4A07A

Human pdk1 kinase domain in complex with allosteric activator ps171 bound to the pif-pocket
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
284
structure length
282
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSAKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Allosteric Regulation of Protein Kinase Pkczeta by the N-Terminal C1 Domain and Small Compounds to the Pif-Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 282
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a07A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a07A01
4RLLA 2W1EA 4ERKA 4CMOA 4E8AA 4ANLA 5LQFA 4A7CA 2VTJA 3KXXA 5LOHA 3BLQA 2ZJWA 3UZPA 2WMSA 1Q61A 5CASA 1WVWA 3DK3A 2C6DA 5HZNA 4WOVA 3U9CA 2OSCA 4J95A 3I6UA 3FMNA 5AP5A 1J7LA 4XJ0A 4M15A 1ZYDA 3UJGA 3ODYX 3VUGA 4DINA 2GU8A 1U54B 5HVKA 2JDVA 3PZHA 5AV1A 4QTAA 1M7NA 2J50A 4PMPA 1FVTA 4WG3A 1Q24A 2OO8X 1OPLA 2Y8OA 3BLRA 3R6XA 4FEQA 3SOAA 4FC0A 3Q60A 4HVDA 1G5SA 2W96B 3BHUA 3F5UA 4YC3A 1OUKA 3UP2A 4LV8A 2P3GX 5EK7A 4O7LA 5AR8A 1WZYA 4YP8A 5M4FA 2C3JA 4DEGA 2YDJA 3VO3A 4JT3A 3N4UA 3QCYA 2XK8A 3QU0A 3QRJA 2NP8A 3WBLA 4BTKA 3KULB 2JDOA 4DFUA 3HZTA 3TXOA 5CU0A 3BE9A 4IJPA 4QQTA 2BHEA 2OI4X 3JVRA 1U5QA 4I41A 3GGFA 5EKOA 4LL0A 2HW6A 3LIJA 1M2PA 4QP9A 4XHKB 4DFLA 2BPMA 5ANEA 4ASEA 3WYYA 3ATSA 4TN6A 3RAKA 3VS2A 4ZP5A 1BUHA 3GFEA 4AZVA 4TL0A 3F2AA 2EVAA 4ZIMA 3E3PA 5AV4A 3PY3A 3F9NA 5KMOA 3T9TA 3OBGA 3RWPA 3FZTA 3LCKA 2X8IA 3IDPA 2OFVA 4W8EA 4K33A 2JDSA 2Y0AA 4NZWB 5JFSA 4DH5A 2GFSA 4RWIA 4IB0A 1OVEA 4K2RA 3QXPA 3ETAA 4EOLA 3ZXZA 5GJFA 2JBOA 4OGRA 5M07A 3RK9A 1OBDA 1QPJA 3U6HA 4I0RA 5IF1A 3HV6A 3OS3A 4AFJA 4H3PA 4JJRA 1ZOEA 3LMGA 4F7JA 3HYHA 4U7ZA 2BVAA 3BHHA 3BHVA 3C0IA 4YTFA 4FT5A 3UQFA 3TKIA 4R1YA 3SLSA 2E9NA 3WZJA 4GRBA 2ETRA 3OEZA 4WSYA 4TYGA 2W9FB 3ZLWA 3DTCA 4BDAA 3I81A 3MH2A 5ANOA 4M0ZA 3VQHA 3DKOA 3UVQA 4IVBA 1BYGA 4LUEA 4TYEA 3QLFA 3VS7A 3ZMMA 4BHNA 3W2CA 2O5KA 1G3NA 4I4FA 5FLFA 4QNYA 1U46A 2R64A 3A7FA 4FE2A 4D9TA 4TT7A 5L6PA 3QAME 4TWOA 3G6HA 3MS9A 4DYMA 4D9UA 4X2KA 4QYGA 3ZYAA 4RC2A 4EHGA 1NVRA 4ERWA 2WMAA 2B55A 3HP5A 2IG7A 5TF9A 2BDWA 1CKJA 4WG4A 3NUUA 3IQ7A 3WE4A 5ITAA 2PVMA 3GC0A 4GCJA 5L3AA 3PDTA 4YJOA 1R39A 2PMNX 3DV3A 3OFMA 3W32A 5LXMA 3OVVA 4FEUA 3QYZA 4CZUA 5IA3A 3EYGA 2YWPA 3R02A 3UG1A 4DBXA 3UMXA 4FV2A 1OMWA 3DAEA 1GNGA 3QTWA 4WUAA 1QL6A 3F5XA 5E8TA 2CDZA 2OK1A 5ANGA 1F3MC 1DAYA 2B9HA 3OC1A 3PXZA 4YPDA 4AW5A 1R78A 3Q9WA 4H3BA 4MNEB 4O96A 3FZPA 3VBTA 1CTPE 4F1MA 4PPAA 5A6NA 4RT7A 2R2PA 2YITA 4ZJIA 2OH4A 4IVDA 3QL8A 1YOMA 2E9OA 2J9MA 3QXOA 4CT2A 3PXQA 3KC3A 3RAWA 2CN8A 2I40A 3ORIA 3R8PA 1UU3A 2JDRA 4O0UA 3VNTA 1XWSA 1FMOE 3NW7A 4AGCA 3FLWA 4F1OA 4J52A 4RJ6A 3OMVA 3UYTA 3PA3A 5FD2A 1XBAA 4LGGA 3ZO4A 3VBQA 4EH6A 4P5QA 2ITZA 5K4IA 3QD0A 4QYEA 3ZO1A 1H1QA 4NSTA 4BHZA 3CC6A 4O7YA 1H25A 1KSWA 3Q32A 1B38A 3I0OA 4QPSA 5CVGA 5HI2A 4RJ3A 1GAGA 2XJ2A 3CJFA 3MFSA 4FMQA 4LQMA 4CRLA 2I0HA 4EOPA 3ZONA 3LLAA 2BALA 4AA4A 1IA8A 3I5ZA 3TCPA 3UGCA 3A7HA 2YM8A 4O27B 3EKKA 3L8VA 3LCOA 1ZY5A 2B4SB 4EWQA 2QO9A 2XA4A 1XHAA 1SYKA 3ERKA 3QLGA 4OBOA 4RZWA 5HESA 4FGBA 3UE4A 3ACKA 3RNIA 4EOJA 3E8NA 4XV9A 3LMIA 1VEBA 4CRSA 2EU9A 3FXXA 3IGGA 4TYIA 1WBSA 4EZ7A 4FT7A 4M67A 1V0OA 3BEAA 5TR6A 4WNKA 4Z16A 4E7WA 4MCVA 3BV3A 5I9UA 4TPTA 3DKCA 4W4VA 2PMLX 2BFXA 4D2SA 2Y9QA 3IOKA 4Y83A 3NIEA 4YJSA 4CT1A 1YOLA 4EOIA 3EZVA 1RJBA 2C4GA 1ZARA 4ZTRA 4CLIA 2X7OA 1JBPE 3QC4A 4GK3A 4CGAA 3ZSIA 4IWDA 4AOJA 5C8NA 4HGTA 4FTOA 5HG9A 4GW8A 5H2UA 3RM7A 4FSRA 1XH8A 4NJDA 3TIZA 3QCQA 3UG2A 1T45A 5EDQA 3BHTA 3R1SA 3LFFA 2QLQA 3Q3BA 4MQ1A 2OXXA 2W4OA 3BYMA 3AQVA 1NXKA 3KKVA 4C61A 3AC4A 3H9RA 1JOWB 4NW5A 3DU8A 2VX0A 4S33A 2ZMDA 4DAWA 4OTQA 4RWJA 5AA8A 4AW2A 3RCJA 2R3FA 1AQ1A 3IDBA 2IJMA 4CXAA 4V0GA 4C3PA 3O8PA 2VWZA 4DITA 3G51A 2WTJA 3ELJA 5JFXA 1IEPA 4L68A 4GUBA 1PMNA 4EUUA 4RMZA 3DBEA 4D5KA 2Z8CA 5DIAA 4UN0C 5CALA 1Y6AA 4JQ7A 4QMZA 4O0RA 5A3XA 3O7LB 4LMUA 5HG7A 3OP5A 3MTFA 4AZTA 3ORPA 1J1BA 3QZHA 3CQUA 2ITXA 2WB8A 4X21A 4FG9A 3CPBA 4R3CA 4RVMA 1XKKA 5FEQA 1ZXEA 1UA2A 4EWHA 4EZ5A 4FEWA 4OTPA 4QNAA 3V51A 1YHVA 2WTKC 3COIA 3SHEA 3U51A 5EH0A 2C6IA 5DLSA 4FZ6A 2X39A 4RC3A 4QQCA 3ZXTA 5E4HA 4PMMA 3K5VA 4FIJA 1G8SA 3CJGA 3JPVA 5KCVA 5A54A 3PXRA 4JS8A 3OY1A 1JNKA 5IH6A 2OIBA 3LCDA 2GS6A 5BUJA 4TXCA 5AP3A 3DXPA 2ZB1A 5CXHA 1OB3A 2W1DA 3QTUA 2ONLC 4FVPA 4BDIA 3NVKI 1YXVA 3AMBA 2XRWA 3FY2A 3V01A 4D4RA 5EOLA 3DBDA 3LMHA 5CEQA 4C59A 1FINA 3UIBA 3HNGA 4NCTC 2HIWA 2UVZA 4GMYA 4JLCA 4UALA 5HNBA 3GOKA 2VTOA 4ANQA 4ENXA 3AOXA 4BIBA 4G3EA 4U0IA 2W7XA 4QP3A 3DFCB 4DGNA 3LPBA 3MIYA 4C34A 3NYOA 2FSMX 2E9UA 3DS6A 1JKSA 4KINA 3V5JA 4APCA 2R3LA 2VNYA 3CXWA 2WMTA 4NWMA 3ZDUA 4L8MA 4G3DA 5AUUA 5HLNA 3ZFYA 2YJRA 3HX4A 3TL8A 2OLCA 4FV7A 4FKLA 3AD5A 4BDBA 5L6WL 4F99A 2OJIA 3P0MA 5JMSA 3GU6A 5L4QA 1WBWA 1SNXA 1JQHA 4FZDB 4NEUA 4AE9A 3KXHA 4KBCA 4MVFA 2H6DA 4PDYA 1DAWA 1BI7A 5CU6A 4Y95A 4IJ9A 3SD0A 3KRLA 1XH5A 4LOPA 4TNBA 4QMSA 3SGCA 2H34A 2I0EA 5AP6A 3HA6A 3AC5A 5DR6A 5IEXA 3OT3A 3OUKA 4CTBA 4CVAA 4KIOA 3E93A 4LUDA 1P14A 4F0FA 4FUYA 4IB3A 4YPSA 3O23A 