3C5UA

P38 alpha map kinase complexed with a benzothiazole based inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
349
structure length
338
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzothiazole based inhibitors of p38alpha MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 97
structure length 338
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c5uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c5uA01
4TYIA 4BKJA 5LWNA 5HESA 4W4VA 2YCQA 4W4YA 3NVMB 2GQGA 3TZ9A 3GI3A 4O7VA 1UU9A 4RC4A 2VD5A 5J7HA 4EZ3A 2XIKA 1VR2A 4NM7A 3UVQA 3QD3A 3NW5A 5EFQA 3GCVA 3PP0A 5EG3A 1HCKA 5L4QA 4FTKA 3FZSA 4MH7A 3IGOA 1CM8A 4PL3A 4RJ5A 1Q61A 3VW8A 4E1ZA 3E87A 3OD6X 4AT4A 5I9YA 3V6SA 4QMVA 5AR8A 3U6IA 3I4BA 5EKOA 5CI6A 1OBDA 3MFUA 4AGDA 4NTTA 3TNPC 3O96A 3K5UA 3OHTA 2XYUA 4LMUA 4AX8A 3V5WA 3ZS5A 5DYJA 2XKDA 2CHLA 1OB3A 1ND4A 3WOWA 2Y8OA 3R02A 1OZ1A 4WIHA 3FL4A 3K3IA 2QU5A 3GCUA 2YHVA 5ETIA 1PKDA 3FXXA 2YWPA 1NVSA 1GNGA 5HLPA 1AD5A 3O7LD 5CU2A 4CFVA 5AV4A 4USEA 3QLFA 4WOVA 2V0DA 4I5HA 2CNUA 1H25A 2UZLA 4KIQA 3ZO2A 4U6RA 4FNZA 5M51A 4EKKA 4U80A 2UZDA 2E9UA 4EHZA 2YZAA 2GFSA 2FVDA 3ZFYA 2XNNA 4DH5A 1YOLA 3LCSA 4X3FC 3SC1A 4WG3A 4TYEA 1OPKA 3FI3A 4XMOA 4F1TA 4ALVA 4DGOA 3V5JA 1YQJA 4FIFA 3GGFA 2Z7SA 1GIHA 3M1SA 3Q32A 4IX4A 2AC5A 4F6WA 5C9CA 1FPUA 2QG5A 3MJ1A 5EW8A 4CGAA 1WMKA 2XJ2A 3VBVA 4YUQA 3GB2A 4MBLA 3C7QA 2QOBA 2R0IA 3WIKA 3OFMA 4QTAA 5EI2A 2XM8A 1FMOE 4CNHA 4EYJA 4C36A 4AE9A 3F82A 2JIIA 4DEIA 1GZ8A 4BDKA 5HTIA 1UU8A 3R71A 3PG3A 2CPKE 5FTQA 4AP7A 4MNEA 4UMQA 3KXMA 3M2WA 1XWSA 4GVJA 4MXZA 4FSUA 4R3CA 2IW9A 3UVPA 4U43A 1B38A 3NCGA 3W18A 3VWAA 4F9BA 1Z5MA 4C37A 2YA9A 3CQUA 4AACA 1U4DA 4UV0A 4G6OA 4TYJA 4EQMA 1J7LA 3MPTA 5DEYA 3ZC5A 1R1WA 1UNLA 2VWUA 4IAZA 5CU4A 4AGUA 3A99A 3WF8A 5A4EA 4EH3A 4L6QA 3KF7A 4QTCA 3AC4A 3TXOA 2J5EA 5JMSA 3IGGA 3DJ7A 3ZRMA 5C4KA 3BHTA 5DR2A 4KSPA 5HICA 3ZLSA 4BTMA 3FHIA 3SXRA 4QP6A 1M17A 2R3QA 3Q52A 3ZU7A 3UPXA 4FG7A 3W2OA 3ANQA 1YW2A 1J1CA 4ACDA 3VVHA 4FZAB 2VWXA 3HAMA 4BBEA 4I22A 4D0XA 4CT1A 3L8XA 3CR0A 2XUUA 4AN9A 3L9NA 5DFPA 5C4LA 3EZVA 4G6NA 3CY3A 3FEGA 1XBAA 1Z9XA 1OITA 3LJ2A 2QR8A 4PWNA 2LAVA 4BCFA 5GJGA 1WFCA 1KE7A 4FVRA 4FKIA 1YXUA 3ZLWA 5LJJA 3UNKA 3IDPA 3HDNA 3VNTA 4FSMA 4K8AA 4EBWA 4IC7A 1P5EA 5M4IA 2PMLX 2VUWA 5DVRA 2PYWA 1JKSA 4PMMA 1TQMA 3MIYA 4WSYA 5FXQA 1DS5A 5J95A 5DT0A 1PXNA 2W5HA 3D94A 4IVDA 4RX5A 5H8BA 4QMMA 2UZBA 3TN8A 4DGLC 3OWLA 3FL5A 3CGFA 3IDBA 4D9UA 2PWLA 3TCPA 2BRGA 5IQAA 3D7TA 4WG4A 4ZJIA 5EM5A 4AZWA 5IA4A 4F99A 1A06A 5FXSA 5AP3A 2J9MA 2WMQA 3S0OA 5IQBA 3PZHA 4JJRA 4UMTA 2OH4A 4O7NA 4DFZE 4E6CA 4RLLA 3UGCA 3IO7A 3K2LA 3QTQA 5BUJA 1ZY4A 3QX4A 2OZAB 5LVLA 3D2IA 2WMBA 2E9PA 3WILA 3CCNA 4ANMA 1H8FA 4I0SA 4RQKA 3R8MA 4LG4A 1H27A 3QHWA 4K33A 2C3IB 2BR1A 3BE9A 3JPVA 2X7FA 2C5XA 4JIAA 4QP9A 3H4JA 2QO2A 3LOKA 5A4QA 1M2PA 4ZTQA 3IDCA 1OBGA 5JZNA 2HY0A 4IZAA 4ZEGA 1ZAOA 1R3CA 4G3EA 4S30A 2VAGA 3IG7A 4EK5A 1UWHA 2A4LA 2CJMA 4J8NA 5DHJA 3ZRLA 3RINA 4JRVA 1LPUA 4NWMA 