3C5UA

P38 alpha map kinase complexed with a benzothiazole based inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
349
structure length
338
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Benzothiazole based inhibitors of p38alpha MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 338
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c5uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c5uA01
4B8MA 3AC3A 5HBHA 3CD3A 2CGUA 4WBBB 5H8GA 3VBWA 2BCJA 3ZO4A 2J5FA 4YUQA 4E7WA 2WTKB 3R73A 4L52A 4BHNA 4C3FA 5HORA 2NPQA 4GIHA 4EHGA 4CKIA 2Q0BA 3LXKA 3QKLA 4EOIA 2I0VA 1OKZA 4EKKA 1U54B 2SRCA 2VTRA 4R5SA 5DI1A 5A6NA 4IADA 4LRKA 3UO6A 5E1EA 3FBVA 2EUFB 3BE9A 3TIYA 5CLPA 4TTHB 3SGCA 3WI6A 4YC3A 4GJ3A 2R3HA 2ITYA 4HPTE 5CAVA 5CU0A 5K4IA 1ZZLA 4IAAA 4IWOA 4XBRA 3L8XA 4AN3A 1IA9A 2B9HA 4FZ6A 1PKGA 5L2QA 2WIHA 1JKKA 3GU6A 3NLBA 3Q4UA 5DNRA 2E9UA 5DLSA 4MWIA 3P0MA 3FMLA 3C4XA 1B39A 3R1NA 2VTHA 5FRIA 4M3QA 3RCJA 2GU8A 1PXOA 3NDMA 1OUKA 3FLSA 4K18A 1MRYA 3R02A 3EQGA 1IRKA 5IEVA 2XK6A 1FVTA 4OGRA 4PTGA 4F9BA 1BL7A 3C51A 4QTEA 5M44A 5AP5A 1IASA 3ZS5A 3OWLA 3BPRA 4DEAA 5HTIA 2XA4A 4I20A 3PXFA 1PMNA 2XBJA 5AM7A 2PWLA 3HEGA 4FT0A 3SW4A 2W5BA 4W4XA 4EK8A 5L4QA 4O0RA 2I0EA 4MBJA 3R0TA 2QLUA 2ITOA 3EFWA 4QMPA 2B7AA 3S95A 3UQCA 3WZKA 2LAVA 3C0HA 2Z2WA 4MYGA 1V1KA 4NM5A 2X8IA 2F7EE 2BFYA 4QMYA 1XBAA 3R7UA 4F9CA 4IZYA 3UPZA 4X2KA 2C3IB 3KRRA 4ASEA 4RVKA 4C35A 4DEDA 3QCYA 3TN8A 4OTPA 4FNXA 4ANBA 4EHVA 1PKDA 2XH5A 5GIOE 2IG7A 4ZSLA 4NFMA 4YHTA 1KV2A 3LJ0A 5HO8A 3NYNA 3TG1A 2H96A 5DYJA 3R7OA 2G1TA 1W7HA 3QCXA 4H3QA 4LL0A 3HMOA 5BVFA 5JEBA 3K5UA 5E8YA 3D83A 4XG3A 3MFTA 4DFLA 2BDWA 4LQMA 2OSCA 3CQUA 4IAFA 2Q83A 5CSPA 2UVYA 3W33A 3GC9A 4AGDA 4E6CA 4IFCA 3E88A 4L67A 5KKRC 3VUDA 2QCSA 5FUTA 4RLKA 3UGCA 4YJOA 2XYNA 5EOLA 5ETCA 2OW3A 2YWVA 5JKGA 3IDPA 1H00A 5LOHA 4QRCA 5BUEA 3CSVA 3V51A 1J3HA 3BI6A 3GU4A 4FEWA 3KULA 2C6DA 3W1FA 4A9TA 3TACA 4U97A 5DT0A 3BZ3A 2YM4A 3KCKA 1KE7A 2QOCA 2RFNA 4RQVA 4F63A 3VHKA 3W8LA 4EORA 5HTBA 3DXNA 1BMKA 3NRMA 2X7FA 4AG8A 4YPDA 2GDOA 3G9LX 3KK9A 3O8TA 4MBIA 4JNWA 4YO6A 2BROA 5CT7A 3CTHA 4DFBA 5C03A 3FLZA 3JY0A 1UKHA 3POZA 3QRUA 4U7ZA 4YC8A 4H3PA 4DFXE 2QR7A 4EBWA 5IH5A 3SVVA 4IVCA 4PPBA 1XO2B 3JS2A 1UNGA 4BBEA 2ZMDA 3RAKA 3V5QA 4PDSA 1MRUA 5IDPA 3CJFA 1WBPA 5IA5A 4HW7A 3MW1A 1SMHA 3EN4A 3RAWA 2X8DA 5AAFA 4I0SA 4Q2AA 5JRSA 2WEIA 2Y4IB 1UNLA 3DTWA 3KVXA 3R04A 4NM3A 3EN5A 4PQNA 3KRLA 4MXXA 5ITAA 5LMKA 4J7BA 3F61A 4C4HA 5IISA 2W0JA 3PG1A 1H25A 2PL0A 3VIDA 3L9PA 3WZJA 2W1CA 5HEZA 1E1XA 1TVOA 3DKFA 4YSJA 5AA9A 4FYNA 2ITZA 4GS6A 3VF8A 3WZUA 3ORPA 3AT3A 3UTOA 4EK6A 4UMRA 3TKIA 4A9UA 4AT4A 2QOFA 2FO0A 1E9HA 1I09A 2VTLA 2ZVAA 1YHVA 3F88A 3OMVA 5AP1A 3EJ1A 4C7TA 2R3GA 4Z16A 4J8MA 4NJ3A 5AUZA 3ZH8A 3TNHA 2C5XA 4FMQA 4X2NA 3FZSA 3UYSA 3C4ZA 4K1BA 2XBAA 1M14A 4QP8A 4XH6A 1FMKA 1FQ1B 5CF8A 3VBVA 5HNIX 5AWMA 4WRSA 5J79A 1LPUA 4QP6A 2JLDA 2IZSA 4FKLA 3SW7A 4FG7A 5JZNA 4USFA 4M13A 4ZSGA 1IG1A 2ITPA 4DLIA 3ZOSA 4MX9A 4KS8A 3SXSA 4CFXA 4RIXB 3VO3A 2JKKA 2XIXA 4F1TA 2PULA 1Q3WA 5A54A 1UU9A 2A0CX 3PE2A 4FF8A 1KE9A 1AGWA 3HA8A 4RVLA 2W4KA 2JDVA 4FKWA 1UU7A 2X8EA 3MH0A 3U51A 4ACHA 4D58A 1Q8TA 3F5GA 4YJTA 4FV3A 4I6HA 4DGOA 2HW7A 1Q24A 4ZMEA 4O7RA 4I5HA 4WG5A 1OL1A 2CGVA 2W1IA 1JKTA 3EN6A 4J97A 5DWRA 3ZFMA 1DAWA 5IZFA 2J7TA 2YM7A 4YLJA 5LWNA 3PG3A 4U41A 4FT3A 3A7IA 4G6NA 4GV1A 5DHJA 1V0PA 3HV3A 3PA3A 4J99A 3VBXA 2BZJA 2ITUA 4YLKA 3VAPA 4GFGA 3BU6A 3JVRA 4IDTA 4IM0A 4X2FA 3OWPA 1S9IA 3BBTB 3VRYA 5IH4A 4DCEA 3HAMA 3Q04A 4DT8A 3PSDA 2R2PA 3FI2A 4LMNA 5F9EA 2WGJA 3CKXA 3R8PA 4O7TA 2F2UA 3C4FA 4M0YA 2C6IA 1OMWA 3K3JA 2GQRA 3II5A 3KRJA 3QD4A 4AS0A 2BRHA 1IAHA 2CCIA 4JDHA 4ZSJA 5HHWA 1RE8A 4MBLA 5JZJA 5KZ0A 3QTZA 2PZPA 4HCVA 2O8YA 2O64A 5F1ZA 5M4FA 4KKHA 2OG8A 3KXZA 1O6KA 2C1AA 4YJPA 3B2WA 5F95A 3RNIA 3KKVA 3FQHA 2ERZE 3PJ2A 1XWSA 4UN0C 4MWHA 4FSWA 5HE1A 4FTQA 5EQYA 1SNXA 3VUTA 4O7ZA 3BHHA 3QQFA 2X6DA 4I21A 3TJDA 3R22A 4EZ7A 3T3VA 4EI4A 4K9YA 4YJUA 1LEZA 3BYSA 4NH1A 4GT4A 4IM2A 3I0QA 5AR2A 3I7CA 4QMOA 1F5QA 4UMQA 5AV2A 4C0TA 3NGAA 5IPJA 3UIBA 4XEYA 4ALWA 4BGHA 5I9UA 1OVEA 1EH4A 4M97A 3HUCA 5KBRA 5GJFA 4A4XA 4E20A 3E3PA 4KKEA 5G1XA 1W83A 1H8FA 4JLCA 1PXNA 2PE2A 2UW3A 3PDTA 4U3YA 1T45A 4FIHA 5CZIA 2ESMA 2R0IA 3TT0A 4FEVA 4TY1A 4G3FA 4E93A 4NIFA 1ERKA 4XP2A 3D7ZA 4KSPA 4E6DA 3GT8A 4R5YA 4EYJA 4MF0A 5C1QB 4E4LA 2R7BA 2OXXA 3KXXA 1Q4LA 3TEIA 2ZAZA 1K3AA 4EJNA 3HA6A 3DQWA 2W1GA 2BRBA 3E8EA 2HELA 4NCTC 4WA9A 4BCFA 3QYWA 2J0JA 5DMZA 4YZBA 4OBOA 3NNWA 4M69A 3RZFA 4O0TA 5FP5A 3S2PA 4O7NA 1Q99A 5KMOA 2GS6A 4D4YA 2B9FA 2E9NA 2ZV2A 5AR3A 3R7VA 4AW2A 5IA3A 1REJA 2F9GA 2J90A 3E87A 1CKIA 3UIMA 4NWMA 5C4LA 4ZY6A 2QKWB 4WNPA 3DBCA 5AP3A 3G9NA 2R3MA 3R63A 5HVJA 3OXTA 3EYGA 3B8RA 4TT7A 4W9WA 3A61A 3ALNA 2J51A 3I7BA 1FOTA 4CTBA 3B8QA 2AC3A 5KBQA 4EOOA 3PP0A 4M8TA 2Q0NA 3UVPA 5M55A 3E8NA 5C26A 2OWBA 3G5DA 3CY2A 3QZIA 5FDXA 3TTJA 1UVRA 5B2KA 4BKJA 4QP1A 4EEVA 5CEKA 4O81A 4FEXA 3R8ZA 3DK7A 3D0EA 4FBXA 3KMMA 2VTAA 4I6FA 4MD8E 1FVVA 2JAMA 4IW0A 4N4SA 4EOJA 