4A07A

Human pdk1 kinase domain in complex with allosteric activator ps171 bound to the pif-pocket
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
284
structure length
282
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSAKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Allosteric Regulation of Protein Kinase Pkczeta by the N-Terminal C1 Domain and Small Compounds to the Pif-Pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 282
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a07A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a07A01
5AP6A 4WBOA 5H9BA 2P33A 2H9VA 1PMEA 4YZMA 2JDVA 4O7TA 3OCGA 4JT3A 4PMTA 4BDBA 2PMIA 5BVKA 4PL3A 4O1OA 2KTYA 3QYZA 2XS0A 3LM0A 4NEUA 3UO5A 2VD5A 3BU6A 1KWPA 4FNZA 1SM2A 4JAIA 3QRJA 3PG1A 3E63A 4ZTQA 2PU8A 2F7XE 1M7QA 5EH0A 3VF9A 4NYEA 3VUKA 3WF8A 2VX3A 3RNIA 3V51A 3ZC5A 5IA3A 3H10A 5CF8A 5AR2A 4CFFA 3KXXA 4F7NA 4Y85A 3RPRA 2W96B 4ONAA 4X2JA 3UDBA 5JGDA 2ONLC 3ETAA 1NVRA 4R3CA 4MD8E 3H9FA 5FXQA 4AA4A 3A7GA 3IGGA 3F6XA 4RJ8A 1FQ1B 2VTNA 2BZIB 5GIOE 4DLJA 4CG9A 4CKJA 3FZPA 3QTSA 4O7WA 3BGPA 4H3QA 2C0TA 2UZBA 3RHXA 3MI9A 4CZTA 2GHLA 1KE5A 3R22A 3FZOA 5AUXA 4K33A 4F63A 1WBPA 5CI7A 3V8SA 1BX6A 2UVZA 5CEIA 4EYJA 3OVVA 4U81A 2Z7QA 3VW8A 3PWDA 4I6QA 4KS8A 4C33A 3WF6A 1LR4A 3ZDUA 4JR7A 4OTQA 2H6DA 3ZBFA 3CD8A 3RAHA 4FEUA 3QRIA 4D2VA 3R7IA 4AOTA 1WVWA 5LQFA 2ITUA 4TNDA 4C36A 4BTMA 3QUDA 3QX4A 4DEBA 4U7ZA 4C57A 3DS6A 4FKPA 3DA6A 3FLSA 5CLPA 3NPCA 5BYLA 5CANA 3QQHA 5CSHA 3POZA 4CRLA 5J9ZA 2PVHA 4HGSA 4JOAA 3R9RA 3BZ3A 3W1FA 1ZY4A 5A4LA 3LLAA 2J0LA 2VTSA 4C4GA 2XK7A 5CZHA 4UX9A 2FSLX 5M4FA 2O64A 2QI8A 5AA9A 5TKDA 3D7TA 3SC1A 3HMNA 4DFBA 2HENA 5AJQA 2C5VA 2QOQA 1H1SA 1PXLA 3QQGA 3TKUA 4D1XA 2Z7SA 3O17A 5EI2A 2E2BA 5L4QA 3A8WA 3SVVA 3N9XA 3VW6A 2A1AB 2O2UA 2ZOQA 3BYMA 5I3RA 1UKIA 1OL7A 5HZNA 3ZU7A 3Q9WA 5CALA 3OUKA 3KMUA 4RMZA 5E7RA 3RM6A 2CKEA 5EFQA 3UOLA 4AT3A 2YA9A 3W16A 3R9DA 4WG4A 4R5YA 1PXOA 2PZYA 1BLXA 3CP9A 3OWKA 1VJYA 5FBNC 3KXHA 5LVMA 3C50A 3TACA 3MV5A 3ATTA 2R9SA 1O6LA 2HCKA 1PXJA 4MNEA 5ANKA 1QPCA 2R3LA 3FMKA 2W1EA 3FHIA 2XF0A 1FVVA 2JKMA 5HE2A 2Y8OA 2HAKA 4TWCA 3VS0A 4X7QA 3AD5A 3GXLA 5AWMA 5GNKA 3S1HA 5AR8A 3H9RA 3QD0A 2QKRA 4ZAUA 3PRFA 4ALVA 2ZDTA 4PV0A 3TNHA 5JH6A 1KE7A 4ANMA 2XYNA 5GZAA 3O23A 1YXUA 2R3FA 5E9EA 2W0JA 4ASEA 3EJ1A 2Y4IC 1PXMA 3A7HA 1P4FA 3LCTA 2EXCX 3BU3A 3C4XA 3BE9A 2I7QA 2BDJA 4PL4A 2ZV8A 1OPJA 1XBBA 4KABA 4FI1A 4EOIA 4I0RA 1B6CB 4XG2A 2A19B 3SXFA 4NSTA 1JWHA 4ERWA 5LVLA 3TWJA 3R01A 3PXKA 4GEOA 3GC8A 1SYKA 3K2LA 4IC8A 4FTOA 2W7XA 4FNWA 5IEVA 4MQ1A 4QQJA 4BCOA 4QMWA 4JLCA 3ZO2A 3ANRA 2CN5A 4EOPA 3FEGA 2QOOA 2C0OA 5K4IA 1YWVA 2ERZE 1YI3A 1YHVA 2PWLA 3F88A 4FTKA 3HMOA 4KWPA 3NVMB 4E6DA 4YUQA 4IEBA 2O65A 5K5XA 3OWJA 1H8FA 2X2LA 3DJ7A 3OHTA 4RX7A 5DHJA 5BUIA 3W8LA 4IFCA 2QODA 2C69A 3JY9A 4FT0A 4W8DA 5HG9A 3UP7A 4CZYB 3UPZA 5A3XA 4ZK5A 4RWJA 5ANEA 4C2VA 3EQRA 4EHZA 4RIYB 4CMTA 3ZONA 1YXTA 5A46A 2Y6MA 4C4FA 3DXNA 5EYMA 2H8HA 4AFEA 4ZJJA 4GV1A 4X3JA 3R9OA 4UXQA 3R7OA 3COKA 3NUXA 3QLGA 4ENYA 4V05A 3QWJA 4NM3A 5C4LA 4AW5A 2I0EA 2W1FA 4D2WA 4IZYA 2XK3A 1H0VA 2ITTA 3KY2A 3ZUUA 4C2WA 4FIGA 3AC2A 4FSUA 1ZOEA 3P5KA 2J90A 2B55A 3EQDA 3PVBA 4IX5A 3R9NA 3FLZA 2IZTA 4U9AA 3KMWA 2XBAA 1OIQA 2ZAZA 4EOSA 4AE6A 4AA5A 2XM9A 3ZM4A 4BL1A 5IH5A 5GZ9A 2C6EA 4FKIA 1PXNA 4DGLC 3ZYAA 4YTHA 4M97A 3GCSA 5CVFA 3Q96A 4FTRA 4AGUA 2WQMA 3EQFA 2P2HA 3E93A 3EQBA 3G9LX 1MRYA 4QMMA 5HG7A 4XV3A 5JFWA 1H07A 4GT4A 4LV8A 4C8BA 4KBKA 2F2CB 5CU4A 5CAQA 3R1QA 3VBVA 3EFLA 3LMHA 4BCNA 2HW7A 4A4XA 1DS5A 5GHVA 5AUUA 3L8PA 1B39A 1PXKA 4II5A 3C1XA 1YHSA 5IUHA 1CMKE 3AQVA 4EZ3A 2WU6A 5CU6A 3VS3A 5HTIA 5M09A 5LWMA 2DS1A 4JBPA 4EQUA 1KUTA 2WPAA 3C0HA 5C8NA 3TIZA 3DTWA 2C6MA 4EQMA 2QOIA 4BYJA 3LQ5A 4AQCA 5CEKA 2GNLA 4NH1A 3D2IA 4FVQA 1IAJA 4FV4A 4U8ZA 4TYGA 4FICA 3IDPA 4XX9A 3HRFA 5IEYA 3A7FA 3R30A 4LL5A 3CTHA 2V7AA 1OPLA 2WTIA 3PZEA 4XV1A 5HO8A 5TE0A 3BGZA 5IUIA 2VTQA 4FK3A 4KBAA 4FKJA 4JR3A 2CKOA 4M14A 4QP2A 3SKCA 4BC6A 3KXZA 4IC7A 2F49A 2BTRA 4N4SA 3QUEA 3M1SA 4X3FA 4E4XA 4TPTA 3ORNA 4HJOA 2X2KA 1XBCA 4MX9A 3HA8A 2Z8CA 3UMXA 1W8CA 3BIZA 4BZOA 2R5TA 4JIKA 3UQCA 4BRXA 2I6LA 3TNQB 4J98A 2UZNA 1Y91A 1ERKA 4IJ9A 5IH6A 3GT8A 2FGIA 2B53A 2IVTA 2J6MA 2PVJA 2YLEA 3I4BA 3QTRA 5DEYA 4HVGA 4BVUA 2DYLA 4RWKA 5IA2A 1XKKA 2F7ZE 3IOPA 3QLFA 3FXXA 5J7HA 3QHWA 5T68A 3WZJA 2QNJA 3PIZA 3PE2A 4RPVA 2YIYA 5J9LA 1M7NA 4YHJA 1U5QA 2C5NA 3IONA 4FV1A 3CTJA 3LXPA 3PIYA 4X2KA 4TYJA 4XH6A 3NS9A 4EC8A 4F7SA 5LXMA 3FKLA 3DB6A 1H1WA 2CCHA 4UYAA 1A9UA 3OEZA 5DFPA 1CTPE 2DUVA 3DK3A 2OSCA 3QTWA 4QMPA 5HX6A 5KX8A 1H1PA 3CIKA 5ANIA 5HKMA 3SX9A 3QXPA 5FXRA 2W1IA 4W4XA 4MK0A 3CGOA 4E1ZA 2JDOA 4EHGA 5C4KA 4LYNA 4WOVA 1J7UA 5HICA 3DBEA 3LQ8A 4AGWA 3P7BA 3A4OX 2JDRA 4X2FA 4BI2A 1ND4A 1M52A 4M66A 4FTNA 5HCZA 2VV9A 4UEUA 2UW6A 4FKLA 2QD9A 4HVIA 4I5HA 3R6XA 4G16A 5IQHA 2ETMA 3DKOA 4M12A 4PF4A 3CQWA 3TT0A 2X8IA 3V6RA 5A6OA 4IB3A 4O6EA 2BRBA 5HCYA 4FT9A 4GRBA 4IZ5A 4XMOA 4Y83A 2YFXA 4KNBA 4Z16A 5IQIA 1VEBA 2EB2A 1JQHA 3OOMA 1H28A 4IW0A 2VWYA 3RI1A 3AMBA 