3DTCA 1KV2A 4MWHA 4OTIA 4L01A 3F2RA 5I3RA 3E8NA 4FT0A 1JKLA 4J97A 4QQ5A 3D2KA 3VC4A 4NCTA 4FKRA 5IZFA 3UOHA 3SD0A 1IR3A 2GS7A 2WOTA 4MKCA 3RMFA 2QHMA 1RDQE 1SYKA 4OUCA 4HVSA 3UO5A 4DCAA 4YO6A 4E7WA 5CT0A 4O1PA 3DAKA 4YMJA 4C0TA 5CAPA 4YTIA 2E9VA 5I5ZA 3VBWA 3R83A 2YABA 2XNBA 2F49A 4QMWA 3Q5ZA 3BRBA 3DLZA 4O82A 5L8KA 5FLFA 4RJ8A 3IQ7A 1YWVA 4ACMA 1HOWA 4IACA 4LGGA 4ZSGA 5HO6A 4ANQA 4WG5A 4G17A 4OAUC 2BILB 3KRWA 4U45A 4ACHA 4C4EA 3U6HA 3PXZA 4XV3A 3AG9A 4B99A 4BWPA 3O0GA 5E9EA 2YN8A 5CNNA 1WBPA 2YACA 4GL9A 2ITYA 4YLJA 5ANJA 5JSMA 3WIGA 4FTCA 5M4UA 3IONA 4AN2A 4OAVB 4BF2A 3FJQE 3WARA 1U59A 3PE2A 5BVEA 4JBOA 2YDJA 5CZHA 1KWPA 1Q8UA 3M42A 3TJDA 4BIEA 4D2VA 4I3ZA 5EDRA 2XYNA 4BDJA 3BV2A 4GK4A 4IAKA 5HLNA 3MH2A 2XBAA 2P33A 1B39A 2DQ7X 4CQEA 1PF8A 4BCNA 5IUIA 2UW0A 3DXQA 4CZTA 3HMPA 3FLWA 3W33A 1M2QA 3Q2JA 4D28A 5I9WA 2C5VA 5B7VA 2Y9QA 3W10A 3EL8A 3U6JA 4BYJA 2GFCA 2BRNA 4GJ2A 5IQEA 4A06A 2GNIA 3EWHA 3FC1X 5BVWA 3DAJA 3LFAA 3HL7A 3LAUA 3HRFA 4BDIA 1GZOA 2R2PA 2QOOA 2XNGA 3D4QA 4A9UA 4BTKA 4GT4A 1VYWA 3HMOA 4EJ7A 5IQHA 4XG7A 4G34A 4FV0A 3ZMMA 4NM0A 2BZJA 4BDGA 3VS7A 5IUGA 2JKKA 4XRLA 3PZEA 4F9AA 5EQYA 4FSTA 5JH6A 5FEDA 4NKSA 4TW9A 3UYSA 4EONA 4EH5A 5B2LA 4Q5EA 3SW4A 4JLCA 4NL0A 2R3NA 3PVGA 5ANGA 4TKSA 4B9DA 1U46A 5GHVA 4EK8A 4C58A 5KZIA 5L8JA 2VGPA 4FV6A 4O0SA 3RAKA 3RCJA 3RCDA 2JAVA 3FKLA 2R9SA 5FD2A 4L45A 4BCOA 4LRKA 4C8BA 2XZSA 2WTKC 4OTFA 2XP2A 4U0IA 4E73A 2LGCA 4V05A 2VTPA 3QTWA 2YIRA 1E9HA 2ZV2A 4D1ZA 3I5ZA 3R04A 4XG6A 2HWPA 3R9DA 4YJTA 1KE5A 3CGOA 3OCBA 4FYNA 2A1AB 1NA7A 1R0PA 4ONAA 3WF5A 5F9EA 4KS7A 1IA8A 3WZKA 3DKGA 2PMNX 2WMSA 3FQHA 2HELA 3LQ5A 3D5UA 4CLJA 3QX2A 3TTJA 4G3DA 2R3IA 2F2CB 3ORTA 3POOA 4RIOA 4H39A 4IWOA 5A9UA 5CF5A 5FTOA 2YM5A 3PXFA 3D0EA 3W2QA 4UEUA 4EOMA 4Z16A 4RIWB 3DZOA 5A3XA 3ATSA 1PXOA 3EMGA 3VUTA 3GU6A 3NUUA 3RM7A 2Y4IB 1K9AA 1W0XC 3T8OA 4CZUA 5CZIA 4IJPA 5BYZA 4W8DA 3T3UA 4G3GA 1OECA 4P90A 3VS2A 3Q04A 3O2MA 3PWDA 3G0FA 2DWBA 4FZFB 2VWBA 4X6RA 4KBKA 4CZYB 3NPCA 4K2RA 4CCUA 3BYOA 2G2IA 3DBCA 4YJVA 5E8TA 2WTKB 4KD1A 3U4UA 4O6EA 2XVDA 2GHGA 5DI1A 5HVYA 1X8BA 5CALA 3KU2A 4A9RA 1MRUA 3GBZA 2WTVA 4ZTSA 3SOCA 4AT5A 1WBTA 2ZM3A 5AP5A 3C4XA 4YJUA 4Z7HA 4IB0A 4JRNA 5L2QA 3KRRA 3B2TA 3D14A 2WTDA 4FNYA 4YGAA 5B0XA 4NIFA 1PRYA 2GQRA 4DTAA 4U41A 3AOXA 5CSVA 3UTOA 1G3NA 3QHRA 2W1ZA 4DTKA 3DB8A 4QQJA 2VNYA 4O96A 2VTQA 3LMGA 4CFMA 3UYTA 3TUCA 2A27A 2YERA 3DS6A 4JI9A 4V0GA 4E6AA 2GQSA 4KUJA 2BFXA 2X0GA 4FSRA 4TRLA 3VS4A 1CMKE 4AE6A 5M09A 4LRJA 1JNKA 2JFLA 2XK9A 2Z7QA 4AF3A 3HV4A 4R77A 5CVGA 1UNGA 2BVAA 4JQ8A 4MAOA 4RZWA 2NRUA 4IVAA 3LPBA 5KBRA 2PMIA 2YDKA 2ZMCA 3EB0A 3E64A 3E7VA 4GCJA 5HHWA 3ZBXA 4H58A 5AM6A 3ZEPA 4E4MA 5A6NA 5IQIA 4IX3A 3F3ZA 4XYFA 3OXZA 2BRMA 3C1XA 3ERKA 2ITWA 2WQMA 2R7BA 3MIAA 4PX6A 3TUBA 4DN5A 2YAKA 5CAOA 1E1XA 3FMKA 5TO8A 4IM2A 5HG5A 5HIBA 2QI8A 2I0YA 4GU6A 3VO3A 1G8AA 4LGHA 3CTQA 4BGGA 2VTLA 1APME 4IM3A 2OXYA 1YRPA 5EM7A 4WO5A 3NGAA 3BHUA 5FDXA 5GZ9A 4O7YA 3THBA 5B2KA 4DH8A 4FTIA 4G5JA 3UIMA 