3QXPA 4P90A 4G3GA 5HKMA 3KL8A 3UOKA 5CVGA 5E91A 3WF5A 1YWNA 4MXOA 2YZAA 4MXYA 3O7LD 4BTJA 3Q2MA 1YKRA 3LXNA 1G8AA 1OL5A 1XH5A 2YAKA 4FKIA 4JBVA 4QMTA 4UB7A 3THBA 4I5CA 1L3RE 4FZAB 3MJ1A 4XCUA 3FEGA 4KAOA 3A8WA 2QO2A 4O2PA 2ZDUA 3IECA 4Q5EA 3U55A 1U4DA 3UG2A 4EQMA 4I93A 2R3PA 4B8LA 2EVAA 1SVHA 3BYVA 2CKQA 2XIKA 2BIYA 3QCSA 3VUKA 4BDAA 4LGHA 4GVAA 4QP3A 4CFMA 4CRSA 3UQFA 3SXFA 3U6HA 2ZOQA 4XP3A 2WMSA 3A99A 5IUGA 2UZNA 4HZSA 3BHUA 1ZMVA 1H01A 3NUNA 3ENMA 3OT3A 2YIXA 5CVHA 3MH2A 4GFOA 5T3QA 4Y46A 3DBDA 4WD5A 5G6VA 3BBWA 1K2PA 5HCZA 3NCZA 4DH7A 1O6LA 3G6HA 5FTOA 2VNWA 5M53A 2HXLA 5EM8A 4CV9A 3TZ9A 1PMVA 4KB8A 2UZDA 4KIQA 3DXQA 4CGAA 3E5AA 3TIZA 4KIKB 4F64A 3WIGA 4ZS0A 3QGWA 3HMPA 2OK1A 5EW9A 5EQEA 4YHJA 1OIYA 5CQWA 2ETRA 2X7GA 4F9YA 3KRXA 2WMBA 1YDTE 2XNBA 3S1HA 5DE2A 2UW6A 3P79A 4G3DA 3RKBA 4FKTA 4O7WA 3H30A 3QUEA 4QTAA 2YABA 3F9NA 4QMWA 2CSNA 2HK5A 4J98A 3RHKA 1YI6A 3QALE 3R71A 5I9YA 3TDVA 5FM3A 4GRBA 2W1HA 4EBVA 5KMIA 3DS6A 2V7AA 4FSNA 4JDJA 4BYJA 4FICA 3BGQA 3L8SA 5ETIA 2HOGA 5C27A 2C6KA 2G2IA 4O7VA 2BHEA 3VULA 3AC2A 2EU9A 4F99A 3RPOA 3E64A 4R3PA 3VN9A 3WIKA 2OLCA 2VO0A 4JDKA 4N57A 5IG1A 3DTCA 5ANKA 2WTWA 4YTCA 2Y0AA 3Q53A 3FL4A 2WNTA 3P08A 3UO5A 2R3OA 4X3FB 5EDQA 1YDSE 3C7QA 3ORNA 4JVGA 2ZM4A 3GQLA 4EC9A 4AFJA 4CCUA 2Z7SA 4CT2A 2CN8A 2F7ZE 4N6YA 4YJNA 3NYVA 2BZIB 5CEMA 1GIHA 4DF3A 3V6RA 4IJ9A 4CKRA 3QRJA 3FI4A 4EH7A 1NT2A 1OBDA 4LV5A 4WT6A 5T6KA 5GZ8A 4QMUA 5KMJA 1B6CB 4RC3A 3CJGA 4JRNA 5GJGA 2XMYA 3ZXZA 4LFIA 3V6SA 2OH0E 3NYXA 2BDJA 3UBDA 2XIZA 3IS5A 3GBZA 2WFYA 2W05A 4PL5A 4L42A 3FPMA 5HD7A 4BDHA 1OZ1A 2HY81 4AW1A 4DGNA 4AF3A 1RW8A 3VS1A 1YOLA 3OUKA 4IX3A 4MTAA 3CC6A 3D5WA 4AN2A 4FK3A 2ERKA 5HNGA 3L9MA 4GG7A 3L8PA 3F7WA 4FKRA 2IN6A 2PZYA 1S9JA 3A62A 2HWOA 5DFPA 2RIOA 4C59A 3CGOA 3VUHA 2WU7A 4XOYA 4AX8A 5AA8A 3DDQA 4AOIA 4XRLA 3AMBA 3DB6A 4EOKA 5L8KA 4FTTA 5IDNA 5CQUA 5LQFA 4KIKA 3HMIA 5IF1A 1ZOGA 2EXCX 1WVYA 3ZSIA 2VWYA 3CTQA 4GU9A 4RFZA 4S31A 4CLIA 3FMDA 4DG2E 2PUNA 2O3PA 4D4SA 4YZ9A 3NAXA 3GOKA 4ERWA 1HCKA 4G5PA 3UZPA 4YJQA 3EFJA 3EN7A 2FB8A 1YQJA 1QPEA 3RINA 2CGWA 1GOLA 4Y5QA 1H27A 1H1WA 2G9XA 3QBNA 4XNEA 1Q62A 1APME 4TWCA 4J95A 5JFXA 4GT3A 4IAYA 2YHVA 3P5KA 4DINA 1SNUA 4M12A 4EOMA 2JGZA 3IDBA 4JG6A 4QQJA 2C6EA 5LARA 1YOMA 1JVPP 2YLFA 2FSMX 4AFEA 3IW5A 4DC2A 3VBYA 3LM0A 4U8ZA 1RQQA 2HZIA 4IB5A 1XQZA 4QMNA 2WELA 3Q2JA 2PTKA 3V5JA 3VQUA 2BILB 3E8DA 3EQBA 5BVNA 2VTSA 3VHEA 1OL6A 1Y6BA 2P2IA 1XJDA 5BYZA 5FTQA 5D11A 3CPBA 3FZTA 4C3RA 4IQ6A 3LW0A 4ACCA 3ODYX 5EM5A 2XCKA 5DRBA 3BHTA 1UNHA 2CCHA 3RP9A 4RJ4A 3GC0A 3ZCLA 1ZYLA 5M4CA 4IAIA 3DNEA 4WIHA 3RGFA 3U9CA 4V0GA 4D5KA 3F2AA 4EH4A 1FINA 5I3RA 3MDYA 4FOCA 2C0IA 2ITTA 3AMYA 1A48A 4ZY4A 1YHSA 4ZZOA 4XYFA 4MEDA 4Y73A 3DKOA 4LRJA 3Q32A 3R2BA 4C2WA 5BVKA 4BBMA 4RIWA 4O0VA 4GKHA 4JR7A 2QODA 4FSMA 4WSYA 2XKDA 2PUIA 2JIUA 4TXCA 4AGUA 4YNEA 4NCTA 3RK7A 4B9DA 1NW1A 3ZO3A 2CKEA 3AD5A 2XNOA 3K54A 5K0KA 2ZM1A 2XP2A 4DG0E 4RFYA 3L8VA 4MHAA 4BCQA 5IUHA 3F3UA 3JXWA 4X6RA 4HVHA 4E4XA 5CSWA 1M7QA 5FD2A 2VX1A 2A1AB 3RM6A 3ULIA 3PY0A 5FDPA 3C0IA 3VS2A 1PW2A 1PYEA 3QKKA 2J4ZA 4C4IA 2UZVA 4K2RA 4KIOA 3ZC6A 5EM6A 2XEZA 3QGYA 4U0IA 1J1CA 3RWPA 3WF9A 2W06A 3UNZA 4BY9E 1Q8UA 2R3IA 3FUPA 3DJ7A 5M56A 2IVTA 3PWDA 1DS5A 1P14A 1VEBA 1OITA 5HIDA 2UV2A 3TV4A 4LUEA 4D9UA 4FNYA 3RM7A 4FK6A 2OXYA 3LMHA 3I5ZA 2Z7QA 3BLRA 3QQKA 4FV9A 4FA2A 1URCA 1YI3A 3PXYA 2ZYBA 3JR1A 5KE0A 3IO7A 4U40A 5J5SA 5L8JA 3HZTA 2WQBA 1YXXA 2Y9QA 3N4TA 4MNEA 2B52A 4NW5A 3QFVA 1BYGA 4TYEA 4CD0A 1PXMA 1XH7A 3OFMA 4LMUA 4EH9A 4DH5A 4DCAA 2BRNA 1UWJA 5J9LA 5HX8A 4JQ8A 4D5HA 2YLEA 5KNJA 3PPZA 5FEQA 3DZOA 2J50A 4L3JA 2YCQA 5BMSA 2B9IA 2XIYA 4FTMA 4MXCA 4JX7A 2G2FA 3GCPA 1IAJA 1JAMA 5GHVA 2C5OA 2WKMA 4D2TA 3ZEWA 3I4BA 4IACA 4F6UA 5K4JA 1OL2A 3G0FA 4I0RA 5HI2A 5BYLA 2B54A 3KY2A 2P4IA 2QNJA 3GEQA 3OCTA 2OIQA 4XG7A 3FY0A 5LVPA 5AP0A 4RVMA 5C4KA 5ETAA 3VS5A 3OW4A 3EL8A 5AV0A 4UWBA 4YC6A 1SM2A 2BUJA 4USEA 4UX9A 2Y4IC 1SVEA 4FI1A 4CMUA 1W84A 3DZQA 5DN3A 5JSMA 2W9FB 3OOMA 1GZOA 1R3CA 1CKPA 5CNNA 3SXRA 5DR9A 5GZAA 2UW8A 4QYGA 4ANMA 5ANOA 3KULB 4I22A 4B7TA 3UVQA 1OKYA 1AQ1A 4PMSA 4QYFA 3TNPC 3P86A 3ZC5A 5HBJA 4BIDA 4TWOA 3ZDIA 4OTFA 3COHA 5IMEA 2F2CB 5LVLA 1U5RA 3FPQA 5TF9A 3MJ2A 4DGLC 2WTIA 2UZTA 1H0WA 2YCFA 3KCFA 5EYDA 2Y7JA 5AJQA 3Q6WA 2CNUA 4F0GA 4R77A 2XB7A 1REKA 4AE9A 4FV6A 4TW9A 2XK9A 2O2UA 5FQDC 3QTXA 4F08A 4XJ0A 1CM8A 4EH5A 2WQMA 3VS6A 3CQEA 2YERA 5A46A 2GHMA 3PJ8A 4EQCA 2HYYA 5HTCA 5JN2A 2B55A 4GYIA 3UNKA 2WMUA 4OBPA 2WQNA 1WBOA 3OZ6A 3LLTA 3LXLA 3VUGA 5AEPA 3PXZA 1GIJA 2C69A 4I41A 5H9BA 5FBNC 5FEEA 4ACGA 4AUAA 2XYUA 5EHLA 1ZY4A 4R1VA 4BIEA 4DFNA 3V8TA 4APPA 5KO1A 4N70A 4GG5A 2R3NA 4C57A 4EOSA 4HGSA 4EUUA 4M7IA 4D1SA 4EKLA 3COKA 5KMNA 3ROYA 3DDPA 3QZGA 3I60A 4TWNA 2C5VA 2ZB1A 3Q4CA 3QUDA 3SOAA 4UBAA 5HG7A 3TL8A 3R9RA 4PMMA 2WQEA 2F7XE 3PJCA 4FOBA 4X7QA 5AP7A 5HG8A 4BCNA 4FKUA 4F65A 5CY3A 3NR9A 3LQ3A 4E5WA 4BN1A 3FQEA 2OBJA 3TCPA 2WTCA 3LJ1A 1G5SA 4NUSA 3PVWA 5HCYA 4O0YA 3C13A 2E9VA 3FLYA 4PF4A 5BVWA 4U80A 5BNJA 3MA3A 4FX3A 3ZM9A 