3PPKA 1JSUA 4D2PA 4L3PA 3TDVA 3SAYA 4BGGA 4ZOGA 2X9EA 4F7JA 2J0IA 4M0ZA 1ZLTA 4QP1A 3WE8A 5JGBA 3PJCA 4FKGA 3L1SA 2QQ7A 1UV5A 4HCTA 3V5QA 4EORA 3E5AA 3MVLA 4JVGA 2JD5A 2PUUA 4QT1A 3CJGA 3NYNA 2OKRA 3U87A 3UMWA 4AG8A 3ZFMA 4O0YA 1IAHA 3CJFA 3HMIA 2J0MB 5HQ0A 4YLLA 2R0IA 5JQ5A 5DR6A 5KMKA 2RG5A 2BMCA 4QMTA 3OOGA 3C4WA 2GQGA 2JFMA 2ZMCA 1QPJA 2IJMA 2VAGA 4Q5EA 3Q2MA 4RIXB 4DFUA 4ZMEA 2QLUA 5IZFA 5FEEA 1IASA 2UZOA 1OL5A 4L7FA 4M0YA 2CLQA 2VO0A 4JL9A 4E26A 3FMEA 4S31A 2Z02A 4QMSA 3V8WA 2XKEA 3O50A 4LRJA 4IDTA 5IDNA 4NKSA 5B2KA 4IM0A 4ITJA 3DQXA 4K8AA 5I0BA 4LUDA 5EI8A 3UO4A 5CEOA 1IA8A 4E6QA 3RK7A 3EQPA 3KRJA 5HESA 3TTJA 2ONLA 1P4OA 3ZSGA 2PZIA 4I6HA 4C4EA 5EG3A 3ET7A 3TUBA 3GQIA 3A60A 3EZRA 2UZTA 1K9AA 2G2IA 4R1YA 3KGAA 1GZ8A 3R7UA 4USFA 4PDSA 1GIJA 3TZ7A 3LAUA 4V0GA 3NR9A 3ID6C 3NSZA 1UWHA 1ZOHA 2F4JA 3CEKA 3H30A 4GFMA 3QQKA 4WRGA 5AX9A 4D4SA 2EXMA 4NTTA 3DOGA 4OTIA 2C3IB 3Q9ZA 5AV1A 4DYMA 5L6WL 3Q9XA 3L9MA 1PMNA 1TKIA 2H34A 4FSTA 4ZTSA 4NK9A 4F0IA 2XNMA 3FLQA 4YC6A 2Q83A 2VWXA 1STCE 5E8XA 3E3PA 4GT5A 5ACBC 3VS1A 3IOKA 2W4JA 1F0QA 2QHNA 3BLRA 3B2WA 2Q0BA 2XA4A 3KL8A 5I9XA 4FZ6A 2BHEA 3DKGA 3W55A 1APME 2UV2A 4QMYA 3SA0A 4NCTA 4M84A 4JG6A 4O2PA 2C1AA 4E8AA 3QD2B 3IPHA 4PWNA 3DNEA 4LMNA 5DYJA 3BLHA 4IWPA 3BHTA 3E7VA 3MFSA 4C3RA 4BGQA 3SD0A 4FKQA 4FV2A 1OZ1A 5EYKA 4W8EA 3EN6A 4TXCA 4U40A 2C4GA 2XH5A 5LJJA 2BZJA 3G6GA 3R04A 5EM7A 3BE2A 4CFVA 4PNKA 3BPRA 3OCSA 5AUWA 1FOTA 3C4FA 3MFRA 3M42A 4UV0A 2X39A 3P4KA 2FA2A 2C0IA 4D2SA 2PUNA 2F7EE 3R63A 3VULA 4J97A 2PMOX 4RZVA 1H00A 3HDMA 4ZTMA 5JK3A 1IR3A 3QTQA 3T3UA 2W5AA 3HP2A 3NVKI 1ZYSA 4MKCA 3NAYA 5HE0A 3TKIA 3VBTA 1Q8YA 5DNRA 4F4PA 4I23A 2A2AA 3JY0A 4J95A 1XH6A 3HRBA 4UMQA 5CXHA 4H05A 3BEAA 2ZVAA 2B9HA 4JG7A 4O21A 1YDRE 4TYHB 1JPAA 4JJRA 3W32A 4YZ9A 1R1WA 4LRKA 3JPVA 4O0VA 2BFYA 3RPSA 3UBDA 1FBNA 3MVHA 3FZRA 2WMBA 4FT5A 1G5SA 4FTMA 4AT4A 2R3KA 4H1JA 3F2RA 2RFSA 2B54A 4ZTLA 3QX2A 5FP6A 1YXSA 2QOKA 4GK2A 5B2MA 4O7SA 5L8LA 3NDMA 4JNWA 5LARA 2FSMX 3FKOA 3UE4A 4U42A 1GJOA 5E91A 3HV5A 3LMGA 3NUYA 3NW5A 3LFNA 4MNFA 4MWIA 2YIWA 2ZB1A 5E92A 2OXDA 2VO6A 1W82A 4LV5A 4AN3A 3U6IA 4QPMA 3VS2A 2OJGA 3I0OA 4AZWA 4DEAA 4OAUC 2NNWB 3K54A 4IWQA 4AUAA 3UNJA 3LVPA 3EKKA 1SNUA 2GPHA 5AFVA 2V7OA 3W8QA 3F7WA 4FEVA 1R78A 2WEIA 2YM8A 4AE9A 3UOJA 4BDGA 5KHWA 2GS6A 2HY81 1KOBA 3DK6A 4G2FA 3KXMA 4FG8A 2BIYA 5BMSA 1P14A 1NXKA 4H1MA 3AD4A 3FYJX 4OTGA 4RIWA 4AN9A 3O2MA 5GJGA 3WF7A 3DPKA 3MB7A 5LCJA 3JVRA 2WTWA 1Q3WA 3ZLSA 3IO7A 4XEYA 3KF7A 2WTKC 2HIWA 4PY1A 4CFXA 2R3MA 3ATSA 4C61A 2GS7A 2VTMA 2J5EA 4QYFA 4X21A 4C02A 4DINA 3LQ3A 4WNPA 2ITVA 2DWBA 5I4NA 4FTJA 3ZZEA 4KB8A 2RF9A 5HBEA 2IN6A 4FL2A 3CC6A 5DEWA 5EI6A 2RSVA 4BDDA 3U9NA 5KBRA 4ACHA 4AT5A 4HYHA 5AIRA 2R3IA 4WBBB 2ITNA 3G2FA 3OROA 5KMJA 3UJGA 4FODA 4OTDA 4IQ6A 2VTTA 4C59A 1QMZA 4CXAA 4EK4A 1YDTE 3EQCA 2JEDA 3FLWA 4FEWA 3ZC6A 2GCDA 4IHPA 3UPXA 3FQSA 4IADA 3BRBA 3F3ZA 3MY1A 4XV9A 3LJ2A 4KUJA 5GINE 4YGAA 4IVDA 4XNEA 2GSFA 5FEQA 3TG1A 1Y8GA 4FSYA 3EB0A 4WUNA 1URCA 4FX3A 4I5CA 1GZNA 4LM5A 5CZIA 3QCXA 3UOHA 4BCFA 1PW2A 3S4QA 2XEYA 3A62A 1QPDA 2XNOA 4IZAA 4OT6A 3RZBA 3WZEA 1JLUE 1XH7A 4HPTE 4YJTA 3UYTA 1KSWA 3K3JA 4A07A 3ZM9A 5AAFA 4UZHA 3FY2A 3Q32A 5M06A 5FQDC 2GQRA 4FKSA 5D12A 4EH4A 5D7VA 1HCKA 2C1BA 2CGUA 4U97A 3PY3A 2WTKB 3UNKA 4AX8A 4KSPA 1Z57A 2ITWA 2VWWA 5CT0A 4RFYA 3DBCA 4CT1A 5DRBA 1AQ1A 3FL4A 3FBVA 5EM5A 4BDFA 5HIDA 2VTAA 3C13A 3OW4A 3R8UA 5JRQA 5AP4A 2BRGA 5EW9A 3DT1A 3IW4A 4FTLA 4GT3A 1T46A 1WBTA 1YWRA 4XCUA 4ANOA 4OTRA 5EOLA 3KB7A 4R8QA 4X0MA 5M44A 1Q61A 3VS7A 3VUDA 2YHVA 1UU3A 3UNZA 3F3WA 3F5UA 4I93A 5K9IA 2ITOA 3HUCA 4MXXA 3VUTA 4Y5QA 5TT7A 3FI4A 1R0PA 1PHKA 4D1SA 4F6WA 4I4EA 4IZ7A 1Y6BA 2YCFA 3RALA 5EQYA 1OL6A 1CDKA 4BB4A 2V62A 5CU0A 4R7BA 2JIVA 3FI3A 4A4LA 2XIKA 3MPMA 3I79A 4IB0A 2XK9A 3GU4A 4ACGA 2R3PA 2R0UA 2W1ZA 3GU5A 4G9RA 4UWCA 5AUYA 1CKJA 1UU8A 4RLLA 2WEVA 1Q4LA 4I22A 3W2PA 4EH2A 5C1QB 5KMMA 3SHEA 3UVRA 2G2HA 3LFFA 4UMUA 3TV7A 4ZY5A 4O6LA 1PYXA 4O0UA 4RQKA 2XK8A 2YLFA 3NYVA 3P0MA 1PMUA 4UMRA 5L6OA 1JAMA 3QWKA 3VVHA 2WAJA 4CTBA 4KBCA 4L3JA 3A2CA 4GVJA 5ETAA 5H8EA 3DBDA 3Q4CA 4NM5A 4O0WA 1ZARA 3GGFA 2HXQA 4WSYA 5KMNA 4CG8A 3L8VA 3LXKA 4WD5A 4E5AX 2PYWA 4AA0A 5F9EA 3I0QA 4BCIA 3OUNB 2NRUA 2AYPA 3BELA 4KS7A 4B7TA 4F0GA 1LP4A 4MBLA 5AR3A 4B6LA 1H1QA 3PSCA 3MA6A 3NCGA 3R71A 4DFZE 2QO7A 1NVSA 4EH3A 4JIAA 2ZV7A 4RX8A 4Z7GA 5ITAA 4BICA 3EYGA 4YJNA 3R7VA 3HV6A 4GUEA 2B4SB 2BUJA 2HZ4A 5AP7A 4C35A 3IG7A 4Z3VA 1GZKA 4NZWB 3TUCA 4YNEA 5HNBA 3U51A 5DR9A 3S0OA 5AA8A 4QRCA 4O7LA 3DB8A 2UUEA 3NCZA 4KA3A 4K18A 4MD9E 3Q4ZA 3PYYA 4OAVB 2J9MA 4PDYA 3Q60A 4JXFA 4Q5HA 3T3VA 4P90A 3MGYA 3ZFXA 2XK6A 4UMTA 5CF4A 5AM6A 4DC2A 2A27A 2J50A 2W9ZB 2XNBA 4M67A 4RJ5A 4WG5A 3SGCA 4RVLA 2JBPA 1U54B 3QKLA 4D2RA 5J79A 3OCBA 5DGZA 3MA3A 1R39A 4PTCA 4ZSAA 4YSMA 5ACKA 4CYJA 2GNHA 3E3BX 3O7LD 4IE9A 1E1VA 1S9JA 5L2QA 3RWPA 4LOQA 4Y73A 2PVRA 3NZ0A 4KRDA 3LCKA 5BQ0A 5M07A 3BHYA 4Z7HA 1ZZ2A 1GOLA 2HY0A 2XIXA 3R83A 3RWQA 3CLYA 4E6CA 4EK8A 5AP1A 4AACA 4FNXA 3TV6A 4YURA 4DEGA 3JR1A 2C3JA 1YKRA 5KCVA 