5HBJA 1YWNA 4D9TA 4YO4A 3KN6A 3NAXA 5AP2A 4QYGA 1LEWA 3AT3A 2XK6A 3E3BX 4C38A 3UOJA 1FQ1B 1ZYJA 2OO8X 4MNEB 3QGYA 4XP0A 3AMBA 4ANNA 4ZLOA 3NRMA 2PUIA 5IH5A 2JEDA 4UXQA 2H96A 3CLYA 5KMOA 2A2AA 3DZQA 4JG7A 5TT7A 5AFVA 4XJ0A 3R1YA 2XJ1A 3RPSA 4AUAA 2Y6OA 3C4WA 3QBNA 3A7IA 4FKPA 4BTJA 1ZYSA 5CLPA 4LFIA 5HVKA 3FLZA 4DG0E 2CMWA 4I5PA 4NK9A 3NYOA 5GZAA 3OBGA 3NWWA 1Q3WA 3UG2A 4GS6A 3NNXA 5JK3A 4HVHA 4OLIA 5IQGA 2NP8A 2XK4A 5I9UA 4L8MA 3VUIA 4W4WA 2VO3A 4Z3VA 5FGKA 3OOMA 1BKXA 2C6OA 4RSSA 2VTIA 4AU8A 3EN6A 2VWVA 3DFCB 1H4LA 3NYXA 4FTAA 2FGIA 1UU3A 2Y7JA 4G16A 2W17A 4MD8E 1RW8A 4A7CA 3QC9A 1PMEA 3BI6A 3V5TA 4D0WA 3R6XA 4F9WA 3KVWA 3PJCA 4ANBA 4C3PA 4EC9A 3KXXA 5IEXA 5I9XA 2QOFA 3GVUA 3QAME 3BQCA 3SVVA 2WU6A 3MY1A 4I6BA 2QD9A 2YIXA 4D2TA 3ZONA 1JBPE 4GYIA 4ALWA 4U44A 2UUEA 3QYWA 2GHLA 5DBXA 2KTYA 4D4RA 4K0YA 4HW7A 3JS2A 2BIYA 3R1NA 1PXMA 3BIZA 3U8WA 2F7EE 5ICPA 2BZIB 4YHTA 5ANEA 3DDQA 4TWPA 4XG8A 3PLSA 3TNQB 4BDDA 1MRVA 3GOKA 5ITAA 2FH9A 3UOKA 2YISA 3B8QA 3I79A 1QPEA 4L68A 1XO2B 3P79A 5HG8A 2GNGA 3UMWA 2X2LA 4A9TA 3ORZA 4YZNA 2NPQA 5CX9A 5ETAA 3MJ2A 5JRSA 5KCVA 3A60A 2C69A 1OKYA 3I81A 1YDTE 4RX8A 4U40A 4Y95A 2YZLA 5AP6A 4ZSLA 4QMNA 2VO0A 5AR2A 4FKLA 3U9NA 4Y5QA 3EQIA 2B0QA 1U54B 4RX7A 1Q4LA 4O0VA 4BDCA 2OZAA 4PUZA 4S33A 5EHOA 4I41A 3G2FA 4QYFA 4PPCA 4CVAA 3U51A 3H10A 4P5ZA 4OTPA 2XKCA 4L53A 5HG7A 4ZTMA 4HNFA 4O0XA 2OFUA 2R3OA 4IBMA 2SRCA 4ZS4A 3ZXZA 3C5UA 3OG7A 3EQCA 4AS0A 4FF8A 3JR1A 1TVOA 5I3OA 4F64A 3NNWA 4GFMA 3PTGA 5LXMA 2JKMA 3JYAA 1BL6A 1OUKA 5EKNA 4FTUA 4AXAA 3D9VA 4DH1A 1V0PA 1O9UA 1YVJA 3MVMA 1F0QA 4KKEA 4C3FA 2ZB0A 2JDRA 4WRSA 5IKWA 2GSFA 1P4FA 5IH4A 5HNIX 4IWPA 1OKVA 2V5QA 4QTBA 1WBVA 4ORKA 2GDOA 3ROCA 3PPKA 2HK5A 5EHYA 4F6SA 1XKKA 4XS2A 3QU0A 4Q2AA 3N4UA 2EXEA 4IZYA 4JAJA 3BU5A 1OL6A 3L9MA 5A54A 3LFDA 4GW8A 3ZTXA 2PUPA 2X8EA 4RWJA 4M8TA 5HEZA 2XB7A 4X7QA 5E1SA 4F65A 1H00A 4FV8A 3TDVA 2ITNA 1L3RE 4RGJA 3P9JA 4OT5A 3MA3A 3QYZA 1JSTA 3DB6A 2CNVA 2ONLA 4U81A 3ROYA 2RFNA 1H24A 2ONLC 4XLIA 3P23A 4I94A 3TJCA 4X2JA 4HYUA 4L3LA 1IG1A 2BZHB 3ATTA 2CGXA 4E4NA 1URCA 2HZNA 1OIYA 3R30A 3FWQA 5C01A 2UVYA 4ZJJA 3BHYA 5KX8A 3NVKI 2W99B 4FOBA 4XV2A 2JIVA 4YTHA 4AN3A 1Q8WA 2VTHA 4QYEA 2C68A 4EQUA 1BL7A 2O2UA 5F20A 4QQTA 5D10A 1BLXA 1WAKA 5I9ZA 2YM7A 3KCFA 3BCEA 5DLSA 3NX8A 5DN3A 1MQ4A 5C8MA 3HV7A 4F08A 2RIOA 3O50A 3JY0A 1PYEA 5K4IA 4MVFA 4IW0A 5M44A 4V04A 3TUDA 4DBNA 4DEAA 5JFVA 2W9FB 4AAAA 4RQVA 2FSLX 4FKOA 3KGAA 3FPMA 1Q3DA 1WBNA 2R64A 4NCTC 2WMAA 3MTLA 5AUZA 2RFEA 5J87A 3PPJA 1CSNA 4L42A 4JIKA 2VNWA 3OT3A 4P2KA 2ZOQA 3AT4A 4L3JA 4N4SA 5TE0A 2OKRA 5JGBA 4DBXA 4EHVA 4JBQA 5GJDA 1WVYA 4MXYA 3OZ6A 1QL6A 3RAWA 2OJJA 2C3KA 3LM0A 2PVNA 4DYMA 4FEUA 2VV9A 2YDIA 3FMNA 2W4JA 2EB2A 3C51A 3C4FA 3GQIA 3OWPA 4TTHB 3R8UA 2G2FA 4DC2A 2X81A 2CDZA 3BBTB 3QQLA 3TACA 3KK9A 4FG8A 3D15A 5CU6A 3C0HA 1OUYA 4FX3A 3ZFMA 4BBMA 5JEBA 3QZFA 3ZLYA 3PJ1A 4J1RA 3I5NA 3H0YA 3MA6A 4GT5A 4MXXA 3WE4A 2OF2A 1U5RA 4O91A 1SM2A 4PDSA 2YM6A 1JSUA 4GVAA 4EH8A 2ZMDA 3HGKA 