1YI4A 2BRMA 3COHA 4ONAA 3R02A 4RLLA 3UMWA 3OCSA 4C4FA 4XG6A 5C8NA 3R9NA 5C03A 2CHLA 3CKXA 1OB3A 4O21A 1IA8A 2VX3A 4Z16A 5CAVA 5CVGA 3ITZA 2XK6A 4NCTA 3F3ZA 4YJTA 4RIYA 5HORA 2BAQA 4OTHA 3LOKA 3P4KA 1O6YA 4FIGA 3PXYA 3GVUA 4WD5A 5CVFA 5HHWA 1E1XA 3WILA 2UW6A 2VZ6A 5I9WA 2W99B 1IR3A 4J98A 2X4FA 4GRBA 3TACA 4YJRA 3N4VA 3QD0A 3QLFA 4O0YA 2XCHA 3PXZA 1DM2A 2UZVA 3FL4A 5BX0A 4EBWA 4C4EA 5HD4A 4PX6A 3F7ZA 4FSTA 4JQ8A 3ZCLA 3GCSA 4KBKA 3TIZA 4FGBA 2OZOA 1QL6A 3PY1A 4RBLA 3ZTXA 3C4EA 3LLAA 3I79A 4E4MA 2JEDA 5KUPA 2PVMA 3QXPA 3FMNA 4JRNA 4MBLA 1PKDA 3FMKA 4F7SA 2DQ7X 3R63A 3SC1A 4M3QA 2REIA 1CKPA 3C0HA 1XKKA 3ZS5A 3LMHA 4K77A 4MD8E 5A14A 3ELJA 4TYHB 1PXLA 1YDTE 2HENA 2YDJA 1XQZA 4G9CA 3ORKA 2WTJA 3MPTA 4RVTA 2GS6A 2B54A 4DCAA 3PP1A 4A9YA 3HP2A 5CXHA 4ZSLA 4YTHA 2PYWA 2RKUA 5A4TA 4IB5A 2GNGA 2C6DA 2GNJA 3OEFX 1QPEA 3D4QA 4HYSA 5M51A 2I0YA 1GNGA 4UWBA 2V0DA 2YM6A 4FNYA 2C5NA 2PMIA 4F7LA 4YZDA 4PDOA 3Q4ZA 3KN5A 3QC9A 4MBIA 3OW3A 3OF0A 4TYGA 2CJMA 3R01A 1BL6A 5D7AA 2QKWB 4H1MA 3FI2A 2IVVA 3BE2A 3EL8A 4EK5A 1SVEA 2ZDUA 4LRKA 3OXTA 4CQEA 5M07A 4RX9A 3TEIA 3OTVA 4F9AA 3KK9A 1Q8UA 1H1PA 2XIKA 3FQHA 2WOUA 5ANJA 5AIKA 5IUGA 1XWSA 3GXLA 5DE2A 2W5AA 3LJ2A 3LXPA 1YDSE 3PWYA 3QRIA 3L9PA 5J5SA 3OD6X 2Y7JA 2X7FA 4DH5A 1YHVA 2O8YA 3GCVA 5BUIA 4W4WA 2PUNA 3R7IA 2QURA 1OGUA 3IONA 2BPMA 3LFFA 1RQQA 2ZV8A 3G6HA 4IH8A 4L44A 4H1JA 3OTUA 4O83A 3DA6A 3ZLXA 5M4FA 5LVMA 2IZRA 3CJGA 3ZYAA 4YU2A 4ZMFA 3R9HA 4AZWA 3U6HA 2BKKA 2WQBA 3HDMA 5ANDA 4FV7A 1OL1A 4MH7A 4FT9A 3E63A 5FXRA 4GUEA 4FZ6A 4RVMA 3Q6UA 5DEYA 3VW8A 3WZUA 3IGGA 3PXFA 2CSNA 2HW6A 4RFZA 2FSTX 3NYOA 2QR8A 2WB8A 3ZDIA 2W4JA 3OW4A 2O65A 5AX3A 3BBTB 1TQPA 3GB2A 4QMYA 5KMOA 3OP5A 4FKTA 3HRCA 4NK9A 4Y8DA 3OVVA 1QPJA 4BCMA 2JDOA 1NVSA 4JG7A 2YM3A 3ZO3A 4M69B 4U80A 4NJ3A 3NEWA 2XK8A 4AG8A 3ET7A 4BCQA 4CQGA 3DAEA 1H28A 2QOHA 4HPUE 3BX5A 4IAZA 2OFVA 4Z9LA 5HO6A 3ZSHA 4FSYA 5M06A 4C2VA 3QD2B 5HG7A 5GZ9A 3NIZA 2LAVA 5EH0A 3UPXA 4QMOA 3ORZA 4UY9A 2UW3A 4NTSA 3BGZA 1YXSA 2Z8CA 2IW9A 3R8PA 2FGIA 3GOKA 3K3JA 3HMPA 3UO6A 3ZO4A 4GK2A 4LV5A 5M4UA 3CD8A 4FVRA 3P08A 4YZ9A 3W8LA 5EI2A 3CPBA 4A07A 1OITA 1ZXEA 2J5FA 3FPMA 4YURA 4WRGA 3IDCA 4TPTA 2XMYA 4BCHA 3SXSA 3A2CA 3CEKA 5AP2A 3N51A 3AG9A 3F7WA 4BGHA 5C4KA 3ZEWA 3TNHA 4AFJA 5HU3A 2GNLA 5JQ8A 2H9VA 3IDPA 4ASZA 3V5TA 2BRNA 5HTBA 3RAHA 2GQRA 1J3HA 3CP9A 5CLPA 3QF9A 4TKSA 4FE2A 4E20A 5DVRA 4EHVA 2CNVA 4ZJJA 3ODZX 3MS9A 4O2PA 2EWAA 2Q83A 4NM7A 2DUVA 4LYNA 3FQSA 5IQHA 4LL5A 4N57A 2PY3A 4RZVA 3IPHA 2CKQA 3PSBA 4ZEGA 2PK9A 2HIWA 3HL7A 3CXWA 3HX4A 4TNBA 5E91A 2H8HA 4RWIA 3IQ7A 4AS0A 4EK6A 3PXRA 3TNPC 1H1SA 2BIKB 4KIKA 4L3PA 3MGYA 1YXTA 4BCGA 1XH4A 4JDIA 4KIOA 3MIYA 5CZIA 5AADA 4BBMA 2UZLA 4QO9A 2BTRA 3ACJA 4JNWA 4I5MA 4YLLA 3F66A 5EI6A 3ORTA 4KAOA 3BI6A 3NW5A 3E8CA 4UZHA 1CSNA 5T68A 2BCJA 1WBNA 2X9EA 3ZUVA 5IEYA 2XIXA 4G3FA 3AC5A 3E7OA 4BDHA 5JMSA 5IA3A 5TR6A 4HNIA 3LHJA 4QMNA 3KCKA 3FHIA 2P3GX 4MYGA 3RCDA 4F0IA 2PVFA 4CLIA 4QYEA 4QMZA 4TW9A 2VN9A 3T9IA 3VBVA 5JQ5A 3REPA 2OF2A 3FEGA 5D7VA 5KZ0A 5KKRC 3MTFA 3QGYA 4RX8A 1WVWA 2VTMA 4WG3A 4P5ZA 4XJ0A 5HE1A 4HVHA 4FTMA 2VTNA 2XB7A 2ZMCA 3BBWA 2NRYA 5IU2A 4OTIA 5A4EA 2YAAA 4X6RA 4USDA 3U9CA 4FKSA 4B8MA 4EOIA 3P9JA 4JG8A 1WAKA 2VO3A 2JD5A 3DFAA 3E5AA 4QMQA 3COKA 3R9OA 4ZSAA 3RCJA 5A46A 3PUPA 3ZFYA 4APPA 5J9YA 3VQHA 2OJ9A 1T45A 1UWJA 4K8AA 5GZAA 3R9DA 4F1MA 2VTRA 2R4BA 4DN5A 3ULIA 4FEWA 4EOQA 5KMNA 4JBQA 4FEQA 4GVAA 3V6RA 4C02A 3NUYA 3HUCA 2W1CA 3WF6A 5J7BA 3C4CA 5HTCA 4DFXE 1BKXA 3JUHA 2WIPA 3UC4A 1LUFA 3LMIA 4Y85A 3V8SA 3QWJA 1OL7A 4I6FA 3EQDA 4ZY6A 4DEBA 4DG2E 4CLJA 2YDIA 4IE9A 2O3PA 4ZXTA 3CPCA 4IW0A 3QQJA 4G17A 1R3CA 1M7QA 3UZPA 4FTIA 4ALUA 4FNWA 5HEZA 3H9RA 5CAUA 2OKRA 3PWDA 2X81A 5C8KA 2JFMA 4G3GA 3DLZA 4YJOA 5J87A 3RKBA 4CV8A 2YZAA 2YIWA 2HXQA 3EQFA 3IOKA 3ZM4A 3OHTA 