1PXPA 1XH4A 3NUUA 3OF0A 5D41A 5IUGA 3BHVA 2WZJA 2BDWA 5EYDA 5B7VA 1TQIA 1CKIA 5CTPA 2XJ2A 3P9JA 3PXYA 4BCGA 3HV7A 5A4QA 3GFEA 4IX4A 3ZSHA 5F94A 5HE1A 2B7AA 1TQMA 3AC4A 3PDTA 4I4FA 5L3AA 4TWPA 4PMSA 1G3NA 2OJIA 3MH3A 4XBUA 4XOZA 2CNQA 3DQWA 1OGUA 4UMPA 1SMHA 2QLQA 2UZWE 3E8CA 3MH0A 4C58A 3C0GA 2Z2WA 2X9FA 2G2FA 2JAVA 3EH9A 4L7SA 4ZP5A 5KE0A 4D5KA 1BI8A 5GJDA 4KIKB 4H36A 4LOOA 3ZEPA 1IEPA 4EJNA 4IM3A 4Z55A 3D2KA 4FKRA 4A9RA 3EL8A 1OBGA 4FV5A 3I6UA 4BIEA 4M69B 2GU8A 5CNNA 3G15A 2WTDA 4EBVA 2J0JA 2JITA 1Q8ZA 4QP9A 5AP5A 2GHMA 1Q5KA 2PL0A 4UZDA 4W4YA 3UZTA 4WIHA 3OMVA 3PJ2A 3ZH8A 2P2IA 3D14A 2VO3A 3CPBA 4EZ7A 4TTHB 3UOKA 4DGOA 5IQDA 1HOWA 4AFJA 4MQ2A 3QXOA 2IZRA 4FKUA 4YJPA 3WIGA 3FMDA 3S2PA 3OEFX 2WOTA 4JQ7A 3AOXA 4L52A 1JNKA 3B8QA 3CE3A 4WO5A 3ZS5A 3GEQA 3SRVA 4I6BA 3QKMA 3F3VA 4NUSA 5ANGA 3SXSA 3ALOA 1H01A 2YDIA 3R1SA 3TM0A 4YP8A 1CKPA 5FDPA 4O2ZA 3FXZA 4BIBA 2WMSA 1OIYA 3GC7A 3GU8A 2YDJA 4ZEGA 2PE0A 5HG8A 3VC4A 4DF3A 5M08A 4FTCA 4A06A 4M7IA 1OI9A 4QP3A 5J5TA 2WMUA 4A7CA 2R3HA 3EFKA 1H4LA 3V5WA 2WQEA 3MBLA 3RZFA 2XNEA 4IMYA 3KC3A 1OIUA 2XM8A 4GCJA 4MF1A 4JDIA 2CGVA 4D0WA 4FIHA 4RVKA 5CSVA 3ZRKA 5ANDA 4RG0A 4BBEA 4RJ3A 4BIDA 3RHKA 4PP7A 2JLDA 3DKCA 3OWLA 4EH9A 1XQZA 3QQFA 1RJBA 2CN8A 1UU7A 5HCXA 4CYIA 4IM2A 2WMVA 5ANJA 4ZJIA 5IEXA 2GNJA 3BX5A 3DU8A 4O27B 3PXRA 4HNFA 2YIQA 3L8SA 4P2KA 4WHZA 5DLSA 3NX8A 3F3TA 4I0TA 4OTPA 3TDWA 4DBXA 3QUPA 4O1PA 4V04A 5IG1A 2XNNA 5M57A 3DZOA 1ZY5A 3GFWA 4G3EA 4CKIA 4G5JA 3UIMA 4GKHA 4LMUA 5CYIA 3Q04A 4FGBA 2XKCA 3UVQA 2IVSA 5IQGA 4KSQA 5L2SA 5J87A 2O5KA 2WMWA 2OZAA 2XIYA 4L00A 3GCVA 3VBYA 2ZYBA 5LMBA 5LWNA 1Q41A 3A7IA 3R0TA 5BVDA 5G1XA 3K5UA 5HIBA 3LHJA 3JS2A 5EDQA 1WBNA 2W1HA 3HLLA 4CCBA 4UY9A 3ZEWA 4IVCA 3ZXZA 3I6WA 3FC1X 3OT8A 3LXNA 4MEDA 2OU7A 4MF0A 5CU3A 4EYMA 5I9YA 2FH9A 2UVYA 4U44A 3WOWA 5AV3A 3PSDA 4YBKA 5J1WA 1U46A 2X7OA 3K5VA 4O38A 4OT5A 3IKAA 4YPSA 2JGZA 2IW6A 4LOPA 4DLIA 3QALE 3E92A 3SW4A 2FVDA 4NWMA 2DQ7X 4U0IA 2ZB0A 2PUIA 3TXOA 5AUZA 4OW8A 4TZRA 3PPZA 4TWNA 5DMZA 4KD1A 2RKUA 4U5JA 1V0OA 2OI4X 4KRCA 4BWXA 4QPSA 4HVHA 5JZJA 5DPVA 5IMXA 4ZTHA 2B52A 4R7IA 2HXLA 3KULB 4D1ZA 4FKTA 3V04A 4AW2A 4BHZA 4MVFA 2YM6A 4NT4A 4QMQA 3IW5A 4FK6A 3HUBA 3GVUA 3SW7A 2C6DA 3G51A 3UIUA 3VQHA 5EKNA 2YEXA 3BQRA 5D11A 3G5DA 4WSQA 3POOA 5J1VA 4CT2A 1HCLA 3KVWA 4BCMA 3MN3A 4O7ZA 4BR3A 4FTQA 4B99A 2IVUA 2VNYA 3AC5A 1OITA 4K0YA 3H0YA 5HD7A 4EH7A 4IX6A 5EW8A 4R6VA 3NEWA 3AG9A 2V55A 2HZNA 4QQ5A 5IQAA 5KBQA 5CS6A 4QYGA 3ORMA 3LE6A 4CSVA 3AXWA 2G01A 4AOIA 4QNYA 4O7NA 2WXVA 3OS3A 4GL9A 4EOKA 2BZKB 2BRHA 3MY0A 4GIIA 4XLIA 4YJVA 5LCKA 3TI1A 3OT3A 5JFXA 1OKVA 3LLTA 3IECA 4FL3A 3ROYA 4E5WA 4ASDA 4TRLA 5EM8A 2OXXA 2XIRA 3DLSA 4YZDA 5IQFA 4HNIA 2CNUA 4WA9A 2XKDA 3QD4A 3IK3A 4BDCA 2VTLA 2Y4PA 5E8UA 2VTRA 2PZPA 3ENMA 3V5JA 4N57A 4BF2A 4YMJA 3NNWA 3LFSA 1U5RA 4IAKA 4O7VA 4I6FA 4OR5A 3DFCB 4TN6A 3RPOA 4PL5A 3NYOA 3R21A 3PLAE 2VTJA 2OWBA 2XRUA 1VZOA 1V0BA 2WMXA 2C5OA 5B0XA 4IDVA 3D5VA 3ALNA 3QQUA 3VUMA 3LCDA 5EHOA 2PVLA 4K77A 1MP8A 4ARKA 1OKYA 1V1KA 4O0SA 5CXZA 2BFXA 2O63A 3PJ3A 4FSZA 3U4WA 1U59A 1V0PA 4IAZA 3R8LA 4B0GA 2YCSA 4RX5A 5I9VA 4DN5A 3T9TA 3TKHA 4YO6A 5AAGA 2E9OA 1YQJA 3HNGA 3BLQA 2XCHA 4NIFA 1NVQA 2JKKA 2R7BA 3ORLA 5AUTA 5E1EA 4E5BA 4EONA 4YTFA 3PVUA 4ZJVA 4YHFA 1IRKA 2A4LA 4BDIA 5JFVA 3R1NA 4XP3A 2GQSA 3PE1A 2B9FA 4JRNA 3AMAA 5EHLA 3I5NA 3I1AA 3BQCA 4QQCA 1AD5A 5EW3A 3FMJA 4BFMA 3R2BA 1Q24A 3EOCA 5AP3A 4XUFA 5M53A 4JDJA 1ZYCA 3VN9A 3R7EA 1FVTA 2QVSE 1E1XA 1ZWSA 3LIJA 3HKOA 3PY0A 4RT7A 3QA0A 1FPUA 4O0RA 1KV2A 4AZVA 3BCEA 2X81A 5AAEA 3CKWA 2OIBA 3CS9A 1REJA 3F9NA 4W9XA 3A61A 3FQEA 1F3MC 4GVAA 1PXIA 5CWZA 3AMYA 1GIIA 4I92A 5EK7A 3RMFA 3BYUA 5ANOA 2XNPA 2IPXA 3B8RA 5LMAA 3D7ZA 4F6UA 1YHWA 4JDHA 4L6QA 2WTCA 3COHA 4UN0C 1FGIA 1XJDA 2WD1A 3ORXA 4E6AA 4IXPA 1BUHA 3DY7A 4FZFB 4XV2A 5BVFA 5HU9A 4RFZA 3N4TA 1YOJA 2F2UA 1M2QA 3C51A 4D9UA 4JRVA 4KKHA 3OXTA 4Y72A 4NL0A 1DI8A 3RJCA 4GMYA 4IB5A 4J8MA 3PY1A 4OUCA 4XG4A 2C68A 4PUZA 1DI9A 4HW7A 2VWUA 3D5XA 4PTEA 4XP2A 1R3CA 3QGWA 4Y5HA 2OFUA 3PXZA 4D28A 4DH5A 2HWPA 4F1TA 2BR1A 3PVGA 5IA5A 3HP5A 4C34A 2HWOA 4FUXA 5FBOA 4O83A 2A0CX 4BTFA 3IW7A 4L44A 4BKZA 3C4EA 4XG6A 5CNOA 5EDPA 4YZBA 2UW3A 4MWHA 4QYYA 4ZS0A 4NW5A 3MIAA 2P4IA 3GCUA 4O91A 4EWHA 3U6HA 2QOHA 4HYUA 3Q6WA 3MS9A 1X8BA 2BPMA 3DV3A 1J1BA 3GCQA 4NM0A 3PXQA 3Q4UA 2CSNA 2OBJA 3T8OA 4NFNA 1OECA 3P7AA 3GC9A 2X1NA 2QHMA 5D10A 3D0EA 3VF8A 4DEDA 2JAMA 1DM2A 1RQQA 3W2SA 2GMXA 3DBFA 5BVWA 2ITXA 4FKOA 3V5TA 4ALWA 4QO9A 4DGMA 3FV8A 1O6KA 2CHLA 3HGKA 3WARA 4GG5A 3PG3A 2ITQA 2XIZA 2IO6A 2OXYA 1J3HA 2ETKA 3RKBA 5I9ZA 2RL5A 3P7CA 1K3AA 4ZY4A 1ATPE 5AP2A 2WFYA 4D58A 5CSWA 2LAVA 5CAUA 4GYIA 5T3QA 1L8TA 2BCJA 3R02A 5K0KA 2GHGA 4FZDB 4JX7A 2BKKA 3RAWA 4YU2A 1RE8A 2WIHA 4KAOA 3FMHA 3U8WA 3D7TB 3KU2A 4IJPA 4RJ6A 3OC1A 4L42A 4S30A 3ZFYA 5L8KA 2VUWA 3I5ZA 2W5HA 3DGKA 5CASA 4ID7A 4G31A 4X6RA 4HZSA 2YIXA 4Y95A 5CEQA 3GB2A 3HDNA 4D9TA 1L3RE 2WMTA 4PDOA 4ZLOA 3WYXA 1MQBA 3QQLA 5C27A 3VAPA 4C3PA 1YI4A 1FGKA 3G9NA 2VU3A 2FO0A 4YZNA 2WQBA 4F9BA 3PXFA 5DT0A 3LFBA 