3P7BA 1J91A 2IVSA 3QQLA 3F66A 4BCOA 4GFMA 4F9WA 4GIIA 3OOGA 3TZ8A 4D4VA 3EL7A 4FTJA 5BPYA 3FYJX 2PE0A 5LCKA 5EKNA 4PDYA 3HRBA 2F4JA 4P7EA 2IO6A 4M66A 4Q9SA 2CNVA 1X8BA 2DQ7X 3R8VA 4D2SA 3FMKA 3AC5A 3D15A 3FAAA 3NPCA 1R0EA 2RGPA 4RQKA 5EQPA 5DEWA 4PTEA 4F70A 5AV1A 5J5TA 1M2PA 3QRIA 4LM5A 3HRFA 4CYIA 1ND4A 2YA9A 3DJ5A 5CSXA 4Y83A 4ANLA 4FT9A 4G5JA 3IW7A 4KNBA 3HV4A 2FUMA 4EK4A 4IC7A 4ZTSA 1OPLA 2UZEA 4EWQA 4FIFA 2BZKB 4ITHA 3GP0A 5TR6A 3DJ6A 4USDA 4FTUA 5J8IA 3HV7A 5F20A 4X0MA 4IVAA 4HGLA 4O91A 2GS7A 1LR4A 3H9RA 5L2TA 3R9NA 3LFCA 4Y95A 4DH1A 5B2LA 5JH6A 2WQOA 3DLSA 2JKQA 2PVMA 1KE5A 2J2IB 5TO8A 2PVNA 4WHZA 3FKLA 4KWPA 3PA5A 2YDIA 1FGIA 4FV4A 4B6LA 2RL5A 3PYYA 4HYSA 4U81A 2J5EA 2V62A 2XKEA 4O7YA 2EWAA 4O7LA 1FGKA 3D4QA 4AAAA 1UU8A 2PUUA 1ZMWA 1YW2A 2JKOA 2QONA 3R6XA 3MVHA 4DG3E 4FKQA 3R00A 3N4UA 3OBJA 1NVRA 2VAGA 2JDTA 5HE0A 5K5XA 2XRUA 4C02A 4M67A 5AX9A 3R7GA 3RALA 2DWBA 3F3ZA 2BHHA 4I24A 4WOVA 4BTFA 4AOJA 3LOKA 3Q5IA 4KSQA 4CQGA 5FEDA 3PLSA 3SA0A 3MSSA 2H34A 1WCCA 2ZJWA 5HU9A 2BZHB 3AT2A 4GEOA 4XG6A 3VUMA 1IEPA 5JGDA 4RIOA 3FHRA 1KE6A 4U44A 2GHLA 2BR1A 3EMGA 2WXVA 4PY1A 1KOBA 3WYXA 2OFVA 3LIJA 5HLNA 3HDMA 4AGWA 4DGMA 4RJ6A 3DA6A 2R3RA 3H9OA 4NTTA 4ZJIA 4GH2A 4UYNA 4PNKA 3HAVA 4RA5A 2PVLA 4DTKA 2OIBA 3D14A 3DQXA 4OAUC 1R1WA 3FZOA 4V01A 5IEXA 2KULA 1G8SA 5HLWA 4JAIA 3L9NA 4OTHA 3ATTA 3PP1A 5ANDA 5E8UA 4RLLA 4O82A 2VU3A 4PNIA 2IWIA 3A7GA 4IAKA 4GVJA 5E90A 3R8LA 3ACKA 4NIFB 3HRCA 4FV5A 4ZLZA 4J96A 2PPQA 4MXZA 4UYAA 3OROA 3R9OA 2W1ZA 5ANGA 2PVJA 3QU0A 4L43A 4IAZA 4R7HA 4IANA 3UO4A 4YSMA 4RX7A 4BHZA 3TZ7A 4C4GA 3QX4A 4IBMA 5KHWA 2YFXA 4JJRA 1UV5A 3BX5A 1TQMA 2I40A 4DT9A 2VWXA 4KS7A 4IH8A 2QLQA 1MUOA 3LPBA 4M69B 4QMVA 4E3CA 2PE1A 4NK9A 2GNLA 2ZV7A 4FR4A 3BEAA 3BELA 3GXLA 4I5MA 3RCDA 4CG8A 4A4LA 2PMNX 1XH8A 3IW8A 4Y8DA 4DFYA 3NW6A 4H36A 3FC2A 3MV5A 1O9UA 3FWQA 1OL7A 2C3JA 4NT4A 3RAHA 3BLQA 1Q8WA 5BUJA 4XLVA 1ZMUA 2O63A 3SDJA 4E73A 3NYOA 4XV2A 3TDWA 5L3AA 4FSTA 5M4IA 4U5JA 3ET7A 2G2HA 4IZAA 4CRLA 2XUUA 2VTMA 2WMWA 3RK9A 3A7JA 1BI8A 4FSQA 4O27B 2W99B 2X9EA 3I6WA 2R4BA 4PMTA 4ZIMA 4BDJA 4BICA 4EHEA 2R3QA 2WO6A 2FGIA 3FLNC 4S32A 3L9LA 4J53A 2X9FA 2VZ6A 2W5HA 4Y85A 4C4JA 4CG9A 4Z55A 4NJDA 1QL6A 1BKXA 4W4VA 5E8XA 4AXAA 4B99A 4E6AA 1J7UA 2WTVA 3OWKA 2JFLA 1GZKA 4APCA 5HD4A 1OGUA 2RFEA 3PSBA 5HICA 2C6OA 3NNUA 4YJRA 5GIPE 4D2WA 2QG5A 3O96A 5AR7A 4AGCA 1FPUA 4O86A 1BX6A 4C2VA 2W1DA 2QHNA 2ITNA 1IA8A 3DOGA 3RJCA 3D94A 5KKRB 4A7CA 4ZTLA 5H8EA 1ZYDA 2F49A 3BU3A 4PDPA 4S2ZA 3CPCA 3LLAA 4JOAA 4FUYA 4QNYA 2UUEA 4TYGA 3LXPA 3QTQA 2QQ7A 5D7VA 2WOTA 3V04A 1W98A 2JIVA 2WTDA 3ZXTA 4E4NA 2VX3A 5J9ZA 2OGVA 3GOPA 3T3UA 4MQ2A 3UOLA 2XF0A 3UC3A 4E5BA 2OZAA 2JAVA 4UWCA 3WYYA 1JNKA 4G16A 4P5QA 3C50A 4TNBA 2V22A 4QYEA 3AC8A 3O71A 4UALA 4AP7A 3VS3A 3PA4A 4QTCA 4QMSA 4FV7A 1KSWA 2PY3A 4IVDA 4W4YA 5CTPA 5C01A 3ZLYA 3COMA 3CQWA 5EI2A 4ENYA 2VWBA 2Z7RA 3D2KA 5AMNA 3CY3A 3P1AA 2HAKA 4HZRA 4U9AA 4IB0A 3M1SA 3O23A 4PL3A 4GMYA 4EUTA 3LJ2A 2VGOA 3ZLSA 3QX2A 4QQCA 5HO7A 3MFUA 4DEIA 4R7BA 5FG8A 4FEQA 3EQDA 4C3PA 4XS2A 3ZFYA 4X3FC 4IVBA 4YMJA 4ZJJA 4W9XA 4BVUA 1NA7A 4D0WA 2XK3A 5AR4A 1NVQA 4FSRA 2UZLA 2R3KA 2BAJA 5M08A 3NUYA 3BU5A 2W7XA 4TYHA 3VQHA 3AD6A 3FXWA 4BTKA 1H26A 4QPAA 4S34A 4BI1A 5EM7A 3U4UA 3ZFXA 4R7IA 5J7HA 4ZK5A 5A4CA 3FXXA 2YIRA 4G9RA 2HZ0A 4DYMA 2BAKA 5ETFA 4EWHA 1GY3A 4OTWA 4ID7A 4KBAA 2C5YA 3R7YA 5A4TA 2P2HA 3IPHA 2XK4A 1YXVA 1OKWA 3Q9WA 4J8NA 4YPSA 4JI9A 1I44A 3I5NA 2BDFA 4FL1A 4EOPA 3VF9A 1XKKA 3C4EA 2DYLA 2Z60A 3KMUA 4I23A 2W17A 4XOZA 5E9EA 4GJ2A 5DR6A 4BCJA 1JKSA 4P5ZA 1A9UA 1M7NA 4LOOA 4DTBA 4H39A 4IIRA 4XV1A 5IU2A 2PMLX 4NKSA 4HYIA 5K5NA 4Z3VA 1YVJA 4TNDA 3MESA 3QA0A 3CLYA 1P4FA 4D2VA 5LVNA 3AG9A 1JLUE 4H1JA 3KRWA 4XMOA 4HGEA 2PZ5A 2VO3A 3NUXA 1MP8A 3QKMA 2HXQA 2JBOA 4BCMA 5H3QA 1CDKA 3DK6A 3PXKA 1PYXA 1ZOEA 3DAKA 5CEPA 2JITA 3SHEA 5DPVA 5EFQA 3QD0A 1H08A 3QLFA 1XH9A 3ZBXA 2ZMCA 5DT4A 4FIJA 3QZHA 4DN5A 5HCXA 3TWJA 3ZUTA 3SV0A 4UXQA 4Z9LA 5HU3A 3S0OA 1GIIA 4BZOA 5HG5A 4FT7A 2B4SB 3AMAA 4HYHA 2ZDTA 1Y8GA 3CR0A 1VJYA 4KKGA 4LUDA 4UWYA 2WIPA 3F69A 2PUPA 3DBEA 3FJQE 3V5PA 4JBPA 5AUVA 5AR8A 5ANJA 5E8ZA 4HVIA 4CFVA 3KEXA 2VTJA 4RG0A 3KFAA 4YJVA 4NW6A 3PIXA 4NZWB 5AR5A 3F5XA 2J0LA 2QKRA 3FHIA 3Q9YA 3QQGA 4H1MA 2QOLA 4MD9E 1PMEA 5TT7A 2CNQA 3SG8A 4BDEA 5KZIA 3AC4A 2XIRA 4ZLOA 3TZMA 4C38A 3B2TA 4FNWA 3W16A 5IQHA 1VYZA 1E1VA 3DFAA 2YZLA 3FI8A 5CI6A 4FTNA 2CGXA 2PU8A 5EKOA 1PRYA 2C3LA 3HKOA 3EOCA 5C8MA 1DAYA 3PXRA 3GCQA 2DS1A 4YTIA 3ZRMA 4TL0A 5L2SA 4FG8A 3ZMMA 1BL6A 4U45A 3FMNA 2GTMA 4CZUA 4S33A 2Y6OA 4H05A 5LJJA 4TYJA 5IA4A 5J1WA 2P0CA 4AZWA 3MIAA 2XM8A 3BKBA 5JT2A 5L2WA 4EK3A 4F7JA 3REPA 3NX8A 1A06A 3C0GA 4IDVA 4HGTA 4IFGA 2VTNA 4FZ7A 1NXKA 4X3JA 4XG9A 3RTPA 3LZBA 3A4PA 3NAYA 4YZDA 4PV0A 5EDRA 3UIXA 2O0UA 4QPSA 1GZ8A 3UG1A 3QHWA 3DK3A 4ZP5A 5CAOA 4AN9A 2BRMA 3GU5A 4RGJA 4GL9A 3BQCA 4CMOA 2R9SA 4FYOA 4L3LA 4EONA 4D0XA 4C33A 3PJ1A 4FSZA 4O83A 4ZTHA 1H0VA 4IWQA 3MFRA 4FG9A 4XG8A 2BVAA 2OZOA 4LL5A 3F3VA 2WMAA 4ZMFA 3ZLXA 4DH3A 4LG4A 4V0GB 5EW3A 4L3PA 