5EM6A 4RJ3A 4M0ZA 2Y4PA 3U8WA 5HNIX 3RK7A 1Q8WA 3GI3A 3MFRA 4IX6A 4E4NA 2BALA 4M14A 1UNGA 4K1BA 4AN9A 4YP8A 3VS3A 5E8VA 3QHWA 4U3ZA 2GFSA 4YHFA 5AAFA 5BUJA 2CLQA 4IBMA 2ERZE 4IWOA 4XRLA 4C37A 5LOHA 4D9TA 3RPSA 3UE4A 5FM3A 2HELA 1PMVA 4ZLOA 4FTAA 1TVOA 1KE9A 3FLZA 4I0TA 2QLQA 2J4ZA 2WTCA 3FLQA 3TUDA 3HECA 4EH8A 4Y83A 3KXXA 2JFLA 4O82A 5IPJA 4OUCA 5L4QA 3A62A 5DT0A 3UNZA 4DFZE 4ZTQA 4WIHA 3FLYA 1YXXA 2Z7SA 4KSPA 2I0HA 2WMAA 1GOLA 3HYHA 4O0RA 5LMKA 4JR7A 3SAYA 4ANMA 3NNUA 4IVAA 5F20A 3R04A 3H4JA 4TRLA 4QYFA 4MF1A 3ZRKA 4O6LA 4IX3A 1NT2A 1IEPA 3C50A 5ANGA 5JFVA 4O22A 4NCTC 4IJ9A 1W0XC 4TTHB 4XS2A 5DN3A 3U54A 3FZOA 1REKA 2H34A 4NIFB 2P2HA 3MFSA 1GIJA 2GHLA 1ZY4A 4GW8A 4RLKA 4TY1A 2EUFB 4XRJA 3E7VA 3FAAA 1ZRZA 4WUNA 3R0TA 3ZC5A 5CEOA 5IH6A 2I0VA 3RTPA 4OT5A 3WF7A 3DJ6A 4IMYA 4IAFA 4FSWA 4KS8A 4O0XA 4QQJA 5H8GA 4QQTA 5J9ZA 1FVRA 1XH8A 4K33A 3I6UA 5L8KA 5JGBA 3PLAE 5KCVA 3TT0A 2WTDA 3F3WA 4O1PA 3V3VA 3U87A 3LCOA 4OTWA 3WOWA 3IW8A 3QUEA 3W8QA 3P78A 3R6XA 4FIHA 3ID6C 1SVHA 3D0EA 5T3QA 5AP5A 3VULA 1KE7A 2WZJA 3A4OX 4XP0A 2VTLA 4BR3A 3UG1A 3MESA 3KRJA 1MRUA 1WCCA 2ZOQA 2BR1A 1JKLA 4BFMA 4KINA 4DG0E 2C68A 3A99A 3RWQA 5A3XA 4UALA 5F1ZA 4CVAA 1ZWSA 5GJDA 2ZYBA 4ANQA 2JAMA 3QA8A 4OTRA 2HOGA 4ZTHA 3THBA 2E9OA 3BYUA 4AWIA 2P0CA 4JG6A 4JBVA 3UP2A 3GQLA 4E4XA 2F57A 1Y6BA 1FQ1B 4U9AA 3RK5A 2WMBA 3GEQA 3F6XA 3D83A 2EXCX 2XK4A 3DAJA 2VTPA 4FV8A 4JIAA 5BQ0A 4RC2A 5K3YA 3WF5A 4C57A 4EUUA 4AZVA 5HVYA 3BHUA 4GKIA 4QMVA 2YISA 3UVQA 5AR8A 4FTOA 1O9UA 4QTBA 1ZZ2A 4IANA 2UV2A 3KRRA 5AA9A 2O2UA 4IZAA 3IGOA 3W2RA 4AAAA 2DYLA 3U55A 5HG5A 3OS3A 3QQGA 4FZ7A 4MHAA 4AE9A 4E5WA 2PE2A 2W1ZA 4GUBA 4QMWA 3DK3A 5KMKA 1I09A 2VGPA 2QO7A 3R7GA 4I6HA 3E3BX 4LM5A 3UC3A 4FV1A 3PJ8A 3R7UA 3ZO2A 3UO4A 2X7GA 2WMSA 5D12A 1SM2A 3DKCA 3RM7A 4CYJA 2PZIA 4ANLA 4O7NA 4GL9A 2C0TA 4CEGA 1M52A 4ZY4A 3KXZA 4L8MA 2YDKA 4C4JA 5ANOA 3L8SA 2IZTA 4B6LA 1ND4A 2UZNA 3DS6A 1OI9A 1O6LA 3P7AA 4FZAB 4MNEB 4GFMA 4IC8A 4DGMA 2C5YA 4LGGA 1PMEA 4RJ4A 3E87A 3Q96A 4PTCA 4ZTSA 4BHZA 4O6EA 4V0GB 3DY7A 2VTHA 3K5VA 3BU3A 5CQWA 4BBFA 3NVMB 1KOBA 3QBNA 4RQKA 4D4SA 2VAGA 2EB3A 1J7IA 4RQVA 1VJYA 4YHJA 2EXMA 1H1WA 4CMUA 3DFCB 3ZM9A 2R3RA 4EOSA 2ITWA 4IVBA 4C0TA 3QYWA 5D11A 1YVJA 3IS5A 4DFNA 3PSCA 4KKHA 1BI7A 5DPVA 3HNGA 2YACA 5IMEA 4RRVA 4LMNA 3OC1A 4DYMA 4XUFA 2X2MA 1GZ8A 1PF8A 5DLSA 1UU9A 2YIYA 1GZNA 3FZPA 3U9NA 2VTQA 3LZBA 4QYHA 5EDQA 5L2SA 3QKKA 3B2WA 4LOPA 1WZYA 2GNHA 3CQEA 5I0BA 3NR9A 5GHVA 3OCGA 4IB1A 4AT4A 3FY0A 3AC3A 3L9LA 3NGAA 3KRXA 1RE8A 2WXVA 2KULA 3MSSA 4FTTA 4OTPA 4ZTLA 2A1AB 4GG7A 5IQCA 5L2TA 3QXOA 2O64A 3VUKA 2W1IA 4FK3A 4FA2A 3HRBA 2VUWA 3BELA 2QHMA 5BVWA 1WMKA 4BF2A 3Q2MA 5AJQA 2GTMA 4PF4A 2KTYA 4TYEA 4IJPA 1M7NA 4MWIA 3W32A 3SOCA 5CSPA 4K11A 2QO2A 3VUMA 4EH7A 3F2AA 4FK6A 4EC8A 3RNIA 4KB8A 2EB2A 2YM7A 3OWKA 4PPCA 4ERWA 5CAPA 4WG5A 3VBQA 4AGWA 5LMBA 2W1GA 3UOJA 4YJSA 2OK1A 3V5PA 3CY2A 3TZMA 2WMTA 4PPBA 4O7SA 1GAGA 5T6KA 4NWMA 3C4WA 3HKOA 3Q4TA 1Q61A 3QWKA 3JVSA 4LUEA 3D7ZA 3MB6A 5CAOA 3R8ZA 3H30A 5EYCA 1K3AA 2YA9A 3RM6A 4R7BA 3DDQA 3NYVA 4MF0A 4XLVA 4MWHA 5GIPE 1MQBA 4M0YA 3T8OA 2PVYA 4EOKA 2NNWB 2JDTA 1NVRA 5IH4A 2R3IA 5ETAA 1XBAA 4RIWA 1AGWA 3E3PA 4HGEA 2B9FA 4JL9A 3M11A 2QKRA 3D7TA 3MV5A 3NCZA 2BIYA 1UNHA 3UNJA 4EJNA 3SX9A 3ATSA 4EZ5A 4EYMA 2XUUA 4IX5A 2NPQA 5CNOA 4S2ZA 2P4IA 2IVSA 3ORNA 2V62A 3QRKA 5LVNA 4HJOA 4CRSA 3OEZA 3HMIA 5LCKA 3LW0A 4BI2A 3UZTA 4O7WA 4Q5EA 4L01A 3T3VA 4QQ5A 2RSVA 2CN8A 1G3NA 3FKNA 4U79A 5F94A 3ANQA 3ORLA 4DCEA 5IISA 4RC4A 3AQVA 2GS2A 3E92A 4Y5HA 4C7TA 4X21A 3FI8A 3JR1A 1KSWA 3Q9YA 3S95A 1OL2A 1OKVA 3BEGA 2IO6A 4FV3A 4AZFA 4CFVA 4BWPA 2E9PA 1H27A 3P7BA 3C1XA 4AW2A 4F7JA 3JXWA 3IG7A 4B8LA 5BVDA 4ALWA 2QOIA 4RJ5A 2QCSA 1J1CA 3BCEA 5EOBA 3EFLA 3I1AA 1R0PA 3AMAA 3BYVA 2ZMDA 4MXOA 4OBOA 4ZP5A 5FEEA 5CASA 2F2UA 