3ZBFA 2XUUA 3BU3A 5DPVA 1Q41A 3UIXA 5KMMA 1GIHA 2XNNA 2PE0A 2PHKA 4QMQA 2C0TA 3IOPA 2BRGA 5IUHA 2I0VA 3FBVA 4G2FA 4KKHA 4Q5HA 2C5XA 1TQIA 3AC3A 2PK9A 4I1ZA 3NCGA 1H1SA 4QP4A 2PUNA 2WTWA 3G15A 1XJDA 4I5MA 4IAFA 4LGDA 2EXMA 4J8NA 4IWQA 4U3YA 3R00A 4RVLA 5LVLA 4K18A 3QTRA 4V04A 3HRCA 4AA5A 4FT3A 3L8SA 4GT5A 2YM5A 4X3FA 2W5AA 2IVVA 4F9YA 3KRWA 3PY1A 4D2RA 1PXKA 4G3FA 4A4LA 1Q8WA 2JAVA 4A07A 4YO4A 3MVMA 2R3HA 4KUJA 4AS0A 2E9VA 3RINA 1REKA 4GVJA 2QURA 4L01A 1H4LA 2Z02A 4X2GA 3W16A 4MKCA 4H36A 2QKRA 5E8VA 3ZRKA 4O21A 4XRJA 4A06A 2B52A 3FAAA 3V5WA 4ZY5A 4DEEA 3FPMA 3SVVA 3NUAA 3E8DA 3F82A 3VBWA 1ZOGA 2WQOA 2YDKA 3M42A 4P4CA 3DJ6A 4I6QA 5AUXA 4C4IA 4BDJA 3DCVA 4J7BA 5HVJA 2PZ5A 4NIFB 3QHRA 5CS6A 3BYUA 3RHXA 1K2PA 3W8LA 1U59A 4RZVA 2W5BA 3PJ2A 3AC2A 3EOCA 3LCTA 3ZTXA 4AGUA 3MY5A 3WZEA 4NM0A 3SG8A 2QU6A 3ZO3A 1U5RA 3DZQA 2R3OA 2W05A 4QTBA 3UO6A 2AYPA 5HOAA 4ACCA 3RPOA 4AWIA 1CDKA 4C02A 1PKDA 3UPXA 3C4WA 4HZRA 4S32A 4MQ2A 5JGBA 5KMJA 2V7OA 1GZNA 4D1ZA 1SM2A 3SAYA 4M3QA 5AP1A 2W17A 1Y6BA 4HGLA 4ITJA 5HE2A 2OIQA 1UWHA 3U8WA 3IDCA 2X4FA 5C8KA 3C1XA 3FMLA 3KY2A 4NM7A 4OTHA 4W4XA 3U87A 4EOOA 1IAHA 5KMKA 2PMIA 3DTWA 1J3HA 3KK9A 4FTCA 4MH7A 3CEKA 5KMIA 1OPJA 4M84A 4O83A 2ETKA 5AADA 4RFMA 2VX1A 4IAAA 3U54A 4IW0A 3DY7A 4X6QC 3D7TA 2GCDA 3JXWA 4O0VA 3QZFA 3HMIA 4DFZE 1U4DA 3JVSA 1NY3A 4MWIA 1YHSA 4FSUA 1ZOHA 4BRXA 3A60A 2ZV2A 3I0QA 3AT4A 4JG7A 3VF9A 3EFWA 4K77A 2WU6A 2R9SA 3CSVA 4AZWA 1V1KA 4M13A 3PTGA 1H8FA 2WOUA 3EQGA 5KMLA 1XH7A 2EWAA 4M14A 4OLIA 4AOTA 3C4ZA 2PULA 4DEAA 4PL5A 3AD6A 2YIWA 5IA2A 2QR7A 2YAKA 3PVUA 1V0PA 2WTDA 3AT2A 5JZNA 4AGWA 1R1WA 4BTJA 4HVSA 3TG1A 1FGIA 4WBOA 4R7BA 4DE4A 5L2SA 4E1ZA 3RZBA 5BPYA 3UO4A 5E1EA 3VAPA 1KV1A 1W7HA 3KA0A 4FTTA 4FNWA 4HVGA 4HOKA 1BKXA 4JAIA 1YVJA 4UMUA 1H07A 3KMUA 4L45A 4TYHA 3RI1A 4I0TA 1FQ1B 2PZRA 5AM6A 5J9LA 1L8TA 5L2QA 4BTFA 5AX9A 3EFKA 2X7GA 4N4SA 4ALWA 1JKLA 5A4LA 4J99A 3I6WA 3DQXA 4BZNA 5HVYA 2J2IB 5EW3A 4NYEA 2IVTA 3TUBA 3E87A 2F7EE 1H24A 3DK7A 1CSNA 3GXLA 1YRPA 2IWIA 3S3IA 2BKZA 3EHAA 1O6KA 2F57A 5GZ8A 2R0IA 4M69A 4DH3A 3IPHA 1Q8ZA 3I79A 4DT8A 2Q0NA 2WTVA 4BDGA 5JGDA 1UNGA 2VTLA 4X3JA 2VWYA 4FL2A 3D4QA 1M2RA 3BBWA 3FSKA 5IQFA 4M7IA 5LMKA 2UW9A 1WAKA 3DJ5A 3DPKA 4BBEA 4TYJA 3DKFA 4K0YA 4DN5A 2FVDA 2OFUA 2XEYA 3EYHA 3OBJA 4Y46A 3FXZA 5A4CA 3TTJA 2JKOA 3TV6A 4YMJA 2PYWA 1YDSE 4HCVA 2VTHA 3QKLA 3QTZA 3PSCA 4ZTLA 4QQ5A 2X4ZA 2VO7A 2HXLA 4U5JA 5M56A 2FYSA 3FC2A 3MJ1A 3PJ1A 1M2QA 2V0DA 1B39A 3OCBA 2EXCX 2QLUA 4LGHA 4BDKA 4E4NA 2BIKB 4JNWA 4JG8A 3R7OA 2YIQA 3KXMA 3VS5A 4BFMA 1QCFA 1BL6A 4DCAA 1UV5A 3OCGA 3OCTA 4XBRA 5BVEA 3ZCLA 3NYNA 3FI4A 3IS5A 5LARA 5EI2A 3F3UA 5DI1A 4AZFA 4AX8A 4BZOA 1H0VA 4EKKA 3U6JA 4NM3A 1ZRZA 3FZSA 4EOQA 3DA6A 5M09A 3E5AA 4FV9A 4V05A 5GHVA 3DXQA 2C47A 2HXQA 4P2KA 2AC3A 3FLZA 1TVOA 5CSVA 2Z7QA 5CEMA 4PPCA 4MNFA 5EYDA 3UQGA 2QO7A 1ND4A 2YWVA 1YW2A 4OAUC 4X6RA 2G01A 4LYNA 5EKNA 3BYVA 3O0GA 4PX6A 2NRUA 3PXFA 4HYHA 2OBJA 3LXKA 4O82A 4RIXB 3OOGA 1YXUA 3OWJA 4EBWA 4MWHA 5IDNA 2B53A 2QCSA 3LXLA 3HMPA 4QMLA 5FM3A 5KBQA 5IQEA 3T3UA 2WEIA 4BCMA 5AWMA 2CGVA 4O7SA 4BWPA 4N57A 2YLEA 3PZEA 4RA4A 1YI4A 3CCNA 4C8BA 2YEXA 2VWIA 2ZMCA 3K54A 4C58A 4XG4A 4O91A 4EZ3A 4BI1A 4AACA 4UX9A 5L2TA 1Q8YA 2YDIA 1PYXA 2WOTA 4ZK5A 4D58A 4KABA 1KOAA 4YTCA 3VW8A 4FA2A 3ORNA 4YLLA 2C3IB 3H0ZA 4L00A 4DLIA 4DGMA 3U6IA 3TIYA 5JGAA 2Z7RA 2JKQA 3F3WA 3FE3A 3L1SA 5CEPA 5GZ9A 3EN5A 4PTCA 4IH8A 3VVHA 4FNZA 4QPMA 5AAFA 4E4LA 2BRHA 4ZTNA 4YURA 4XUFA 2YACA 4FL3A 3BGPA 3I4BA 3ZH8A 3QA0A 5HIBA 3HV7A 2OG8A 2UVYA 4PRJA 4F09A 3ATTA 2GTMA 2XK6A 3R9HA 1H1RA 2PVKA 4QRCA 5CWZA 4YGAA 3VS3A 4ZTQA 4MXCA 4EH3A 4EH9A 2GNGA 2UW0A 5A4QA 2RFDA 3OXIA 4JIAA 4A4OA 4KS8A 3DAKA 3P4KA 2R4BA 5CY3A 3OWPA 5EI6A 3D15A 3R8ZA 3UNJA 4RIWA 3WF5A 4AT4A 2GNHA 4IZ7A 4APPA 4FVQA 4IMYA 4HYIA 1PXJA 4JI9A 4YJVA 3AMAA 3V5LA 4C7TA 1KUTA 1Z57A 3CTJA 5HD7A 2PU8A 1V0BA 2CHLA 2F2UA 4IM0A 4XP0A 2CSNA 4IACA 4L6QA 4FGRA 5CAVA 5IQGA 4QT1A 3RBWA 4QTCA 3LFCA 5HCYA 3O50A 1PW2A 3JY9A 4AFEA 5GZAA 3S1HA 1M7QA 4C3RA 2VO3A 2VGPA 4ZLYA 5ICPA 2XIYA 3ZS5A 2C5OA 1KE5A 2ZV9A 3CKXA 3EN6A 3TKUA 4QPAA 1S9IA 5A14A 2X81A 4L7SA 4O7RA 2ZM3A 4FR4A 4IE9A 1P4OA 5DFPA 4HW7A 4FYNA 2WMRA 5JH6A 3UOLA 2JFLA 3E62A 3P7AA 4D2PA 4RRVA 3ENHA 5JKGA 4U44A 2XNBA 2IZSA 2CKPA 3ZC6A 2XIXA 4FKIA 5CNOA 4JR3A 3UNZA 4NKSA 3MH3A 1QPEA 4K6ZA 4EH8A 5D10A 1GY3A 2B9FA 4PUZA 2YHVA 4QYFA 5D41A 1G8AA 3L9LA 2WPAA 5FXSA 3VRZA 2VTRA 3S00A 4X3FC 2BTRA 4FV1A 3DDPA 2QR8A 3HL7A 3ZSHA 5H3QA 2YCQA 3MYGA 4GG7A 5EHLA 4AZSA 3NAYA 5M57A 4AU8A 2W1FA 4OTWA 3VULA 1UU9A 1STCE 4G6OA 3LLTA 3RGFA 3SG9A 1NW1A 1R0EA 4FT0A 3KCKA 5CT7A 2EB3A 3GQIA 4BF2A 3QRTA 4U97A 3FMEA 4XV3A 4JG6A 3RKBA 4F9CA 5BYYA 3LFNA 3BYSA 4LRKA 1PY5A 1IASA 4FKSA 5DH3A 5ETAA 4D1SA 4F9AA 3QYWA 4S30A 5E8WA 2DQ7X 3OD6X 4Z7HA 4MNEA 4KIKB 2C3KA 3E7VA 3HMOA 3PWYA 4NU1A 1JSTA 4M12A 5EYKA 2G2HA 3QTXA 1Y8GA 4QYHA 3TNWA 2PSQA 2VAGA 2BROA 2CPKE 3BQRA 3LJ2A 4BGHA 5HNIX 2H96A 3IW6A 4HGSA 1OIYA 3HKOA 2R3PA 2J0LA 3UMWA 5BYLA 3CQWA 2XS0A 3FJQE 3PA4A 3F2NA 3GU5A 4XP3A 3RPYA 3L9PA 1YXSA 4ZSGA 