5A46A 2A0CX 3ORIA 4QOXA 3EJ1A 5M07A 4C4GA 2C6MA 1FOTA 4TYGA 2J0MB 2C0OA 3LW0A 4JOAA 4D4VA 3Q4UA 2OIBA 1GZKA 1AQ1A 4NH1A 3P1AA 3FXZA 4R5SA 1SVHA 1UV5A 2VTAA 1Q8YA 3Q6WA 4JNWA 4MF0A 3W32A 1FVTA 2XCKA 4F9CA 2C4GA 1FBNA 3QA0A 4YLKA 5AX3A 3TV4A 2C30A 1H0WA 2XF0A 4ZTHA 4CFUA 2QG7A 3GCQA 5LVMA 4RBLA 1PJKA 1YDRE 1WZYA 2Z2WA 4J53A 3O51A 4XV9A 3RVGA 3MI9A 1PY5A 3AC3A 3EQBA 2WTIA 4BI1A 2NNWB 3D7ZA 3EFKA 2XK7A 3GU4A 4LRMA 3FKOA 2O64A 3FMEA 4MWIA 4IVCA 3ZO1A 3GXLA 4BIDA 2I1MA 3V3VA 4IB3A 3L9LA 4XV1A 1UVRA 3FYKX 3H0ZA 2PMOX 5HNBA 4KA3A 2O8YA 3Q96A 3HECA 2W5AA 2X4FA 4RFZA 2PPQA 4EOIA 4FV9A 4TNDA 3UPZA 1CTPE 3F5XA 4K1BA 4O84A 3IKAA 2WEIA 2PVJA 2OXDA 4Z9LA 4UXLA 4O7SA 4FI1A 5CT7A 4CTCA 3ZLXA 5CASA 3PA5A 5A6OA 2W1CA 3FYJX 4NEUA 3Q5IA 1OL7A 2G15A 3P7AA 3AXWA 4QP1A 5EM6A 5D12A 4FOCA 4EL9A 3PVBA 3QWJA 1J91A 1KE8A 3EQPA 3CPCA 3ZFXA 3QKMA 4O7LA 3R9RA 3B8RA 5IF1A 2FYSA 5BMSA 5EDQA 2HWOA 3T9TA 1P14A 5K3YA 3WYXA 4FSQA 4LYNA 2WXVA 3ANRA 4HZRA 4RJ7A 5KMIA 2UW3A 5AADA 4MEDA 2B9HA 2QOHA 4D55A 3L8PA 3LCKA 4XP2A 1YHVA 4AT3A 4IQ6A 2OU7A 5CY3A 5E91A 2W1DA 3LMIA 4A4XA 2WQEA 3QUDA 4QMLA 3V8TA 4CFWA 3G9NA 3EFWA 4FEWA 5IG1A 4ZMEA 2BPMA 4XP3A 4C7TA 4GK2A 3RAIA 3V5QA 3KQ7A 3FQSA 4IAFA 4RC2A 4TYHA 4LI5A 4PQNA 2YITA 4BIBA 1PKGA 4H3QA 3P7BA 5BVKA 5JQ8A 2R3GA 3MY5A 5EK7A 3PIXA 4CEGA 3KXGA 5DWRA 5B2MA 5FXRA 3F7ZA 3BYUA 1Y91A 2IVUA 2W1EA 4FZ7A 4D5KA 3E3PA 5FM2A 3EFLA 3C4ZA 5CI7A 5G6VA 2X8IA 4YJRA 4E4LA 4QO9A 3BU3A 1H01A 3C4EA 2UZTA 3GFEA 3LQ8A 1M2RA 1SMHA 2OSCA 3EIDA 4S34A 3OWJA 4I93A 2C6LA 4HPUE 4B6LA 4YC3A 4XUFA 3ZDIA 4DE4A 4D2WA 3WI6A 5EW3A 2GS6A 2HW6A 4HCVA 5KBQA 2O3PA 3ENMA 3QRJA 1GZNA 4YNOA 5AAEA 2OGVA 4LUEA 4WRGA 2XK3A 3H9OA 4BR3A 3MSSA 5FEQA 4TNBA 5HOAA 5KMLA 5CYIA 1J1BA 4EORA 2WMRA 4M12A 1Y57A 2XEZA 5G1XA 3O7LB 4BYIA 4QMQA 4L43A 3BKBA 2PULA 4FA2A 3PVWA 4EQCA 1UWJA 3FE3A 2GTNA 3EH9A 5AR5A 4BWXA 4IDTA 3H3CA 4J95A 4R7IA 4Q5HA 5L2WA 5J1WA 3R63A 1MRYA 5C8NA 3EQDA 1KE6A 1XH5A 3FLQA 5D11A 4RWKA 2Q83A 4DHFA 2CKEA 4E6QA 4BZNA 5J9ZA 3QTXA 2A19B 2PVKA 1V0BA 3OW4A 1ZZLA 5GJFA 5M57A 3QCYA 3OXTA 5HX8A 3GCPA 3TV6A 1REKA 5KE0A 4E5AX 5KMKA 4GG5A 3KRJA 4G1WA 4KRCA 4JVGA 4I1ZA 3PA3A 3ULZA 5AUYA 2ZV7A 2C5OA 3KEXA 5IU2A 2UW7A 3OTUA 1VJYA 4IFCA 4NKAA 3HAVA 5CNOA 2X4ZA 4G3CA 3CJGA 4JDKA 4MCVA 4O38A 5H9BA 3MS9A 1GOLA 3F3WA 5LMAA 4Y46A 5J7BA 4II5A 4QYHA 4RJ4A 5IDNA 4V01A 3ENHA 4AW2A 3BHVA 4O0YA 2Z7RA 4BBFA 4YSJA 3LFNA 3A8WA 5CF4A 3HV5A 5LCJA 3DBFA 4ZOGA 3NIZA 4WNPA 1YXSA 2QOIA 4LQMA 4FK6A 1DI9A 5DRDA 5K0XA 4CG9A 3UO6A 4IAYA 4UALA 2Q0BA 3OCSA 4PP9A 4MHAA 2WTWA 3ZUTA 4S32A 2OW3A 3MB6A 4ZY4A 2ZJWA 4CYIA 4RIYB 3CKXA 4PF4A 3P0MA 1YDSE 4QT1A 5L6PA 2B9IA 2V22A 3R22A 5M4CA 4KIPA 4WKQA 1XR1A 2CGVA 1Q97A 3N9XA 3UP7A 2O5KA 4GT3A 4NYEA 2YCRA 1JVPP 4BCPA 3DV3A 3MYGA 3RALA 2C0IA 3BQRA 2YCSA 5F4NA 5H8EA 2C6KA 1JKTA 4FV2A 5KZ0A 3DBQA 3V04A 3NUAA 3UC3A 3MN3A 3AC1A 3QGWA 4MQ1A 4OBQA 2PZ5A 2WELA 3E8EA 4PPAA 1M7QA 2C47A 5HE0A 1DI8A 4M97A 1RE8A 1STCE 3TWJA 1R78A 5AR7A 4YBJA 5AP7A 1B6CB 4C02A 