4DITA 1P5EA 3H10A 2UUEA 3L9MA 4E8AA 1G5SA 4O7TA 4FT3A 4O7YA 3TL8A 2JKOA 5HG9A 2FH9A 3FMMA 2J0KA 2OO8X 2ZAZA 3AMYA 3OUKA 2BZKB 2JIIA 2XK9A 1W8CA 4M67A 3RAWA 4BDFA 3P0MA 5J7HA 1H25A 5L6OA 3KC3A 3HZTA 3ZBXA 3MW1A 4E6AA 4XG3A 4YZNA 3IECA 3PY0A 1ZY5A 4FTUA 4IWQA 4LUDA 1JQHA 5EW3A 5FD2A 3U4WA 4DF3A 4YMJA 3LAUA 3WZEA 5FBNC 4J53A 3HAMA 4PNKA 1FGIA 3R83A 5K4IA 2YERA 2XYUA 3D15A 5CEKA 3F5UA 3KF7A 3A4PA 3Q53A 3HP5A 2V55A 2WU7A 3LFQA 4XMOA 5CSXA 5CU6A 3OWLA 5E4HA 1H24A 4AA5A 3NAYA 5AM6A 1E1VA 1KE8A 4QP1A 4EH4A 1PXPA 4BDBA 3BKBA 5FP6A 5JH6A 4FOCA 3BYMA 4BZDA 3VBTA 2PZRA 4BYJA 4MK0A 4MXAA 4XHKB 3GC9A 3EH9A 3BLHA 3G0EA 2O63A 1Q97A 5KZIA 3FSKA 4GCJA 4R7HA 2XZSA 3R2BA 5JN2A 4EHEA 1Z5MA 4OLIA 4DEGA 1M14A 4I94A 5EM8A 4D28A 5B7VA 2RG5A 4HOKA 4FT7A 5E8ZA 3U51A 4AP7A 4F09A 2X9FA 3NNVA 3FPQA 3QYZA 4RJ7A 3MA3A 4W4XA 3TNIA 2X8DA 1SNXA 2PVHA 5TT7A 3KN6A 3CKWA 2W05A 3DNDA 4RIXB 4DLJA 3BGPA 3ORPA 2PVRA 4K18A 2P33A 2WAJA 4QYYA 4RSSA 4BB4A 4H05A 4ANBA 2NP8A 2PTKA 4JR3A 2BMCA 2G2FA 4AZSA 4L52A 2ZB1A 3R7VA 3P86A 4CD0A 4YTIA 3HGKA 4BICA 4X2NA 1NW1A 4ERKA 1PJKA 3ERKA 5CQUA 4I1ZA 3V51A 3VJOA 4UN0C 5FDPA 4G3DA 4DTAA 2ITQA 2JDVA 4BCIA 1ZOEA 5IQAA 4TYHA 2IWIA 4FT5A 3Q2JA 1JKSA 2IW6A 3ZC6A 3M2WA 1ZYDA 3PVWA 4YSMA 3AOXA 4PY1A 4XV3A 4BI0A 2GFCA 1ZMWA 3DBDA 3I0OA 4R7IA 5GINE 2ITYA 5LMKC 3NMUF 3P7CA 1ZLTA 5GJGA 4KSQA 2UZTA 2QOFA 5M44A 4AW1A 3C51A 4YR8A 5AP1A 1MRYA 3PJ3A 4I41A 3FHRA 3QHRA 3KL8A 2WTKB 3MDYA 3CTHA 3DJ7A 4PRJA 4FIEA 3TKIA 5FWKK 3FYJX 5IKWA 1Q8YA 2VWBA 4HVSA 4FKVA 5IMXA 4K6ZA 3BHTA 3ZDUA 4HGSA 3CJFA 4A9UA 4D2SA 4JDKA 5TE0A 2JDSA 3QAME 3SKCA 4DEEA 4I0SA 4Y5QA 4D2PA 5M56A 5B0XA 4YZBA 4FICA 3EHAA 4E6CA 1PXMA 3AGLA 2CKOA 2PUUA 3GNIB 4QNAA 3DTCA 5DFPA 3KVXA 4EH9A 1KE6A 3PXQA 4GT4A 3RPVA 3S3IA 5CF5A 2OBJA 3VRYA 2OLCA 1H07A 4BZNA 4AFEA 1PYXA 4D1XA 3MH1A 3AC2A 2FA2A 4ITJA 4EK3A 4R1VA 1VYWA 4E6QA 3JY9A 3D2IA 3FJQE 4C59A 2XRUA 3O50A 3R2YA 4EBVA 2C4GA 2W06A 5CSHA 4CFXA 2H96A 4FKPA 3PZEA 5DRBA 4OBPA 4I21A 3QTIA 4RIOA 2ZM3A 3LMGA 4GK3A 3UIUA 2Y8OA 3IOPA 4L6QA 3UIBA 2OIQA 2HYYA 3LM0A 4IM3A 4D0XA 4BTFA 2R3HA 4OBQA 2JGZA 4U45A 1WVXA 1HCLA 2ACXA 4ZY5A 3K5UA 2VTTA 4AACA 4BI1A 4FTJA 4FSMA 1U46A 5HZNA 5EG3A 4DTBA 4JLCA 2CNUA 5GNKA 4RJ6A 3MJ2A 2R3MA 4O7VA 4O7LA 3G51A 5I3RA 4FKLA 2WU6A 3QTWA 2WELA 1NY3A 1SMHA 2PL0A 3EL7A 3EN9A 3FZSA 3EFJA 3JVRA 3MA6A 4UBAA 3SRVB 3TKUA 5CU0A 4S30A 3NNXA 3AMBA 4M84A 1UU8A 4PP9A 5AUVA 2WQEA 5M4CA 3VRZA 1YI6A 5IA1A 4DEDA 4QT1A 2ITOA 5K4JA 4CG8A 1FMOE 3FZ1A 3BV2A 4W8EA 5EHOA 5TF9A 4D5KA 5FBOA 4EH6A 4L45A 4TYJA 1Q5KA 5EW8A 4NM0A 1ZOHA 3MH3A 3DKGA 2OZAB 3SGCA 5M4IA 3FL5A 1DS5A 4Z3VA 1OPLA 4UYAA 2XYNA 3GU8A 2XCKA 3E8DA 4YGAA 3TV7A 4A9TA 4AXAA 4AZEA 3LKMA 2YABA 3TG1A 4ASXA 4BY9E 4FKJA 4CZTA 4W9XA 5LVLA 5JRQA 3W2SA 2WFYA 3B8RA 3BZ3A 2OJIA 4LMUA 4ASEA 1XH7A 5CS6A 2BKZA 4DFLA 3FV8A 4G3EA 2R3FA 4KBAA 2YJSA 4J71A 2QLUA 3F2RA 1JSTA 2W9FB 4MXCA 4P5QA 4FV2A 3KREA 2XK3A 3BWFA 3VF9A 1PMUA 2WTIA 4R78A 4XG2A 4F7NA 3EZRA 5LARA 4LQMA 2C3IB 4J1RA 4NTTA 4PL3A 1PYEA 3EB0A 4F6WA 3TZ7A 2YCFA 3EKNA 1ERKA 2G9XA 2J0IA 4BCKA 3S1HA 3RMFA 2QHNA 2X4ZA 1VYZA 4FTKA 4AA4A 1YDRE 2UZOA 5I9ZA 2HZ4A 3R7YA 4BKYA 2YWVA 1PXNA 3IKAA 3QCXA 2WO6A 1REJA 4GSBA 3UQCA 2GMXA 4M15A 1L3RE 3LFBA 4GKHA 1JOWB 2RFSA 1WBWA 2IG7A 3ZH8A 4ALVA 3WARA 1A06A 4CFFA 3KMMA 5AM7A 4WO5A 4DT9A 1BYGA 4J95A 3QUDA 1J7UA 4EZ3A 4CXAA 2GQSA 1ZMUA 2EU9A 2J9MA 5IUHA 3WF9A 4QRCA 4QP2A 3DOGA 3R21A 3E88A 4WNPA 5DG5A 4PMTA 4ZS4A 2HCKA 3I5ZA 5EHLA 4MD9E 5IZFA 2GTNA 5AMNA 4GU6A 3DBQA 3EMGA 3VF8A 3UZRA 1CTPE 1Y8GA 3RWPA 4JQ7A 4ZTRA 3VC4A 2Y4IB 3ZONA 4F9YA 3CR0A 4NKSA 3POZA 3LM5A 4I5PA 4N6ZA 2VWUA 4RC3A 4B9DA 2PVJA 3F9NA 4ACMA 1PHKA 5IQEA 1V0PA 3DAKA 2VWWA 2PUPA 4BGQA 4F9CA 3QTRA 2QU6A 4YHTA 4AT5A 2A0CX 2VD5A 4FYNA 3SW4A 3DBFA 4D58A 5CF6A 4DT8A 4MKCA 3PRIA 2QNJA 