2ZM1A 1R0PA 3F3TA 3NEWA 2UVXA 4FZFB 4L44A 2ZB0A 3O17A 3O8UA 3HAMA 2J5FA 2ACXA 2QODA 3W2RA 4EH5A 2NO3A 3F88A 3CY3A 3OF0A 1M52A 4ZY4A 4B8LA 5FUTA 4FSQA 1YI6A 3B8RA 1DS5A 2QOOA 3ZDIA 1K3AA 3ZZEA 3JR1A 2Y4PA 3HRBA 3SXSA 4ORKA 4LG4A 4UY9A 1KOBA 2ZM4A 4ZTHA 3RMFA 2BMCA 4WIHA 3R7UA 4OBQA 5C27A 2GHLA 4CFFA 1MRVA 4ACGA 2WFYA 4I92A 2GMXA 3MGYA 5IPJA 3JYAA 2LAVA 5DRBA 2UW3A 4TW9A 5J5SA 1H27A 2QOQA 2VRXA 3E64A 2UZUE 1WBPA 3DBCA 3OEFX 5HG8A 5TE0A 4CV9A 2H8HA 3MVJA 5BUEA 3FMHA 4MHAA 4RIYB 3TKHA 5IQCA 1OZ1A 4IIRA 3K3IA 4GT3A 2R3IA 4R3RA 3FUPA 3MWUA 2VTPA 2X9FA 2X2MA 3GOPA 3MFRA 4FZAB 4W9WA 5CSWA 4ASZA 4ASDA 2PVNA 4EC9A 5DHJA 4IXPA 4EC8A 4AXAA 1FVRA 4KRDA 3SV0A 3R2BA 5D7AA 5BVOA 3QC9A 4O0WA 2PY3A 4JQEA 4RA5A 5HQ0A 3GU7A 4EONA 3DXNA 4O0SA 5DT0A 4JRNA 1TKIA 2HAKA 3NRMA 4NFNA 5AP2A 4FKGA 4GJ2A 2ITTA 1T46A 3ZSGA 4DLJA 3LAUA 2C1BA 3LXPA 5BVNA 4EH7A 5KHXA 5H8BA 3VC4A 2IN6A 2QG7A 3VJOA 5FDPA 2C69A 4HZSA 4FIGA 4M0YA 5G6VA 3DK6A 4PTGA 4E6DA 3DNEA 5J9YA 4BIEA 2HWOA 4GH2A 3FQEA 3PA5A 4MBIA 4G3GA 4KS7A 4BDFA 3G6GA 3H10A 4O38A 4DG2E 4FK3A 4FV8A 2WGJA 4BDEA 2VWVA 3VBVA 4DEHA 4K8AA 5HBJA 4CFVA 4R8QA 2VV9A 3R73A 2BHHA 2ITOA 3F5GA 4CQGA 3E63A 3R9RA 1LEZA 3B2WA 2PE2A 3FDNA 4EQUA 3MA6A 4MXOA 2PVJA 1OKYA 2R3JA 3VHEA 4C35A 4CNHA 4FSMA 1XH4A 5G1XA 4FG8A 5DT3A 4GK2A 4IC8A 3R7EA 2VGOA 2W1IA 1Q97A 3QWKA 2VWBA 2ZVAA 2HZIA 3U4WA 3ZUTA 4BCHA 3PRIA 4BIDA 5HTIA 2QVSE 2WQNA 3AD4A 4Z9LA 2C0IA 2XIRA 5FXRA 4DFBA 3D7ZA 3FZRA 2WTIA 3F61A 4FSNA 5LMKC 2QKWB 2VO6A 3FV8A 3DB6A 4W8DA 2G1TA 5JRQA 1Q8UA 2G9XA 4EJNA 4YTIA 3QZIA 4P90A 4WSQA 2YM4A 1XQZA 2XH5A 4IFCA 2IVSA 4FSZA 4M97A 3PSBA 2QI8A 1QMZA 5CSPA 2VWXA 2B7AA 3SW4A 3TZ8A 3DLZA 2WEVA 3VHKA 3ALNA 3MN3A 4BCPA 3R9NA 3B8QA 3EQDA 2WIPA 3AG9A 3HA8A 3OG7A 2UW4A 3BIZA 5CVFA 3MW1A 3QZGA 4EQMA 4F0GA 5CAUA 3R0TA 5HX6A 3MESA 4WT6A 4BWKA 4IAZA 2ITQA 2ZV7A 4C36A 3QWJA 4FV4A 5JT2A 2RFEA 2BR1A 4NKAA 3GENA 3G9NA 4D55A 4PNKA 4IBMA 3UOJA 3ID6C 3OROA 4OTRA 4USFA 4QYYA 4UMTA 3R7YA 2G15A 1ERKA 5M4UA 1BX6A 4O7VA 2J0MB 2OJGA 4W4WA 3CD8A 3SC1A 4IDTA 5HCZA 1VYZA 1I09A 1PMEA 4QMXA 3SRVA 5K0KA 4U6RA 5AEPA 5M08A 3KU2A 1LEWA 5LJJA 1F0QA 3FQHA 5AUZA 4LMNA 1YI3A 2YABA 4GL9A 2B54A 4G9RA 4KNBA 4OT5A 4WNPA 2EUFB 3Q9ZA 4J8MA 2CNUA 2QOIA 2RIOA 3AT3A 3EQHA 4MTAA 3IW8A 4ZLZA 3BHYA 2OXYA 4E4XA 5LMBA 3A2CA 4YHJA 2HCKA 1W98A 3THBA 3LXNA 3WIKA 4ZZNA 3FI8A 4TWCA 5AFVA 3R01A 4O22A 3HDMA 3EFJA 1VZOA 3QCXA 4UB7A 4Q5EA 1PKGA 3T3VA 4RQKA 3R2YA 4PWNA 1IAJA 3D5VA 2JAMA 4JBQA 2OU7A 4ARKA 3DDQA 5GJDA 4ZOGA 3VUKA 4IQ6A 4N70A 3K5UA 2ITWA 2PZYA 5F9EA 4BKZA 3CLYA 2BCJA 4QMPA 5J87A 4EQCA 4JBVA 5C01A 5BQ0A 4U81A 1XBCA 2W1ZA 2XM8A 2OF4A 4P5ZA 2VTQA 3H30A 4NW6A 3SOCA 3WF8A 3IONA 3ORKA 5FGKA 4E73A 2VX3A 3VW6A 2WMVA 3H4JA 4QTDA 3Q6UA 3ET7A 2F7ZE 2O2UA 3SXFA 3EQCA 4GSBA 2VUWA 3DLSA 4XG6A 4XP2A 4RFZA 5CF5A 4FEXA 3GT8A 5FBNC 4FTNA 4J53A 4C0TA 3BI6A 3MB7A 3QFVA 5IQBA 2VNWA 1TQMA 3WZUA 2P2IA 4MBJA 5ACKA 1Y57A 3G0FA 4EOSA 3CQEA 3MVHA 3UC4A 3R63A 2CN5A 3O96A 4CYIA 2HY0A 1WVXA 4G1WA 4I24A 4UXQA 1Z5MA 1ZYJA 4WNOA 4PTEA 2QOFA 3MIAA 1WVYA 4O0XA 1CKIA 5I0BA 5HICA 1H26A 1WBNA 2UZLA 4O1PA 4YJUA 3FQSA 4D2VA 2FSLX 3BBTB 3NPCA 2ZOQA 5CVHA 5L8LA 4R3PA 4CD0A 4NL0A 4YZBA 4GT4A 5D7VA 2WKMA 1PJKA 4GIIA 5BYZA 5CSXA 3OT8A 3QUPA 2C5YA 5K0XA 2CKOA 5FTOA 3C50A 2OJ9A 4QOXA 1E1XA 2QOBA 4EHEA 2EB2A 3V8TA 4FKPA 4YR8A 3ROCA 3ENMA 2GS7A 2PVLA 2VTNA 4E5BA 2XK9A 4O6EA 4IZAA 4IAIA 1XO2B 3EQPA 4GV1A 4O6LA 3E8CA 3C4CA 4BKYA 3AC8A 3A7IA 5I9XA 1H1PA 4FNXA 5DN3A 4YZ9A 3C9WA 3MBLA 2QD9A 5I9VA 4KKGA 4FKTA 4MAOA 5BVDA 4MYGA 5CTPA 1GZ8A 4JDKA 4RFYA 4XLVA 4BZDA 4ZTSA 2ITPA 2BRMA 4NTTA 3O2MA 4WO5A 4CG9A 2JGZA 4RWLA 3G0EA 4IADA 3HV4A 2GQRA 4HJOA 4CFMA 3C51A 3KGAA 4OTDA 3S2PA 4MD8E 3GU8A 4I6FA 5EI8A 2O65A 1UWJA 1FBNA 4P7EA 1NVQA 4C3FA 3PXKA 5DT4A 5KZIA 4UWCA 2PVFA 3MTLA 3I7CA 3NYXA 4RX5A 1LR4A 3NR9A 4IB5A 3ALOA 2QG5A 5LWMA 4L9IA 4L53A 3AC1A 3IECA 2W0JA 3VS1A 5JSMA 5CYIA 3V5PA 3E7OA 3R28A 4KA3A 4C2WA 4YZDA 4IX6A 5LMAA 4AT5A 5E8ZA 2A1AB 2YM7A 3LM0A 4IM3A 5CAPA 3KF7A 4JDHA 3TM0A 1PMUA 3NS9A 3VUTA 1ZYSA 2C6OA 2O64A 4FICA 2XYUA 1PXPA 4LRJA 2C1AA 4UBAA 2A0CX 2HWPA 4WG5A 3P7BA 4YHFA 5KKRC 2DYLA 4AUAA 3D0EA 4O84A 4GYGA 4CEGA 2W1CA 2RG6A 4ZSLA 3PJCA 1YWVA 2GHGA 3FL5A 4H58A 5HHWA 3ACJA 5E8SA 4I23A 3KRRA 1URWA 4YTHA 3L8XA 1FPUA 5C8MA 4F7SA 2GTNA 3SXRA 4G6LA 4AN3A 3FXWA 3PXYA 4RPVA 4E26A 4BTMA 3B2TA 4C33A 5AUWA 3V6RA 4BKJA 3EQFA 4BCOA 3HLLA 3QTQA 2GS2A 4M8TA 4X0MA 4A9SA 4F9BA 5B2LA 4C4JA 2X6DA 4LI5A 3TV4A 2UZVA 2BUJA 2X6EA 5HORA 1BI8A 5AIRA 5CT0A 3WE8A 3BPRA 3F66A 4ITIA 4H1MA 4EOMA 4G6NA 5KX8A 2BZJA 1L3RE 3BWFA 3R7IA 4EOKA 3GP0A 5JFVA 3G9LX 3Q4ZA 3CY2A 1GIIA 1YHWA 4OW8A 3VUDA 4EH4A 5K3YA 4FTQA 2C6KA 2ITVA 3UDBA 1Q3DA 3CKWA 3FWQA 1OGUA 3I1AA 4XBUA 3MDYA 5EG3A 2CNQA 4QO9A 3POZA 3IW4A 2XYNA 2XKDA 3KMWA 4HNIA 3UZRA 2PVYA 3L9NA 2PWLA 4F1TA 2V5QA 3BKBA 4Z7GA 3ZOSA 1MQ4A 3PIXA 2W1GA 5K5XA 4HPUE 5IMXA 4QP6A 2PUPA 2WAJA 2HK5A 2IW8A 5HO7A 3NUSA 4IX5A 4LM5A 4F64A 4A9TA 4TY1A 5FRIA 1GZKA 4GIHA 4L3LA 4IC7A 2OZOA 5ANKA 1IG1A 1SZMA 2C68A 3D5XA 3JY0A 3NUPA 4I6BA 2FSOX 