5EYCA 1DI9A 3PRIA 3NWWA 5FXQA 3V01A 3ENHA 2QOOA 3GVUA 3EB0A 2UZUE 3BGZA 3ORKA 4BGQA 1R78A 3ACJA 2A27A 3F82A 3W18A 3G6GA 3ZUUA 3Q4ZA 3QZFA 4RZWA 4FIEA 4B0GA 2GNGA 3TUBA 4AW0A 3W2QA 1P4OA 4LI5A 2XNMA 4RIWB 4FV8A 2FVDA 4O2ZA 3PLAE 4F1OA 4D28A 4AT5A 2GNHA 4ITIA 4YP8A 4G3CA 1PXLA 3W2OA 5CAQA 3PZHA 3EQIA 4BFMA 3QWKA 3HP5A 2XEYA 4CMTA 5LVOA 1OB3A 4FTRA 4II5A 5CWZA 4RBLA 2CLQA 4F7NA 4A07A 2YIQA 2XNEA 2XK8A 3L1SA 3M11A 1OIUA 5DGZA 5F4NA 5K9IA 5CX9A 2B9JA 2BFXA 2E9PA 2PVKA 2VWWA 2YACA 3KXGA 2JEDA 3ORTA 4RX8A 3EQFA 2GNFA 2R3LA 2WAJA 4WUAA 4V04A 5IQAA 3LVPA 2EXEA 3G90X 3FKOA 3R8MA 5KMLA 5D10A 1CTPE 5E8SA 3O7LB 5IKWA 4WG4A 4W4WA 4IB3A 2VWZA 3MS9A 4FTKA 4IC8A 1KOAA 2XKCA 3DNDA 3AT4A 4IE9A 4A9SA 3MH1A 3T8OA 4DEGA 4LGGA 3VNTA 2V0DA 1Q61A 5DR2A 4RJ7A 4MK0A 2GNIA 2QVSE 5D12A 4HOKA 4F7LA 5DT3A 2C30A 4NM0A 1NVSA 1YXSA 3KU2A 4NM7A 3FZRA 3MTLA 1V0OA 2B53A 3PSCA 3E93A 4GU6A 4PX6A 3PWYA 5JFSA 3OY1A 5M09A 1XBCA 2X6EA 4O6EA 1WVWA 4MD7E 3MN3A 3IW4A 1VZOA 4O96A 1TQPA 2WTKC 3IKAA 2QURA 3ITZA 3PPJA 5TE0A 5IH6A 3ELJA 4MNEB 4IWDA 4DEHA 2C5NA 2HW6A 5CI7A 4FGRA 4FV2A 3VVHA 3H0ZA 2WU6A 4NTSA 2R3FA 2XK7A 3IQ7A 4OT5A 3R9HA 3W2PA 3MH3A 2XS0A 3PZEA 4ARKA 4RC4A 4CFFA 3UVRA 4QMQA 2I0HA 3QYZA 4GYGA 3TNIA 3IDCA 5CNOA 4F6SA 4DFUA 5CU4A 4CFUA 3UMWA 4E26A 4EHZA 4ZTQA 4Q9ZA 2W1FA 2XJ1A 4K33A 3IONA 5C8NA 4I1ZA 5IUIA 5CF5A 5M51A 2A19B 2AC5A 3KA0A 2OICA 2PMOX 2CKOA 5M57A 3LFDA 3SKCA 5CYIA 5DIAA 4PL4A 5H2UA 4EZ5A 3FV8A 3OXZA 2UVXA 4ANQA 4FKVA 3P7CA 4ANSA 4M0ZA 2VTPA 3BQRA 5D9HA 3UP2A 5LMKC 5M07A 4MF1A 4DHFA 2IVUA 4ZTRA 3F5UA 3FL5A 3IK3A 4FKPA 1W82A 4XP0A 4PP7A 2KTYA 1OECA 1WBSA 3DAEA 5JFWA 4HCTA 5I9ZA 1UU3A 4Q5HA 3ZONA 4AWIA 1Q41A 2Z8CA 2YDJA 3KGAA 4KD1A 3E3BX 5C9CA 2NRYA 2IZRA 2YM8A 3LAUA 4GUEA 3G15A 1PJKA 3ORZA 5AV4A 5I9XA 1Q3DA 2XRWA 3UODA 4RZVA 2VD5A 3R8UA 5HLPA 3NIZA 4IM3A 4TRLA 4I0TA 5CAUA 1ZWSA 3PIZA 5EG3A 4ZLYA 5A14A 5KCVA 4AZVA 4YURA 5IQFA 5BVEA 4DAWA 3ID6C 5E8TA 3KN5A 4BDGA 1YRPA 2YISA 2XKFA 3FMJA 4RFMA 3EFKA 3ATSA 3DFCB 4ERKA 3OUNB 4PPCA 5HVKA 5J87A 2OKRA 4K6ZA 4OTDA 2OJFE 2ITWA 3GCUA 4MXAA 4UXLA 3WZDA 3QUPA 2OF2A 4UMPA 5GINE 3GUBA 4JS8A 2PVYA 2VTIA 1OI9A 5I9WA 3DBQA 4QYYA 4UMUA 4JG8A 5EI6A 1H1QA 3DB8A 2GFCA 4FVRA 4TPTA 4BGGA 3VBTA 4O84A 3UNJA 3IW6A 4FT5A 5TKDA 3PUPA 4TZRA 3LFEA 3ORMA 4BZNA 5D7AA 5CXHA 3FLQA 3DV3A 4O22A 3R83A 3FC1X 4C4FA 3KF7A 3W2CA 4IXPA 5DVRA 5AP6A 2C3KA 2NRUA 1ZARA 2FSTX 2VTQA 5AIKA 5GJDA 4P4CA 4D1ZA 1H07A 1JSVA 2JBPA 2REIA 3R30A 4KA3A 3LCOA 3M42A 3LHJA 1LP4A 5AUUA 1PXJA 4DITA 3PPKA 5A6OA 1YXTA 5FXRA 3VW6A 1XR1A 2JIIA 1TKIA 2ITXA 4ACDA 3F3TA 1UA2A 2XJ2A 3NZ0A 3CGFA 3R01A 4O1PA 2YCRA 3OC1A 4G6LA 2VGPA 5I3OA 2H6DA 4RSSA 3ZTXA 3VS4A 2RG5A 2W5AA 3MVLA 2IW6A 1ZOHA 4JR3A 3ZU7A 2OO8X 4QP7A 3WARA 1PXKA 3I0OA 2PSQA 2X0GA 4E5AX 4UMTA 1DM2A 3LFSA 5JGAA 5J7BA 5AUTA 3FSFA 2OF4A 2YIYA 2OU7A 4FSYA 2NO3A 4I94A 1Z5MA 1CKJA 3D7TA 4XV3A 3CD8A 5A4LA 2Y8OA 3U54A 2IW8A 3E92A 1QPCA 2J6MA 3POOA 4IHPA 2W96B 2GCDA 3D5UA 3RZBA 4WNKA 1URWA 5HE3A 3VW8A 5HIEA 4EH3A 3EHAA 5H8BA 4QYHA 3ANRA 1GJOA 5CEIA 5HZNA 5CS6A 4ITJA 2ETMA 3V5LA 3EFLA 2W4JA 1ZZ2A 5J95A 4TN6A 3MGYA 3WF6A 2AUHA 4E4MA 3VS0A 5JMSA 2PHKA 5EOBA 3S00A 4DBXA 1P5EA 3MWUA 5FXSA 1OKVA 3MI9A 4OBQA 3UQGA 3FZ1A 2G01A 4J71A 3HMNA 2ITVA 3LFQA 1OPJA 3FY2A 4NU1A 3QA8A 2BIKB 2P33A 3NVMB 5LMBA 1O6YA 3F7ZA 2WHBA 5HE2A 2C47A 4EK5A 2WZJA 3SRVA 3ORXA 3U4WA 1KUTA 4BCIA 2C6TA 3S4QA 2EXMA 3BE2A 2V55A 4BBFA 2RFSA 1KE8A 4OW8A 3CBLA 4D55A 3HL7A 2OI4X 2FSLX 4IX5A 3UDBA 4NKAA 2YJSA 2QOIA 3HLLA 2X2MA 3K2LA 5JQ8A 3MYGA 4FODA 5BUIA 3NEWA 3FSKA 4G1WA 1R39A 2VWVA 5ACKA 2X81A 2HIWA 4D9TA 5B2MA 4EYMA 3H4JA 2BKZA 4FSUA 4DE4A 2XZSA 4YZMA 4I6BA 4KRCA 4JT3A 4XHKB 3MB6A 2VRXA 4LV8A 4D2RA 1WZYA 4WG3A 2ACXA 2PVHA 3QQHA 2XNNA 4FVPA 1Y6AA 3ZEPA 3WE4A 3F2NA 4UY9A 3OP5A 4F09A 2XCHA 2CDZA 5M06A 3LCKA 4F7SA 4O1OA 5HGIA 4FTOA 1J1BA 3GQIA 4QP4A 4BKYA 2WMTA 2O5KA 3R2YA 4C4EA 1HCLA 2XNGA 4A9RA 4K0YA 2UW4A 2Y4PA 3EZRA 3FE3A 5IEYA 2FSOX 4GKIA 3O8PA 3PIYA 3UOHA 5GNKA 4BL1A 4FZDB 4PP9A 3LFFA 4C62A 3TKUA 4WRGA 1FBNA 1WVXA 2WMRA 4K8AA 2QO7A 2F57A 5KUPA 2WD1A 5CALA 5J1VA 4G17A 3MVJA 4QMZA 2A4LA 5CSVA 3BCEA 3E7VA 3HV6A 4C61A 4GCJA 4H58A 2JDOA 3BYMA 4QP2A 5IQBA 4GUBA 2X2LA 3FMHA 3EQPA 5FTGA 2QHMA 2ETKA 3BYUA 3GU7A 4Z7GA 5FBOA 2ZM3A 4BWPA 4CT1A 4RPVA 3TJCA 4L53A 1H28A 4QOXA 3PY3A 4LGDA 4XBUA 2ITQA 1M17A 4U6RA 2H8HA 3GENA 3NCGA 2QC6A 3D9VA 4L9IA 4CLJA 4ASDA 2RSVA 4R78A 4RRVA 2IPXA 5DEYA 4AZTA 1BUHA 5JK3A 4L44A 4ZAUA 4YBJA 4O0XA 3OCBA 3BYOA 3MY1A 1H24A 2UW5A 4M14A 3TKHA 1F3MC 5E7RA 1JSTA 4BCPA 4AACA 3OEZA 3W8QA 4BB4A 4CXAA 1U54A 2UW0A 3FQSA 5A3XA 3W10A 4I5PA 4RVTA 4X2JA 2QI8A 3KMWA 4L7FA 4CSVA 2BKKA 4QQ5A 3WOWA 3KF4A 4AA5A 4WO5A 4C37A 3A4OX 1R0PA 4I4EA 4CFNA 4JQ7A 5IA0A 2JKMA 4JAJA 4EH6A 1IR3A 4V05A 4X2GA 3KQ7A 4R6VA 4BR3A 3LE6A 3R1QA 1BI7A 5AAGA 4OTGA 3PRFA 4OTQA 3QC4A 4RX5A 4W8EA 3SLSA 2V5QA 1PHKA 3OTVA 5M4UA 3RK5A 4JL9A 4MVFA 2I7QA 2ZB0A 3G0EA 3LMIA 3AXWA 4BI0A 4IZ7A 2X2KA 4RJ8A 3VRZA 1XH6A 2YITA 3MBLA 3OF0A 4QTDA 5HVYA 5IMXA 2X4ZA 3VWAA 3ODZX 3FLWA 2VTOA 