2QVSE 1M2QA 1WVYA 2ESMA 2HZNA 2WQNA 3F5XA 3D9VA 4OGRA 4C34A 2PZ5A 2VNWA 2ZV2A 4S34A 2QC6A 2RFDA 4FNZA 3G6GA 4HYUA 2PULA 3Q5IA 3FDNA 3N4UA 3E8EA 3TTJA 4O0UA 2QR7A 4YNOA 5HLNA 3RHXA 4F6SA 3QZGA 4MX9A 2Z7LA 5AV1A 1Q4LA 4CCUA 4YSJA 4Z7GA 1J7LA 3WE4A 3F88A 4WOVA 4I6BA 1YRPA 3RGFA 2ERKA 4BWKA 4PQNA 3M1SA 3QQLA 4PUZA 2I7QA 3C0IA 3UJGA 2JBPA 3AXWA 2ZDTA 3A60A 4ACGA 4FKGA 1Z9XA 5I5ZA 5CVHA 5FTQA 2C6TA 4NEUA 4D4RA 2VO7A 3NUNA 4IDTA 4DLIA 2PPQA 3NWWA 1Y91A 4DE4A 3RNYA 5D1JA 4CTCA 3LLTA 4OTFA 3SG9A 2QOKA 3C4FA 4MQ1A 3DU8A 4U0IA 4BDAA 5DYJA 2VWIA 4NW5A 2AYPA 4S33A 5CU4A 4A06A 1H26A 3R1SA 4YC3A 3VS6A 4I92A 4CZUA 5FRIA 2IJMA 3ZUTA 3ORXA 4C62A 5ETIA 3ZBFA 2XNOA 4ZOGA 2XJ0A 4KNBA 4ZJVA 3EQBA 5E7RA 2Y6OA 5K0XA 3OWPA 5I4NA 5L3AA 3V5LA 1OMWA 4PTGA 3OY1A 2VTJA 4RWJA 3VHKA 1OIQA 3PJ1A 4HYIA 4MXZA 4UV0A 5KMLA 3S2PA 4NSTA 3FI3A 2V5QA 2ITTA 3DKOA 4GH2A 4UYNA 4A9SA 2YJRA 4MBJA 3RI1A 5ACBC 3U6IA 4GT5A 2WMXA 4L53A 2OIBA 5LJJA 5AIRA 4U6RA 3Q32A 4CT1A 2YCQA 4RZWA 3EN5A 4J97A 5HBEA 2UW7A 2XF0A 4LV8A 5IG1A 4FL1A 5AR2A 3BHHA 1XO2B 3QA0A 3QCSA 3QTSA 4E7WA 4XX9A 4BDCA 4EQMA 2WGJA 2R0IA 4EUTA 4IM2A 3EFKA 2YM8A 3HV5A 4I0RA 1FVTA 4J52A 2QODA 3EFWA 4NIFA 3R8VA 4J8NA 2CPKE 3TKHA 1J1BA 2V22A 2QOOA 5BYZA 3HMMA 3MVJA 4BIDA 5KHWA 4YJQA 4OT6A 4Y72A 4R77A 3QX4A 2WD1A 4BDIA 1JLUE 3NYNA 3EQCA 3O71A 2YCSA 4IWDA 3POOA 2WQOA 3S4QA 1VEBA 4YPSA 3KMUA 5J8IA 4O0WA 4N4SA 1L8TA 2FYSA 2HWPA 2QI8A 5FUTA 5CALA 4EONA 3L1SA 1FINA 2BTSA 4FTNA 4J7BA 1URCA 2C6MA 4E73A 3VS7A 5ICPA 3TXOA 3QRJA 4O38A 3G15A 1ATPE 2ETMA 3D14A 2BZIB 4M97A 1Q41A 5HX6A 4IB0A 1ZAOA 2XNMA 4QNYA 5L2IA 2W5HA 3TNWA 3MBLA 3UMXA 4NT4A 2DS1A 2X39A 4D4VA 1PKGA 3MTLA 4KD1A 4BGGA 4EK8A 1Z57A 4IB3A 3P79A 3PIXA 1LR4A 4Q9ZA 4C4HA 2UVZA 3SD0A 1WFCA 2HK5A 4JXFA 2C3JA 2R9SA 3ACKA 4FSZA 4CRLA 4CFUA 2W1EA 3Q4UA 5H2UA 3GU7A 3OY3A 1U4DA 4R1YA 3TI1A 4HCTA 1U5QA 5IDPA 3TZ9A 1U5RA 4PDYA 1XBBA 2C5OA 3C7QA 3G90X 4YTCA 5EQEA 5B2MA 4ZMEA 3PY3A 2X0GA 4WRSA 2IVTA 2X2KA 3TJCA 5AUTA 5DWRA 3MY1A 4JVGA 4BRXA 1LEWA 5HBJA 4DH7A 4E6DA 2G2HA 2PZYA 4AGCA 3EQPA 4U5JA 1PXOA 3UODA 4QYGA 4RVLA 4S32A 3Q4CA 4FEUA 3W2PA 4CFMA 3TDWA 3W18A 1WBVA 2RFNA 1QPDA 3FQEA 2VRXA 3FWQA 4QPAA 4X6QC 4R6VA 5EKOA 2UW9A 4FV5A 4AZTA 2YZLA 4XV2A 2QOBA 4E5BA 3TV4A 5EQPA 3WIGA 4PP7A 3VUGA 3RPRA 1W82A 3EQIA 4EC9A 3CQUA 3E8NA 3DQXA 5DEWA 5L2QA 1B39A 2G1TA 4ZLZA 5EM7A 4II5A 4FV9A 2B52A 2JKKA 3D5VA 4GK4A 4XOYA 5AR7A 4USEA 2R3NA 4R8QA 3ZFXA 2C5VA 4O81A 5FTGA 3FMLA 3QD4A 5A4LA 4FEVA 4IAAA 4MNEA 4CKJA 2E9NA 4HCVA 5JK3A 3ORMA 2GS7A 3CBLA 3KRLA 1YW2A 3VIDA 4XV1A 1YKRA 2OF4A 4O1OA 2JDRA 5LVOA 3H0YA 4V0GA 2V7OA 3G9LX 4XG7A 3GGFA 3AC4A 4YPDA 1ZYCA 2C47A 4CKRA 3ANRA 1BUHA 5FLFA 3DB6A 1P2AA 3FLWA 1R1WA 3P5KA 3MVLA 1GIHA 3ZOSA 4ZS0A 2BFXA 4P7EA 4MNFA 4EORA 1FMKA 1FPUA 2EVAA 2OSCA 2CGXA 2C3KA 2PSQA 4F9BA 1XJDA 3D5UA 4F0FA 3BGQA 3ZXZA 1UKIA 4JT3A 1JSVA 4QMMA 4W9WA 5DHJA 3NCGA 2ZB0A 4IX4A 4AOTA 5AR5A 3L8VA 4L68A 4G6OA 4MTAA 4PTEA 3ALNA 1CM8A 3PZHA 2JITA 2BDFA 4U7ZA 2X8IA 2B9JA 2PMNX 4HVIA 2F49A 5DRDA 2B4SB 3HVCA 1Y57A 4CT2A 5HE3A 4BTKA 1OZ1A 3G0FA 1AD5A 2OH0E 4TT7A 4C38A 2W0JA 2WOTA 5HO7A 3O2MA 4I93A 1F3MC 1DI9A 3PA3A 4I20A 3TM0A 3HV7A 4QTDA 4UMQA 4A4XA 4C58A 2XNNA 3O8TA 3CQWA 1YHWA 3OXZA 2XA4A 4XG8A 4LOOA 3I81A 3BV3A 4KKGA 2CKPA 2WIHA 3DKFA 5LMAA 4G2FA 3KXGA 5EYDA 5EYKA 4KRCA 3V6SA 1I44A 2X1NA 3I0QA 4HYHA 4CTBA 2JKMA 3OOGA 3I5NA 1UKHA 4O96A 4BDDA 5KO1A 5KMIA 5EW9A 5HTIA 2OFUA 3BE9A 5M09A 5EI8A 3VW6A 1O6KA 4ZJIA 4R5YA 4Z55A 1A48A 3PJCA 5HIBA 2GPHA 2CCIA 4CKIA 1JPAA 3FLSA 5H8BA 2OW3A 4P2KA 1BL7A 2A27A 5AUZA 3UOLA 4N6YA 5J1WA 1K9AA 2PUIA 4XBRA 2PMOX 4JBOA 3O8PA 2J51A 3O7LB 3ZO1A 4CMTA 2VWVA 2WTVA 4ARKA 4YZMA 4XEYA 2CDZA 3IDBA 4L7FA 4L46A 4WNMA 4AOJA 4QP6A 1Y8YA 3O51A 1BI8A 4IAKA 4Q2AA 3KEXA 4ZSGA 2YLFA 4USFA 5CYIA 3R8UA 4D4YA 4JDJA 4UB7A 