2VZ6A 3F7WA 3ZU7A 3C13A 4BWXA 4FIEA 5HG5A 4GU6A 2IW9A 4I93A 3FKNA 2QONA 4OUCA 3ORXA 3OXTA 2C0OA 2CGUA 2JKMA 4G17A 2BAKA 4BCKA 4QMOA 5EM6A 3IKAA 4A4XA 3R83A 2V55A 4D2TA 3MY0A 4H39A 5B0XA 3D5UA 4FZ7A 3EZRA 5IH4A 5IQHA 3GI3A 3KRJA 4EK6A 1CKPA 3FZOA 2X7FA 5JK3A 2WQMA 3FLYA 2VTAA 3F7ZA 4RIXA 2BKKA 4UEUA 3BGQA 3CE3A 2B1PA 3CS9A 2BIYA 4WBBB 4TZRA 4FV0A 3M2WA 4EKLA 3KVWA 3QRKA 4LOOA 3FPQA 4L43A 2HW7A 3SDJA 4F4PA 2OF2A 4IHPA 1URCA 3WF7A 1WBOA 2BFYA 2KULA 3O51A 4PQNA 4QMUA 2RF9A 1SVGA 3VN9A 4CCUA 5KMNA 3IK3A 3Q5ZA 4G9CA 5F1ZA 2RSVA 4X3FB 3PP0A 5CAOA 1BMKA 3Q4UA 4FV5A 4TNDA 3LVPA 3VUMA 4CKRA 2CLQA 5CU4A 3TZ9A 3QGWA 5AP0A 5M55A 5HLWA 3FMKA 5CQWA 3TNQB 3DAJA 1XBBA 4EHZA 2Y6OA 2W4KA 4E6CA 2V62A 2BZIB 3F5PA 3QQFA 3N4VA 2F9GA 4O0TA 3G2FA 1JWHA 4FSWA 1E9HA 3LQ8A 2XF0A 2XMYA 1MP8A 3QD4A 3TDVA 4JRVA 1J91A 4RIOA 2Y7JA 3LW0A 3OTUA 5AR5A 2IZTA 4ZJJA 4BICA 3UNKA 3NUYA 3QX2A 5HBHA 2KTYA 2R3GA 2FUMA 4CKIA 4XYFA 2PZPA 4E20A 2GNIA 3BE2A 3GC9A 3BCEA 3FHRA 2R0UA 1ZWSA 3HDNA 2PL0A 2I6LA 3NDMA 4RJ8A 2OIDA 2RGPA 5FWKK 5M51A 2NPQA 2V22A 1OL6A 4A9YA 2Y4IC 4DHFA 4O7ZA 1KE9A 3PP1A 1FMKA 4RVTA 1PXLA 3S4QA 4E5WA 5M4IA 3R1NA 3HGKA 1ZYCA 5F95A 1ATPE 4YU2A 4YBJA 2UW7A 5ANIA 3DJ7A 4AN2A 1OL1A 3FYKX 2A2AA 4Y5QA 3Q2JA 4EHVA 4U43A 2UZTA 5JFWA 1H01A 1PF8A 4BCQA 3HMMA 4D0WA 1OKWA 3Q6WA 5DEWA 3UIMA 4C2VA 1LUFA 3UPZA 2WD1A 1OL2A 2OZAB 5ETCA 2BZKB 5HCXA 2WIHA 4PL4A 4ZS4A 2WZJA 3MFUA 4G16A 3VUIA 4EYJA 4AE6A 2YA9A 4F65A 1W82A 2ITUA 3P7CA 5IH5A 1KV2A 4A9UA 5CEKA 3NW5A 4Y5HA 3QCSA 5CI7A 4GFMA 5E7RA 4WD5A 4ITHA 3QGYA 3ORTA 3MV5A 4RSSA 5DOSA 3FLNC 3NSZA 5FEEA 4BI0A 3DGKA 2YM3A 3ZHPC 3TTIA 2QOLA 5IDPA 4N6ZA 2XNOA 4XV1A 4ZSJA 4YZNA 4HCUA 2DS1A 5JRSA 1U54A 3HV3A 5HKMA 1Y91A 3DZOA 1OPKA 4MX9A 3W2PA 2F4JA 4UMRA 3Q5IA 4I5PA 3CP9A 2WXVA 1P2AA 4FOCA 4KBKA 3NUNA 4AW0A 2C5VA 2XIKA 3MH1A 3NWWA 5E8UA 5AJQA 2YISA 5AR7A 5L8JA 2R7IA 4R77A 4KIKA 4QP7A 3O8TA 2RL5A 4FUXA 3TNHA 4TKSA 4U80A 4U45A 5AP7A 3P86A 1CM8A 1W8CA 2ESMA 5EHYA 1GOLA 4Q9ZA 3KULA 1A48A 2ZAZA 4Y8DA 4KD1A 3RPRA 2PVRA 1AD5A 5EFQA 3V04A 5IEYA 2PZIA 2Z2WA 4JX3A 2J0JA 5A46A 4O7WA 5M06A 4YJQA 4UV0A 4YO6A 2YM6A 4Z55A 5CXZA 5BNJA 3UOHA 5BVFA 4M68A 4PP7A 5H9BA 3FI2A 3QA8A 5B7VA 5BVWA 3PE1A 3T8OA 3IW7A 4JAJA 5LCKA 1APME 3RCDA 1MQBA 1QPCA 4FTRA 4E5AX 3GC8A 3NIZA 3Q9YA 4M69B 1XH6A 5EDRA 4DGGA 4RC4A 2GPHA 2XIZA 4MEDA 4JDIA 4W9XA 4RX7A 5A9UA 3RALA 4RJ4A 4OTFA 3QKMA 3SA0A 4ACHA 4O86A 4N0SA 2X2LA 4DG0E 1ZZLA 3D9VA 3UVPA 3MA3A 3QKKA 1OI9A 4UXLA 3KEXA 3QHWA 5AAGA 2YN8A 1H28A 3Q2MA 4R6VA 4YJNA 1S9JA 4FI1A 5DWRA 1JKKA 1Z9XA 3TUDA 2C6EA 4FV6A 2RFSA 2O63A 2W06A 2I1MA 4R7HA 5DNRA 4CZYB 4WRSA 5KZ0A 3GCPA 3PLSA 5CEOA 5EDPA 4C4HA 4RIYA 3FY0A 2GSFA 3CTQA 1PXOA 3NNVA 2YIXA 3EKNA 3KREA 5T3QA 3E92A 5HIEA 3TJDA 3LQ3A 4KKEA 4NM5A 4DFYA 2YCFA 3PPKA 4MK0A 5CEIA 5L8KA 4NCTA 3KN6A 2JIVA 1GIJA 2XRUA 3TDWA 5I3RA 3FZ1A 2JD5A 4KB8A 4AZEA 4IM2A 4WNMA 3R8LA 1YDRE 5A4TA 4E3CA 3KCFA 4UYNA 3ORZA 3H3CA 2V7AA 5FM2A 4H1JA 3N9XA 2DWBA 3AMYA 4TWPA 4JVGA 4UZHA 4UYAA 3VS6A 2J5EA 4IZ5A 4CQEA 4XV2A 2IPXA 4L52A 1OECA 4QMVA 4CTCA 3KFAA 1SMHA 5H8GA 5KE0A 4DA5A 4X2JA 4G34A 4JR7A 2QOKA 5DMZA 4CKJA 1OITA 3A7JA 4MXAA 3Q4CA 4U3ZA 5E91A 5HE1A 3VS0A 5LWNA 3PLAE 3W2QA 4MBLA 2XKFA 4FF8A 2J90A 3PIYA 4AP7A 4ZSEA 4BBFA 3GB2A 2XK3A 3FKOA 2QU5A 2UV2A 1ZMWA 3LJ1A 5I5ZA 5HEZA 3II5A 3ZM4A 4PV0A 2EXEA 3PIZA 3VIDA 3BU5A 3W18A 2PPQA 3FMJA 4GKIA 3EB0A 5IA0A 2UZBA 5GIPE 2JIUA 3DOGA 5IQIA 3C0GA 2XM9A 4YNOA 4CMTA 4X2FA 3G33A 2GFCA 4Y72A 3NW6A 5HO6A 5J5TA 5E92A 3IW5A 3L8PA 3RK5A 1JAMA 2F7XE 2UZEA 2E2BA 2YJSA 5CI6A 2C3LA 2WTKB 3DFAA 4DH1A 3A7GA 5AMNA 5D9HA 5D11A 2UW8A 4BGGA 3ZBXA 2AUHA 3TI1A 5EQYA 2JITA 4I94A 3W55A 5LCJA 3OW4A 4R5SA 4RIWB 5HLPA 5DVRA 3QQUA 3L9MA 3QTIA 2NNWB 5AUTA 1DI9A 3GCSA 3PRFA 4UWBA 3R22A 4ALUA 2OGVA 3BQCA 1P5EA 3W10A 4FTKA 3C5IA 1AGWA 3S95A 3WIGA 1Q4LA 3BX5A 1YXXA 2G2IA 3M1SA 4G3CA 4ENYA 5I9WA 4YSJA 4KWPA 4GVAA 1WCCA 3N51A 1PYEA 3QX4A 3FYJX 5FXQA 2XEZA 1H00A 3ULZA 5GIOE 5IMEA 2J6MA 4GU9A 1NVSA 2YFXA 4YJTA 4YSMA 3ZZWA 5J8IA 5M4CA 2ITYA 4K1BA 4QMYA 5GNKA 1FGKA 2WQBA 4C4FA 5AR3A 4USDA 4YC6A 4KRCA 3LFDA 5DR9A 4QP2A 4E4MA 4IX3A 3RVGA 4IDVA 4WKQA 5BMMA 2FSTX 3V8WA 4DEDA 2VTIA 3A8WA 3D2IA 2CCIA 2BAQA 1P4FA 3WZKA 3HVCA 3HV5A 3DKGA 2YAAA 3CD3A 4DGLC 4GEOA 4OR5A 4TRLA 3FLSA 5BVKA 5DE2A 4O7NA 4W4YA 4EK8A 3DNDA 4L46A 3RPVA 3MB6A 4FTIA 1VYWA 3V3VA 4OAVB 3UQCA 4XMOA 3FC1X 3OZ6A 3F3VA 3OWKA 5CF8A 1DI8A 3HEGA 5C4KA 3EH9A 3N4TA 2GNLA 3VBXA 4ZSAA 3C4XA 5HTCA 2BTSA 2GNFA 2NRYA 5HBEA 2UZDA 3D2KA 1REJA 4NT4A 3R1YA 1YDTE 3QTSA 3MPMA 1OUYA 2OJFE 3ZUVA 4AAAA 4YBKA 5HIDA 4ACMA 4F6WA 5M44A 3A4OX 3F6XA 4I20A 4HPTE 5GJGA 3TNPC 1MRYA 2PUUA 4TWNA 5C03A 4S34A 1NT2A 3VJNA 2HENA 3SX9A 4QD6A 3DT1A 4Z3VA 5DRDA 4GYIA 2ERZE 3FHIA 2HZNA 4JL9A 5J1WA 3FEGA 3ROYA 4B0GA 1PMVA 3KMMA 4IZYA 4C62A 3I60A 5JZJA 4CV8A 1QPDA 2ZDTA 3TACA 3CIKA 4MXZA 3EL7A 2FO0A 2JIIA 3EMGA 4FBXA 5HO8A 3UYSA 3BEGA 2UW6A 4ZS0A 5AA9A 4YJPA 5EQPA 2P33A 3BV2A 3O7LD 3MPTA 4BB4A 4YNEA 1IRKA 4QMTA 4BI2A 5KKRB 4GKHA 4RG0A 2XK7A 3PE2A 4Y73A 3WF6A 3GU4A 2J0KA 4MD7E 5M53A 