4FNZA 2IW9A 3GB2A 4CZYB 4L00A 3HYHA 1WBWA 1J7LA 4LRMA 4P2KA 5AX3A 2PVRA 4O0SA 5HBEA 3P23A 4TWPA 1YWRA 4ZY5A 2OZAB 5CF6A 1SZMA 4ZZMA 3MPAA 3NSZA 1H1RA 3OWJA 3ZSGA 1ZYSA 1MRVA 3E63A 3HNGA 3NNVA 4NEUA 1OIQA 3U8WA 4U43A 1YHWA 4DH8A 4TYIA 3KN6A 3QRKA 5CF4A 5CEOA 4FKGA 3ORIA 4JRVA 2NNWB 2OJIA 4TKSA 3TUDA 2WMQA 2X4FA 2X39A 3QQUA 4JIAA 5CEQA 4DTAA 1P2AA 3I6UA 4YLLA 5JQ5A 3RI1A 2VWUA 2PZIA 2BTRA 2QO9A 4QMLA 2CN5A 4XUFA 2AYPA 4ANOA 4BDBA 4QT1A 2FYSA 4K11A 4BCGA 1ZLTA 3Q6UA 4I3ZA 4IB1A 2C0OA 4EJ7A 1VYWA 3IGOA 3CCNA 3NUPA 4M84A 4CEGA 1WBNA 3QTWA 3ZRKA 2EB2A 4WBOA 5FM2A 4PDOA 3C5UA 5CU2A 3N9XA 4OTRA 4TYHB 3H10A 4HNFA 2YCSA 3VC4A 5KMMA 3N51A 3C9WA 1F0QA 3V5WA 2QOBA 4FTCA 4QMMA 4QPMA 1JQHA 4ENXA 4JG7A 3RVGA 2C6MA 5KX8A 5CU3A 4RWKA 3SC1A 2YM3A 4FUXA 5EYKA 4MAOA 2IZTA 2R0UA 5DOSA 4KBCA 4BC6A 4C36A 2QG7A 3ROCA 2QR8A 2YEXA 4ASZA 4CTCA 1XBBA 3ZUVA 3OEFX 3UP7A 3QD2B 4CFWA 3HDNA 2YDKA 4JDIA 4BYIA 2C6LA 4CYJA 3NUAA 1YDRE 2W4OA 1FVRA 4RMZA 2GQGA 2X1NA 4QTBA 4Z7HA 3EIDA 3HECA 5A4QA 4L46A 3LMGA 1U5QA 3LCSA 2ZV8A 3MTFA 4FKSA 4XRJA 4FE2A 4EC8A 5L6PA 4ONAA 2RG6A 1Y8YA 3P4KA 5FGKA 3G2FA 4OT6A 3Q4TA 2V7OA 3JY9A 4AZEA 4DEBA 3CXWA 4UEUA 2YM6A 5LXMA 5HIBA 3OHTA 3U87A 3GNIB 4D1XA 3C4WA 5GZ9A 1BLXA 4BRXA 2XJ0A 5CU6A 3CTJA 2RKUA 2B1PA 4IJPA 4FEUA 2JD5A 2YN8A 2GTNA 3EKNA 5ANIA 3IG7A 1Q97A 4IX4A 3ALOA 3RMFA 3BWJA 2CKPA 3R1YA 4G9CA 4FZFB 1WFCA 1SVGA 4U79A 2CLXA 3A60A 4DEEA 3NMUF 5IQCA 1W0XC 1QCFA 4DGGA 4O7SA 1TQIA 3LFBA 2WMXA 3VJNA 3W32A 2I1MA 4IX6A 2CMWA 2PVFA 4MNFA 4MKCA 2Y6MA 4XX9A 3TI1A 3TV6A 2I6LA 3QCQA 4ASXA 2YWPA 3HGKA 3PY1A 1PY5A 3CE3A 2C1BA 2FH9A 2VNYA 5A9UA 5C8KA 1VR2A 4EQUA 3I1AA 1STCE 2GNJA 1DI8A 3JUHA 2PK9A 3LCTA 3TTIA 4FV0A 3LM5A 1WBTA 5E92A 5IA2A 5FP6A 4Y5HA 3KREA 3BWFA 4W8DA 1Z9XA 2W9ZB 3ZZEA 2YIWA 3F3WA 4RA4A 5AADA 2XM9A 3RPSA 3VS7A 4GK4A 4HVDA 1YWVA 3DT1A 4PWNA 4ALVA 2OJJA 3O0GA 3BV3A 3ZO1A 4RIXA 4WUNA 4IWPA 3QD3A 1MQ4A 3NVKI 4FV1A 3R21A 2IVVA 3BLHA 2GS2A 4QNAA 4HYUA 2NP8A 3O51A 3Q9ZA 3QLGA 2UZOA 1XH4A 5CASA 1GAGA 3KK8A 3BGPA 4HJOA 4YJSA 2UW7A 5AP2A 5DA3A 1WMKA 2R3JA 2QOQA 2VUWA 2A2AA 4FKJA 2RFDA 4F6WA 3U6JA 4ZSAA 4AOTA 5LWMA 3KVWA 4ZOGA 2UVZA 4K77A 3DLZA 5AM6A 4BDDA 1ZY5A 5CSHA 4PMPA 3F5PA 4PUZA 4ACMA 1T46A 3EN9A 4FTLA 4L45A 3TUCA 3GI3A 3ZM4A 1CMKE 3OY3A 3SQQA 3R7EA 5EH0A 4F1MA 3H3CA 4BIBA 4UZDA 3K3IA 5D1JA 2W1EA 3ETAA 3IGGA 3H9FA 3W55A 3BEGA 5EHOA 4HPUE 3V3VA 3R9DA 4BCKA 3G33A 4PTCA 2GMXA 4GK3A 2VWIA 5HO6A 4AA0A 3ZYAA 2HWPA 4G31A 1KWPA 3P7AA 3HUBA 4FL2A 3OCSA 4JIKA 5CZHA 4AQCA 3GC7A 3UOJA 4BCHA 4HVSA 4HVGA 5E8VA 4QO9A 3Q5ZA 3VBQA 3CS9A 1UWHA 4L01A 4RJ5A 4BDCA 4D2PA 5ICPA 5BX0A 4OTIA 5CT0A 3PFQA 1ZAOA 3Q3BA 5AP4A 3QTSA 4GW8A 2OJ9A 4G34A 4R8QA 4RT7A 3BV2A 5BYYA 2O65A 3BHYA 3RPVA 2PZRA 1LUFA 4L68A 1NY3A 2GFSA 5EYMA 1OM1A 4EH8A 1ZYJA 3D5VA 3R7IA 2B0QA 3MB7A 2ZV9A 5CENA 1Y91A 3O17A 3DU8A 1G3NA 4AE6A 4HNIA 5BVDA 1U46A 4A4OA 4AU8A 2BMCA 2CJMA 3ZRLA 3HP2A 2E2BA 2WTJA 5HESA 3QC9A 4C58A 4FTAA 2HY0A 2ONLC 3HVCA 4EL9A 3EKKA 1YOJA 4KBKA 4EH2A 5L8LA 2XNPA 4F4PA 4AW5A 3TM0A 2J0KA 2OIDA 3FMMA 4LYNA 5I0BA 4DA5A 3R1SA 2C0TA 4LOPA 4RIYB 2X7OA 4CQEA 3NW5A 4JX3A 2YAAA 3JPVA 5K0XA 3Q96A 4N6ZA 4HCUA 4O6LA 2WB8A 1JSUA 2P55A 3WE8A 3UZTA 1Q8ZA 3OG7A 3OXIA 4KRDA 4O38A 5AUXA 2VTTA 4FL3A 5ACBC 3MFSA 2OXDA 2PYWA 2Z02A 3C4CA 5L6OA 3CIKA 5EW8A 3FZPA 4UZHA 3JVSA 3A2CA 3FYKX 4FIGA 3GFEA 2R5TA 1YI4A 2WPAA 4ZTMA 3MY0A 5FWKK 4CNHA 2VO7A 3U6IA 2BAQA 4YO4A 3P9JA 1FMOE 4X21A 4ZSEA 4RWLA 1PXIA 5CAPA 4U42A 1OUYA 3OTUA 4E6QA 3EQCA 3ZBFA 3OD6X 4C34A 3KXMA 2J0IA 5LMAA 2BALA 4YU2A 3LKMA 5TOZA 2HZ4A 5E8WA 2XVDA 5IQDA 3UJGA 3EWHA 3SG9A 1ATPE 1M2QA 2IJMA 3NW7A 5ANEA 3OS3A 1KV1A 4PPAA 4DLJA 2WEVA 4L8MA 2QD9A 2JDSA 2JDRA 2JC6A 5AUYA 4CV8A 1H4LA 5CVFA 2UZWE 4KINA 3F2RA 4GT5A 4FKOA 1M52A 1QPDA 2QOHA 3RPYA 2JFMA 5HNBA 4DFZE 3OCGA 3F6XA 5I5ZA 3P78A 3PXQA 5BQ0A 1JBPE 3KXHA 2GQSA 5AAEA 4BF2A 1JPAA 4F0FA 3FI3A 3RPRA 3QL8A 3FMEA 3OW3A 3AOXA 3QXOA 3NUSA 4R3RA 3RHXA 5JFVA 5EK7A 5HQ0A 3C5IA 2WOUA 2HENA 2BRGA 4RJ3A 2UZBA 3FXZA 4AZFA 3E8CA 2GHGA 3QWJA 1QPJA 3COIA 4WKQA 1CSNA 3SX9A 1MQBA 4XG4A 4AT3A 3MY5A 4U3ZA 3GCSA 3ZSHA 4ALUA 3LCDA 4BDFA 3FDNA 4BWXA 4QMXA 3EYHA 2BTSA 4KABA 3EQRA 4RWIA 3V8SA 3S3IA 3KC3A 4MH7A 5DG5A 3DGKA 3DKGA 4NSTA 5JRQA 2VO6A 4EOLA 1JOWB 3D5XA 1HOWA 2R64A 4D4RA 1W8CA 3EQHA 3FKNA 4YTHA 3SOCA 4ZEGA 4A06A 1ZRZA 3VUIA 4JQEA 5AV3A 4RIYA 4RWJA 3H0YA 3WZEA 5IA1A 3DXPA 5J9YA 3M2WA 2GPHA 1H1PA 4KIPA 3DBFA 2VN9A 4F9AA 3GCVA 2LGCA 5IQGA 3E62A 4ZS4A 1K9AA 5A4EA 2GSFA 3TNWA 3R28A 3PE1A 4JBQA 3UIUA 1AD5A 2FA2A 4CVAA 2EB3A 3O2MA 4UV0A 2I0YA 2C68A 3UMXA 3TNQB 5IQIA 5E1SA 3ULZA 3EH9A 4BWKA 3HV5A 3KB7A 5KHXA 2WMVA 2P3GX 1PF8A 1GZNA 5CANA 1SYKA 3T9IA 1OBGA 4O0WA 3W2SA 4YGAA 3AQVA 2BPMA 1RDQE 4AA4A 1QMZA 2J9MA 5EI8A 3QRTA 3QTRA 1J7IA 4WNOA 3BRBA 3PJ3A 3HX4A 4J52A 4CZTA 5I9VA 4NL0A 2C4GA 3PVUA 5D41A 4YBKA 2J0MB 3CEKA 4QD6A 5HOAA 5K3YA 3SD0A 5I4NA 5LVMA 1Z57A 4WSQA 4QQTA 4E8AA 5BVOA 3TXOA 3AGLA 3PTGA 3BIZA 4YZNA 5B0XA 3UC4A 3ANQA 3O8UA 3DPKA 4CKJA 1RJBA 4FVQA 2YM5A 4G3EA 3W2RA 3LQ8A 2HCKA 5FLFA 