1OL5A 3NDMA 1P14A 2BHHA 4I3ZA 4QTCA 1TQMA 3F2NA 3A7HA 1XH6A 2XBJA 2YEXA 4WUAA 3DXPA 3ZXTA 4J99A 3G9NA 3OBGA 3Q6WA 5HLWA 4BN1A 3O0GA 5AV0A 3V8TA 3LJ1A 4I6QA 5CTPA 1H0VA 3FKLA 3VQUA 3RBWA 4L3JA 3N9XA 3AD6A 3CSVA 3LFEA 5D41A 2XKEA 4BVUA 2WEVA 4IZ7A 3OROA 3FYKX 1P4FA 3W16A 2B0QA 3MVHA 3QCYA 1H0WA 5TO8A 4XLIA 2B7AA 5DT3A 4A7CA 2IZSA 4BDGA 2WTWA 3W2OA 3GCPA 3UVPA 5M08A 3MPAA 4AE6A 4HZSA 5IQBA 3SLSA 3D94A 1YOLA 1ZYSA 3QZIA 4FEXA 3DQWA 3EKKA 4AGUA 4TXCA 3ZRMA 5G1XA 2X8EA 2FSLX 1UU3A 3GC7A 4DBNA 3SG8A 1OIRA 3PPKA 4H58A 2JAVA 4X2FA 4F08A 3PPZA 2J0LA 3QGWA 4F4PA 2WMRA 4N0SA 2XKFA 3K54A 4EKKA 1SNUA 2WQMA 4PDSA 4AOIA 3VUDA 5K9IA 4FR4A 1XH9A 4FUYA 4ZK5A 5G6VA 3FC1X 4B7TA 1W7HA 3RAIA 3TIYA 3ZU7A 2W4KA 4L43A 5HICA 4BDEA 5C27A 4M69A 5FDXA 2HY0A 5K5XA 3DT1A 1IRKA 3R28A 4G31A 5FGKA 4DH3A 3EN6A 4RFMA 3JY0A 3C9WA 4LGDA 2XNBA 2C6IA 3KU2A 1OKWA 2Y9QA 4FVPA 2CGVA 5AV2A 1UU7A 3HA6A 4KABA 2BROA 4M68A 3DB8A 3GBZA 3FSFA 4EQCA 5CT7A 2I6LA 4H3BA 3MPMA 1W98A 4MD7E 2WNTA 3HLLA 3DPKA 3GQIA 4IXPA 4PNIA 2QOQA 5D9HA 5HD7A 1FBNA 3ALOA 3QU0A 2XK7A 4O7ZA 3TV6A 3QKMA 3I7CA 4A9RA 1JBPE 2J5EA 3BIZA 5ANEA 4BCJA 1MP8A 5EM5A 3OXIA 3KXNA 5AWMA 3DZQA 3OWJA 4EK4A 2F2CB 5ITAA 4U42A 3ZLWA 3QTXA 3R00A 3CGFA 4EH3A 4ZIMA 1Q62A 2JC6A 2QOLA 2RL5A 2CMWA 5DI1A 5AP7A 5JRSA 2YM5A 1H1RA 3EWHA 3PVBA 3C13A 3VS4A 2QD9A 5JKGA 4RIXA 5KX8A 4FSNA 4ACCA 3ATTA 4H3QA 1OL6A 4IC7A 2V7AA 4GEOA 4QP3A 4D1ZA 2C6OA 4NJDA 3OUNB 2J90A 2QO9A 5I3OA 5E90A 5FEQA 1H4LA 4RGJA 4EOPA 2R2PA 4WHZA 5L6WL 1RDQE 1XH5A 3FMDA 1SZMA 4R3RA 5CY3A 4E1ZA 3NW6A 3QQFA 4CV9A 2VX1A 2VWYA 5M55A 4XYFA
chains in the Genus database with same CATH superfamily
4GVJA 1G8SA 3KF4A 4G3CA 5JZJA 2C1BA 4TNDA 2Z7RA 4V01A 4WBBB 1ST0A 2XVDA 5CF4A 4HNFA 5CZHA 5HCZA 3FLNC 2ZVAA 3IK3A 5TKDA 4E4LA 5EYMA 3SVVA 1HCKA 3SW7A 1XR1A 4ID7A 4O27B 4ZZOA 3OBJA 5IEVA 5KKRB 3PA5A 4V04A 2E2BA 3PJ2A 2UZDA 4K9YA 1HOWA 3DLSA 3COIA 2XKCA 3A8XA 1LPUA 4EHZA 4XH6A 5E8UA 5C8MA 4XP3A 4DDGA 3F5GA 2Z60A 5LWNA 3VHEA 3MH0A 2GHMA 4O0TA 2BUJA 3A7IA 3ZFMA 4Q9SA 5F9EA 2R3OA 1CKJA 3ROYA 4XOZA 1YOJA 3RJCA 3JS2A 4NYEA 2CCHA 3NYXA 4U40A 4RA4A 3Q5ZA 4FKQA 5IQDA 4NL0A 4YBKA 5HI2A 4H39A 3MYGA 3BU6A 3WZKA 4FG8A 3MVMA 3QZHA 1X8BA 2GSFA 1M2PA 1ZYLA 2G2IA 1IASA 3C4ZA 3QRTA 5HU9A 4IWPA 4NH1A 5L6PA 5BUEA 2HAKA 3PLSA 3KRWA 4FL2A 5HE0A 4GT3A 1YQJA 4GMYA 5CENA 5BMSA 3AGMA 2C3LA 5CXZA 3EQRA 5CAQA 3WZJA 3ORIA 4YJNA 1PXJA 3NLBA 5HX8A 2WPAA 4DGOA 3LXLA 3HAVA 2OG8A 2GNIA 3KCFA 4U97A 5KBQA 1KWPA 4IEBA 3LQ5A 1OIYA 4LL0A 3NNWA 2BRGA 2BHEA 5CEQA 4C8BA 4UX9A 2W7XA 4BTMA 5FTOA 3T3UA 4FJVA 2HZ0A 1KUTA 2PMLX 2X7OA 3R30A 1ZMVA 1JVPP 4UMPA 4DHJA 3CGOA 4HGLA 3RP9A 4I4FA 3S00A 3R8LA 2LGCA 3I4BA 1TQIA 4DGLC 5AV4A 2ZJWA 1W83A 1PXKA 2UVYA 5DOSA 4L9IA 1H00A 4YJVA 4XCUA 5JT2A 2F9GA 5ANKA 3H9FA 3UQGA 2R3PA 2J50A 4FV0A 4F64A 3R9RA 3HV3A 4W4YA 2UZBA 4FKIA 4DG3E 3N4TA 5DT4A 4FBXA 2XIRA 2P55A 2HXLA 3SRVA 5GIOE 4FIJA 3PUFC 4KWPA 5B2KA 3T9TA 5A9UA 4FVQA 4AF3A 4C4IA 2R0UA 4JS8A 3EOCA 4XNEA 4YO6A 3LFDA 3PE1A 2XNGA 1MQ4A 3QX2A 4R3PA 3UDTA 3W0MA 3QQKA 5FXQA 3WYYA 3VUIA 1VZOA 2FVDA 3AKJA 3CTQA 3LVPA 1OKYA 4H36A 1FOTA 3KMWA 1OPJA 1QPCA 3VJNA 4DA5A 4ENXA 4G34A 4IZYA 4Z7HA 3TDVA 2OZAA 1KV1A 3D5XA 3R8MA 2E9VA 3WBLA 2EXEA 2FSMX 4YBJA 4RIYB 3BHYA 4DFUA 3NVKI 2BDJA 4HGTA 4PL4A 1ZZLA 1OKZA 2CGWA 4FG7A 5C9CA 4ZZMA 4HVDA 3FI4A 3QUPA 2G01A 2VO0A 3FUPA 3CS9A 4G1WA 4F9WA 3GP0A 4D2RA 5BVEA 2WMQA 3GC0A 4UEUA 3TUCA 3FE3A 5DH3A 4F70A 4L42A 2OJFE 4EZ7A 3FXWA 4PMPA 2VNYA 2Y0AA 2UW4A 1Q8ZA 4FC0A 2ETRA 2GU8A 4FL3A 5JFWA 1Y6AA 4G6LA 3CD3A 3ZEPA 3TUBA 5CU3A 1H8FA 4CNHA 1OUYA 1YXUA 2F7EE 2W17A 2C0OA 5E1EA 4GJ2A 1WBPA 4FSUA 5EQYA 2ZM4A 4A4LA 4BC6A 2BDWA 2ITXA 3O7LD 2J2IB 4QPSA 3D5WA 4YTFA 3CE3A 3OZ6A 2W5BA 3R1NA 1TKIA 3BHVA 2G15A 1F5QA 2OXDA 4NM5A 4O4DA 4D1SA 3NPCA 4D9UA 3QQUA 3GUBA 5EFQA 