3GCSA 4G2FA 5TF9A 2PVFA 4FBXA 4R7BA 3R01A 4DAWA 1YI3A 2BDWA 2V55A 3G5DA 3I0OA 4RVKA 5AP1A 4X2KA 2QC6A 5HGIA 4B0GA 5JFWA 3Q53A 1S9IA 3QTSA 3Q3BA 4IVBA 4PV0A 4KBCA 4BKYA 2QU6A 2CLXA 2EU9A 2V7OA 3PXKA 4F9YA 3SG9A 2UZOA 3NZ0A 4TPTA 3VBYA 5CU0A 3HLLA 4KWPA 4TN6A 3K3JA 3B2WA 2B54A 4CFNA 3EYHA 3KY2A 4U5JA 4ANSA 4BZDA 3SLSA 1CKPA 2Y4IC 4I92A 2XM9A 3VRZA 1J7UA 4I4EA 2PVHA 5BMMA 1Z57A 3FSFA 4CT2A 3CPBA 2O0UA 1A48A 2R3MA 4O21A 5GIPE 4UBAA 2XCHA 2Y0AA 4CG8A 3NIEA 5CEOA 4YZBA 1YWRA 5DNRA 3FUPA 3I1AA 3KRLA 3TZ7A 4OGRA 2XS0A 3N4TA 4CRSA 4ZAUA 3FPQA 4RLKA 3QTIA 4FTLA 4BZOA 3BEAA 3VS0A 3SOAA 4FIIA 2ERKA 1IASA 2QLQA 3E63A 4DEHA 1H28A 2J7TA 4XNEA 5KKRC 3CTJA 3I60A 2ETKA 2UZUE 5A4LA 4MTAA 1WBOA 4IZ5A 4BGQA 5CANA 3FDNA 3HEGA 1NY3A 3DFAA 4NSTA 2BFYA 2W1IA 1XH6A 4M68A 4D2RA 4F0FA 3DTWA 2IG7A 4R1YA 2YM3A 1JPAA 3UIUA 5DH3A 3F3TA 2F57A 3F66A 5AP4A 2XNOA 3A62A 4OW8A 2P3GX 3GU8A 4EC8A 3E8CA 3EQGA 3ZEWA 2QURA 4JX7A 4C35A 1VZOA 4Y8DA 5E8SA 4ALUA 3G0EA 3RHXA 5HX6A 4EOQA 3TNHA 5AUXA 4E3CA 1F5QA 3CJFA 2VTJA 4CV8A 5CSPA 5DMZA 2I40A 4NT4A 4EH9A 2YIYA 3GC8A 2H9VA 2CCHA 4IEBA 4WBOA 4DA5A 4AOJA 1SVEA 4EOKA 4ASDA 4B7TA 4CKJA 3VF8A 4W8EA 5DT4A 2EXCX 5J1VA 4L46A 5LWMA 3BLRA 4L52A 5CSWA 4H1MA 2OF4A 2JDOA 4FKQA 4GJ3A 1TQIA 4IIRA 4KAOA 5H3QA 5K0KA 3ORXA 4EBVA 3EN9A 2P4IA 4XEYA 1Y8YA 3LJ0A 4O2PA 4QQCA 3KRXA 4X6QC 2P2HA 2JKQA 4AOIA 3F5GA 4U42A 4BKZA 2J4ZA 3OC1A 4DFYA 5BUEA 5CEKA 3IOPA 3ZUVA 3G33A 4ACCA 5E8UA 4L00A 2J0IA 3HYHA 4FSYA 4QYYA 4GYGA 4QNYA 4JG8A 1H07A 4FTMA 3LXPA 3W1FA 1KUTA 3O23A 5DR6A 2W1GA 3MPAA 4HYHA 5DRBA 2IVSA 4MYGA 4QP7A 4TYHB 4H1JA 5AA8A 4BWKA 4DH7A 2O65A 5GINE 1FMKA 3FI8A 3CD3A 3QTUA 3IW8A 2HY81 4MQ2A 5IA1A 5AV2A 5EYCA 3BGZA 2PUUA 4K9YA 5CTPA 2BKZA 3A8XA 5TOZA 3BLHA 5CS6A 3RKBA 4GMYA 3V01A 3ZM4A 5FUTA 4J71A 3MY0A 4GV1A 5DOSA 1DAYA 1T45A 2ETRA 1H1RA 1W98A 2XRWA 3AC8A 4F0IA 5E8VA 2PVRA 4RC3A 2PE0A 2YCFA 3VUMA 3QKKA 2I6LA 3C13A 3F69A 4JBPA 4AW0A 2BHHA 4W9WA 3N4VA 3ZC6A 4QMUA 4Y72A 5E7RA 3AT2A 4BICA 4WNKA 2ERZE 2JBPA 2UW5A 3ET7A 1Q99A 2B9FA 4USDA 3ZO4A 5IA3A 5IMXA 2XKFA 5FM3A 3HP2A 4FT5A 5AV3A 4AZVA 5LVOA 3CS9A 3S95A 3PSBA 4P7EA 4GK3A 5AV1A 3R7EA 4F7JA 4QD6A 3C0GA 1R0EA 4R3RA 2EWAA 3ELJA 2WZJA 4RFMA 4CTBA 3CQWA 3HMIA 4YJQA 2R3KA 4ASZA 4D1XA 2RF9A 3LFBA 2W4KA 3MGYA 1ZOGA 3A7GA 3MPMA 4DT9A 3UOLA 5HORA 4ZZNA 2OH0E 3ORLA 4ZLYA 1BI8A 5EDPA 3S3IA 4USFA 3QZGA 3EQFA 3HA6A 2NO3A 4M69B 1BMKA 5HE3A 4BHNA 4EK4A 2OI4X 3NW7A 3IW4A 4EI4A 2F7XE 3DKOA 5GIOE 4JX3A 1S9JA 3LJ1A 4YJPA 3O8PA 2WOUA 3OS3A 3ZZWA 4H3BA 4F7LA 1JSVA 2QNJA 3ORPA 1REJA 5KHXA 4G9RA 2ZAZA 4U97A 4ZTRA 3TKUA 3ZSGA 4KSQA 3CTHA 3F88A 4PMTA 4ENXA 2QOQA 4AW1A 2OFVA 2YIWA 4UY9A 3JVRA 4R8QA 4C33A 4F0GA 4DLJA 5JGDA 4R7HA 5BX0A 3BHHA 4QNAA 2JFMA 4JXFA 1TKIA 4BRXA 4CMUA 1I09A 5HU9A 1URWA 4LOPA 4O2ZA 4YURA 3F61A 2B55A 3F7WA 4JL9A 5IPJA 3RI1A 3C9WA 3FKNA 4IHPA 3A7JA 1CDKA 2X8DA 4S2ZA 4ZTNA 2J6MA 4LM5A 5E8YA 1ZRZA 1J7IA 4LV8A 4JR3A 5LQFA 4IE9A 2W9ZB 3ZZEA 2X9EA 3WZEA 5TR6A 5HLWA 1FVVA 5ANDA 2PVYA 4NM5A 3C50A 