4DTBA 2BILB 5L2WA 5E90A 4MF0A 3QALE 2ZDUA 4NH1A 3RNYA 4CFUA 4FKOA 2XBAA 4XLIA 5AIKA 3EN9A 3KXNA 3Q52A 3O71A 3I7BA 3WILA 4J71A 1ZYLA 2PTKA 3Q4TA 4HNFA 5CNNA 1YWRA 4CMUA 3NMUF 1F5QA 5J9ZA 3OHTA 2O3PA 3NCZA 2REIA 4O2PA 3KQ7A 3SKCA 4RJ7A 1Q62A 5FQDC 3HECA 4EJ7A 5D12A 3GVUA 4HCTA 3SQQA 4I0SA 4O0YA 2GHMA 3U9NA 2UZOA 4R7IA 5DGZA 3EWHA 1ZY4A 3KXZA 3PPJA 3DB8A 3ZC5A 5HE3A 5HD4A 4II5A 3W1FA 2IZUA 1CMKE 3DBFA 4PMSA 4H3QA 5IA5A 4CFXA 3K3JA 3UODA 4B99A 4IX4A 4PDOA 4AN9A 4E6AA 2YIYA 4MD9E 5HGIA 5I3OA 4FV3A 4GG5A 4QMMA 3VRYA 3PPZA 2HELA 4U41A 2OW3A 1B6CB 4L3PA 3NUXA 3QQLA 1NA7A 5EW9A 1JLUE 1W84A 4BYJA 4OTIA 4HGEA 3ZRLA 3G5DA 4ANMA 4QTEA 2IZRA 5C1QB 4QMWA 4FVRA 4XH6A 3NX8A 3PYYA 4D4VA 4FEVA 5B2KA 4FSYA 3R9DA 4F63A 3MY1A 1K9AA 2E9PA 3PVGA 1PXNA 4EK5A 5AAEA 5K5NA 3WARA 2BZHB 4FOBA 3TV7A 2YLFA 5J7BA 5GINE 2XKCA 3HRFA 3RAIA 3ORLA 3GUBA 2XK4A 3NLBA 2CNVA 3UOKA 3COMA 3FMDA 3KVXA 4BCGA 4CSVA 4DC2A 5B2MA 3RWQA 5H8EA 4YLKA 1OL5A 3AGMA 3PY0A 3R9OA 4EUTA 4BY9E 2JLDA 2OICA 5EHOA 1Q5KA 3A61A 2WQEA 4D5HA 3TWJA 4M66A 5ANJA 3UZTA 5IQDA 1SVEA 3FMMA 2W1HA 2WO6A 4C4GA 4UMQA 3OWLA 2BDFA 2XBJA 3KN5A 3U4UA 3Q04A 3C4EA 3LE6A 5CANA 2R3NA 4QQJA 3PWDA 2VD5A 2HZ0A 3ANQA 2ERKA 3NAXA 3BGZA 5FTQA 2VTTA 3TZ7A 3VWAA 3E3BX 3Q9XA 1KE8A 3QQGA 4FNYA 5CU3A 4LRMA 1I44A 4AGDA 4E93A 2OWBA 3BYOA 4ZMEA 3GCUA 2JEDA 5IA4A 3CGFA 1YKRA 2PMOX 4DCEA 1RW8A 4B9DA 3G90X 2HY81 4NIFA 2W9ZB 4AG8A 4RLKA 4GFOA 2XZSA 3DBQA 3ZFMA 3P78A 4ZY6A 3OW3A 4ACDA 2JFMA 1YXTA 4L3JA 3WF9A 4O1OA 2QO2A 4J1RA 5FP6A 2UW5A 1OIQA 3RPSA 3A62A 4IFGA 4ONAA 4YHTA 3V6SA 3V8SA 1LP4A 3D5WA 3EQRA 3QQKA 3LFSA 4ZJVA 3GQLA 1LPUA 2I0YA 4USEA 3TEIA 1JSUA 3PG3A 3MH0A 3OCSA 4OTGA 1JPAA 5D1JA 3BRBA 3P9JA 4CG8A 4FL1A 3LQ5A 5TO8A 4EYMA 5CLPA 2FB8A 5ETFA 4MXYA 3QD3A 4PPBA 4XG9A 4V01A 3MSSA 4PNIA 2GNJA 5BUIA 2VWWA 3LFEA 4FX3A 5DYJA 1BLXA 4IB1A 1O6YA 5KO1A 1H08A 3ZUUA 3FSFA 3QUEA 5AP4A 3KL8A 3F3ZA 4KBAA 2J0IA 2XP2A 3SRVB 3QF9A 4ANSA 1X8BA 1A06A 1A9UA 2XB7A 4XX9A 4F9WA 4F7NA 3CGOA 4AOIA 4EI4A 3AXWA 3UO5A 4IWPA 2PVHA 3NGAA 4D2WA 4LL5A 3R8MA 4RBLA 5J79A 4JXFA 3RAHA 1SNUA 3OUNB 4RWKA 3K2LA 4WUNA 4XOZA 4EK4A 3RZFA 1Q3WA 2C5NA 4BDCA 2Y4IB 3KK8A 5LVPA 4BR3A 3W8QA 3A99A 3ITZA 2XJ1A 2VO0A 3HP2A 4G5PA 4RX9A 4FTLA 4Y85A 4CYJA 3PVWA 4YUQA 3P23A 5HU3A 3V5QA 4V0GB 5CU2A 5EOBA 5L6OA 2PE1A 4FTAA 1VJYA 5CZHA 3ZEPA 3ZM9A 2Q83A 3JUHA 3T9IA 3FI3A 5T6KA 4QP1A 2B9IA 1YWNA 2XCKA 3KF4A 4AF3A 2VWUA 5KNJA 1O9UA 3D94A 3IG7A 3R04A 4BDDA 4ZZOA 2R3RA 5JEBA 1GJOA 2X8EA 4Q9SA 1MRUA 3ORMA 3R8VA 3GCQA 5CAQA 4I3ZA 2IO6A 4AT3A 4RQVA 3EIDA 5KUPA 2BDJA 4AA0A 3COHA 4CFWA 3VF8A 2ZV8A 4DEBA 4X2NA 1RE8A 1ZMUA 4WRGA 2YZLA 4DTKA 2X8DA 4OT6A 3OXZA 2WU7A 4O2ZA 3NNUA 2WMWA 3HUCA 3VUHA 2UUEA 4F7LA 4ID7A 4PDSA 4L42A 3ZFXA 5IUIA 1EH4A 5AM7A 3A8XA 4FKWA 2IW6A 5J1VA 3R21A 4U40A 4BC6A 4G5JA 4K9YA 2QHMA 4B4LA 1UNLA 1Y8YA 3RK7A 4XEYA 3W2OA 2CJMA 2RG5A 4B6LA 1DM2A 4O7TA 4F08A 3EN7A 3W2SA 4I5CA 4IWOA 5F4NA 2HZ4A 1ZAOA 2F49A 2J51A 4F6UA 4HVIA 3CTHA 5AR2A 4B8MA 3BELA 2G2FA 2WMBA 4AQCA 2QNJA 3MFTA 4FYOA 3LFAA 1XR1A 2BRNA 3UC3A 4ZXTA 4QMNA 3MI9A 1J7IA 2VU3A 2YCRA 5HNGA 1YQJA 5CF4A 4DBNA 3RTPA 4R5YA 1PHKA 3VS4A 1WFCA 5DBXA 2WELA 3P1AA 5AV3A 2UZWE 2J4ZA 2XNPA 3NNWA 3OY3A 2J7TA 3IGOA 3RM6A 1GZOA 4FODA 3UIUA 3EL8A 4NJ3A 5JQ8A 4I4EA 4BCNA 2WTCA 4JQ8A 1OKVA 4AW1A 2XNMA 4GUEA 4BBMA 3P08A 4D4YA 3FLQA 4F6SA 5BX0A 4DF3A 5EQEA 1OM1A 3PVBA 2GQGA 2Z60A 4FKJA 3BU6A 4JBPA 5T68A 4LFIA 2OZAA 4FKRA 4I22A 4UZDA 1Q99A 4U42A 2RFNA 3ZRMA 1OKZA 2FA2A 1HCKA 2GDOA 3UTOA 5HU9A 3HMNA 2C6MA 5EYMA 2OKRA 4I21A 2R3MA 4RVKA 3BZ3A 3QUDA 4R1VA 2H9VA 4JDJA 1O6LA 4IEBA 2YIRA 4XRLA 4O81A 2FGIA 4XG8A 4I6HA 3CR0A 5CENA 1M17A 1ZLTA 4Q2AA 5F20A 2X1NA 2SRCA 5EM5A 4PF4A 4LV5A 3LHJA 5CQUA 1UU8A 3DQWA 5K4JA 3VBYA 1HCLA 4BN1A 4HYUA 3JS2A 4MF1A 5C4LA 2R5TA 4NUSA 2UZNA 1KE6A 5LVMA 3QRIA 4FIIA 3A4PA 3LZBA 2ETMA 3LCSA 4YJRA 4IVCA 3M11A 2VTSA 5TKDA 1ZMVA 1Q8TA 3LM5A 1UKHA 4YLJA 2W5HA 2X2KA 4U8ZA 1JSVA 4XG3A 5IQAA 2OH0E 4PP9A 1VR2A 4ZMFA 5FDXA 4DH7A 3S0OA 2B0QA 4EK3A 5I9ZA 3FL4A 1UU7A 2ZYBA 5FTGA 4FTUA 4JOAA 3H9FA 5HE0A 3TZMA 3R30A 2IVUA 3C0HA 4KAOA 1PRYA 5TOZA 2XKEA 4FKUA 3NVMB 2HYYA 4EL9A 2WNTA 2OXDA 3W33A 5K9IA 1WBTA 3F2RA 2OJJA 1BL7A 1WBVA 3NNXA 5DR2A 4JIKA 4XCUA 3QQJA 3ZLSA 5CF6A 5HTBA 3AGLA 2Y6MA 3EN4A 2A4LA 3PG1A 4WA9A 3TJCA 5EM8A 4D0XA 1M14A 3GC7A 5HX8A 1XH9A 4HYSA 4NK9A 5DG5A 4RGJA 4BCFA 2C6LA 2QQ7A 3GBZA 3KB7A 2C30A 2RKUA 5FG8A 5KBRA 2YCSA 3ANRA 4BGQA 3ODZX 4DTAA 1TQPA 1OIUA 3E88A 1UKIA 4RJ5A 3RJCA 5IKWA 5ETIA 3EJ1A 3LJ0A 5BMSA 5DA3A 2CGWA 4H05A 4A9RA 5IUGA 4JX7A 4UWYA 4D4SA 4FG7A 4C57A 3V5TA 3Q96A 3R1QA 3WYXA 2WMQA 4BCJA 4E6QA 2WMUA 4NFMA 5KHWA 1ZZ2A 3LFQA 2R7BA 2I7QA 2XJ0A 3C4FA 4CCBA 3GNIB 4DEIA 4C38A 3IO7A 2LGCA 3H9OA 3PSDA 1H0WA 4RX8A 3NYVA 4FIHA 4C4EA 3MVLA 1OL7A 2PUIA 2CCHA 3OOMA 2P4IA 4S2ZA 3D7TB 4CFNA 1OIRA 4ALVA 5AV2A 3U55A 3VQUA 4GK4A 1OBGA 2A27A 3COKA 4EH2A 5E8YA 2HOGA 5A4EA 4KIPA 1H1WA 3NZ0A 2CLXA 2AC5A 3R7VA 4R78A 1W83A 2R3KA 4FKQA 2QOCA 4XG2A 4ANBA 2P2HA 4C37A 4IVAA 3R8UA 4FTJA 3WOWA 5IU2A 1UNHA 2P55A 5C26A 3D83A 3KRXA 2JBPA 