3LQ8A 3MH2A 4D2TA 3B2TA 4DAWA 3EN4A 5CI6A 3PVUA 3I7BA 4MXXA 2JBOA 1QCFA 3R7EA 3DCVA 5JZNA 4IDVA 3ENMA 4FV4A 4LG4A 4UZDA 4XG4A 3KVWA 3W2QA 2R5TA 3G2FA 1OIUA 4CGAA 1MUOA 2XBAA 5AP3A 4FZDB 3DTWA 2AUHA 3DZOA 4D2WA 2I40A 1J91A 4YUQA 2YITA 2YAKA 4QP8A 5LCJA 5IQGA 2F7XE 4RPVA 2H6DA 3GENA 4N70A 4QPMA 5CWZA 5HQ0A 2IPXA 3K3IA 4PWNA 4FT0A 3VONA 2XM9A 2J7TA 3OT3A 5HNBA 4C3PA 4ZSJA 4GYGA 4IIRA 4QMUA 3FXXA 3D2KA 2B55A 4I4EA 3BQCA 5AP4A 2C5XA 4EWHA 4S31A 3W2CA 1OECA 2RIOA 3FBVA 4APCA 5BYLA 4EOMA 2X6EA 4MQ2A 3LPBA 3NUPA 1GIIA 3DNEA 2W1FA 4IFCA 5FQDC 2UZEA 2X0PA 4BL1A 2YIXA 2YFXA 4JX3A 2R7BA 3E62A 3NUSA 2OXYA 3VS2A 5LVPA 1GJOA 1U54A 1LEZA 4X3FA 4I23A 2IVUA 4BCNA 3VUTA 2XIZA 4O0SA 5BPYA 2A2AA 3LFSA 3UTOA 4CYIA 1IAJA 2AC3A 4M12A 4XG9A 5GZ8A 3F69A 2ITVA 4BIBA 2XJ2A 3RZFA 4O84A 4NFNA 3HMOA 3UQFA 2UZUE 4DHFA 5KMMA 2CLXA 4XBUA 2ONLC 2WKMA 2FUMA 2OIDA 4MXYA 3PIYA 5E8SA 2PZPA 5DNRA 5EK7A 2QG5A 3IO7A 3KGAA 5L8JA 3I6WA 3OCBA 3VVHA 1G8JA 4KUJA 3QTZA 1K2PA 3DXNA 3EN7A 4ITHA 4YJUA 5HNGA 2A4LA 5J95A 3U6JA 2AC5A 1JWHA 4U3YA 1PMNA 4F1TA 4DBXA 2ITPA 4FIFA 2Q0NA 4LFIA 2IN6A 4UXLA 2VU3A 5C1QB 3WYXA 4TL0A 2VTOA 2W96B 4ANSA 2C30A 4HVGA 1OUKA 3AT2A 3FC2A 2R3GA 2XH5A 4FSQA 4G5JA 4IAYA 4BTJA 3DV3A 4PPAA 4AU8A 3R7OA 1U54B 4Y73A 4B0GA 3W0OA 4X3FB 3NSZA 3DK6A 1UV5A 1CMKE 4GFGA 5H9BA 3B8QA 5TOZA 3ZZWA 1TFFA 3BL9A 3ZRLA 3NUXA 3NW7A 4QMXA 1DI8A 4U81A 1NA7A 4W4VA 5AA8A 4L00A 1CKIA 3KQ7A 5HBHA 4EH2A 5K0KA 1YWRA 4WSYA 2R3LA 3CIKA 2OI4X 5HG8A 2IW8A 3GFWA 4O86A 5AR4A 5E9EA 3KK8A 3DJ5A 4X2GA 4C36A 3HMNA 4QMPA 5DA3A 5A54A 2VGOA 2Q0BA 1JKKA 5JSMA 3Q52A 4ORKA 1A9UA 4BYIA 5JEBA 3RAKA 4M66A 4RX5A 2X6DA 4O4FA 3TTIA 4FV6A 4FG9A 4IVDA 2YM4A 4JAIA 3BLRA 3RPOA 4RMZA 4YJPA 2JKQA 5E92A 5AUXA 1JKTA 2WMWA 4KIPA 4P90A 3QFVA 5BVNA 1YI3A 4FKWA 3NFGB 1VR2A 3GCQA 1GY3A 3EJ1A 2O0UA 3F5PA 3OOMA 5E8XA 4PMSA 2J0MB 3WZDA 5IQFA 3QD3A 5E8YA 3O8UA 1YOMA 2JIVA 2QU5A 4E5AX 5LQFA 2R7IA 5BMMA 5CEIA 3OT8A 3AC1A 5F4NA 3UYTA 4AA0A 3L9NA 4CZYB 1WBOA 2VTIA 2BRBA 2UW5A 3KFAA 4TWOA 4DEAA 5J1VA 5HIDA 4FKOA 5BVOA 4O2ZA 3CLYA 4C3RA 2RGPA 3O96A 4FIIA 4KIKB 5HCYA 1STCE 3HEGA 4FRFA 3EQGA 1BMKA 4YZCA 4ACHA 4JOAA 4DEIA 3PE2A 5AAEA 4QTAA 5H3QA 3ULZA 5EKNA 1Q24A 3QZFA 3Q3BA 3VUHA 4BIEA 4LRMA 4YO4A 3NUAA 4HCUA 3ZHPC 3HRFA 2PE1A 4OR5A 2WEIA 1R0EA 2W9ZB 2XP2A 3P23A 1OBDA 3VNTA 3R71A 3VS1A 3MI9A 4BKJA 4BDKA 3NZ0A 4DINA 3PXKA 4C4GA 5AR3A 3M42A 4MCVA 3LQ3A 3WI6A 4F1OA 2C6EA 3WE8A 2WMUA 5CI7A 5CEMA 5A4CA 2HW7A 4MAOA 5ETFA 4EEVA 5AAGA 4LI5A 4WG4A 4JDHA 2XEYA 4GG5A 4FTCA 5J9LA 2HY81 2C6KA 4GV1A 2W4OA 5FEDA 4CCBA 4IHPA 2O5KA 2OH4A 4ZTMA 5CSVA 5KMJA 4YC8A 3PYYA 3A8WA 3OFMA 4HZRA 3UIXA 4DFBA 4YC6A 4JIKA 5E8TA 2YCRA 4FOBA 4BJJA 3R73A 3BYSA 2XRWA 2YWPA 3F61A 4LGHA 2PU8A 4ENYA 2WTKC 2R3KA 4IAIA 4WKQA 4PL5A 4DTKA 1OPKA 4FZFB 3ZLSA 1B6CB 4FTLA 3JPVA 2GDOA 4PMMA 1EH4A 5DR6A 1V1KA 2BFYA 4QOXA 5DIAA 2VTSA 4O91A 5A6NA 2IZUA 4BKZA 3LXKA 4NU1A 4BCPA 1RW8A 4FGRA 4AN3A 4MVFA 4EKLA 3MFUA 4UMUA 3PG1A 3TJDA 4BWXA 3DK7A 3F3TA 3Q9XA 5BNJA 2XAMA 4EJ7A 2J6MA 4GJ3A 4AW5A 1KV2A 3K2LA 4F6UA 3HA8A 2R3JA 3G5DA 4AQCA 1IA9A 3RINA 1M17A 3UNKA 4GIHA 2XKDA 4NKAA 4TWNA 5HCXA 1XBCA 3V5WA 5M57A 1QMZA 3SQQA 3GC8A 2BVAA 3TZ8A 3C5IA 3ROCA 3ETAA 4Q5HA 1CDKA 4QP7A 4I5CA 4AW0A 2XEZA 3C0GA 4XV9A 3UDBA 5BVFA 1AQ1A 4FNXA 2OWBA 4WNOA 4BJJB 3FMHA 5DMZA 4JX7A 2CKEA 3NAXA 3DXQA 1BX6A 2QOCA 4MEDA 5IA2A 4KIQA 4J8MA 4OTDA 5GJFA 3NRMA 4AUAA 3PIZA 4WT6A 4E93A 3SV0A 4L3LA 5HGIA 4JBPA 2FO0A 2YN8A 3C4XA 5JGDA 5KHXA 1SVGA 1IG1A 4BBEA 3PTGA 4G5PA 3QCQA 4TWPA 4P4CA 5CU2A 3PVGA 3WIKA 3LIJA 3NX8A 2XNPA 4CG9A 1UWHA 2XARA 2Z7QA 3QC4A 4W8DA 2F7ZE 2GHGA 3KB7A 4C35A 1V0BA 4O4EA 3V5JA 5AFVA 1R78A 1KOAA 3SOAA 3HV6A 3LJ0A 3SXFA 3U4UA 5AUYA 3LCSA 4FF8A 3Q9WA 3PRFA 4I24A 1T46A 4OTQA 3LCKA 3VO3A 3WF8A 4OAUC 2UZWE 3FKOA 2R3QA 4E3CA 1YWNA 