2HCKA 3DK6A 3QQKA 2BAKA 4ANLA 3EQRA 2QKWB 4PTEA 3PG1A 3ZUUA 3UODA 3P4KA 2E2BA 4RIWA 2J0LA 3DK3A 4M14A 4ZZMA 3RPRA 1P4OA 4D4YA 2YLEA 2UV2A 3CBLA 2XEYA 4PDPA 4R1VA 3JY9A 4X2FA 4M3QA 3EYGA 2Z02A 4MXCA 3V6RA 3A2CA 2VO6A 3BZ3A 4FTNA 2R3PA 3ZSHA 1H1SA 2ZV8A 3TV7A 4CFXA 3QZHA 3QRKA 3LCDA 2B1PA 4FSZA 1UKIA 5D1JA 5DPVA 3EHAA 1ZOEA 2BAJA 2OICA 4G5PA 1YI4A 4YPDA 3EN4A 3DU8A 2WMUA 4MBIA 4OBPA 1ZZ2A 2BZKB 2UZVA 4JG6A 4O7RA 2JIUA 3FMHA 3TEIA 3BX5A 2WAJA 3U87A 4XG4A 4F1MA 2C6TA 3FLYA 3QRUA 3TM0A 4MBJA 2CN5A 3R7VA 2AYPA 4L7FA 1I44A 3QD4A 4QTEA 2RL5A 4XG9A 4YTFA 3COMA 3DCVA 1BI7A 5CWZA 3DDPA 4RVLA 3R7OA 4QMTA 5DG5A 3R9OA 3PUPA 3VHKA 3VQUA 4DTBA 2CKPA 3PRIA 2GHMA 3R2BA 3EOCA 4MD7E 4DFUA 5ACBC 4FG9A 4RJ3A 3LQ3A 4PDYA 3QF9A 3MVJA 3HKOA 5AA9A 2OJGA 4G6LA 4WA9A 4AZTA 3UBDA 4C2WA 5GZ8A 2WMTA 1H1QA 2BALA 1LR4A 1XBCA 3O71A 4ERWA 1FGIA 2C6IA 4FODA 2WHBA 3RK7A 4EOPA 5C8KA 3MFSA 5HQ0A 3GT8A 4ZJVA 3LFQA 3VS1A 3A4OX 3NYVA 4HVGA 1OM1A 4OR5A 4PL4A 1GAGA 4DINA 2H8HA 1CKIA 3RGFA 5BVDA 4FUYA 4GKHA 4F4PA 3R8VA 4FKGA 4ZZOA 4IAAA 1PMUA 3ZOSA 1OVEA 3FLNC 2VTTA 4GSBA 5AAFA 3LMHA 3MBLA 4M0YA 3OOGA 3R28A 4BDEA 4EHEA 2XIZA 4DCEA 5LMBA 5HTCA 5LMKA 5IQDA 3LE6A 3G6GA 1XHAA 4W9XA 2ITXA 1YHWA 4HGSA 3UIBA 3PA4A 3W2PA 3VUHA 2W96B 4FL2A 3QALE 4GUBA 3OWKA 3MFTA 3LM5A 3Q9ZA 2OIDA 4EK3A 4RFYA 5IA5A 1W8CA 2B7AA 1PW2A 2YM8A 2CSNA 5LCKA 2BTSA 3FMJA 1QPDA 3KB7A 5JQ5A 3GENA 4FVPA 2CGWA 3Q6UA 3RP9A 1OL5A 3F2AA 4EYMA 4U9AA 4TWNA 4LUDA 4IWQA 1M52A 3A7HA 3HV3A 5AX9A 2WTJA 4ITIA 5E90A 3WYYA 5HO7A 3DLSA 4E4XA 3R7GA 2OBJA 2QO9A 2G2HA 4R78A 3UC4A 5M53A 4S31A 1ZARA 2Q0NA 5K5NA 5ANKA 2Y6MA 4X0MA 2UW8A 4DFLA 2PU8A 1VYZA 1AGWA 3U9CA 4BHZA 4GUEA 3NUPA 1NVRA 3ZDUA 3HDMA 2EUFB 2FSOX 3Q60A 4RJ6A 3VULA 5BNJA 4LL5A 4L9IA 3OBJA 2F2UA 2IW6A 1R39A 3C4CA 3OMVA 3ULIA 4I4FA 3ZCLA 3G9LX 4JT3A 2IZTA 4IZ7A 1P2AA 2P2IA 3TIZA 4WT6A 3S00A 5FP6A 2BDJA 2ETMA 2XH5A 3F9NA 4U3YA 4D2PA 3RK9A 1NW1A 4HVDA 1PYXA 1ZXEA 5E4HA 4N57A 1WBWA 3JUHA 3BBWA 4I24A 4G31A 4FZDB 5BYLA 4EOLA 5BQ0A 4E6DA 4FZ6A 3GC9A 5GNKA 4C57A 4JS8A 4EKLA 3NEWA 2WB8A 4Q9SA 2CKOA 4YC8A 4C3RA 4GKIA 4RWIA 4TXCA 3DKFA 1HCLA 2R3RA 4BDFA 2Y4PA 3NW6A 4HNIA 4RVMA 5JT2A 5CSHA 2J0KA 2F9GA 2QOKA 3NNUA 5I4NA 5J5TA 5AM7A 4FSNA 2W4OA 3FZTA 1PXIA 4I5MA 4DEGA 5J79A 3RK5A 2QHNA 4YHJA 4UMPA 4Y5HA 3KREA 4FL1A 4J7BA 1UKHA 3ZBFA 3KMUA 3MH1A 3WF7A 3TG1A 4GFOA 1OPJA 3E5AA 3WE8A 4A4OA 3I7CA 2X9FA 4L3PA 2IJMA 3ZRKA 4K6ZA 3N51A 4NM3A 3KMWA 2RKUA 3MV5A 3JXWA 4N6YA 4PDOA 4FIHA 5AIKA 2YWVA 3W2RA 4F70A 4AZEA 4CMTA 3GNIB 5HNGA 3ACJA 1Q8TA 2W0JA 2UZWE 2C5YA 4I6QA 5FBNC 3TZ8A 5BVOA 3TI1A 2C5NA 3R21A 2IZUA 4EH6A 3W8LA 1JAMA 4MF1A 5EHLA 1JOWB 4OTRA 3D83A 1KE9A 3NCZA 4CV9A 2BDFA 5EW9A 1PMNA 2X7GA 4NZWB 4FC0A 2HXQA 2GNJA 2XBJA 3O8TA 2Z8CA 5FG8A 5J9LA 4AZFA 3G15A 2VO7A 4OTGA 1OMWA 4ZIMA 3MESA 2WKMA 3QL8A 3OROA 3PYYA 4RA4A 5BYYA 1YXVA 5KMJA 4NJ3A 3AMAA 4E5BA 3LXKA 4BDAA 4F09A 4ZS0A 4FEXA 4IDVA 3BV3A 3COHA 3QD0A 3DJ6A 4AOTA 1UA2A 2ZV9A 5T3QA 5EH0A 3Q2MA 2X39A 3T9IA 3CXWA 4O0RA 5HCXA 