4F99A 2YISA 3OBGA 3Q2JA 4QTDA 1KE9A 3KXGA 5HGIA 5HI2A 3NIEA 5CVHA 3RNYA 3HL7A 4AW1A 4CFNA 1YXVA 4F64A 2WIPA 5E8WA 4MNEB 2XMYA 4NW6A 2OICA 3S95A 3D94A 1OBDA 5TO8A 3QRTA 1NT2A 3MVJA 2C5YA 4R78A 5E4HA 3EKNA 3Q3BA 1M2PA 5HG5A 1XWSA 2JKOA 3QFVA 3UODA 1J1CA 1O6YA 3PSBA 2HOGA 1SVHA 2J51A 2PHKA 3ORPA 4QYEA 2X6DA 2E9PA 4D2TA 4HGEA 5AV4A 3BYOA 3E8EA 5M4IA 3BBWA 1QCFA 3V8TA 3C0IA 3MB6A 5A14A 4F70A 2QOFA 2JBOA 2XCKA 4D4YA 3GOPA 5D7AA 2PTKA 1F5QA 4QTCA 2E9NA 5AR4A 2PK9A 1Q3DA 3OBJA 3IDCA 3I7BA 4XG3A 4JBQA 5HU3A 4FGRA 3DXQA 4X6QC 5LVPA 2ERKA 4FV6A 3QCYA 3HAVA 5IISA 5FG8A 3VHEA 3FZTA 2AC5A 5HHWA 5D9HA 2GNGA 4X2NA 4ZZOA 4FT3A 1PY5A 1PYEA 1VR2A 5J95A 2CNVA 4L45A 5I3OA 4E20A 5DH3A 2REIA 4J99A 4BWPA 2JKQA 2WU7A 5KKRB 3FI8A 3SV0A 1MUOA 4GS6A 3BWJA 4RBLA 4P5ZA 2YM5A 4EOJA 5KNJA 3LKMA 1W98A 4RIYA 3Q53A 3WF5A 1JKSA 3VQUA 2R3JA 3KFAA 3EHAA 5E8TA 4FF8A 3KN6A 2VRXA 3BWFA 2YABA 4XRJA 3JVSA 3DBQA 5HVJA 3ODZX 4OBOA 2G1TA 2QOBA 4I5MA 3E64A 1XH8A 4EZ5A 3HMMA 4PTGA 4M8TA 2GFCA 5E8YA 3CCNA 3KMMA 5DT3A 3C5IA 5BNJA 2W1GA 2OF4A 3UP2A 2FYSA 1ZAOA 2UZEA 3OY1A 3ZLYA 3UC4A 4IANA 2V5QA 2BAJA 5HLWA 5IMEA 2QONA 1OMWA 3V3VA 3N4VA 4FT7A 3ZOSA 3FZ1A 5HBHA 3R7GA 4DE4A 2Q0NA 1I09A 4CGAA 2C6LA 4O0XA 3AT4A 4ACMA 4CTCA 3SDJA 3S3IA 5FLFA 2G15A 5J9YA 3U55A 4MAOA 3TNPC 5DA3A 4FIIA 5FRIA 3II5A 4KKGA 3G6HA 1Y57A 4MBIA 4V01A 5L2WA 3GC0A 4RJ7A 4CFMA 2HELA 2WOUA 5IQCA 2XNGA 5CT7A 4L67A 4TT7A 4O82A 3HEGA 2VWZA 1I44A 3UC3A 4EH8A 5LVNA 2HW6A 4WNKA 4OLIA 5BPYA 3GU6A 3E88A 5IA1A 1QPEA 5B2LA 4AZTA 3AGMA 5CAOA 3MVMA 3SG8A 2YJSA 3EFWA 3FJQE 3D9VA 4RC4A 4F9AA 2ZM1A 3CY2A 2XJ1A 4YR8A 3JYAA 5FP5A 3N4UA 3QC4A 1Z9XA 5JZNA 4C38A 2W17A 1WBVA 3ZLXA 4CKRA 5M56A 1OM1A 2VO7A 4AZFA 3LZBA 5E8VA 5A4EA 3A8XA 4JG8A 3OW3A 4FOCA 4PQNA 4QP4A 3MTLA 2YJRA 4UWBA 5C03A 3FI2A 3KA0A 4FTUA 4BBFA 3QA8A 2Y7JA 1OIRA 4JQEA 4RGJA 4AS0A 2FUMA 3O8UA 4MXZA 2B9IA 4S34A 2X7GA 2FSTX 4G3FA 3CSVA 4MTAA 2R3GA 4U41A 4YZCA 2PY3A 4L43A 1GY3A 4HCUA 2YERA 4FYNA 2X7FA 5CQWA 3FMLA 4XOYA 4I41A 3KRWA 5K5NA 4S33A 2F57A 4OBQA 2R2PA 4LGDA 2PVNA 4GW8A 2X4FA 3UZPA 4UALA 4ITIA 3RBWA 3RPYA 4G34A 5KMOA 3RAIA 5CEMA 1WVXA 3G33A 4QD6A 4MYGA 3BV2A 2OO8X 1T45A 3OP5A 3Q52A 4GU9A 4CV8A 1H26A 2ZJWA 3TZ9A 4BCKA 3ACKA 4CCUA 4FZ7A 3FPMA 4YTCA 3BI6A 2RFDA 2G9XA 3JUHA 2YCRA 4MD7E 4X3FB 1E9HA 3WBLA 4H58A 3SOAA 3MY5A 3O96A 3ZTXA 2ZMDA 3O7LB 3WZKA 2JDTA 3DCVA 4FSQA 4EOOA 3GENA 4DG3E 3QTIA 2XP2A 3ZDIA 1QL6A 2OFVA 4RLKA 2IWIA 4QMLA 5EYCA 4EK3A 2WGJA 4GG7A 3ANQA 3UIBA 2Y0AA 1BI7A 4YJRA 3ORZA 1UA2A 4U79A 5AV2A 5CSPA 2Y6OA 3CR0A 3SG9A 3E7OA 2QG5A 3LM5A 3NUPA 4M68A 3TL8A 3HRCA 2R7IA 2R3NA 3UQFA 4DFNA 4J71A 4RC2A 3NIZA 2EB3A 4DT9A 2PVKA 1OUYA 1P2AA 2AUHA 2OJJA 2QOCA 3RPVA 3LFDA 2XVDA 3ZRMA 3MPTA 5F1ZA 4C4IA 3ELJA 4AW0A 4YLKA 3DJ5A 3RVGA 3K3IA 3ENHA 2UW0A 3LMIA 3ROCA 3NYXA 5L2TA 1G8SA 5EQPA 2YWPA 4FIFA 2KULA 5EHYA 5J5SA 5DR2A 3UIXA 3F61A 4GFOA 5JSMA 2RGPA 4YO4A 5H3QA 4RWLA 4MXOA 4KINA 1W84A 2OLCA 4FEXA 2I0YA 4UBAA 4PDPA 2C5XA 5EKOA 3PP1A 4LG4A 5FGKA 3RK5A 2PE2A 3PA3A 5CI6A 4YTIA 4O86A 4L46A 2IW8A 3QTXA 3R1YA 4PP9A 3NW7A 4QMXA 5AV0A 4ZS4A 3F7ZA 1PKDA 1ZOGA 2XBJA 3V5PA 4FSNA 3TN8A 4LUEA 3OFMA 3CTQA 4YJQA 5E1SA 2CKQA 3H4JA 3PTGA 2ZV9A 1CSNA 4E4NA 3VJNA 3GQLA 2YN8A 1MRUA 4L9IA 3OZ6A 3TUDA 2ACXA 4FSRA 1S9IA 2X6EA 4DH8A 1KE6A 2HZ0A 1PKGA 2JFLA 2OGVA 2WELA 4HYIA 1VYWA 4Z9LA 4L3LA 4RWIA 4IVAA 5I9UA 3R9HA 2QC6A 4U80A 4DEHA 3FQHA 2C47A 2BAKA 3LCSA 3P23A 3UGCA 2QR8A 4XG7A 3FSFA 4RIXA 3Q9YA 2WB8A 4K1BA 4A4OA 3EZVA 2Z7LA 3MW1A 3NRMA 4PX6A 4TWOA 4UWYA 2QCSA 5CQUA 4ALUA 4A9UA 3GOKA 3CGFA 4F65A 2W06A 5K4JA 3REPA 1YVJA 2F9GA 4H3BA 3DAEA 3QGYA 5CENA 4BBMA 4KIOA 2X0GA 4RJ4A 3FUPA 1JOWB 4IAYA 2FSOX 3MSSA 3B2TA 4K2RA 5CU2A 1Q8TA 4ANBA 4CVAA 3QRUA 5AR5A 3VNTA 5BVNA 5DN3A 4DT8A 4BI1A 4RIOA 3VWAA 1SZMA 4MXCA 4EK5A 1YOMA 4ENXA 5LOHA 5IQBA 3FKNA 3PJ8A 3R8MA 1AGWA 4R5SA 3BEGA 4TY1A 4NCTC 4DTBA 4E93A 1UWJA 4EC9A 2BRNA 2Z60A 2BHHA 2LGCA 4FL1A 5K3YA 3BBTB 4QP7A 3C4ZA 4PPBA 4IIRA 2CJMA 4ZSGA 5HLPA 4HCVA 4FZAB 3S00A 2W99B 3EYHA 3FZSA 4GJ3A 1XHAA 3BU5A 5TF9A 4FTAA 2VTPA 1PRYA 4B8MA 4F9YA 4EEVA 5KUPA 3R8PA 4BTJA 3D83A 2I0VA 3NAXA 4AWIA 1SVEA 1A48A 2E9VA 2PMNX 5ICPA 1XBAA 4FTIA 5DVRA 4WNMA 1OB3A 5FEDA 4FG9A 3SOCA 2Y9QA 3KKVA 4J52A 2ZM3A 1PMVA 1WCCA 3DTCA 5JKGA 3ZUVA 4FYOA 3MWUA 2CGXA 4QOXA 3COMA 2VTOA 4QTBA 2YM7A 1SVGA 1WBOA 3VRZA 4BDEA 4FNYA 4L8MA 3ZRLA 4V0GB 3VBQA 3VUIA 2YCQA 1KE8A 3FAAA 3AC3A 2JIUA 4G17A 1LPUA 4AZSA 4CLIA 4GIHA 4DAWA 5IDPA 2C6TA 4QMOA 5DT4A 3VHKA 3IW8A 1B38A 3G0EA 3QF9A 3PJ1A 3EQGA 2VZ6A 2GTMA 4HZRA 3P79A 5L2IA 5E8SA 2PPQA 4DEEA 2VX0A 4BTKA 2BVAA 3R8VA 3C7QA 5G6VA 4E73A 5KZ0A 5JQ8A 3KK8A 4M15A 3FLNC 2J7TA 3OCTA 3PA5A 4NTSA 5J8IA 3UG2A 4C62A 3Q4TA 5DBXA 3LW0A 4PPCA 4JBOA 1GAGA 5DRDA 3RGFA 1JBPE 4PPAA 3MTFA 3U6JA 2OG8A 1BKXA 4MH7A 3DKFA 3QYWA 3GNIB 4W9WA 2C6KA 4TYHA 4BDKA 5CEPA 5KHXA 4DTAA 2UZLA 3MIYA 2PVMA 4I94A 4QPAA 4C7TA 3CQUA 1BYGA 1WAKA 1ZXEA 4DEIA 3F2NA 2HK5A 2Z7RA 5D1JA 2IZSA 3F5GA 3TZ8A 3I7CA 4GKIA 1LUFA 3MH2A 3MPAA 3IGOA 4I20A 5DI1A 2NPQA 4O7RA 3R8ZA 5DIAA 3KVXA 4JS8A 4AP7A 2BIKB 