3Q53A 4YC8A 4G31A 4ZLOA 3PJ8A 2X0GA 4J97A 4ASXA 3HUBA 1E1VA 3PFQA 4JBOA 5IISA 3ZO2A 4CZTA 4DFXE 1UVRA 2CKEA 4L67A 4F70A 5IA1A 2F2CB 1J7UA 4MXXA 4PY1A 4YZCA 3UP7A 3EQBA 5L2IA 2W99B 4ANOA 2FH9A 2JDTA 4QP8A 4DG3E 2BRBA 1MUOA 2Z7LA 3ZLYA 5CX9A 4OBPA 4EEVA 5I4NA 1W0XC 2DUVA 2O8YA 3C5UA 4TYHB 2YERA 5TT7A 4BCIA 5IEVA 3CBLA 2Z7SA 4DH8A 3EFLA 3OTVA 5AX3A 4DT9A 3I5NA 5LVOA 3PJ3A 5EYCA 1IA9A 4FTMA 2YZAA 3LOKA 3CPCA 5FEDA 5C9CA 4BVUA 3FKLA 4DFNA 3TT0A 4DGOA 3TUCA 3ZLXA 4K11A 3E8EA 3RHKA 4IAKA 5LVNA 3P5KA 1RDQE 4EORA 3SW7A 3MPAA 5J95A 1RQQA 4FK6A 3QRUA 4KSQA 5AUYA 4B7TA 5FP5A 4ANNA 1YOJA 4KSPA 5AUVA 2CKQA 2BAJA 3EQIA 4FSTA 3RP9A 3QQHA 4XNEA 4BYIA 4HVHA 3D14A 2XCHA 3QBNA 3KXGA 2XNGA 4PMTA 4CLJA 1KWPA 2VN9A 4XG7A 3ZEWA 4D28A 2GQSA 2C6TA 4TTHB 1IR3A 5E8XA 5IZFA 2VTMA 5J7HA 3TN8A 4D1XA 3PUPA 4U79A 3R7GA 3GCVA 5JN2A 4J98A 2WMXA 3H0YA 1FVVA 4I5HA 4IANA 3UVRA 2A19B 2QHNA 4FT9A 5F94A 4NTSA 3REPA 3GFWA 4FIFA 4J96A 1JKTA 1R3CA 4GFGA 4ZTMA 2ONLA 3BWJA 4PDPA 3ULIA 4ZEGA 5I9YA 2JC6A 4KIQA 3UBDA 1WMKA 4L7FA 4WHZA 4FKVA 4IAYA 4LOQA 2R3QA 2QC6A 2Q0BA 4F0IA 5CZIA 1SVHA 2O0UA 4N6YA 2XVDA 3R71A 4GS6A 5ANDA 2X9EA 4XOYA 5AR4A 5A6OA 5DEYA 3QD2B 2W4JA 1KE7A 2CGXA 3P79A 5FBOA 5JQ5A 2WHBA 5EM7A 3C7QA 1J1CA 3MJ2A 5CSHA 3GEQA 4EBVA 5E1SA 3BLHA 3F69A 3HAVA 3WZDA 3POOA 4ZAUA 3LKMA 5AV0A 5ACBC 5E9EA 4ZZMA 4U9AA 1PXIA 5EW8A 4S31A 1FOTA 1HOWA 2CMWA 3LFBA 5IG1A 4PL3A 4GJ3A 4X7QA 2QOHA 3TNIA 2ITNA 2JKKA 4UMPA 2P0CA 2B9JA 4YZMA 4BDHA 3WI6A 4BL1A 1JVPP 4XS2A 1PXMA 2XNEA
chains in the Genus database with same CATH superfamily
4RLLA 2W1EA 4ERKA 4CMOA 4E8AA 4ANLA 5LQFA 4A7CA 2VTJA 3KXXA 5LOHA 3BLQA 2ZJWA 3UZPA 2WMSA 1Q61A 5CASA 1WVWA 3DK3A 2C6DA 5HZNA 4WOVA 3U9CA 4LV7A 2OSCA 4J95A 3I6UA 3FMNA 5AP5A 1J7LA 4XJ0A 4M15A 1ZYDA 3UJGA 3ODYX 3VUGA 4DINA 2GU8A 1U54B 5HVKA 2JDVA 3PZHA 5AV1A 2X0PA 1M7NA 2J50A 4QTAA 4PMPA 1FVTA 4WG3A 1Q24A 2OO8X 1OPLA 2Y8OA 3BLRA 3R6XA 4FEQA 3SOAA 4FC0A 3Q60A 4HVDA 1G5SA 2W96B 3BHUA 3F5UA 4YC3A 1OUKA 3UP2A 4LV8A 2P3GX 5EK7A 4O7LA 5AR8A 1WZYA 4YP8A 5M4FA 2C3JA 4DEGA 2YDJA 3VO3A 4JT3A 3N4UA 3QCYA 2XK8A 3QU0A 3QRJA 2NP8A 3WBLA 4BTKA 3KULB 2JDOA 4DFUA 3HZTA 3TXOA 5CU0A 3BE9A 4IJPA 4QQTA 2BHEA 2OI4X 3JVRA 1U5QA 4I41A 3GGFA 5EKOA 4AAYA 4LL0A 2HW6A 3LIJA 1M2PA 4QP9A 4XHKB 4DFLA 2BPMA 5ANEA 4ASEA 3WYYA 3ATSA 4TN6A 3RAKA 3VS2A 4ZP5A 1BUHA 3GFEA 4AZVA 4TL0A 3F2AA 2EVAA 4ZIMA 3E3PA 5AV4A 3PY3A 3F9NA 5KMOA 3T9TA 3OBGA 3RWPA 3FZTA 3LCKA 2X8IA 3IDPA 2OFVA 4W8EA 4K33A 2JDSA 2Y0AA 4NZWB 5JFSA 4DH5A 2GFSA 4RWIA 4IB0A 1OVEA 4K2RA 3QXPA 3ETAA 4EOLA 3ZXZA 5GJFA 2JBOA 4OGRA 5M07A 3RK9A 1OBDA 1QPJA 3U6HA 4I0RA 5IF1A 3HV6A 3OS3A 4AFJA 4H3PA 4JJRA 1ZOEA 3LMGA 4F7JA 3HYHA 4U7ZA 2BVAA 3BHHA 3BHVA 3C0IA 4YTFA 4FT5A 3UQFA 3TKIA 4R1YA 3SLSA 2E9NA 3WZJA 4GRBA 2ETRA 3OEZA 4WSYA 4TYGA 2W9FB 4DDIA 3ZLWA 3DTCA 4BDAA 3I81A 3MH2A 5ANOA 4M0ZA 3VQHA 3DKOA 3UVQA 4IVBA 1BYGA 4LUEA 4TYEA 3QLFA 3VS7A 3ZMMA 4BHNA 3W2CA 2O5KA 1G3NA 4I4FA 5FLFA 4QNYA 1U46A 2R64A 3A7FA 4FE2A 4D9TA 4TT7A 5L6PA 3QAME 4TWOA 3G6HA 3MS9A 4DYMA 4D9UA 4X2KA 4QYGA 3ZYAA 4RC2A 4EHGA 1NVRA 4ERWA 2WMAA 2B55A 3HP5A 2IG7A 5TF9A 2BDWA 1CKJA 4WG4A 3NUUA 3IQ7A 3WE4A 5ITAA 2PVMA 3GC0A 4GCJA 5L3AA 3NFFB 4YJOA 3PDTA 1R39A 2PMNX 3DV3A 3OFMA 3W32A 5LXMA 3OVVA 4FEUA 3QYZA 4CZUA 5IA3A 3EYGA 2YWPA 3R02A 3UG1A 4DBXA 3UMXA 4FV2A 1OMWA 3DAEA 1GNGA 3QTWA 4WUAA 1QL6A 3F5XA 5E8TA 2CDZA 2OK1A 5ANGA 1F3MC 1DAYA 2B9HA 3OC1A 3PXZA 4YPDA 4AW5A 1R78A 3Q9WA 4H3BA 4MNEB 4O96A 3FZPA 3VBTA 1CTPE 4F1MA 4PPAA 5A6NA 4RT7A 2R2PA 2YITA 4ZJIA 2OH4A 4IVDA 3QL8A 1YOMA 2E9OA 2J9MA 3QXOA 4CT2A 3PXQA 3KC3A 3RAWA 2CN8A 2I40A 3ORIA 3R8PA 4O4BB 1UU3A 2JDRA 4O0UA 3VNTA 1XWSA 1FMOE 3NW7A 4AGCA 3FLWA 4F1OA 4J52A 4RJ6A 3OMVA 3UYTA 3PA3A 5FD2A 1XBAA 4LGGA 3ZO4A 3VBQA 4EH6A 4P5QA 2ITZA 5K4IA 3QD0A 1ST4A 4QYEA 3ZO1A 1H1QA 4NSTA 4FRFA 3CC6A 4BHZA 4O7YA 1H25A 1KSWA 3Q32A 1B38A 3I0OA 4QPSA 5CVGA 5HI2A 4RJ3A 1GAGA 2XJ2A 3CJFA 3MFSA 4FMQA 4LQMA 4CRLA 2I0HA 4EOPA 3ZONA 3LLAA 2BALA 4AA4A 1IA8A 3I5ZA 3TCPA 3UGCA 3A7HA 2YM8A 4O27B 3EKKA 3L8VA 3LCOA 1ZY5A 2B4SB 4EWQA 2QO9A 2XA4A 1XHAA 1SYKA 3ERKA 3QLGA 4OBOA 4RZWA 5HESA 4FGBA 3UE4A 3ACKA 3RNIA 4EOJA 3E8NA 4XV9A 3LMIA 1VEBA 2NYAA 4CRSA 2EU9A 3FXXA 3IGGA 4TYIA 1WBSA 4EZ7A 4FT7A 4M67A 1V0OA 3BEAA 5TR6A 4WNKA 2XARA 4Z16A 4E7WA 4MCVA 3BV3A 5I9UA 4TPTA 3DKCA 4W4VA 2PMLX 2BFXA 4D2SA 2Y9QA 3IOKA 4DHIB 4Y83A 3NIEA 4YJSA 4CT1A 1YOLA 4EOIA 3EZVA 1RJBA 2C4GA 1ZARA 4ZTRA 4CLIA 2X7OA 1JBPE 3QC4A 4GK3A 4CGAA 3ZSIA 4IWDA 4AOJA 5C8NA 4HGTA 4QDVA 4FTOA 5HG9A 4GW8A 5H2UA 3RM7A 4FSRA 1XH8A 4NJDA 3TIZA 3QCQA 3UG2A 1T45A 5EDQA 3BHTA 3R1SA 3LFFA 2QLQA 3Q3BA 4MQ1A 2OXXA 2W4OA 3BYMA 3AQVA 1NXKA 3KKVA 4C61A 3AC4A 3H9RA 4BJJA 1JOWB 4NW5A 3DU8A 2VX0A 4S33A 2ZMDA 4DAWA 4OTQA 4RWJA 5AA8A 4AW2A 4DHZA 3RCJA 2R3FA 1AQ1A 3IDBA 2IJMA 4CXAA 4V0GA 4C3PA 3O8PA 1TFFA 2VWZA 4DITA 3G51A 2WTJA 3ELJA 5JFXA 1IEPA 4L68A 4GUBA 1PMNA 4EUUA 4RMZA 3DBEA 4D5KA 2Z8CA 5DIAA 4UN0C 5CALA 1Y6AA 4JQ7A 4QMZA 4O0RA 5A3XA 3O7LB 4LMUA 5HG7A 3OP5A 3MTFA 4AZTA 3ORPA 1J1BA 3QZHA 3CQUA 2ITXA 2WB8A 4X21A 