3NNXA 5AFVA 4R1YA 2UW9A 2OFUA 3AGMA 3D7TB 4NFNA 2QOKA 3A8XA 3LFAA 3LFNA 2G15A 5L6WL 3DY7A 4L7SA 1WBVA 4YTFA 1PMUA 4Y72A 3CKWA 3G51A 3GU8A 3ZLWA 4A9YA 3TV7A 4O21A 2VV9A 2YJRA 3KXNA 1Q8YA 2Z7LA 3MPMA 3PVGA 3JYAA 4LOQA 4N0SA 4X3FA 4GK2A 4E1ZA 3WBLA 1V0BA 3NUUA 4C8BA 2PMIA 1LEWA 2RF9A 4XLIA 3Q60A 5DRDA 1H1SA 3QHRA 5HX6A 5T68A 4YZCA 2VX0A 1GNGA 4ZXTA 1XHAA 4J1RA 1L8TA 3OBGA 4M68A 4YHFA 3UPXA 1UKIA 1OPKA 3A7FA 3EZVA 4G2FA 5IQEA 4BI2A 2R7IA 4I6QA 3HMMA 3QAME 3WF7A 1Y57A 4AZSA 4DBNA 4YR8A 1ZYCA 3MVMA 4G6OA 3RNYA 2HZNA 4JXFA 3ERKA 5B7VA 4XG2A 3E7OA 4FGBA 1U59A 3SRVB 5E4HA 3ZHPC 3ZDUA 3PVBA 5DH3A 1M2RA 5LCJA 3D2IA 4PRJA 4OLIA 1WAKA 3RBWA 4ZJVA 4X6QC 5BMMA 3O50A 3GC8A 3N4VA 2E9OA 1YXUA 4F0IA 2OJGA 3I79A 4H3BA 3WILA 4S30A 3BHVA 2QU6A 3V8WA 5AIRA 4EOQA 4KUJA 4BTMA 2CHLA 1JKLA 4FIIA 3OT8A 5AUWA 1OIRA 4IMYA 4OR5A 4EZ3A 4CCBA 3V5TA 3ZO2A 3A7HA 3IOKA 5L2IA 3UE4A 4ANNA 3QF9A 4ZTNA 5F94A 5DBXA 3C1XA 3AC1A 3AD4A 3RAIA 3T9TA 3VJOA 4B4LA 4JBOA 4OUCA 3UZRA 5EDPA 3MA6A 1JWHA 3ORLA 3DAJA 1B38A 4L6QA 3QTIA 4RC2A 5CXZA 3MIYA 4R3CA 3QQJA 1ZXEA 5JGBA 2DUVA 3DCVA 3MPTA 4I4FA 4M15A 4MCVA 3K5VA 3ZZWA 4WNMA 3CP9A 4GSBA 4BZDA 4RX9A 3U9NA 4IEBA 3I81A 5EHYA 3QTUA 5KMKA 4QP9A 2CPKE 3UYTA 2OH4A 3GGFA 1PXPA 2H9VA 4YNOA 4ORKA 4NYEA 3NS9A 4MQ1A 4BKZA 3LQ5A 3NIEA 4ZZNA 3Q9XA 4FTIA 3SAYA 4XV9A 2ONLA 4OAVB 1Q5KA 4BDKA 3WF8A 3RWQA 4I92A 4O0UA 3IOPA 2QU5A 3GFWA 5HG9A 3OVVA 3Q52A 4FC0A 3DKCA 2IZUA 4BDIA 4IZ5A
chains in the Genus database with same CATH superfamily
4B8MA 3AC3A 5HBHA 3CD3A 2CGUA 4WBBB 5H8GA 3VBWA 2BCJA 3ZO4A 2J5FA 4YUQA 4E7WA 2WTKB 3R73A 4L52A 4BHNA 4C3FA 5HORA 2NPQA 4GIHA 4EHGA 4CKIA 2Q0BA 3LXKA 3QKLA 4EOIA 2I0VA 1OKZA 4EKKA 1U54B 2SRCA 2VTRA 4R5SA 5DI1A 5A6NA 4IADA 4LRKA 3UO6A 5E1EA 3FBVA 2EUFB 3BE9A 3TIYA 5CLPA 4TTHB 3SGCA 3WI6A 4YC3A 4GJ3A 2R3HA 2ITYA 4HPTE 5CAVA 5CU0A 5K4IA 1ZZLA 4IAAA 4IWOA 4XBRA 3L8XA 4AN3A 1IA9A 2B9HA 4FZ6A 1PKGA 5L2QA 2WIHA 1JKKA 3GU6A 3NLBA 3Q4UA 5DNRA 2E9UA 5DLSA 4MWIA 3P0MA 3FMLA 3C4XA 1B39A 3R1NA 2VTHA 5FRIA 4M3QA 3RCJA 2GU8A 1PXOA 3NDMA 1OUKA 2AQXA 3FLSA 4K18A 1MRYA 3R02A 3EQGA 1IRKA 5IEVA 2XK6A 1FVTA 4OGRA 4PTGA 4F9BA 1BL7A 4O4EA 3C51A 4QTEA 5M44A 5AP5A 1IASA 3ZS5A 3OWLA 3BPRA 4DEAA 5HTIA 2XA4A 4I20A 3PXFA 1PMNA 2XBJA 5AM7A 2PWLA 3HEGA 4FT0A 3SW4A 2W5BA 4W4XA 4EK8A 5L4QA 4O0RA 2I0EA 4MBJA 3R0TA 2QLUA 2ITOA 3EFWA 4QMPA 2B7AA 3S95A 3UQCA 3WZKA 2LAVA 3C0HA 2Z2WA 4MYGA 1V1KA 4NM5A 2X8IA 2X0OA 4DHIB 2F7EE 2BFYA 4QMYA 1XBAA 3R7UA 4F9CA 4IZYA 3UPZA 4X2KA 2C3IB 3KRRA 4ASEA 4RVKA 4C35A 4DEDA 3QCYA 3TN8A 4OTPA 4FNXA 4ANBA 4EHVA 1PKDA 2XH5A 5GIOE 2IG7A 4ZSLA 4NFMA 4YHTA 1KV2A 3LJ0A 5HO8A 3NYNA 3TG1A 2H96A 5DYJA 3R7OA 2G1TA 1W7HA 3QCXA 4H3QA 4LL0A 3HMOA 5BVFA 5JEBA 3K5UA 5E8YA 3D83A 4XG3A 3MFTA 4DFLA 2BDWA 4LQMA 2OSCA 3CQUA 4IAFA 3W0RA 2Q83A 5CSPA 2UVYA 3W33A 3GC9A 4AGDA 4E6CA 4IFCA 3E88A 4L67A 5KKRC 3VUDA 2QCSA 5FUTA 4RLKA 3UGCA 4YJOA 2XYNA 5EOLA 5ETCA 2OW3A 2YWVA 2AEGA 5JKGA 3IDPA 1H00A 5LOHA 4QRCA 5BUEA 3CSVA 3V51A 1J3HA 3BI6A 3GU4A 4FEWA 3KULA 2C6DA 3W1FA 4A9TA 3TACA 4U97A 4FRFA 5DT0A 3BZ3A 2YM4A 3KCKA 1KE7A 2QOCA 2RFNA 4RQVA 4F63A 3VHKA 3W8LA 4EORA 5HTBA 3DXNA 1BMKA 3NRMA 2X7FA 4AG8A 4YPDA 2GDOA 3G9LX 3KK9A 3O8TA 4MBIA 4JNWA 4YO6A 2BROA 5CT7A 3CTHA 4DFBA 5C03A 3FLZA 3JY0A 1UKHA 3POZA 3QRUA 4U7ZA 4YC8A 4H3PA 4DFXE 2QR7A 4EBWA 5IH5A 3SVVA 4QEBA 4IVCA 4PPBA 1XO2B 3JS2A 1UNGA 4BBEA 2ZMDA 3RAKA 3V5QA 4PDSA 1MRUA 5IDPA 3KIOC 3CJFA 1WBPA 5IA5A 4HW7A 3MW1A 1SMHA 3EN4A 3RAWA 2X8DA 5AAFA 4I0SA 4Q2AA 5JRSA 2WEIA 2Y4IB 1UNLA 3DTWA 3KVXA 3R04A 4NM3A 3EN5A 4PQNA 3KRLA 4MXXA 5ITAA 5LMKA 4J7BA 3F61A 4C4HA 5IISA 2W0JA 3PG1A 1H25A 2PL0A 3VIDA 3L9PA 3WZJA 2W1CA 5HEZA 1E1XA 1TVOA 3DKFA 4YSJA 5AA9A 4FYNA 2ITZA 4GS6A 3VF8A 3WZUA 3ORPA 3AT3A 3UTOA 4EK6A 4UMRA 3TKIA 4A9UA 4AT4A 2QOFA 2FO0A 1E9HA 1I09A 2VTLA 2ZVAA 1YHVA 3F88A 3OMVA 5AP1A 3EJ1A 4C7TA 2R3GA 4Z16A 4J8MA 4NJ3A 5AUZA 3UDZA 3ZH8A 3TNHA 2C5XA 4FMQA 4X2NA 3FZSA 1W2CA 3C4ZA 4K1BA 2XBAA 1M14A 4QP8A 3UYSA 4XH6A 1FMKA 1FQ1B 5CF8A 3VBVA 4JMQA 5HNIX 5AWMA 4WRSA 5J79A 1LPUA 4QP6A 2JLDA 2IZSA 4FKLA 3SW7A 4FG7A 5JZNA 2XALA 4USFA 4M13A 4ZSGA 1IG1A 2ITPA 4DLIA 3ZOSA 4MX9A 4KS8A 3SXSA 4CFXA 4RIXB 3VO3A 2JKKA 2XIXA 4F1TA 2PULA 4FJVA 1Q3WA 5A54A 1UU9A 2A0CX 3PE2A 4FF8A 1KE9A 1AGWA 3HA8A 4RVLA 2W4KA 2JDVA 4FKWA 1UU7A 2X8EA 3MH0A 3U51A 4ACHA 4D58A 1Q8TA 3F5GA 4YJTA 3BL9A 4FV3A 4I6HA 4DGOA 2HW7A 1Q24A 4ZMEA 4O7RA 4I5HA 4WG5A 1OL1A 2CGVA 2W1IA 2X0PA 1JKTA 3EN6A 4J97A 5DWRA 3ZFMA 1DAWA 5IZFA 2J7TA 2YM7A 4YLJA 5LWNA 3PG3A 4U41A 4FT3A 3A7IA 4G6NA 4GV1A 5DHJA 1V0PA 3HV3A 3PA3A 4J99A 3VBXA 2BZJA 2ITUA 4YLKA 3VAPA 4GFGA 3BU6A 3JVRA 4IDTA 4IM0A 4X2FA 3OWPA 1S9IA 3BBTB 3VRYA 5IH4A 4DCEA 3HAMA 3Q04A 4DT8A 3PSDA 2R2PA 3FI2A 4LMNA 5F9EA 2WGJA 3CKXA 3R8PA 4O7TA 2F2UA 3C4FA 4M0YA 2C6IA 1OMWA 3K3JA 2GQRA 3II5A 3KRJA 3QD4A 4AS0A 2BRHA 1IAHA 2CCIA 4JDHA 4ZSJA 5HHWA 1RE8A 4MBLA 5JZJA 5KZ0A 3QTZA 2PZPA 4HCVA 2O8YA 2O64A 5F1ZA 5M4FA 4KKHA 2OG8A 3KXZA 1W2FA 1O6KA 2C1AA 4YJPA 3B2WA 5F95A 3RNIA 3KKVA 3FQHA 2ERZE 3PJ2A 1XWSA 