1NVQA 5L2WA 2RG6A 4IFGA 2PWLA 3I60A 3O23A 3EYHA 3LE6A 3A7JA 5FXSA 1IAHA 1JSUA 4ZSEA 3MWUA 5I9VA 5C26A 3KULA 4FODA 3VBXA 1WBSA 4KS7A 3F3UA 4DEHA 5IA4A 5FP5A 5HLPA 4QEBA 4C33A 4BZOA 5HO8A 2OJJA 4RWLA 5AX9A 1UVRA 4BHNA 3UPZA 4XP2A 3GFEA 4RX7A 3VN9A 4EH5A 3W10A 4BCOA 2CN5A 4B99A 3IW6A 2BZHB 4YLKA 4I5HA 1G8AA 1G8KA 1DAWA 2C1AA 3FY2A 5EDPA 2YLEA 4GS6A 5M53A 4FKRA 2XNEA 3TCPA 4JRVA 5EOLA 1YHSA 2OGVA 3TNQB 5JGAA 3MN3A 4U41A 3QL8A 3O5AA 3NIEA 4ANOA 4EWQA 1LP4A 3MY5A 4EI4A 2BILB 4YNEA 1PXIA 1PW2A 4JJRA 1OM1A 3BYOA 4F63A 4D0WA 4YLJA 4FYOA 3VS0A 4LOQA 3VWAA 3UP7A 1FGKA 4DHIB 3IW7A 3FMJA 5CSWA 4OW8A 3A61A 2VO6A 3P1AA 5C01A 4Y46A 3F3VA 3FMEA 3ZZEA 4CMOA 3BQRA 3TWJA 3GOPA 3L8XA 4U8ZA 4JAJA 4IQ6A 4M8TA 3KULB 2ZFYA 2DWBA 2PE0A 3UG2A 4U44A 1V0OA 1MRVA 4DH1A 4NFMA 4I22A 1XMLA 3C5UA 3V01A 2VWXA 3BWJA 2GNFA 5BVKA 2FSOX 3LCTA 3PG3A 4CSVA 2PVNA 1SYKA 4LRJA 4RJ8A 1FVVA 1NXKA 5IUIA 1KE5A 3H3CA 2Y6MA 3EYGA 4X0MA 2ETKA 3AD5A 4EOJA 2JIUA 2XM8A 3KA0A 3BLQA 3MB7A 2NO3A 3ZSIA 3CCNA 2C6LA 5B2LA 5H8EA 4TYIA 2CNQA 4R5SA 3ZSGA 5LXMA 4OAVB 2GCDA 3DBCA 3LFCA 4TWCA 5AEPA 2HWOA 4ITIA 4OTGA 3EQHA 4RT7A 4UWCA 5KE0A 3R1YA 3ZMMA 1H1QA 1UNLA 1YWVA 2I1MA 2Y4IC 3DBEA 3FZRA 4X7QA 2PHKA 4EYJA 4F0GA 5JFSA 3MIAA 5KNJA 3QALE 2ZM1A 4UMRA 4C2WA 1Q3WA 4FX3A 4AX8A 2BZJA 4LDTA 2QONA 5K5NA 5CANA 5I9YA 3EZVA 3RALA 3ODYX 2NRUA 3AD4A 3GT8A 3Q04A 4QTEA 2ONLA 3NUUA 3UBDA 2P2IA 3LFAA 4QMSA 4D5HA 5I9XA 3DDPA 3ML1A 3UIMA 2WHBA 4X3FC 4F99A 2B9HA 4EHGA 4L7SA 3QTUA 2X0QA 5HKMA 3W55A 4GIIA 4DC2A 4UMTA 5AUWA 3RVGA 5AUUA 2Z02A 2W1HA 1P4OA 3ENHA 4G6NA 5CF8A 3LFNA 4GU9A 4ANNA 1W84A 4QP4A 4RG0A 3A7FA 3BPRA 4TN6A 4EL9A 5IA0A 5DR9A 2BAJA 4EOLA 4ZAUA 2RFEA 4AGDA 2XS0A 4WSQA 2ZV9A 3Q60A 5IDNA 3V04A 4K0YA 3RK9A 4UXQA 1Q3DA 4FTRA 4C61A 1BLXA 4TZRA 4WNKA 4Y95A 4L67A 3HDNA 1R39A 3VAPA 4ZZNA 3OMVA 4A4OA 5IA5A 5AP0A 5J79A 1JAMA 2QQ7A 3GCUA 3O17A 4BCFA 4O7RA 3L8PA 5F95A 4F65A 5FM2A 2HZIA 3UVRA 3OCTA 1DAYA 2X2LA 4B4LA 3QQHA 3BU5A 1H01A 3KKVA 5C4LA 3W1FA 2JLDA 3H0ZA 4U43A 3HV4A 3PFQA 3UYSA 3MY0A 1S9IA 3UOKA 1WBTA 3AC8A 2I0EA 4AN2A 5BYYA 5EHYA 2B9IA 3KXHA 2BAKA 5DBXA 3ZUUA 2ITZA 2F4JA 5HOAA 2ITUA 3S0OA 3IW5A 2YIRA 5CT0A 4CFNA 3V8WA 2OU7A 3CTJA 3UOHA 1OBGA 3MFTA 5LWMA 4QMLA 2VV9A 4DHZA 2UW0A 5CEPA 1Q8TA 3CC6A 3H9OA 4EOOA 2VTAA 4HW7A 2Z2WA 4M7IA 3VBYA 4QMTA 1XHAA 4FMQA 5EDRA 3W33A 3W0PA 1W2DA 5HESA 1ZOGA 3BEAA 3FZTA 4QP9A 4NUSA 3PDTA 1H08A 4J96A 4FTQA 3GU6A 1S9JA 4D2VA 4QD6A 5JFXA 2XIYA 3G33A 3A7GA 3PSDA 4IZ5A 5ETCA 2GQGA 4C3FA 3PP0A 4G16A 3E64A 4QQCA 4IADA 5HVJA 5DGZA 4DFYA 5IF1A 2E9UA 1Q99A 2WMVA 3E93A 2YHVA 1YXVA 3KXMA 4RFYA 3UGCA 3QLGA 4D55A 3NS9A 4O0VA 2ITNA 4G9RA 2A19B 2PVLA 4FKUA 3KY2A 4IVCA 4RIWB 4DH8A 3QKLA 5BV3A 5IQIA 3UO5A 5DR2A 4K2RA 4GYIA 2FB8A 4WBOA 3D7TB 4ASDA 4KA3A 4UWYA 4EQUA 3CY3A 1UA2A 3JYAA 2RF9A 1GZOA 5FG8A 3FXZA 1ZARA 4ACDA 4M13A 2C0IA 1PY5A 1B38A 4ZLYA 3HUBA 4RA5A 2YIQA 3VS5A 1URWA 4FI1A 4WA9A 3F82A 2UW8A 1GZKA 3SXRA 1M2RA 5L8LA 3PA4A 5AV3A 2A98A 2PVKA 3LCDA 3GU5A 4PDPA 3SDJA 2CGUA 4X2KA 5I9UA 5E8WA 4X2JA 3BRBA 5ANIA 3SA0A 5CNNA 3EIDA 4FUXA 2OXXA 2B53A 5ACKA 3II5A 4V05A 1RJBA 4ZTNA 2SRCA 5CX9A 3AT3A 5KBRA 3TYKA 3LXNA 2OICA 4CFWA 4RVKA 5A4QA 1OVEA 4KRDA 4QDVA 5AP6A 2R64A 3R1QA 2B1PA 5IEXA 3AT4A 5D10A 4GFOA 4KKEA 3GU4A 4HPTE 2C69A 2UVXA 5HIEA 4DGGA 3MJ1A 2OJGA 4E26A 5J5TA 4AT3A 4H3PA 3IW4A 2W1DA 3OG7A 3RHKA 2VWZA 3COMA 4DGNA 1APME 4PV0A 3SHEA 4JQEA 5E1SA 5HE2A 3DGKA 3RPYA 4IM0A 1F0QA 2J0JA 3QRUA 1E9HA 2ZV7A 3Q9ZA 4NM3A 3V5QA 4RWKA 1PRYA 1JNKA 5IH5A 4R3CA 1ZYJA 4JI9A 2XJ1A 2VX0A 4FSRA 3PPJA 3RZBA 3ZLYA 3TN8A 4BDJA 5A6OA 3R22A 4KBCA 2QG7A 3QTQA 2BRHA 4IACA 1U59A 4NW6A 4NZWB 4X3JA 5HVKA 3VBWA 1YI4A 2BRMA 3COHA 2NYAA 4ONAA 3R02A 4RLLA 3UMWA 3OCSA 4C4FA 4XG6A 5C8NA 3R9NA 5C03A 2CHLA 3CKXA 1OB3A 4O21A 1IA8A 2VX3A 4Z16A 5CAVA 2AEGA 5CVGA 