3AQVA 4AZSA 5LOHA 4F7SA 2UVZA 1IA9A 4QPAA 3G6HA 5HCZA 1OPLA 4KIKA 4P5QA 1SNUA 5HBHA 5JFXA 4AWIA 4PTCA 5IMEA 5T6KA 4FT7A 4O0UA 4XHKB 4YLLA 2JLDA 3TDWA 1XH4A 3F5UA 5AUUA 2HZIA 3FMDA 2X6DA 3ZH8A 4ZTLA 5C03A 3PSCA 4EEVA 4B8LA 4PPBA 2OWBA 3R1SA 1Q8ZA 4HCTA 4TT7A 4BCHA 3NYNA 2XNMA 5IEVA 4E93A 4QP4A 4FE2A 5L6OA 1IEPA 2PHKA 2VRXA 3HV6A 4FV4A 4M66A 4QMPA 4RA5A 4WUAA 5JN2A 2ITTA 4WHZA 2HENA 3GQLA 3PY1A 3REPA 3RZBA 4JDHA 4QMOA 3P7CA 2E9OA 2CCIA 3R8ZA 3DXPA 4FICA 4IWDA 4R3PA 2XK8A 4UZDA 2QONA 2WNTA 3LHJA 5KHWA 5M08A 3O17A 3R7UA 4ZP5A 1A9UA 3Q9WA 3V5PA 3NUSA 5IQFA 4BI0A 5LVPA 3D5VA 3GU5A 3G51A 4FTOA 4QMSA 3UJGA 3VS6A 4J99A 5HU3A 5LMKC 3UZRA 4M15A 4YTCA 4DG3E 5CEQA 2CN8A 4BCQA 5C26A 5C27A 1WCCA 2BUJA 2RSVA 2DUVA 4FEVA 4EJNA 1H08A 2JKOA 4AA4A 4UN0C 3PXYA 3QXPA 4U3ZA 4FKUA 4HCUA 3NNVA 2XJ0A 5HCYA 2GTMA 4DH3A 3HZTA 3UG1A 5AUVA 2UW9A 2UW6A 2BROA 3HX4A 3VS5A 4CSVA 3PFQA 2OJ9A 2ZYBA 5T68A 1ZWSA 3P08A 2R3FA 4ZSAA 1JKKA 2REIA 3BYSA 3LFSA 3PIYA 4YHFA 1XH8A 5CQUA 3TNWA 4AA0A 1KOAA 3OTVA 2W7XA 3H9FA 3BGPA 3R9NA 4EWQA 1LEZA 2JDVA 4J98A 4F63A 3IOKA 4AG8A 3QCQA 5FBOA 4PTGA 2JD5A 4O7WA 2OG8A 3BE2A 3GC0A 4ZLZA 3MW1A 1QCFA 1E1VA 4PMPA 2IW8A 2XIRA 3FMLA 3KN5A 5HIDA 5EOLA 3FV8A 4K18A 4EH4A 3BEGA 4CRLA 2BAQA 1LP4A 3A61A 1ERKA 4FTRA 5EQPA 3MVLA 3W16A 2OK1A 4LGDA 5DR9A 2R0UA 3H30A 3LLAA 4KBAA 4FIEA 4ZSJA 1YKRA 4PP7A 5JKGA 2HXLA 3OEFX 3FZPA 4ZK5A 4EZ7A 1TQPA 3LKMA 4HYIA 4YPSA 4YJOA 1H26A 4RWLA 1Y6AA 4EUUA 5HBEA 2C1BA 4QP2A 4FIJA 5HI2A 4LL0A 3UZTA 2YJRA 3HNGA 3OP5A 2PE1A 3QTRA 1XQZA 1V1KA 3GC7A 3IK3A 4M69A 5FQDC 3BWFA 2R3LA 2I0HA 3COKA 4WBBB 3EL7A 4A9YA 4D5HA 4I21A 3ZO3A 4KIOA 3TNIA 4L7SA 3NAYA 2IN6A 4GEOA 3GFWA 2BIKB 5CAVA 2WIHA 4C2VA 3E93A 3FC2A 2XMYA 4M13A 3EZRA 2F7ZE 2UW4A 2WO6A 3MH3A 5CU3A 2WGJA 1Y8GA 4O1OA 2ZM1A 3NUYA 2I0EA 4I6HA 3LFEA 4EUTA 1GJOA 4QP8A 4ZY6A 3KXHA 3QTZA 1SNXA 3F3VA 2DYLA 3NUNA 2BCJA 2XRUA 3KMMA 4D2SA 4ID7A 5DGZA 1YHSA 3EN7A 3CD8A 4BN1A 5L2SA 5E1EA 2EB3A 3DPKA 2OZOA 2ITZA 3QQHA 4OTDA 2VN9A 1ZMWA 4OTQA 1NVQA 4QMYA 4Y73A 3SQQA 4AQCA 3KCKA 4CKRA 2W1HA 1GIIA 2OJIA 4IJ9A 5CQWA 3KF4A 4RIXA 4GIIA 3FY0A 1FGKA 3VW6A 1OL1A 4CLIA 3OUKA 2J90A 1W82A 1J3HA 3FMMA 3R9HA 5KMMA 5ANIA 3PSDA 4C4HA 3I6UA 5DA3A 4RT7A 4D4SA 2GU8A 5EOBA 3HRBA 3FQEA 4APCA 3VQHA 2VX3A 5AP0A 3LXNA 3SRVB 3P5KA 3BLQA 2VWWA 4C4IA 4H3PA 1G8SA 3DKCA 3KVXA 3NUXA 3PY3A 3WZJA 3E88A 3U55A 4CKIA 2BTRA 3ZYAA 3RNYA 2QQ7A 3FHRA 1W84A 2WQOA 2X2KA 3SHEA 4QMXA 3W8QA 2WMVA 3DT1A 5M06A 1H1WA 3VUKA 3ID6C 4I23A 2J0JA 1PXJA 4FMQA 3C5IA 3CSVA 2WD1A 4BY9E 3QCXA 5J5SA 2PZRA 3PXQA 3RZFA 3QQUA 3DXNA 1PMVA 2HW7A 2WPAA 3I6WA 1JWHA 4I20A 4YNEA 3RBWA 3RHKA 3LLTA 4UZHA 3SKCA 4B4LA 3ACKA 4KABA 5HIEA 4O86A 3UP2A 4DF3A 1WVWA 4EOSA 4QPMA 5IUHA 1SZMA 3MH0A 3DBEA 3SW7A 4NTSA 4EHGA 4KIKB 2JBOA 3OEZA 5AAGA 3HMMA 3SV0A 3GEQA 4HJOA 2VGOA 3F3UA 4P4CA 4MX9A 2PVLA 4NIFB 4LOQA 3VBQA 4FVQA 4YR8A 1O6LA 3HUCA 4X3FA 4FGBA 4FT3A 2AUHA 5IEYA 3D5WA 5ACKA 2XIYA 4JBVA 2RG5A 3FY2A 3QA8A 3PWYA 3TTIA 5HKMA 4IM0A 1OIQA 3R8LA 