4FG9A 3CPBA 4R3CA 4RVMA 1XKKA 5FEQA 1ZXEA 1UA2A 4EWHA 4EZ5A 4FEWA 4OTPA 4QNAA 3V51A 1YHVA 2WTKC 3COIA 3SHEA 3U51A 5EH0A 4MUQA 2C6IA 5DLSA 4FZ6A 2X39A 4RC3A 4QQCA 3ZXTA 5E4HA 4PMMA 3K5VA 4FIJA 1G8SA 3CJGA 3JPVA 5KCVA 5A54A 3PXRA 4JS8A 3OY1A 1JNKA 5IH6A 2OIBA 3LCDA 2GS6A 5BUJA 4TXCA 5AP3A 3DXPA 2ZB1A 5CXHA 1OB3A 2W1DA 3QTUA 2ONLC 4FVPA 4BDIA 3NVKI 1YXVA 3AMBA 3UDZA 2XRWA 3FY2A 3V01A 4D4RA 5EOLA 3DBDA 3LMHA 5CEQA 4C59A 1FINA 3UIBA 3HNGA 4NCTC 2HIWA 2UVZA 4GMYA 4JLCA 4UALA 5HNBA 3GOKA 2VTOA 4ANQA 4ENXA 3AOXA 4BIBA 4G3EA 4U0IA 2W7XA 4QP3A 3DFCB 4DGNA 3LPBA 3MIYA 4C34A 3NYOA 2FSMX 2E9UA 3DS6A 1JKSA 4KINA 3V5JA 4APCA 2R3LA 2VNYA 3CXWA 2WMTA 4NWMA 3ZDUA 4L8MA 4G3DA 5AUUA 5HLNA 3ZFYA 2YJRA 3HX4A 3TL8A 2OLCA 4FV7A 4FKLA 3AD5A 4BDBA 5L6WL 4F99A 2OJIA 3P0MA 5JMSA 3GU6A 5L4QA 1WBWA 1SNXA 1JQHA 4FZDB 4NEUA 4AE9A 3KXHA 4KBCA 4MVFA 2H6DA 4PDYA 1DAWA 1BI7A 5CU6A 4Y95A 4IJ9A 3SD0A 3KRLA 1XH5A 1TZDA 4LOPA 4TNBA 4QMSA 3SGCA 2H34A 2I0EA 5AP6A 3HA6A 3AC5A 5DR6A 5IEXA 3OT3A 3OUKA 4CTBA 4CVAA 4KIOA 3E93A 4LUDA 1P14A 4F0FA 4FUYA 4IB3A 4YPSA 3O23A 3ZBFA 2XUUA 3BU3A 5DPVA 1Q41A 3UIXA 5KMMA 1GIHA 2XNNA 2PE0A 2PHKA 4QMQA 2C0TA 3IOPA 2BRGA 5IUHA 2I0VA 3FBVA 4G2FA 4KKHA 4Q5HA 2C5XA 1TQIA 3AC3A 2PK9A 4I1ZA 3NCGA 1H1SA 4QP4A 2PUNA 2WTWA 3G15A 1XJDA 4I5MA 4IAFA 4LGDA 3W0NA 2EXMA 4J8NA 4IWQA 4U3YA 3R00A 4RVLA 5LVLA 4K18A 4AXCA 3QTRA 4V04A 3HRCA 4AA5A 4FT3A 3L8SA 4GT5A 2YM5A 4X3FA 2W5AA 2IVVA 4F9YA 3KRWA 3PY1A 4D2RA 1PXKA 4G3FA 4A4LA 1Q8WA 2JAVA 4A07A 4YO4A 3MVMA 2R3HA 4KUJA 4AS0A 2E9VA 3RINA 1REKA 4GVJA 2QURA 4L01A 1H4LA 2Z02A 3W0QA 4X2GA 3W16A 4MKCA 4H36A 2QKRA 5E8VA 3ZRKA 4O21A 4XRJA 4A06A 2B52A 3FAAA 3V5WA 4ZY5A 4DEEA 3FPMA 3SVVA 3NUAA 3E8DA 3F82A 3VBWA 1ZOGA 2WQOA 2YDKA 3M42A 4P4CA 3DJ6A 4I6QA 5AUXA 4C4IA 4BDJA 3DCVA 4J7BA 5HVJA 2PZ5A 4NIFB 3QHRA 5CS6A 3BYUA 3RHXA 1K2PA 3W8LA 1U59A 4AXDA 4RZVA 2W5BA 3PJ2A 3AC2A 3EOCA 3LCTA 3ZTXA 4AGUA 3MY5A 3WZEA 4NM0A 3SG8A 2QU6A 3ZO3A 1U5RA 3DZQA 2R3OA 4F78A 2W05A 4QTBA 3UO6A 2AYPA 5HOAA 4ACCA 3RPOA 4AWIA 1CDKA 4C02A 1PKDA 3UPXA 3C4WA 4HZRA 4S32A 4MQ2A 5JGBA 5KMJA 2V7OA 1GZNA 4D1ZA 1SM2A 3SAYA 4M3QA 5AP1A 2W17A 1Y6BA 4HGLA 4ITJA 5HE2A 2OIQA 1UWHA 3U8WA 3IDCA 2X4FA 5C8KA 3C1XA 3FMLA 3KY2A 4NM7A 4OTHA 4W4XA 3U87A 4EOOA 1IAHA 5KMKA 2PMIA 3DTWA 4DHJA 1J3HA 3KK9A 4FTCA 4MH7A 3CEKA 5KMIA 1OPJA 4M84A 4O83A 2ETKA 5AADA 4RFMA 2VX1A 4IAAA 3U54A 4IW0A 3DY7A 4X6QC 3D7TA 2GCDA 3JXWA 4O0VA 3QZFA 3HMIA 4DFZE 1U4DA 3JVSA 1NY3A 4MWIA 1YHSA 4FSUA 1ZOHA 4BRXA 3A60A 2ZV2A 3I0QA 3AT4A 4JG7A 3VF9A 3EFWA 4K77A 2WU6A 2R9SA 3CSVA 4AZWA 1V1KA 4M13A 3PTGA 1H8FA 2WOUA 3EQGA 5KMLA 1XH7A 2EWAA 4M14A 4OLIA 4AOTA 3C4ZA 2PULA 4DEAA 3AKJA 4PL5A 3AD6A 2YIWA 5IA2A 2QR7A 2YAKA 3PVUA 1V0PA 2WTDA 3AT2A 5JZNA 4AGWA 1R1WA 4BTJA 4HVSA 3TG1A 1FGIA 4WBOA 4R7BA 4DE4A 5L2SA 4E1ZA 3RZBA 5BPYA 3UO4A 5E1EA 3VAPA 1KV1A 1W7HA 3KA0A 4FTTA 4FNWA 4HVGA 4HOKA 1BKXA 4JAIA 1YVJA 4UMUA 1H07A 3KMUA 4L45A 4TYHA 3RI1A 4I0TA 1FQ1B 2PZRA 5AM6A 5J9LA 1L8TA 5L2QA 4BTFA 5AX9A 3EFKA 2X7GA 4N4SA 4ALWA 1JKLA 5A4LA 4J99A 3I6WA 3DQXA 4BZNA 5HVYA 2J2IB 5EW3A 4NYEA 2IVTA 3TUBA 3E87A 2F7EE 1H24A 3DK7A 1ST0A 1CSNA 3GXLA 1YRPA 2IWIA 3S3IA 2BKZA 3EHAA 1O6KA 2F57A 5GZ8A 2R0IA 4M69A 4DH3A 3IPHA 1Q8ZA 3I79A 4DT8A 2Q0NA 2WTVA 4BDGA 5JGDA 1UNGA 2VTLA 4X3JA 2VWYA 4FL2A 3D4QA 1M2RA 3BBWA 3FSKA 5IQFA 4M7IA 5LMKA 2UW9A 1WAKA 3DJ5A 3DPKA 4BBEA 4TYJA 3DKFA 4K0YA 4DN5A 2FVDA 2OFUA 2XEYA 3EYHA 3OBJA 4Y46A 3FXZA 5A4CA 3TTJA 2JKOA 3TV6A 4YMJA 4I6LA 2PYWA 1YDSE 4HCVA 2VTHA 3QKLA 3QTZA 3PSCA 4ZTLA 4QQ5A 2X4ZA 2VO7A 2HXLA 4U5JA 5M56A 2FYSA 3FC2A 3MJ1A 3PJ1A 1M2QA 2V0DA 1B39A 3OCBA 2EXCX 2QLUA 4LGHA 4BDKA 4E4NA 2BIKB 4JNWA 4JG8A 3R7OA 2YIQA 3KXMA 3VS5A 4BFMA 1QCFA 1BL6A 4DCAA 1UV5A 3OCGA 3OCTA 4XBRA 5BVEA 3ZCLA 3NYNA 3FI4A 3IS5A 5LARA 5EI2A 3F3UA 5DI1A 4AZFA 4AX8A 4BZOA 1H0VA 4EKKA 3U6JA 4NM3A 1ZRZA 3FZSA 4EOQA 3TMOA 3DA6A 5M09A 3E5AA 4FV9A 4V05A 5GHVA 3DXQA 2C47A 2HXQA 4P2KA 2AC3A 3FLZA 1TVOA 5CSVA 2Z7QA 5CEMA 4PPCA 4MNFA 5EYDA 3UQGA 2QO7A 1ND4A 2YWVA 1YW2A 4OAUC 4X6RA 2G01A 4LYNA 5EKNA 3BYVA 3O0GA 4PX6A 2NRUA 3PXFA 4HYHA 2OBJA 3LXKA 4O82A 4RIXB 3OOGA 1YXUA 3OWJA 4EBWA 4MWHA 5IDNA 2B53A 2QCSA 3LXLA 3HMPA 4QMLA 5FM3A 5KBQA 5IQEA 3T3UA 2WEIA 4BCMA 5AWMA 2CGVA 4O7SA 4BWPA 4N57A 2YLEA 3PZEA 4RA4A 1YI4A 3CCNA 4C8BA 2YEXA 2VWIA 2ZMCA 3K54A 4C58A 4XG4A 4O91A 4EZ3A 4BI1A 4AACA 4UX9A 5L2TA 1Q8YA 2YDIA 1PYXA 2WOTA 4ZK5A 4D58A 4KABA 1KOAA 4YTCA 3VW8A 4FA2A 3ORNA 4YLLA 2C3IB 3H0ZA 4L00A 4DLIA 4DGMA 3U6IA 3ML1A 3TIYA 5JGAA 2Z7RA 2JKQA 3F3WA 3FE3A 3L1SA 5CEPA 5GZ9A 3EN5A 4PTCA 4IH8A 3VVHA 4FNZA 4QPMA 5AAFA 4E4LA 2BRHA 4ZTNA 4YURA 4XUFA 2YACA 4FL3A 3BGPA 3I4BA 3ZH8A 3QA0A 5HIBA 3HV7A 2OG8A 2UVYA 4PRJA 4F09A 3ATTA 2GTMA 2XK6A 3R9HA 1H1RA 2PVKA 4QRCA 5CWZA 4YGAA 3VS3A 4ZTQA 4MXCA 4EH3A 4EH9A 2GNGA 2UW0A 5A4QA 2RFDA 3OXIA 4JIAA 4A4OA 4KS8A 3DAKA 3P4KA 2R4BA 5CY3A 3OWPA 5EI6A 3D15A 3R8ZA 3UNJA 4RIWA 3WF5A 4AT4A 2GNHA 4IZ7A 4APPA 4FVQA 4IMYA 4HYIA 1PXJA 4JI9A 4YJVA 3AMAA 3V5LA 4C7TA 1KUTA 1Z57A 3CTJA 1W2CA 5HD7A 2PU8A 1V0BA 2CHLA 2F2UA 