3ITZA 2XK6A 4NCTA 3F3ZA 4YJTA 4RIYA 5HORA 2BAQA 4OTHA 3LOKA 3P4KA 1O6YA 4FIGA 3PXYA 3GVUA 4WD5A 5CVFA 5HHWA 1E1XA 3WILA 2UW6A 2VZ6A 5I9WA 2W99B 1IR3A 4J98A 2X4FA 4GRBA 3TACA 4YJRA 3N4VA 3QD0A 3QLFA 4O0YA 2XCHA 3PXZA 1DM2A 2UZVA 3FL4A 5BX0A 4EBWA 4C4EA 5HD4A 4PX6A 3F7ZA 4FSTA 2XALA 4JQ8A 3ZCLA 3GCSA 4KBKA 3TIZA 4FGBA 2OZOA 1QL6A 3PY1A 4RBLA 3ZTXA 3C4EA 3LLAA 3I79A 4E4MA 2JEDA 5KUPA 2PVMA 3QXPA 3FMNA 4JRNA 4MBLA 1PKDA 3FMKA 4F7SA 2DQ7X 3R63A 3SC1A 4M3QA 2REIA 1CKPA 3C0HA 1XKKA 4AXEA 3ZS5A 3LMHA 4K77A 4MD8E 5A14A 3ELJA 4TYHB 1PXLA 1YDTE 2HENA 2YDJA 1XQZA 4G9CA 3ORKA 2WTJA 3MPTA 4RVTA 2GS6A 2B54A 4DCAA 3PP1A 4A9YA 3HP2A 5CXHA 4ZSLA 4YTHA 2PYWA 2RKUA 5A4TA 4IB5A 2GNGA 2C6DA 2GNJA 3OEFX 1QPEA 3D4QA 4HYSA 5M51A 2I0YA 1GNGA 4UWBA 2V0DA 2YM6A 4FNYA 2C5NA 2PMIA 4F7LA 4YZDA 4PDOA 3Q4ZA 3KN5A 3QC9A 4MBIA 3OW3A 3OF0A 4TYGA 2CJMA 3R01A 1BL6A 5D7AA 2QKWB 4H1MA 3FI2A 2IVVA 3BE2A 3EL8A 4EK5A 1SVEA 2ZDUA 4LRKA 3OXTA 4CQEA 5M07A 4RX9A 3TEIA 3OTVA 4F9AA 3KK9A 1Q8UA 1H1PA 2XIKA 3FQHA 2WOUA 5ANJA 5AIKA 5IUGA 1XWSA 3GXLA 5DE2A 2W5AA 3LJ2A 3LXPA 1YDSE 3PWYA 3QRIA 3L9PA 5J5SA 3OD6X 2Y7JA 2X7FA 4DH5A 3AKKA 1YHVA 2O8YA 3GCVA 5BUIA 4W4WA 2PUNA 3R7IA 2QURA 1OGUA 3IONA 2BPMA 3LFFA 1RQQA 2ZV8A 3G6HA 4IH8A 4L44A 4H1JA 3OTUA 4O83A 3DA6A 3ZLXA 5M4FA 5LVMA 2IZRA 3PFYA 3CJGA 3ZYAA 4YU2A 4ZMFA 3R9HA 4AZWA 3U6HA 2BKKA 2WQBA 3HDMA 5ANDA 4FV7A 1OL1A 4MH7A 4FT9A 3E63A 5FXRA 4GUEA 4FZ6A 4RVMA 3Q6UA 5DEYA 3VW8A 3WZUA 3IGGA 3PXFA 2CSNA 2HW6A 4RFZA 2FSTX 3NYOA 2QR8A 2WB8A 3ZDIA 2W4JA 3OW4A 2O65A 5AX3A 3BBTB 1TQPA 3GB2A 4QMYA 5KMOA 3OP5A 4FKTA 3HRCA 4NK9A 4Y8DA 3OVVA 1QPJA 4BCMA 2JDOA 1NVSA 4JG7A 2YM3A 3ZO3A 4M69B 4U80A 4NJ3A 3NEWA 2XK8A 4AG8A 3ET7A 4BCQA 4CQGA 3DAEA 1H28A 2QOHA 4HPUE 3BX5A 4IAZA 2OFVA 4Z9LA 5HO6A 3ZSHA 4FSYA 5M06A 4C2VA 3QD2B 5HG7A 5GZ9A 3NIZA 2LAVA 5EH0A 3UPXA 3TMOA 4QMOA 3ORZA 4UY9A 2UW3A 4NTSA 3BGZA 1YXSA 2Z8CA 2IW9A 3R8PA 2FGIA 3GOKA 3K3JA 3HMPA 3UO6A 4AQKA 3ZO4A 4GK2A 4LV5A 5M4UA 3CD8A 4FVRA 3P08A 4YZ9A 3W8LA 5EI2A 3CPBA 4A07A 1OITA 1ZXEA 2J5FA 3FPMA 4YURA 4WRGA 3IDCA 4TPTA 2XMYA 4BCHA 3SXSA 3A2CA 3CEKA 5AP2A 3N51A 3AG9A 3F7WA 4BGHA 5C4KA 3ZEWA 3TNHA 4AFJA 5HU3A 2GNLA 5JQ8A 2H9VA 3IDPA 4ASZA 3V5TA 2BRNA 5HTBA 3RAHA 2GQRA 1J3HA 3CP9A 5CLPA 3QF9A 4TKSA 4FE2A 4E20A 5DVRA 4EHVA 2CNVA 4ZJJA 3ODZX 3MS9A 4O2PA 2EWAA 2Q83A 4NM7A 2DUVA 4LYNA 3FQSA 5IQHA 4LL5A 4N57A 1OGYA 2PY3A 4RZVA 3IPHA 2CKQA 3PSBA 4ZEGA 2PK9A 2HIWA 3HL7A 3CXWA 3HX4A 4TNBA 5E91A 2H8HA 4RWIA 3IQ7A 4AS0A 4EK6A 3PXRA 3TNPC 1H1SA 2BIKB 4KIKA 4L3PA 3MGYA 4MUQA 1YXTA 4BCGA 1XH4A 4JDIA 4KIOA 3MIYA 5CZIA 5AADA 4BBMA 2UZLA 4QO9A 2BTRA 3ACJA 4JNWA 4I5MA 4YLLA 3F66A 5EI6A 3ORTA 4KAOA 3BI6A 3W0RA 3NW5A 3E8CA 4UZHA 1CSNA 5T68A 2BCJA 1WBNA 2X9EA 3ZUVA 5IEYA 2XIXA 4G3FA 3AC5A 3E7OA 4BDHA 5JMSA 5IA3A 5TR6A 4HNIA 3LHJA 4QMNA 3KCKA 3FHIA 2IF8A 2P3GX 4MYGA 3RCDA 4F0IA 2PVFA 4CLIA 4QYEA 4QMZA 4TW9A 2VN9A 3T9IA 3VBVA 5JQ5A 3REPA 2OF2A 3FEGA 5D7VA 5KZ0A 5KKRC 3MTFA 3AKLA 3QGYA 4RX8A 1WVWA 2VTMA 4WG3A 4P5ZA 4XJ0A 5HE1A 4HVHA 4FTMA 2VTNA 2XB7A 2ZMCA 3BBWA 2NRYA 5IU2A 4OTIA 5A4EA 2YAAA 4X6RA 4USDA 3U9CA 4FKSA 4B8MA 4EOIA 3P9JA 4JG8A 1WAKA 1W2FA 2VO3A 2JD5A 3DFAA 3E5AA 4QMQA 3COKA 3R9OA 4ZSAA 3RCJA 5A46A 3PUPA 3ZFYA 4APPA 5J9YA 3VQHA 2OJ9A 1T45A 1UWJA 4K8AA 5GZAA 3R9DA 4F1MA 2VTRA 2R4BA 4DN5A 3ULIA 4FEWA 4EOQA 5KMNA 4JBQA 4FEQA 4GVAA 3V6RA 4C02A 3NUYA 3HUCA 2W1CA 3WF6A 5J7BA 3C4CA 5HTCA 4DFXE 1BKXA 3JUHA 2WIPA 3UC4A 1LUFA 3LMIA 4Y85A 3V8SA 3QWJA 1OL7A 4I6FA 3EQDA 4ZY6A 4DEBA 4DG2E 4CLJA 2YDIA 4IE9A 2O3PA 4ZXTA 3CPCA 4IW0A 3QQJA 4G17A 1R3CA 1M7QA 3UZPA 4FTIA 4ALUA 4FNWA 5HEZA 3H9RA 5CAUA 2OKRA 3PWDA 2X81A 5C8KA 2JFMA 4G3GA 3DLZA 4YJOA 5J87A 3RKBA 4CV8A 2YZAA 2YIWA 2HXQA 3EQFA 3IOKA 3ZM4A 3OHTA 5EM6A 4RJ3A 4M0ZA 2Y4PA 3U8WA 5HNIX 3RK7A 1Q8WA 3GI3A 3MFRA