1FMKA 1LEZA 4FKWA 1GIHA 4GUBA 3AT2A 2AC3A 3P86A 4GYGA 5C8MA 3TTIA 5FWKK 4G6LA 5M51A 4NJ3A 3FMNA 2CPKE 4W4VA 5HO6A 4EL9A 2X8DA 3DNDA 3OWPA 3QL8A 3U9CA 4APPA 4O81A 4IWOA 4G3GA 4YSJA 2HZIA 3I81A 1UKHA 2OJ9A 5JRSA 5A4CA 3MYGA 3TCPA 3PWYA 5A9UA 2EWAA 3IS5A 3GUBA 4UB7A 3PRIA 1H1RA 3UYSA 4E7WA 1KV1A 2QU6A 4ZZNA 4TL0A 5DE2A 2OIQA 3IW6A 3KF4A 3KRRA 4XBRA 4ZIMA 4CFUA 3QBNA 4A9TA 5E90A 3U4UA 3NW6A 2WQOA 1YI6A 1OKWA 3EN4A 5HOAA 5BUJA 4YJOA 4FV8A 2QO2A 2ZM4A 4J8NA 3TNIA 4D5HA 4EHVA 3KXNA 3QRKA 4FVRA 1WFCA 2UW5A 2WQNA 3DZQA 3F82A 3LCOA 3KN5A 1P5EA 3H3CA 2P3GX 3BKBA 4O96A 3ULZA 4BYIA 4EOQA 5M4UA 3PPJA 4U3YA 2YDKA 4YC3A 3GI3A 3RCJA 4FEQA 4BHNA 4ANSA 4BCQA 5IU2A 1DAYA 5AEPA 4BKJA 1WBSA 4D0XA 3W18A 3ZUTA 5CVGA 4MXYA 2P0CA 4K11A 4PMMA 1Y6AA 3MFUA 4KIPA 4RIWB 5FTGA 3EN5A 1DAWA 2JC6A 4CMUA 5IKWA 4FIEA 5CF6A 1UNGA 2GFSA 2Y4IB 5FD2A 5FDXA 3EIDA 5KO1A 3W2RA 3UZRA 3OG7A 4AXAA 4BCHA 3DAJA 4G6NA 2J4ZA 1OVEA 3MDYA 4JQ8A 2PZ5A 4BZNA 2VWIA 3DDQA 3EL7A 1JKKA 1M17A 3IQ7A 3PFQA 4LFIA 4IX3A 4IWDA 4MHAA 4OBPA 4YHTA 5HNIX 5LMKC 4DFYA 4RQVA 3OY3A 4BDAA 2H96A 1K2PA 3CY3A 3P1AA 2O0UA 1NW1A 2RG6A 4MBJA 4QNAA 4TW9A 3ZLWA 4ZLYA 4FV3A 1ZZLA 2HYYA 4G6OA 3QZFA 2O8YA 4HYSA 4R3RA 3RCDA 3PZHA 3BV3A 4F1MA 3LOKA 4I3ZA 3RP9A 2EVAA 2OW3A 3HV3A 4FUYA 4RZWA 4N6ZA 2VWBA 1WBWA 4KIQA 3ODYX 3LXLA 4YC8A 2YACA 1YRPA 2BALA 4XG8A 1BMKA 3NUNA 3ORKA 4HGLA 4U6RA 1BL6A 5HEZA 3R2YA 4EQCA 4QTEA 2RFNA 1J91A 3QD3A 5JN2A 4S32A 3IDBA 4C37A 1Y8YA 1JVPP 4IFGA 5H8GA 5A6NA 2VNWA 4GH2A 2J2IB 5ETFA 1JSTA 4PMPA 2I0HA 4Q2AA 5KMIA 4ZSJA 4NJDA 2YZLA 3WYYA 5E8ZA 3D15A 1R0EA 2PMLX 3O8PA 3UTOA 1PF8A 4FOBA 4ERKA 1Q8WA 1OPKA 3P78A 3P08A 3UO6A 4ACDA 1TQPA 3OTUA 4CV9A 4AAAA 1UNHA 3W10A 2GNFA 3LJ0A 2WMQA 4CZUA 4LI5A 3LJ1A 3O8TA 5H8BA 5IA4A 4ANQA 2XRWA 3AGLA 4DBNA 1Q99A 1MQ4A 1ZMUA 4RC3A 2R3OA 2RIOA 3ZMMA 1NA7A 4UYNA 1W7HA 2B9JA 3QCQA 4RRVA 5AUVA 4QMNA 4NKAA 5T6KA 3QAME 3WILA 4ANNA 4USEA 1W0XC 4LQMA 2VTHA 4HGTA 5EDRA 2W4OA 4AZEA 5JEBA 2X4ZA 4FSMA 4FV0A 4QYHA 4F9CA 2NO3A 3T9IA 3WE4A 4EOMA 5HD4A 4IB1A 2PUPA 5FUTA 3Q5IA 4Y8DA 1H0WA 4RVMA 1ZMWA 3HAMA 3ZSIA 3MJ2A 1H24A 3EFJA 5A4TA 3FY0A 2PVFA 4L01A 3MFTA 3L9LA 4NM7A 5TR6A 3R73A 3TJDA 5AR7A 3NGAA 3L9PA 3QCSA 4CMOA 4B8LA 3VO3A 2B0QA 4ANLA 3FDNA 5IF1A 2BZHB 2FB8A 1KOAA 3PLSA 3QZIA 3RAKA 4D4RA 1IG1A 2WNTA 2XJ0A 3DXPA 4TYEA 4W4WA 3F69A 4FC0A 5FTOA 3A4PA 4DGGA 2R4BA 4OTWA 4IAIA 4MXAA 5H2UA 4GSBA 4NU1A 4I21A 4ASXA 3ZZWA 3MH1A 1ZYLA 2QKWB 2EXEA 3WZUA 4APCA 3EWHA 4G3DA 5BX0A 4A9YA 4GK3A 5KMLA 3FYKX 4PNIA 1RDQE 2GNIA 1UNLA 1U4DA 3LFQA 4Q9SA 5CY3A 3TZMA 2CCIA 2R3QA 3QQJA 1ZYJA 4AGCA 2W9FB 5HTCA 3KQ7A 1XH5A 3C4CA 4FBXA 2I40A 4R3PA 4L53A 2R64A 3NLBA 4C4JA 5HE3A 3PUPA 2WMRA 3KK9A 3O51A 3ULIA 1OKZA 3L9NA 4F0FA 3CXWA 3AT3A 1U54A 4K9YA 1UU9A 4QQTA 4JDKA 5AX3A 4ZTRA 3NNUA 3Q6UA 4DG2E 5BYYA 5C26A 3G90X 2EUFB 3DK7A 4N6YA 2X2MA 4FKVA 2C30A 2UW7A 3EN7A 1YXXA 4RSSA 3VS6A 3ZO3A 1JKTA 2IVVA 3FL5A 1UVRA 3HYHA 4IACA 4YLJA 4F08A 3ZCLA 5IA0A 3GBZA 4JI9A 2OK1A 4F9WA 2OF2A 4FG7A 2BRMA 2V22A 4M3QA 4Q9ZA 3DAKA 4QTAA 2P55A 1WZYA 3ZBXA 5CAPA 2YWVA 5AMNA 4EOLA 5JT2A 3F5PA 4CQEA 4C0TA 2R3RA 1Q62A 4EJ7A 4YPDA 3BYSA 2B1PA 2PE1A 4CLJA 1WVYA 4I0SA 3U54A 2IW9A 3QC9A 4LL0A 4BWKA 4CNHA 3NWWA 2WTJA 3LFAA 4E3CA 2NP8A 5HLNA 1OL1A 5EOBA 4CRSA 4WUAA 2YZAA 2C3LA 4LGGA 4RVTA 5HNGA 4EWQA 5BMMA 3M2WA 2CMWA 4G1WA 3D5UA 1Z5MA 5HTBA 4RA5A 4UXLA 4XLVA 5F4NA 5BYZA 4BDHA 4X2GA 2ITZA 3BHHA 3KRXA 4WNOA 3GU7A 4YJSA 4ZSEA 3PIXA 1WMKA 3DDPA 3FWQA 5JMSA 4KIKA 2JIIA 2V0DA 5M55A 3AD6A 1Q97A 1RW8A 4ZTNA 4K6ZA 2WMAA 4BCJA 2IZUA 3GP0A 5IH4A 5ETCA 1URWA 4FTTA 4FV9A 3DLZA 4DHFA 2O3PA 4M69A 4EH5A 4FMQA 4FR4A 3KCKA 3DFAA 4F1OA 1MRVA 2YITA 3HX4A 2CGWA 4DH1A 5L8JA 4TYIA 4B9DA 3AC1A 1PJKA 2UZDA 2ZV2A 5FXSA 4ZMFA 5FTQA 2JDSA 2PZRA 2W5BA 3FSKA 4JAJA 5JGAA 4R77A 4ZXTA 5KKRC 3W33A 2YM4A 4L68A 4I24A 4ZZMA 3R7YA 1J7IA 2CKPA 4C3FA 3N51A 4QMZA 1A06A 2VGPA 3PP0A 4O22A 4IBMA 5F95A 5L6PA 4HPUE 4DA5A 3F3UA 4TKSA 3EQIA 2GTNA 3WZDA 5GJFA 3V01A 4BI0A 4I1ZA 3FXWA 2PVYA 2BKZA 3QTUA 4CD0A 2OIDA 4EBWA 3C5UA 3HECA 2QU5A 2VWVA 4DG0E 5C8KA 4O84A 2C3KA 2QOLA 3NUSA 2OJFE 4GFGA 4GK4A 4J96A 2SRCA 4M13A 4ASZA 3KEXA 5LVOA 1EH4A 4IH8A 4XYFA 3HMPA 4Y46A 3VBXA 3VRYA 2E9UA 4N70A 5K0XA 3QKKA 2XK4A 4XS2A 2QG7A 5BVOA 4OTHA 4IVBA 3NMUF 5AIKA 4KKEA 1W83A 3SRVB 3RTPA 4DITA 2ZDUA 4HVDA 5GZ8A 2J5FA 3F66A 5KZIA 3WIKA 2C6OA 4BZDA 4BGHA 5AP0A 2UW4A 4HVSA 3EQHA 4P7EA 3CBLA 3W2OA 4ACCA 2YM3A 4P4CA 3UG1A 4U45A 3QHRA 5GIPE 4JBVA 1H08A 4XHKB 5FM2A 3R28A 4ZLZA 4WRSA 3MJ1A 2W05A 3COIA 5FM3A 1M2RA 2VN9A 3DJ6A 1YOLA 3RINA 2J0KA 5HBJA 5C9CA 2PSQA 3VBWA 4ORKA 2IG7A 1H27A 2UW8A 3ZO4A 1O9UA 5ETIA 4H3PA 1VYZA 2WKMA 3TV4A 4A9SA 3A7JA 3EN9A 3G0FA 3SQQA 4AGDA 5DOSA 5CAVA 3L8XA 4N0SA 4EHEA 3UVPA 5JFSA 1IA9A 2RFEA 2OZOA 3BYVA 4WT6A 2XEZA 5J7BA 3CKXA 1YWNA 4RFMA 3E8DA 5AADA 3TNWA 3C9WA 3UQGA 3TIYA 3VJOA 2UVXA 2ESMA 3BGQA 1OUKA 5M4CA 4DH3A 4FV7A 4OGRA 4G9CA 3OXIA 2XZSA 4EI4A 1NY3A 3LFCA 2QURA 5C01A 3ORTA 2I1MA 3W2QA 4QMUA 4TNBA 2C6IA 2OZAB 4WKQA 4XJ0A 4S2ZA 4F7LA 1XR1A 3ZO1A 2BDFA 3AC8A 3M11A 5AM7A 4G3CA 3D5WA 