4IM0A 4XP0A 2CSNA 4IACA 4L6QA 4FGRA 5CAVA 5IQGA 4QT1A 3RBWA 4QTCA 3LFCA 5HCYA 3O50A 1PW2A 3JY9A 4AFEA 5GZAA 3S1HA 1M7QA 4C3RA 2VO3A 2VGPA 4ZLYA 5ICPA 2XIYA 3ZS5A 2C5OA 1KE5A 2ZV9A 3CKXA 3EN6A 3TKUA 4QPAA 1S9IA 5A14A 2X81A 4L7SA 4O7RA 2ZM3A 4FR4A 4IE9A 1P4OA 5DFPA 4HW7A 4FYNA 2WMRA 5JH6A 3UOLA 2JFLA 3E62A 3P7AA 4D2PA 4RRVA 3ENHA 5JKGA 4U44A 2XNBA 2IZSA 2CKPA 3ZC6A 2XIXA 4FKIA 5CNOA 4JR3A 3UNZA 4NKSA 3MH3A 1QPEA 4K6ZA 4EH8A 5D10A 1GY3A 2B9FA 4PUZA 2YHVA 4QYFA 5D41A 1G8AA 3L9LA 2WPAA 5FXSA 3VRZA 2VTRA 2XALA 3S00A 4X3FC 2BTRA 4FV1A 3DDPA 2QR8A 3HL7A 3ZSHA 5H3QA 2YCQA 3MYGA 4GG7A 5EHLA 4AZSA 3NAYA 5M57A 4AU8A 2W1FA 4OTWA 3VULA 1UU9A 1STCE 4G6OA 3LLTA 3RGFA 3SG9A 1NW1A 1R0EA 4FT0A 3KCKA 5CT7A 2EB3A 3GQIA 4BF2A 3QRTA 4U97A 3FMEA 4XV3A 4JG6A 3RKBA 4F9CA 5BYYA 3LFNA 3BYSA 4LRKA 1PY5A 1IASA 4FKSA 5DH3A 5ETAA 4D1SA 4F9AA 3BL7A 3QYWA 4S30A 5E8WA 2DQ7X 3OD6X 4Z7HA 4MNEA 4KIKB 2C3KA 3E7VA 3HMOA 3PWYA 4NU1A 1JSTA 4M12A 5EYKA 2G2HA 3QTXA 1Y8GA 4QYHA 3TNWA 2PSQA 2VAGA 2BROA 2CPKE 3BQRA 3LJ2A 4BGHA 5HNIX 2H96A 3IW6A 4HGSA 4O4FA 1OIYA 3HKOA 2R3PA 2J0LA 3UMWA 5BYLA 3CQWA 2XS0A 3FJQE 3PA4A 3F2NA 3GU5A 4XP3A 3RPYA 3L9PA 1YXSA 4ZSGA 2ZM1A 1R0PA 3F3TA 3NEWA 2UVXA 4FZFB 4L44A 2ZB0A 3O17A 3O8UA 3HAMA 2J5FA 2ACXA 2QODA 3W2RA 4EH5A 2NO3A 3F88A 3CY3A 3OF0A 1M52A 4ZY4A 4B8LA 5FUTA 4FSQA 1YI6A 3B8RA 1DS5A 2QOOA 3ZDIA 1K3AA 3ZZEA 3JR1A 2Y4PA 3HRBA 3SXSA 4ORKA 4LG4A 4UY9A 1KOBA 2ZM4A 4ZTHA 3RMFA 2BMCA 4WIHA 3R7UA 3PFYA 4OBQA 5C27A 2GHLA 4CFFA 1MRVA 4ACGA 2WFYA 4I92A 2GMXA 3MGYA 5IPJA 3JYAA 2LAVA 5DRBA 2UW3A 4TW9A 5J5SA 1H27A 2QOQA 2VRXA 3E64A 2UZUE 1WBPA 3DBCA 3OEFX 5HG8A 5TE0A 4CV9A 2H8HA 3MVJA 5BUEA 3FMHA 4MHAA 4RIYB 3TKHA 5IQCA 1OZ1A 4IIRA 3K3IA 4GT3A 2R3IA 4R3RA 3FUPA 3MWUA 2VTPA 2X9FA 2X2MA 3GOPA 3MFRA 4FZAB 4W9WA 5CSWA 4ASZA 4ASDA 2PVNA 4EC9A 5DHJA 4IXPA 4EC8A 4AXAA 1FVRA 4KRDA 3SV0A 3R2BA 5D7AA 5BVOA 3QC9A 4O0WA 2PY3A 4JQEA 4RA5A 5HQ0A 3GU7A 4EONA 3DXNA 4O0SA 5DT0A 4JRNA 1TKIA 2HAKA 3NRMA 4NFNA 4FJVA 5AP2A 4FKGA 4GJ2A 2ITTA 1T46A 3ZSGA 4DLJA 3LAUA 2C1BA 3LXPA 5BVNA 4EH7A 5KHXA 5H8BA 3VC4A 2IN6A 2QG7A 3VJOA 5FDPA 2C69A 4HZSA 4FIGA 4M0YA 5G6VA 3DK6A 4PTGA 4E6DA 3DNEA 5J9YA 4BIEA 2HWOA 4GH2A 3FQEA 3PA5A 4MBIA 4G3GA 4KS7A 4BDFA 3G6GA 3H10A 4O38A 4DG2E 4FK3A 4FV8A 2WGJA 4BDEA 2VWVA 3VBVA 4DEHA 4K8AA 5HBJA 4CFVA 4R8QA 2VV9A 3R73A 2BHHA 2ITOA 3F5GA 4CQGA 3E63A 3R9RA 1LEZA 3B2WA 2PE2A 3FDNA 4EQUA 3MA6A 4MXOA 2PVJA 1OKYA 2R3JA 3VHEA 4C35A 4CNHA 4FSMA 1XH4A 5G1XA 4FG8A 5DT3A 4GK2A 4IC8A 3R7EA 2VGOA 2W1IA 1Q97A 3QWKA 2VWBA 2ZVAA 2HZIA 3U4WA 3ZUTA 4BCHA 3PRIA 4BIDA 5HTIA 2QVSE 2WQNA 3AD4A 4Z9LA 2C0IA 2XIRA 5FXRA 4DFBA 3D7ZA 3FZRA 2WTIA 3F61A 4FSNA 5LMKC 2QKWB 2VO6A 3FV8A 3DB6A 4W8DA 2G1TA 5JRQA 1Q8UA 2G9XA 4EJNA 4YTIA 3QZIA 4P90A 4WSQA 2YM4A 1XQZA 2XH5A 4IFCA 2IVSA 4FSZA 4M97A 3PSBA 2QI8A 1QMZA 5CSPA 2VWXA 2B7AA 3SW4A 3TZ8A 3DLZA 2WEVA 3VHKA 3ALNA 3MN3A 4BCPA 3R9NA 3B8QA 3EQDA 2WIPA 3AG9A 3HA8A 3OG7A 2UW4A 3BIZA 5CVFA 3MW1A 3QZGA 4EQMA 4F0GA 5CAUA 3R0TA 5HX6A 3MESA 4WT6A 4BWKA 4IAZA 2ITQA 2ZV7A 4C36A 3QWJA 4FV4A 5JT2A 2RFEA 2BR1A 4NKAA 3GENA 3G9NA 4D55A 4PNKA 4IBMA 3UOJA 3ID6C 3OROA 4OTRA 4USFA 4QYYA 4UMTA 3R7YA 3NFGB 2G15A 1ERKA 5M4UA 1BX6A 4O7VA 2J0MB 2OJGA 4W4WA 3CD8A 3SC1A 4IDTA 5HCZA 1VYZA 1I09A 1PMEA 4QMXA 3SRVA 5K0KA 4U6RA 5AEPA 5M08A 3KU2A 1LEWA 5LJJA 1F0QA 3FQHA 5AUZA 4LMNA 1YI3A 2YABA 4GL9A 2B54A 4G9RA 4KNBA 4OT5A 4WNPA 2EUFB 3Q9ZA 4J8MA 2CNUA 2QOIA 2RIOA 3AT3A 1W2DA 3EQHA 4MTAA 3IW8A 4ZLZA 3BHYA 2OXYA 4E4XA 5LMBA 3A2CA 4YHJA 2HCKA 1W98A 3THBA 3LXNA 3WIKA 4ZZNA 3FI8A 4TWCA 5AFVA 3R01A 4O22A 3HDMA 3EFJA 1VZOA 3QCXA 4UB7A 4Q5EA 1PKGA 3T3VA 4RQKA 3R2YA 4PWNA 1IAJA 3D5VA 2JAMA 4JBQA 2OU7A 4ARKA 5BV3A 3DDQA 5GJDA 4ZOGA 3VUKA 4IQ6A 4N70A 3UDSA 3K5UA 2ITWA 2PZYA 5F9EA 4BKZA 3CLYA 2BCJA 4QMPA 5J87A 4EQCA 4JBVA 5C01A 5BQ0A 4U81A 1XBCA 2W1ZA 2XM8A 2OF4A 4P5ZA 2VTQA 3H30A 4NW6A 3SOCA 3WF8A 3IONA 3ORKA 5FGKA 4E73A 2VX3A 3VW6A 2WMVA 3H4JA 4QTDA 3Q6UA 3ET7A 2F7ZE 2O2UA 3SXFA 3PUFC 3EQCA 4GSBA 2VUWA 3DLSA 4XG6A 4XP2A 4RFZA 5CF5A 4FEXA 3GT8A 5FBNC 4FTNA 4J53A 4C0TA 3BI6A 3MB7A 3QFVA 5IQBA 2VNWA 1TQMA 3WZUA 2P2IA 4MBJA 5ACKA 1Y57A 3G0FA 4EOSA 3CQEA 4LDTA 3MVHA 3UC4A 3R63A 2CN5A 3O96A 4CYIA 2HY0A 1WVXA 4G1WA 4I24A 4UXQA 1Z5MA 1ZYJA 4WNOA 4PTEA 2QOFA 3MIAA 1WVYA 4O0XA 1CKIA 5I0BA 5HICA 1H26A 1WBNA 2UZLA 4O1PA 4YJUA 3FQSA 4D2VA 2FSLX 3BBTB 3NPCA 2ZOQA 5CVHA 5L8LA 4R3PA 4CD0A 4NL0A 4YZBA 4GT4A 5D7VA 2WKMA 1PJKA 4GIIA 5BYZA 5CSXA 3OT8A 3QUPA 2C5YA 5K0XA 2CKOA 5FTOA 3C50A 2OJ9A 4QOXA 1E1XA 2QOBA 4QDEA 4EHEA 2EB2A 3V8TA 4FKPA 4YR8A 3ROCA 3ENMA 2GS7A 2PVLA 2VTNA 4E5BA 2XK9A 4O6EA 4IZAA 4IAIA 1XO2B 3EQPA 4GV1A 4O6LA 3E8CA 3C4CA 4BKYA 3AC8A 3A7IA 5I9XA 1H1PA 4FNXA 5DN3A 2A98A 4YZ9A 3C9WA 3MBLA 2QD9A 5I9VA 3TYKA 4KKGA 4FKTA 4MAOA 5BVDA 4MYGA 5CTPA 1GZ8A 4JDKA 4RFYA 4XLVA 4BZDA 4ZTSA 2ITPA 2BRMA 4NTTA 3O2MA 4WO5A 4CG9A 2JGZA 4RWLA 3G0EA 4IADA 3HV4A 2GQRA 2X0OA 4HJOA 3C51A 3KGAA 4OTDA 3S2PA 4MD8E 3GU8A 4CFMA 4I6FA 5EI8A 2O65A 1UWJA 1FBNA 4P7EA 1NVQA 4C3FA 3PXKA 5DT4A 5KZIA 4UWCA 2PVFA