4UN0C 4MWHA 4FSWA 5HE1A 4FTQA 5EQYA 1SNXA 3VUTA 4O7ZA 3BHHA 3QQFA 2X6DA 4I21A 3TJDA 3R22A 4EZ7A 3T3VA 4EI4A 4DHZA 4K9YA 4YJUA 1LEZA 3BYSA 4NH1A 4GT4A 4IM2A 3I0QA 5AR2A 3I7CA 4QMOA 1F5QA 4UMQA 5AV2A 4C0TA 3NGAA 5IPJA 3UIBA 4XEYA 4ALWA 4BGHA 5I9UA 1OVEA 1EH4A 4M97A 3HUCA 5KBRA 5GJFA 4A4XA 4E20A 3E3PA 4KKEA 5G1XA 1W83A 1H8FA 4JLCA 1PXNA 2PE2A 2UW3A 3O5AA 4U3YA 3PDTA 1T45A 4FIHA 5CZIA 2ESMA 2R0IA 3TT0A 4FEVA 4TY1A 4G3FA 4E93A 4NIFA 1ERKA 4XP2A 3D7ZA 4KSPA 4E6DA 3GT8A 4R5YA 4EYJA 4MF0A 5C1QB 4E4LA 2R7BA 2OXXA 3KXXA 1Q4LA 3TEIA 2ZAZA 1K3AA 4EJNA 3HA6A 3DQWA 2W1GA 2BRBA 3E8EA 2HELA 4NCTC 4WA9A 4BCFA 3QYWA 2J0JA 5DMZA 4YZBA 4OBOA 3NNWA 4M69A 3RZFA 4O0TA 5FP5A 3S2PA 4O7NA 1Q99A 5KMOA 2GS6A 4D4YA 2B9FA 2E9NA 2ZV2A 5AR3A 3R7VA 4AW2A 5IA3A 1REJA 2F9GA 2J90A 3E87A 1CKIA 3UIMA 4MUQA 4NWMA 5C4LA 4ZY6A 2QKWB 4WNPA 3DBCA 5AP3A 3G9NA 2R3MA 3R63A 5HVJA 3OXTA 3EYGA 3B8RA 4TT7A 4W9WA 3A61A 3ALNA 2J51A 3I7BA 5C01A 1FOTA 4CTBA 3NFFB 3B8QA 2AC3A 5KBQA 4EOOA 3PP0A 4M8TA 2Q0NA 3UVPA 5M55A 3E8NA 5C26A 2OWBA 3G5DA 3CY2A 3QZIA 5FDXA 3TTJA 1UVRA 5B2KA 4BKJA 4QP1A 4EEVA 5CEKA 4O81A 4FEXA 3R8ZA 3DK7A 3D0EA 4FBXA 3KMMA 2VTAA 4I6FA 4MD8E 1FVVA 2JAMA 4IW0A 4N4SA 4EOJA 3QXPA 4P90A 4G3GA 5HKMA 3KL8A 3UOKA 5CVGA 5E91A 3WF5A 1YWNA 4MXOA 2YZAA 4MXYA 3O7LD 4BTJA 3Q2MA 1YKRA 3LXNA 1G8AA 1OL5A 1XH5A 2YAKA 4FKIA 4JBVA 4QMTA 4UB7A 3THBA 4I5CA 1L3RE 4FZAB 3MJ1A 4XCUA 3FEGA 4KAOA 3A8WA 2QO2A 4O2PA 2ZDUA 3IECA 4Q5EA 3U55A 1U4DA 3UG2A 4EQMA 4I93A 2R3PA 4B8LA 2EVAA 1SVHA 3BYVA 2CKQA 2XIKA 2BIYA 3QCSA 3VUKA 4BDAA 4LGHA 4GVAA 4QP3A 4CFMA 4CRSA 3UQFA 3SXFA 3U6HA 2ZOQA 4XP3A 2WMSA 3A99A 5IUGA 2UZNA 4HZSA 3BHUA 1G8KA 1ZMVA 1H01A 3NUNA 3ENMA 3OT3A 2YIXA 5CVHA 3MH2A 4GFOA 5T3QA 4Y46A 3DBDA 4WD5A 5G6VA 3BBWA 1K2PA 5HCZA 3NCZA 4DH7A 1O6LA 3G6HA 5FTOA 2VNWA 5M53A 2HXLA 5EM8A 4CV9A 3TZ9A 1PMVA 4KB8A 2UZDA 4KIQA 3DXQA 4CGAA 3E5AA 3TIZA 4KIKB 4F64A 3WIGA 4ZS0A 3QGWA 3HMPA 2OK1A 5EW9A 5EQEA 4YHJA 1OIYA 5CQWA 2ETRA 2X7GA 4F9YA 3KRXA 2WMBA 1YDTE 2XNBA 3S1HA 5DE2A 2UW6A 3P79A 4G3DA 3RKBA 4FKTA 4O7WA 3H30A 3QUEA 4QTAA 2YABA 3F9NA 4QMWA 2CSNA 2HK5A 4J98A 3RHKA 1YI6A 3QALE 3R71A 5I9YA 3TDVA 3UDTA 5FM3A 4GRBA 2W1HA 4EBVA 5KMIA 3DS6A 2V7AA 4FSNA 4JDJA 4BYJA 4FICA 3BGQA 3L8SA 5ETIA 2HOGA 5C27A 2C6KA 2G2IA 4O7VA 2BHEA 3VULA 3AC2A 2EU9A 4F99A 3RPOA 3E64A 4R3PA 3VN9A 3WIKA 2OLCA 2VO0A 4JDKA 4N57A 5IG1A 3DTCA 5ANKA 2WTWA 4YTCA 2Y0AA 3Q53A 3FL4A 2WNTA 3P08A 3UO5A 2R3OA 4X3FB 5EDQA 1YDSE 3C7QA 3ORNA 4JVGA 2ZM4A 3GQLA 4EC9A 4AFJA 4CCUA 2Z7SA 4CT2A 2CN8A 2F7ZE 4N6YA 4YJNA 3NYVA 2BZIB 5CEMA 1GIHA 4DF3A 3V6RA 4IJ9A 4CKRA 3QRJA 3FI4A 4EH7A 1NT2A 1OBDA 4LV5A 4WT6A 5T6KA 5GZ8A 4QMUA 5KMJA 1B6CB 4RC3A 3CJGA 4JRNA 5GJGA 2XMYA 3ZXZA 4LFIA 3V6SA 2IF8A 2OH0E 3NYXA 2BDJA 3UBDA 2XIZA 3IS5A 3GBZA 2WFYA 2W05A 4PL5A 4L42A 3FPMA 5HD7A 4BDHA 1OZ1A 2HY81 4AW1A 4DGNA 4AF3A 1RW8A 3VS1A 1YOLA 3OUKA 4IX3A 4MTAA 3CC6A 3D5WA 4AN2A 4FK3A 2ERKA 5HNGA 3L9MA 4GG7A 3L8PA 3F7WA 4FKRA 2IN6A 2PZYA 1S9JA 3A62A 2HWOA 5DFPA 2RIOA 4C59A 3CGOA 3VUHA 2WU7A 4XOYA 4AX8A 5AA8A 3DDQA 4AOIA 4XRLA 3AMBA 3DB6A 4EOKA 5L8KA 4FTTA 5IDNA 5CQUA 5LQFA 4KIKA 3HMIA 5IF1A 1ZOGA 2EXCX 1WVYA 3ZSIA 2VWYA 3CTQA 4GU9A 4RFZA 4S31A 4CLIA 3FMDA 4DG2E 2PUNA 2O3PA 4D4SA 4YZ9A 3NAXA 3GOKA 4ERWA 1HCKA 4G5PA 3UZPA 4YJQA 3EFJA 3EN7A 2FB8A 1YQJA 1QPEA 3RINA 2CGWA 1GOLA 4Y5QA 1H27A 1H1WA 2G9XA 3QBNA 4XNEA 1Q62A 1APME 4TWCA 4J95A 5JFXA 4GT3A 4IAYA 2YHVA 3P5KA 4DINA 1SNUA 4M12A 4EOMA 2JGZA 3IDBA 4JG6A 4QQJA 2C6EA 5LARA 1YOMA 1JVPP 2YLFA 2FSMX 4AFEA 3IW5A 4DC2A 3VBYA 3LM0A 4U8ZA 1RQQA 2HZIA 4IB5A 1XQZA 4QMNA 2WELA 3Q2JA 2PTKA 3V5JA 3VQUA 2BILB 3E8DA 3EQBA 5BVNA 2VTSA 3VHEA 1OL6A 1Y6BA 2P2IA 1XJDA 5BYZA 5FTQA 5D11A 3CPBA 3FZTA 4C3RA 4IQ6A 3LW0A 4ACCA 3ODYX 3W0PA 5EM5A 2XCKA 5DRBA 3BHTA 1UNHA 2CCHA 3RP9A 4RJ4A 3GC0A 3ZCLA 1ZYLA 5M4CA 4IAIA 3DNEA 4WIHA 3RGFA 3U9CA 4V0GA 4D5KA 3F2AA 4EH4A 1FINA 5I3RA 3MDYA 4FOCA 2C0IA 2ITTA 3AMYA 1A48A 4ZY4A 1YHSA 4ZZOA 4XYFA 4MEDA 4Y73A 3DKOA 4LRJA 3Q32A 3R2BA 4C2WA 5BVKA 4BBMA 4RIWA 4O0VA 4GKHA 4JR7A 2QODA 4FSMA 4WSYA 2XKDA 2PUIA 2JIUA 4TXCA 4AGUA 4YNEA 4NCTA 3RK7A 4B9DA 1NW1A 3ZO3A 2CKEA 3AD5A 2XNOA 3K54A 5K0KA 2ZM1A 2XP2A 4F78A 4DG0E 4RFYA 2ZFYA 3L8VA 4MHAA 4BCQA 5IUHA 3F3UA 3JXWA 4X6RA 4HVHA 4E4XA 5CSWA 1M7QA 5FD2A 2VX1A 2A1AB 3RM6A 3ULIA 3PY0A 5FDPA 3C0IA 3VS2A 1PW2A 1PYEA 3QKKA 2J4ZA 4C4IA 2UZVA 4K2RA 4KIOA 3ZC6A 5EM6A 2XEZA 3QGYA 4U0IA 1J1CA 3RWPA 3WF9A 2W06A 3UNZA 4BY9E 1Q8UA 2R3IA 3FUPA 3DJ7A 5M56A 2IVTA 3PWDA 1DS5A 1P14A 1VEBA 1OITA 5HIDA 2UV2A 3TV4A 4LUEA 4D9UA 4FNYA 3RM7A 4FK6A 2OXYA 3LMHA 3TYKA 3I5ZA 2Z7QA 3BLRA 3QQKA 4FV9A 4FA2A 1URCA 1YI3A 3PXYA 2ZYBA 3JR1A 5KE0A 3IO7A 4U40A 5J5SA 5L8JA 3HZTA 2WQBA 1YXXA 2Y9QA 3N4TA 4MNEA 2B52A 4NW5A 3TMOA 3QFVA 1BYGA 4TYEA 4CD0A 1PXMA 1XH7A 3OFMA 4LMUA 4AXEA 4EH9A 4DH5A 4DCAA 2BRNA 1UWJA 5J9LA 5HX8A 4JQ8A 4D5HA 3BLAA 2XAMA 2YLEA 5KNJA 3PPZA 5FEQA 3DZOA 2J50A 4L3JA 2YCQA 5BMSA 2B9IA 2XIYA 4FTMA 4MXCA 4JX7A 2G2FA 3GCPA 1IAJA 1JAMA 5GHVA 2C5OA 2WKMA 4D2TA 3ZEWA 3I4BA 4IACA 4F6UA 5K4JA 