2UZVA 2VX1A 4NFMA 4QMVA 4B4LA 3PA4A 4AU8A 5I9WA 4PRJA 4BKYA 4ITHA 4IAAA 3HV4A 3KULA 3FE3A 4FSWA 5DWRA 5CF5A 4DFLA 3KREA 4O0TA 4USDA 4EUTA 5CSXA 4EUUA 3PVWA 1JSVA 3E87A 4GU6A 4FA2A 4X3FC 4EK6A 1REKA 2BROA 3F2AA 3OD6X 4FE2A 3V6SA 3VS4A 1XO2B 3WF9A 5HVKA 3TJCA 1FMOE 1GNGA 2EU9A 4WG3A 3R00A 3CPCA 3CQEA 1XH9A 3NUAA 3SXRA 5DG5A 4DGNA 3NNVA 2OH0E 2W1DA 3F5XA 5IPJA 4AN2A 4YJUA 1SNXA 3ZHPC 2YAAA 2W4KA 4G5PA 3FPQA 4F09A 4BCPA 1Q8UA 4DFXE 5BUEA 4RA4A 1G8AA 4AF3A 4XG9A 3NNXA 2ETRA 2QO9A 4J7BA 3QU0A 3SLSA 2X8EA 5HORA 2NRYA 3FMMA 2GS2A 5EM6A 5BVEA 3VUHA 3CD3A 4J53A 3QZHA 5I5ZA 4GJ2A 3VIDA 3RM7A 2WTVA 3FHRA 4DCEA 3V5LA 3A99A 3O0GA 4YNOA 1LEWA 4E4LA 4EKKA 2QR7A 3RK9A 3HVCA 4MCVA 1FVRA 3ERKA 1YDSE 3OXZA 2BTSA 2UZUE 3QTZA 1ZRZA 3TEIA 4D55A 3FC2A 1FINA 2ITYA 4C4HA 4O7YA 2VGOA 5F20A 4CQGA 2XB7A 1OL2A 4R1VA 5TOZA 3HA6A 2ITPA 3KRLA 3LFEA 3E62A 1H25A 1M14A 3JXWA 5LMKA 4QP8A 2UW9A 1GZOA 2YIRA 2CDZA 4U43A 4BN1A 4ZSLA 5HVYA 2CLXA 3BHUA 3WI6A 4DTKA 4XRLA 5CX9A 4CEGA 3MESA 4DH7A 4F6SA 5A54A 2WO6A 3H0ZA 4FIJA 4LGHA 3D4QA 4FVPA 4ZY6A 1ZMVA 3ZXTA 4H39A 4HOKA 5HX8A 3ACJA 4CFWA 4R7HA 1ZYDA 4JX3A 3H9OA 1CM8A 4LRMA 4P5QA 5HO7A 4J1RA 5HIEA 3GCPA 2OH4A 1JKLA 1TVOA 3LPBA 5IQEA 2XUUA 3EMGA 3ORIA 4AOJA 4EKLA 1J7LA 2XKFA 1BL7A 3THBA 2GDOA 2W1CA 2VTIA 4D4VA 3ITZA 3VUGA 5EQEA 3E8NA 3KCFA 3Q5ZA 4OTFA 4DCAA 4BY9E 4NIFB 3O71A 3OTVA 3HZTA 3VS5A 4I5PA 2WHBA 4RX9A 4QP6A 4XP0A 3QZGA 2BILB 2YAKA 2XYUA 3FLYA 2BAQA 3I60A 4IAFA 4U3ZA 4E4MA 4YBJA 3W2CA 4BDJA 2PULA 1YW2A 4EH6A
chains in the Genus database with same CATH superfamily
5AP6A 4WBOA 5H9BA 2P33A 2H9VA 1PMEA 4YZMA 2JDVA 4O7TA 3OCGA 4JT3A 4PMTA 4BDBA 2PMIA 5BVKA 4PL3A 4O1OA 2KTYA 3QYZA 2XS0A 3LM0A 4NEUA 3UO5A 2VD5A 3BU6A 1KWPA 4FNZA 1SM2A 4JAIA 3QRJA 3PG1A 3E63A 4ZTQA 2PU8A 2F7XE 1M7QA 5EH0A 3VF9A 4NYEA 3VUKA 3WF8A 2VX3A 3RNIA 3V51A 3ZC5A 5IA3A 3H10A 5CF8A 5AR2A 4CFFA 3KXXA 4F7NA 4Y85A 3RPRA 2W96B 4ONAA 4X2JA 3UDBA 5JGDA 2ONLC 3ETAA 1NVRA 4R3CA 4MD8E 3H9FA 5FXQA 4AA4A 3A7GA 3IGGA 3F6XA 4RJ8A 1FQ1B 2VTNA 2BZIB 5GIOE 4DLJA 4CG9A 4CKJA 3FZPA 3QTSA 4O7WA 3BGPA 4H3QA 2C0TA 2UZBA 3RHXA 3MI9A 4CZTA 2GHLA 1KE5A 3R22A 3FZOA 5AUXA 4K33A 4F63A 1WBPA 5CI7A 3V8SA 1BX6A 2UVZA 5CEIA 4EYJA 3OVVA 4U81A 2Z7QA 3VW8A 3PWDA 4I6QA 4KS8A 4C33A 3WF6A 1LR4A 3ZDUA 4JR7A 4OTQA 2H6DA 3ZBFA 3CD8A 3RAHA 4FEUA 3QRIA 4D2VA 3R7IA 4AOTA 1WVWA 5LQFA 2ITUA 4TNDA 4C36A 4BTMA 2XAOA 3QUDA 3QX4A 4DEBA 4U7ZA 4C57A 3DS6A 4FKPA 3DA6A 3FLSA 5CLPA 3NPCA 5BYLA 5CANA 3QQHA 5CSHA 3POZA 4CRLA 5J9ZA 2PVHA 4HGSA 4JOAA 3R9RA 3BZ3A 3W1FA 1ZY4A 5A4LA 3LLAA 2J0LA 2VTSA 4C4GA 2XK7A 5CZHA 4UX9A 2FSLX 5M4FA 2O64A 2QI8A 5AA9A 5TKDA 3D7TA 3SC1A 3HMNA 4DFBA 2HENA 5AJQA 2C5VA 2QOQA 1H1SA 1PXLA 3QQGA 3TKUA 4D1XA 4DDIA 2Z7SA 3O17A 5EI2A 2E2BA 5L4QA 3A8WA 3SVVA 3N9XA 3VW6A 2A1AB 2O2UA 2ZOQA 3BYMA 5I3RA 1UKIA 1OL7A 5HZNA 3ZU7A 2AEGA 3Q9WA 5CALA 3OUKA 3KMUA 4RMZA 5E7RA 3RM6A 2CKEA 5EFQA 3UOLA 4AT3A 2YA9A 3W16A 3R9DA 4WG4A 4R5YA 1PXOA 2PZYA 1BLXA 3CP9A 3OWKA 1VJYA 5FBNC 3KXHA 5LVMA 3C50A 3TACA 3MV5A 3ATTA 2R9SA 1O6LA 2HCKA 1PXJA 4MNEA 5ANKA 4O4BB 1QPCA 2R3LA 3FMKA 2W1EA 3FHIA 2XF0A 1FVVA 2JKMA 5HE2A 2Y8OA 2HAKA 1W2CA 4TWCA 3VS0A 4X7QA 3AD5A 3GXLA 5AWMA 5GNKA 3S1HA 5AR8A 3H9RA 3QD0A 2QKRA 4ZAUA 3PRFA 4ALVA 2ZDTA 4PV0A 3TNHA 1XMMA 5JH6A 1KE7A 4ANMA 3PUFC 2XYNA 5GZAA 3O23A 1YXUA 2R3FA 5E9EA 2W0JA 4ASEA 3EJ1A 2Y4IC 1PXMA 3A7HA 1P4FA 3LCTA 2EXCX 3BU3A 3C4XA 3BE9A 2I7QA 2BDJA 4PL4A 2ZV8A 1OPJA 1XBBA 4KABA 4FI1A 4EOIA 4I0RA 1B6CB 4XG2A 2A19B 3SXFA 4NSTA 1JWHA 4ERWA 5LVLA 3TWJA 3R01A 3PXKA 4GEOA 3GC8A 1SYKA 3K2LA 4IC8A 4FTOA 2W7XA 4FNWA 5IEVA 4MQ1A 4QQJA 4BCOA 4QMWA 4JLCA 3ZO2A 3ANRA 2CN5A 4EOPA 3FEGA 2QOOA 2C0OA 5K4IA 1YWVA 2ERZE 1YI3A 1YHVA 2PWLA 3F88A 4FTKA 3HMOA 4KWPA 3NVMB 4E6DA 4YUQA 4IEBA 2O65A 5K5XA 3OWJA 1H8FA 2X2LA 3DJ7A 3OHTA 4RX7A 5DHJA 5BUIA 3W8LA 4IFCA 2QODA 3PFYA 2C69A 3JY9A 4FT0A 4W8DA 5HG9A 3UP7A 4CZYB 3UPZA 5A3XA 4ZK5A 4RWJA 5ANEA 4C2VA 3EQRA 4EHZA 4RIYB 4CMTA 3ZONA 1YXTA 5A46A 2Y6MA 4C4FA 3DXNA 5EYMA 2H8HA 4AFEA 4ZJJA 4GV1A 4X3JA 3R9OA 4UXQA 3R7OA 3COKA 3NUXA 3QLGA 4ENYA 4V05A 3QWJA 4NM3A 5C4LA 4AW5A 2I0EA 2W1FA 4D2WA 4IZYA 2XK3A 1H0VA 2ITTA 3KY2A 3ZUUA 4C2WA 4FIGA 3AC2A 4FSUA 1ZOEA 3P5KA 2J90A 2B55A 3EQDA 3PVBA 4IX5A 3R9NA 3FLZA 2IZTA 4U9AA 3KMWA 2XBAA 1OIQA 2ZAZA 4EOSA 4AE6A 4AA5A 2XM9A 3ZM4A 4BL1A 5IH5A 5GZ9A 2C6EA 4FKIA 1PXNA 4DGLC 3ZYAA 4DHJA 4YTHA 4M97A 3GCSA 5CVFA 3Q96A 4FTRA 4AGUA 2WQMA 3EQFA 2P2HA 3E93A 3EQBA 3G9LX 1MRYA 4QMMA 5HG7A 4XV3A 5JFWA 1H07A 4GT4A 4LV8A 4C8BA 4KBKA 2F2CB 5CU4A 5CAQA 3R1QA 3VBVA 3EFLA 3LMHA 4BCNA 2HW7A 4A4XA 1DS5A 5GHVA 5AUUA 3L8PA 1B39A 1PXKA 4II5A 3C1XA 1YHSA 5IUHA 1CMKE 3AQVA 4EZ3A 2WU6A 5CU6A 3VS3A 5HTIA 5M09A 5LWMA 2DS1A 4JBPA 4EQUA 1KUTA 2WPAA 3C0HA 5C8NA 3TIZA 3DTWA 2C6MA 4EQMA 2QOIA 4BYJA 3LQ5A 4AQCA 5CEKA 2GNLA 4NH1A 3D2IA 4FVQA 1IAJA 4FV4A 4U8ZA 4TYGA 4FICA 3IDPA 4XX9A 3HRFA 5IEYA 3A7FA 3R30A 4LL5A 3CTHA 2V7AA 1OPLA 2WTIA 3PZEA 4XV1A 5HO8A 5TE0A 3BGZA 5IUIA 2VTQA 4FK3A 4KBAA 4FKJA 4JR3A 2CKOA 4M14A 4QP2A 3SKCA 4BC6A 3KXZA 4IC7A 2F49A 2BTRA 4N4SA 3QUEA 3M1SA 4X3FA 4E4XA 4TPTA 3ORNA 4HJOA 2X2KA 1XBCA 4MX9A 3HA8A 2Z8CA 3UMXA 1W8CA 3BIZA 4BZOA 2R5TA 4JIKA 3UQCA 4BRXA 2I6LA 3TNQB 4J98A 2UZNA 1Y91A 1ERKA 4IJ9A 5IH6A 3GT8A 2FGIA 2B53A 2IVTA 2J6MA 2PVJA 2YLEA 3I4BA 3QTRA 5DEYA 4HVGA 4BVUA 2DYLA 4RWKA 5IA2A 3UDTA 1XKKA 2F7ZE 3IOPA 3QLFA 3FXXA 5J7HA 3QHWA 5T68A 3WZJA 2QNJA 3PIZA 3PE2A 4RPVA 2YIYA 5J9LA 1M7NA 4YHJA 1U5QA 2C5NA 3IONA 4FV1A 3CTJA 3LXPA 3PIYA 4X2KA 4TYJA 4XH6A 3NS9A 4EC8A 4F7SA 5LXMA 3FKLA 3DB6A 1H1WA 2CCHA 4UYAA 1A9UA 3UDZA 3OEZA 5DFPA 3BL9A 1CTPE 2DUVA 3DK3A 2OSCA 3QTWA 4QMPA 5HX6A 5KX8A 1H1PA 3CIKA 5ANIA 5HKMA 3SX9A 3QXPA 5FXRA 2W1IA 4W4XA 4MK0A 3CGOA 4E1ZA 2JDOA 4EHGA 5C4KA 4LYNA 4WOVA 1J7UA 5HICA 3DBEA 3LQ8A 4AGWA 3P7BA 3A4OX 2JDRA 4X2FA 4BI2A 1ND4A 1M52A 4M66A 4FTNA 5HCZA 2VV9A 4UEUA 2UW6A 4FKLA 2QD9A 4HVIA 4I5HA 3R6XA 4G16A 5IQHA 2ETMA 3DKOA 4M12A 4PF4A 3CQWA 3TT0A 2X8IA 3V6RA 5A6OA 4IB3A 4O6EA 2BRBA 5HCYA 4FT9A 4GRBA 4IZ5A 4XMOA 4Y83A 2YFXA 4KNBA 4Z16A 5IQIA 1VEBA 2EB2A 1JQHA 3OOMA 1H28A 4IW0A 2VWYA 3RI1A 3AMBA 3PPKA 1JSUA 4D2PA 4L3PA 3TDVA 3SAYA 4BGGA 4ZOGA 2X9EA 4F7JA 2J0IA 4M0ZA 1ZLTA 4QP1A 3WE8A 5JGBA 3PJCA 4FKGA 3L1SA 2QQ7A 1UV5A 4HCTA 3V5QA 4EORA 3E5AA 3MVLA 4JVGA 2JD5A 2PUUA 4QT1A 3CJGA 3NYNA 2OKRA 3U87A 3UMWA 4AG8A 3ZFMA 4O0YA 1IAHA 3CJFA 3HMIA 2J0MB 5HQ0A 4YLLA 2R0IA 5JQ5A 3AKLA 5DR6A 5KMKA 2RG5A 2BMCA 4QMTA 3OOGA 3C4WA 2GQGA 2JFMA 2ZMCA 1QPJA 2IJMA 2VAGA 4Q5EA 3Q2MA 4RIXB 4DFUA 4ZMEA 2QLUA 5IZFA 5FEEA 1IASA 2UZOA 1OL5A 4L7FA 4M0YA 2CLQA 2VO0A 4JL9A 4E26A 3FMEA 4S31A 2Z02A 4QMSA 3V8WA 2XKEA 3O50A 4LRJA 4IDTA 5IDNA 4NKSA 5B2KA 4IM0A 4ITJA 3DQXA 4K8AA 5I0BA 4LUDA 5EI8A 3UO4A 5CEOA 1IA8A 4E6QA 3RK7A 3EQPA 3KRJA 5HESA 3TTJA 2ONLA 1P4OA 3ZSGA 2PZIA 4I6HA 4C4EA 5EG3A 3ET7A 3TUBA 3GQIA 3A60A 4O4DA 3EZRA 2UZTA 1K9AA 2G2IA 4R1YA 3KGAA 1GZ8A 3R7UA 4USFA 4PDSA 1GIJA 3TZ7A 3LAUA 4V0GA 3NR9A 3ID6C 3NSZA 1UWHA 1ZOHA 2F4JA 3CEKA 3H30A 4GFMA 3QQKA 4WRGA 5AX9A 4D4SA 2EXMA 4NTTA 3DOGA 4OTIA 2C3IB 3Q9ZA 5AV1A 4DYMA 5L6WL 3Q9XA 3L9MA 1PMNA 1TKIA 2H34A 4FSTA 4ZTSA 4NK9A 4F0IA 2XNMA 3FLQA 4YC6A 2Q83A 2VWXA 1STCE 5E8XA 3E3PA 4GT5A 5ACBC 3VS1A 3IOKA 2W4JA 1F0QA 2QHNA 3BLRA 3B2WA 2Q0BA 2XA4A 3KL8A 5I9XA 4FZ6A 2BHEA 3DKGA 3W55A 1APME 2UV2A 4QMYA 3SA0A 4NCTA 4M84A 4JG6A 4O2PA 2C1AA 4E8AA 3QD2B 3IPHA 4PWNA 3DNEA 4LMNA 5DYJA 3BLHA 2X0QA 3BHTA 3E7VA 3MFSA 4IWPA 4C3RA 4BGQA 3SD0A 4FKQA 4FV2A 1OZ1A 5EYKA 4W8EA 3EN6A 4TXCA 4U40A 2C4GA 2XH5A 5LJJA 2BZJA 3G6GA 3R04A 5EM7A 3BE2A 4CFVA 4PNKA 3BPRA 3OCSA 5AUWA 1FOTA 3C4FA 3MFRA 3M42A 4UV0A 2X39A 3P4KA 2FA2A 2C0IA 4D2SA 2PUNA 2F7EE 3R63A 3VULA 4J97A 2PMOX 4RZVA 1H00A 3HDMA 4ZTMA 5JK3A 1IR3A 3QTQA 3T3UA 2W5AA 3HP2A 3NVKI 1ZYSA 4MKCA 3NAYA 5HE0A 3TKIA 3VBTA 1Q8YA 5DNRA 4F4PA 4I23A 2A2AA 3JY0A 4J95A 1XH6A 3HRBA 4UMQA 5CXHA 4H05A 3BEAA 2ZVAA 2B9HA 4JG7A 4O21A 1YDRE 4TYHB 1JPAA 4JJRA 3W32A 4YZ9A 1R1WA 4LRKA 3JPVA 4O0VA 2BFYA 3RPSA 3UBDA 1FBNA 3MVHA 3FZRA 2WMBA 4FT5A 1G5SA 4FTMA 4AT4A 2R3KA 4H1JA 3F2RA 2RFSA 2B54A 4ZTLA 3QX2A 5FP6A 1YXSA 2QOKA 4GK2A 5B2MA 4O7SA 5L8LA 3NDMA 4JNWA 5LARA 2FSMX 3FKOA 3UE4A 4U42A 1GJOA 5E91A 3HV5A 3LMGA 3NUYA 3NW5A 3LFNA 4MNFA 4MWIA 2YIWA 2ZB1A 5E92A 2OXDA 2VO6A 1W82A 4LV5A 4AN3A 3U6IA 4QPMA 3VS2A 2OJGA 3I0OA 4AZWA 4DEAA 4OAUC 2NNWB 3K54A 4IWQA 4AUAA 3UNJA 3LVPA 3EKKA 1SNUA 2GPHA 5AFVA 2V7OA 3W8QA 3F7WA 4FEVA 1R78A 2WEIA 2YM8A 4AE9A 3UOJA 4BDGA 5KHWA 2GS6A 2HY81 1KOBA 3DK6A 4G2FA 3KXMA 4FG8A 2BIYA 5BMSA 1P14A 1NXKA 4H1MA 3AD4A 3FYJX 4OTGA 4RIWA 4AN9A 3O2MA 5GJGA 3WF7A 3DPKA 3MB7A 5LCJA 3JVRA 2WTWA 1Q3WA 2A98A 3IO7A 3ZLSA 4XEYA 3KF7A 2WTKC 2HIWA 4PY1A 4CFXA 2R3MA 3ATSA 4C61A 2GS7A 2VTMA 2J5EA 4QYFA 4X21A 4C02A 4DINA 3LQ3A 4WNPA 2ITVA 2DWBA 5I4NA 4FTJA 3ZZEA 4KB8A 2RF9A 3AKJA 5HBEA 2IN6A 4FL2A 3CC6A 5DEWA 5EI6A 2RSVA 4BDDA 3U9NA 5KBRA 4ACHA 4AT5A 4HYHA 5AIRA 2R3IA 4WBBB 2ITNA 3G2FA 3OROA 5KMJA 3UJGA 4FODA 4OTDA 4IQ6A 2VTTA 4C59A 1QMZA 4CXAA 4EK4A 1YDTE 3EQCA 2JEDA 3FLWA 4FEWA 3ZC6A 2GCDA 4IHPA 3UPXA 3FQSA 4IADA 3BRBA 3F3ZA 3MY1A 4XV9A 4O4FA 3LJ2A 4KUJA 5GINE 4YGAA 4IVDA 4XNEA 2GSFA 5FEQA 3TG1A 1Y8GA 4FSYA 3EB0A 4WUNA 1URCA 4QDVA 4FX3A 4I5CA 1GZNA 4LM5A 5CZIA 3QCXA 3UOHA 4I6LA 4BCFA 1PW2A 3S4QA 2XEYA 3A62A 1QPDA 2XNOA 4IZAA 4OT6A 3RZBA 3WZEA 1JLUE 1XH7A 4HPTE 4YJTA 3UYTA 1KSWA 3K3JA 4A07A 3ZM9A 5AAFA 4UZHA 3FY2A 3Q32A 5M06A 5FQDC 2GQRA 4FKSA 5D12A 4EH4A 5D7VA 1HCKA 2C1BA 2CGUA 4U97A 3PY3A 2WTKB 3UNKA 4AX8A 4KSPA 1Z57A 2ITWA 2VWWA 5CT0A 4RFYA 3DBCA 4CT1A 5DRBA 1AQ1A 3FL4A 3FBVA 5EM5A 4BDFA 5HIDA 2VTAA 3C13A 3OW4A 2IF8A 3R8UA 5JRQA 5AP4A 2BRGA 5EW9A 3DT1A 3IW4A 4FTLA 4GT3A 1T46A 1WBTA 1YWRA 4XCUA 4ANOA 4OTRA 5EOLA 1W2DA 3KB7A 4R8QA 4X0MA 5M44A 1Q61A 3VS7A 3VUDA 2YHVA 1UU3A 3UNZA 3F3WA 3F5UA 4I93A 5K9IA 2ITOA 3HUCA 4MXXA 3VUTA 4Y5QA 5TT7A 3FI4A 1R0PA 1PHKA 4D1SA 4F6WA 4I4EA 4IZ7A 1Y6BA 2YCFA 3RALA 5EQYA 1OL6A 1CDKA 4BB4A 2V62A 5CU0A 4R7BA 2JIVA 3FI3A 4A4LA 2XIKA 3MPMA 3I79A 4IB0A 2XK9A 3GU4A 4ACGA 2R3PA 2R0UA 2W1ZA 3GU5A 4G9RA 4UWCA 5AUYA 1CKJA 1UU8A 4RLLA 2WEVA 1Q4LA 4I22A 3W2PA 4EH2A 5C1QB 5KMMA 3SHEA 3UVRA 2G2HA 