1OL2A 3G0FA 4I0RA 5HI2A 5BYLA 2B54A 3KY2A 2P4IA 2QNJA 3GEQA 3OCTA 2OIQA 4XG7A 3FY0A 5LVPA 1VLRA 5AP0A 4RVMA 5C4KA 5ETAA 3VS5A 3OW4A 3EL8A 5AV0A 4UWBA 4YC6A 1SM2A 2BUJA 4USEA 4UX9A 2Y4IC 1SVEA 4FI1A 4CMUA 1W84A 3DZQA 5DN3A 5JSMA 3W0MA 2W9FB 3OOMA 1GZOA 1R3CA 1CKPA 5CNNA 3SXRA 5DR9A 5GZAA 2UW8A 4QYGA 4ANMA 5ANOA 3KULB 4I22A 4B7TA 3UVQA 1OKYA 1AQ1A 4PMSA 4QYFA 3TNPC 3P86A 3ZC5A 5HBJA 4BIDA 4TWOA 3ZDIA 4OTFA 3COHA 5IMEA 2F2CB 5LVLA 1U5RA 3FPQA 5TF9A 3MJ2A 4DGLC 2WTIA 2UZTA 1H0WA 2YCFA 3KCFA 5EYDA 2Y7JA 5AJQA 3Q6WA 2CNUA 4F0GA 4R77A 2XB7A 1REKA 4AE9A 4FV6A 4TW9A 2XK9A 2O2UA 5FQDC 3QTXA 4F08A 4XJ0A 1CM8A 4EH5A 2WQMA 3VS6A 3CQEA 2YERA 5A46A 2GHMA 3PJ8A 4EQCA 2HYYA 5HTCA 5JN2A 2B55A 1G8JA 4GYIA 3UNKA 2WMUA 4OBPA 2WQNA 1WBOA 3OZ6A 3LLTA 3LXLA 3VUGA 5AEPA 3PXZA 1GIJA 2C69A 4I41A 5H9BA 5FBNC 5FEEA 4ACGA 4AUAA 2XYUA 5EHLA 1ZY4A 4R1VA 4BIEA 4DFNA 3V8TA 4APPA 5KO1A 4N70A 4GG5A 2R3NA 4C57A 4EOSA 4HGSA 4EUUA 4M7IA 4D1SA 4EKLA 3COKA 5KMNA 3ROYA 3DDPA 3QZGA 3I60A 4TWNA 2C5VA 2ZB1A 3Q4CA 3QUDA 3SOAA 4UBAA 5HG7A 3TL8A 3R9RA 4PMMA 2WQEA 2F7XE 3PJCA 4FOBA 4X7QA 5AP7A 5HG8A 4BCNA 4FKUA 4F65A 5CY3A 3NR9A 3LQ3A 4E5WA 4BN1A 3FQEA 2OBJA 3TCPA 4AAYA 2WTCA 3LJ1A 1G5SA 4NUSA 3PVWA 5HCYA 4O0YA 3C13A 2E9VA 3FLYA 4PF4A 5BVWA 4U80A 5BNJA 3MA3A 4FX3A 3ZM9A 3P7BA 1J91A 2IVSA 3QQLA 3F66A 4BCOA 4GFMA 4F9WA 4GIIA 3OOGA 1ST4A 3TZ8A 4D4VA 3EL7A 4FTJA 5BPYA 3FYJX 2PE0A 5LCKA 5EKNA 4PDYA 3HRBA 2F4JA 4P7EA 2IO6A 4M66A 4Q9SA 2CNVA 1X8BA 2DQ7X 3R8VA 4D2SA 3FMKA 3AC5A 3D15A 3FAAA 3NPCA 1R0EA 2RGPA 4RQKA 5EQPA 5DEWA 4PTEA 4F70A 5AV1A 5J5TA 1M2PA 3QRIA 4LM5A 3HRFA 4CYIA 1ND4A 2YA9A 3DJ5A 5CSXA 4Y83A 4ANLA 4FT9A 4G5JA 3IW7A 4KNBA 3HV4A 2FUMA 4EK4A 4IC7A 4ZTSA 1OPLA 2UZEA 4EWQA 4FIFA 2BZKB 4ITHA 3GP0A 5TR6A 3DJ6A 4USDA 4FTUA 5J8IA 3HV7A 5F20A 4X0MA 4IVAA 4HGLA 4O91A 2GS7A 1LR4A 3H9RA 5L2TA 3R9NA 3LFCA 4Y95A 4DH1A 5B2LA 5JH6A 2WQOA 3DLSA 2JKQA 2PVMA 1KE5A 2J2IB 5TO8A 2PVNA 4WHZA 3FKLA 4KWPA 3PA5A 2YDIA 1FGIA 4FV4A 4B6LA 2RL5A 3PYYA 4HYSA 4U81A 2J5EA 2V62A 2XKEA 4O7YA 2EWAA 4O7LA 1FGKA 3D4QA 4AAAA 1UU8A 2PUUA 1ZMWA 1YW2A 2JKOA 2QONA 3R6XA 3MVHA 4DG3E 4FKQA 3R00A 3N4UA 3OBJA 1NVRA 2VAGA 2JDTA 5HE0A 5K5XA 4QDEA 2XRUA 4C02A 4M67A 5AX9A 3R7GA 3RALA 2DWBA 3F3ZA 2BHHA 4I24A 4WOVA 4BJJA 4BTFA 4AOJA 3LOKA 3Q5IA 4KSQA 4CQGA 5FEDA 3PLSA 3SA0A 3MSSA 2H34A 1WCCA 2ZJWA 5HU9A 2BZHB 3AT2A 4GEOA 4XG6A 3VUMA 1IEPA 5JGDA 4RIOA 3FHRA 1KE6A 4U44A 2GHLA 2BR1A 3EMGA 2WXVA 4PY1A 1KOBA 3WYXA 2OFVA 3LIJA 5HLNA 3HDMA 4AGWA 4DGMA 4RJ6A 3DA6A 2R3RA 3H9OA 4NTTA 4ZJIA 4GH2A 4UYNA 4PNKA 3HAVA 4RA5A 2PVLA 4DTKA 2OIBA 3D14A 3DQXA 4OAUC 1R1WA 3FZOA 4V01A 5IEXA 2KULA 1G8SA 5HLWA 4JAIA 3L9NA 4OTHA 3ATTA 3PP1A 5ANDA 5E8UA 4RLLA 4O82A 2VU3A 4PNIA 2IWIA 3A7GA 4IAKA 4GVJA 5E90A 3R8LA 3ACKA 1OGYA 4NIFB 3HRCA 4FV5A 4ZLZA 4J96A 2PPQA 4MXZA 4UYAA 3OROA 3R9OA 2W1ZA 5ANGA 2PVJA 3QU0A 4L43A 4IAZA 4R7HA 4IANA 3UO4A 4YSMA 4RX7A 4BHZA 3TZ7A 4C4GA 3QX4A 4IBMA 5KHWA 2YFXA 4JJRA 1UV5A 3BX5A 1TQMA 2I40A 4DT9A 2VWXA 4KS7A 4IH8A 2QLQA 1MUOA 3LPBA 4M69B 4QMVA 4E3CA 2PE1A 4NK9A 2GNLA 2ZV7A 4FR4A 3BEAA 3BELA 3GXLA 4I5MA 3RCDA 4CG8A 4A4LA 2PMNX 1XH8A 3IW8A 4Y8DA 4DFYA 3NW6A 4H36A 3FC2A 3MV5A 1O9UA 3FWQA 1OL7A 2C3JA 4NT4A 3RAHA 3BLQA 1Q8WA 5BUJA 4XLVA 1ZMUA 2O63A 3SDJA 4E73A 3NYOA 4XV2A 3TDWA 5L3AA 4FSTA 5M4IA 4U5JA 3ET7A 2G2HA 4IZAA 4CRLA 2XUUA 2VTMA 2WMWA 3RK9A 3A7JA 1BI8A 4FSQA 4O27B 2W99B 2X9EA 3I6WA 2R4BA 4PMTA 4ZIMA 4BDJA 4BICA 4EHEA 2R3QA 2WO6A 2FGIA 3FLNC 4S32A 3L9LA 4J53A 2X9FA 2VZ6A 2W5HA 4Y85A 4C4JA 4CG9A 4Z55A 4NJDA 1QL6A 1BKXA 4W4VA 5E8XA 4AXAA 4B99A 4E6AA 1J7UA 2WTVA 3OWKA 2JFLA 1GZKA 4APCA 5HD4A 1OGUA 2RFEA 3PSBA 5HICA 2C6OA 3NNUA 4YJRA 5GIPE 4D2WA 2QG5A 3O96A 5AR7A 4AGCA 1FPUA 4O86A 1BX6A 5BV3A 4C2VA 2W1DA 2QHNA 2ITNA 1IA8A 3DOGA 3RJCA 3D94A 5KKRB 4A7CA 4ZTLA 5H8EA 1ZYDA 2F49A 3BU3A 4PDPA 4S2ZA 3CPCA 3LLAA 4JOAA 4FUYA 4QNYA 2UUEA 4TYGA 3LXPA 3QTQA 2QQ7A 5D7VA 2WOTA 3V04A 1W98A 2JIVA 2WTDA 3ZXTA 4E4NA 2VX3A 5J9ZA 2OGVA 3GOPA 3T3UA 1W2DA 4MQ2A 3UOLA 2XF0A 3UC3A 4E5BA 2OZAA 2JAVA 4UWCA 3WYYA 1JNKA 4G16A 4P5QA 3C50A 4TNBA 2V22A 4QYEA 3AC8A 3O71A 4UALA 4AP7A 3VS3A 3PA4A 4QTCA 4QMSA 4FV7A 1KSWA 2PY3A 4IVDA 4W4YA 4O4DA 5CTPA 3ZLYA 3COMA 3CQWA 5EI2A 4ENYA 2XAOA 2VWBA 2Z7RA 3D2KA 5AMNA 3CY3A 3P1AA 2HAKA 4HZRA 4U9AA 4IB0A 3M1SA 3O23A 4PL3A 4GMYA 4EUTA 3LJ2A 2VGOA 4AXDA 3ZLSA 3QX2A 4QQCA 5HO7A 3MFUA 4DEIA 4R7BA 5FG8A 4FEQA 3EQDA 4C3PA 4XS2A 3ZFYA 4X3FC 4IVBA 4YMJA 4ZJJA 4W9XA 4BVUA 1NA7A 4D0WA 2XK3A 5AR4A 1NVQA 4FSRA 2UZLA 2R3KA 2BAJA 5M08A 3NUYA 3BU5A 2W7XA 4TYHA 3VQHA 3AD6A 3FXWA 4BTKA 1H26A 4QPAA 4S34A 4BI1A 5EM7A 3U4UA 3ZFXA 4R7IA 5J7HA 4ZK5A 5A4CA 3FXXA 2YIRA 4G9RA 2HZ0A 4DYMA 2BAKA 5ETFA 4EWHA 1GY3A 4OTWA 4ID7A 4KBAA 2C5YA 3R7YA 5A4TA 2P2HA 3IPHA 2XK4A 1YXVA 1OKWA 3Q9WA 4J8NA 4YPSA 4JI9A 1I44A 3I5NA 2BDFA 4FL1A 4EOPA 3VF9A 1XKKA 3C4EA 2DYLA 2Z60A 3KMUA 4I23A 2W17A 4XOZA 5E9EA 2X0QA 4GJ2A 5DR6A 4BCJA 1JKSA 4P5ZA 1A9UA 1M7NA 4LOOA 4DTBA 4H39A 4IIRA 4XV1A 3ML1A 5IU2A 2PMLX 4NKSA 4HYIA 5K5NA 4Z3VA 1YVJA 4TNDA 3MESA