3LFFA 4UMUA 3TV7A 4ZY5A 4LV7A 4O6LA 1PYXA 4O0UA 4RQKA 2XK8A 2YLFA 3NYVA 3P0MA 1PMUA 4UMRA 5L6OA 2IEWA 1JAMA 3QWKA 3VVHA 2WAJA 4CTBA 4KBCA 4L3JA 3A2CA 4GVJA 5ETAA 5H8EA 3DBDA 3Q4CA 4NM5A 4O0WA 1ZARA 3GGFA 2HXQA 4WSYA 5KMNA 4CG8A 3L8VA 3LXKA 4WD5A 4E5AX 2PYWA 4JMQA 4AA0A 5F9EA 3I0QA 4BCIA 3OUNB 2NRUA 2AYPA 3BELA 4KS7A 4B7TA 4F0GA 1LP4A 4MBLA 5AR3A 4B6LA 1H1QA 3PSCA 3MA6A 3NCGA 3R71A 4DFZE 2QO7A 1NVSA 4EH3A 4JIAA 2ZV7A 4RX8A 4Z7GA 5ITAA 4BICA 3EYGA 4YJNA 3R7VA 3HV6A 4GUEA 2B4SB 2BUJA 2HZ4A 5AP7A 4C35A 3IG7A 4Z3VA 1GZKA 4NZWB 3TUCA 4YNEA 5HNBA 3U51A 5DR9A 3S0OA 5AA8A 4QRCA 4O7LA 3DB8A 2UUEA 3NCZA 4KA3A 4K18A 4MD9E 3Q4ZA 2AQXA 3PYYA 4OAVB 2J9MA 4PDYA 3Q60A 4JXFA 4Q5HA 3T3VA 4P90A 3MGYA 3ZFXA 2XK6A 4UMTA 5CF4A 5AM6A 4DC2A 2A27A 2J50A 2W9ZB 2XNBA 4M67A 4RJ5A 4WG5A 3SGCA 4RVLA 2JBPA 1U54B 3QKLA 4D2RA 5J79A 3OCBA 5DGZA 3MA3A 1R39A 4PTCA 4ZSAA 4YSMA 5ACKA 4CYJA 2GNHA 3E3BX 3O7LD 4IE9A 1E1VA 1S9JA 5L2QA 3RWPA 4LOQA 4Y73A 2PVRA 3NZ0A 4KRDA 3LCKA 5BQ0A 5M07A 4DHIB 3BHYA 4Z7HA 1ZZ2A 1GOLA 2HY0A 2XIXA 3R83A 3RWQA 3CLYA 4E6CA 4EK8A 5AP1A 4AACA 4FNXA 4AXFA 3TV6A 4YURA 4DEGA 3JR1A 2C3JA 1YKRA 5KCVA 1PXPA 1XH4A 3NUUA 3OF0A 5D41A 5IUGA 3BHVA 2WZJA 2BDWA 5EYDA 5B7VA 1TQIA 1CKIA 5CTPA 2XJ2A 3P9JA 3PXYA 4BCGA 3HV7A 5A4QA 3GFEA 4IX4A 3ZSHA 5F94A 5HE1A 2B7AA 1TQMA 3AC4A 3PDTA 4I4FA 5L3AA 4TWPA 4PMSA 1G3NA 2OJIA 3MH3A 4XBUA 4XOZA 2CNQA 3DQWA 1OGUA 4UMPA 1SMHA 2QLQA 2UZWE 3E8CA 3MH0A 4C58A 3C0GA 2Z2WA 3UDSA 2X9FA 2G2FA 2JAVA 3EH9A 4L7SA 4ZP5A 5KE0A 4D5KA 1BI8A 5GJDA 4KIKB 4H36A 4LOOA 3ZEPA 1IEPA 4EJNA 4IM3A 4Z55A 3D2KA 4BJJA 4FKRA 4A9RA 3EL8A 1OBGA 4FV5A 3I6UA 4BIEA 4M69B 2GU8A 5CNNA 3G15A 2WTDA 4EBVA 2J0JA 2JITA 1Q8ZA 4QP9A 5AP5A 2GHMA 1Q5KA 2PL0A 4UZDA 4W4YA 3UZTA 4WIHA 3OMVA 3PJ2A 3ZH8A 2P2IA 3D14A 2VO3A 3CPBA 4EZ7A 4TTHB 3UOKA 4DGOA 5IQDA 1HOWA 4AFJA 4MQ2A 3QXOA 2IZRA 4FKUA 4YJPA 3WIGA 3FMDA 3S2PA 3OEFX 2WOTA 4JQ7A 3AOXA 4L52A 1JNKA 3B8QA 3CE3A 4WO5A 3ZS5A 3GEQA 3SRVA 4I6BA 3QKMA 3F3VA 4NUSA 5ANGA 3SXSA 3ALOA 1H01A 2YDIA 3R1SA 3TM0A 4YP8A 1CKPA 5FDPA 4O2ZA 3FXZA 4BIBA 2WMSA 1OIYA 3GC7A 3GU8A 2YDJA 4ZEGA 2PE0A 5HG8A 3VC4A 4DF3A 5M08A 4FTCA 4A06A 4M7IA 1OI9A 4QP3A 5J5TA 2WMUA 4A7CA 2R3HA 3EFKA 1H4LA 3V5WA 2WQEA 3MBLA 3RZFA 2XNEA 4IMYA 3KC3A 1OIUA 2XM8A 4GCJA 4MF1A 4JDIA 2CGVA 4D0WA 4FIHA 4RVKA 5CSVA 3ZRKA 5ANDA 4RG0A 4BBEA 4RJ3A 4BIDA 3RHKA 4PP7A 2JLDA 3DKCA 3OWLA 4EH9A 1XQZA 3QQFA 1RJBA 2CN8A 1UU7A 5HCXA 4CYIA 4IM2A 2WMVA 5ANJA 4ZJIA 5IEXA 2GNJA 3BX5A 3DU8A 4O27B 3PXRA 4HNFA 2YIQA 3L8SA 4P2KA 4WHZA 5DLSA 3NX8A 3F3TA 4I0TA 4OTPA 3TDWA 4DBXA 3QUPA 4O1PA 4V04A 5IG1A 2XNNA 5M57A 3DZOA 1ZY5A 3GFWA 4G3EA 4CKIA 4G5JA 3UIMA 4GKHA 4LMUA 5CYIA 3Q04A 4FGBA 2XKCA 3UVQA 2IVSA 5IQGA 4KSQA 5L2SA 5J87A 2O5KA 2WMWA 2OZAA 2XIYA 4L00A 3GCVA 3VBYA 2ZYBA 5LMBA 5LWNA 1Q41A 3A7IA 3R0TA 5BVDA 5G1XA 3K5UA 5HIBA 3LHJA 3JS2A 5EDQA 1WBNA 2W1HA 3HLLA 4CCBA 4UY9A 3ZEWA 4IVCA 3ZXZA 3I6WA 3FC1X 3OT8A 3LXNA 4MEDA 2OU7A 4MF0A 5CU3A 4EYMA 5I9YA 2FH9A 2UVYA 4U44A 3WOWA 5AV3A 3PSDA 4YBKA 5J1WA 1U46A 2X7OA 3K5VA 4O38A 4OT5A 3IKAA 4YPSA 2JGZA 2IW6A 4LOPA 4DLIA 3QALE 3E92A 3SW4A 2FVDA 4NWMA 2DQ7X 4U0IA 2ZB0A 2PUIA 3TXOA 5AUZA 4OW8A 4TZRA 3PPZA 4TWNA 5DMZA 4KD1A 2RKUA 4U5JA 1V0OA 2OI4X 4KRCA 4BWXA 4QPSA 4HVHA 5JZJA 5DPVA 5IMXA 4ZTHA 2B52A 4R7IA 2HXLA 3KULB 4D1ZA 4FKTA 3V04A 4AW2A 4BHZA 4MVFA 4QDEA 2YM6A 4NT4A 4QMQA 3IW5A 4FK6A 3HUBA 3GVUA 3SW7A 2C6DA 3G51A 3UIUA 3VQHA 5EKNA 2YEXA 3BQRA 5D11A 3G5DA 4WSQA 3POOA 5J1VA 4CT2A 1HCLA 3KVWA 4BCMA 3MN3A 4O7ZA 4BR3A 4FTQA 4B99A 2IVUA 2VNYA 3AC5A 1OITA 4K0YA 3H0YA 5HD7A 4EH7A 4IX6A 5EW8A 4R6VA 3NEWA 3AG9A 2V55A 2HZNA 4QQ5A 5IQAA 5KBQA 5CS6A 4QYGA 3ORMA 3LE6A 4CSVA 3AXWA 2G01A 4AOIA 4QNYA 4O7NA 2WXVA 3OS3A 4GL9A 4EOKA 2BZKB 2BRHA 3MY0A 4GIIA 4XLIA 4YJVA 5LCKA 3TI1A 3OT3A 5JFXA 1OKVA 3LLTA 3IECA 4FL3A 3ROYA 4E5WA 4ASDA 1ST4A 4TRLA 5EM8A 2OXXA 2XIRA 3DLSA 4YZDA 5IQFA 4HNIA 2CNUA 4WA9A 2XKDA 3QD4A 3IK3A 4BDCA 2VTLA 2Y4PA 5E8UA 2VTRA 2PZPA 3ENMA 3V5JA 4N57A 4BF2A 4YMJA 3W0SA 3NNWA 3LFSA 1U5RA 4IAKA 4O7VA 3KIOC 4I6FA 4OR5A 3DFCB 4TN6A 3RPOA 4PL5A 3NYOA 3R21A 3PLAE 2VTJA 2OWBA 2XRUA 1VZOA 1V0BA 2WMXA 2C5OA 5B0XA 4IDVA 3D5VA 3ALNA 3QQUA 3VUMA 3LCDA 5EHOA 2PVLA 4K77A 1MP8A 4ARKA 1OKYA 1V1KA 4O0SA 5CXZA 2BFXA 2O63A 3PJ3A 4FSZA 3U4WA 1U59A 1V0PA 4IAZA 3R8LA 4B0GA 2YCSA 4RX5A 5I9VA 4DN5A 3T9TA 3TKHA 4YO6A 5AAGA 2E9OA 1YQJA 3HNGA 3BLQA 2XCHA 4NIFA 1NVQA 2JKKA 2R7BA 3ORLA 5AUTA 5E1EA 2X0PA 4E5BA 4EONA 4YTFA 3PVUA 4ZJVA 4YHFA 1IRKA 2A4LA 4BDIA 5JFVA 3R1NA 4XP3A 2GQSA 3PE1A 2B9FA 4JRNA 3AMAA 5EHLA 3I5NA 3I1AA 3BQCA 4QQCA 1AD5A 5EW3A 3FMJA 1TZDA 4BFMA 3R2BA 1Q24A 3EOCA 5AP3A 4XUFA 5M53A 4JDJA 1ZYCA 3VN9A 3R7EA 1FVTA 2QVSE 1E1XA 1ZWSA 3LIJA 3HKOA 3PY0A 4RT7A 3QA0A 1FPUA 4O0RA 1KV2A 4AZVA 3BCEA 2X81A 5AAEA 3CKWA 2OIBA 3CS9A 1REJA 3F9NA 4W9XA 1G8KA 3A61A 3FQEA 1F3MC 4GVAA 1PXIA 5CWZA 3AMYA 1GIIA 4I92A 5EK7A 3RMFA 3BYUA 5ANOA 2XNPA 2IPXA 3B8RA 5LMAA 3D7ZA 4F6UA 1YHWA 4JDHA 4L6QA 2WTCA 3COHA 4UN0C 1FGIA 1XJDA 2WD1A 3ORXA 4E6AA 4IXPA 1BUHA 3DY7A 4FZFB 4XV2A 5BVFA 5HU9A 4RFZA