2R3JA 2ZDTA 3HRCA 1MP8A 4KINA 4QP3A 5EYDA 3KL8A 3HA8A 4EK6A 1UU7A 5HO8A 5L2IA 3U4WA 2B4SB 4H36A 1KOBA 4NW5A 4RPVA 4ANOA 4F1OA 2HZ0A 3L8SA 1XBBA 3AD5A 4GU9A 4ACGA 3PLAE 5E8XA 2FSMX 2PL0A 3UNJA 1H1PA 2JAMA 5JZJA 1PXPA 2C6DA 4CQGA 3TL8A 4GIHA 4M67A 4DFNA 5CVFA 5A4TA 3VBTA 1MQBA 1QPJA 4FK3A 4N0SA 4TY1A 5IA0A 3QUPA 5HD7A 4DG2E 2IPXA 3NR9A 2X1NA 3W55A 3GP0A 4YZ9A 4K77A 5E92A 2VTOA 3VUGA 4PRJA 4I5CA 3AC5A 5AJQA 1U5QA 2WQBA 2BHEA 3UDBA 3POZA 4MXAA 2B52A 3QRIA 4HGEA 5CSXA 4BCGA 4XG3A 5M4FA 4BCIA 2RFDA 5AWMA 5HE1A 2ACXA 3HMNA 5K4JA 2XNPA 3F5PA 3L8VA 4BTFA 3QQGA 2WMWA 3IPHA 4I0TA 3SGCA 3KKVA 5IISA 1BUHA 2ITPA 3ETAA 5CEIA 3UNZA 3WZUA 2ITQA 4HPTE 5CF6A 3R8PA 5KKRB 2UZNA 3CKWA 3F2NA 3C0IA 3QLGA 2IWIA 3RM6A 3VJOA 5CEMA 3CP9A 1ATPE 2PE2A 4FKWA 5HTBA 4MD9E 3DA6A 3R1QA 4FT9A 4JAIA 3II5A 3FLSA 3QUEA 4A9SA 5DEWA 4MK0A 3I0QA 1OKZA 2QODA 1PHKA 2OIQA 3BYVA 3NLBA 1IAJA 1EH4A 2PZIA 3AGLA 4KS8A 3FI4A 1M7NA 4AW5A 5L6WL 2BRHA 4YU2A 3DY7A 5EYKA 5HVJA 2PVMA 3E62A 3V8WA 5E8ZA 1JLUE 4FKVA 1Y6BA 3K5VA 1PXLA 3WF6A 4GRBA 3RAHA 4FV5A 4NFMA 4IADA 5FDPA 5ETFA 3QD2B 5D9HA 5L8LA 3FZRA 2VWZA 5CVHA 5H2UA 2JGZA 4M7IA 2HAKA 4C34A 4EH7A 3BGQA 1BX6A 2UVXA 4Z55A 3OVVA 4GG7A 3RWPA 3KULB 4X2NA 2QO7A 5F94A 1YXTA 3T3VA 3RTPA 4UWYA 4YP8A 3DBDA 3QCSA 3DK7A 3WBLA 4DT8A 2CLQA 4DFBA 4NU1A 4BCJA 2PZYA 3SXFA 5D41A 2IZSA 3OT8A 3LCOA 5HZNA 2BKKA 3QRTA 3FSKA 3MB7A 3QKLA 1UNHA 4KB8A 4OTWA 3GU7A 1T46A 4PNIA 4FEQA 4HZSA 4XRJA 2QVSE 3UQGA 3AD4A 3PXRA 5EYMA 2WIPA 2IZRA 4FKJA 5CENA 4U79A 3TZMA 1OL2A 3ORNA 1OGUA 1WVXA 2VTSA 4FTJA 2AC3A 3KULA 4WSQA 3RPOA 5EM8A 4NW6A 3QXOA 5CF8A 5HD4A 3GUBA 3SX9A 4QRCA 2XIXA 1W7HA 3WZDA 3LCTA 5KNJA 1KV1A 4BDHA 5FP5A 5I0BA 5KO1A 2ZDUA 2C1AA 4C62A 1XH9A 5I9VA 4BGHA 3AD6A 2VX1A 1ZYCA 3R7YA 1OIRA 3R73A 4O6LA 1ZY5A 2GMXA 3LIJA 3DNEA 4YBKA 3EN5A 3BELA 3P78A 4JQ7A 4WNMA 1KSWA 4QPSA 3QQJA 5M55A 2FO0A 4U7ZA 2X7OA 3VRYA 1FINA 2WMXA 3F6XA 4TZRA 5CAQA 4TWOA 2XNEA 3EKNA 4BDBA 3PIZA 3QQFA 4J8MA 4CYJA 4DGNA 4WD5A 2X6EA 5L3AA 4PY1A 4DLIA 4HGLA 4E8AA 2Z7LA 4KKHA 3UZPA 3D5XA 1U54A 4XG2A 5DT3A 3NSZA 3BYMA 5AR4A 5H8GA 5IH6A 5FRIA 1Q24A 1F3MC 2VU3A 2YIQA 3OW3A 3W2SA 1O6YA 4KRDA 2P55A 3V8SA 2G1TA 4FTTA 3RPYA 1BYGA 3A4PA 3DOGA 3L1SA 4XCUA 2YM4A 2X2MA 4UX9A 4ZMFA 3QFVA 4ENYA 4GFGA 4RVTA 4ERKA 4XBUA 3UMXA 4FNXA 2FUMA 2GPHA 3OXIA 2FA2A 5A14A 5BVNA 2VX0A 3Q4CA 4IB5A 4BC6A 2G9XA 3COIA 4UWBA 2EXMA 2JDSA 5M56A 1DAWA 1OIUA 3LVPA 3IW6A 3Q9YA 4IX5A 5EI8A 3VS3A 3LZBA 4O0WA 2IVTA 3DJ5A 1NXKA 2XA4A 4D1SA 4NUSA 3KFAA 2PTKA 2GNLA 3H9RA 2OJFE 3D7TB 3PPZA 4GH2A 2NRYA 2YAAA 3UIXA 3P86A 2C3JA 4DGMA 3DNDA 3OCGA 4MNFA 3CC6A 3UVRA 4BCKA 4FYOA 4AFJA 3PJ3A 5J9YA 1V0OA 1OI9A 1ZYLA 2QLUA 4M0ZA 4N6ZA 3ZM9A 3HVCA 3I7BA 3RNIA 5BVFA 3CEKA 4ITHA 4IX6A 1ZMUA 3PJ8A 1FVRA 2QR7A 2ITVA 2CGUA 4Y83A 2B9JA 3KXNA 4I0RA 4EZ5A 5EQEA 3WF9A 4ASEA 2RG6A 5BPYA 4C4FA 3GOPA 2EVAA 4RMZA 1ZYDA 2ZM4A 4JR7A 3RJCA 3QWKA 3UO4A 2GCDA 2H34A 5EI6A 4CXAA 5FTGA 1SVGA 5F1ZA 4IB1A 3OCTA 2PY3A 3FAAA 4DFXE 5LARA 3PDTA 4O0TA 2HZ4A 2VWYA 4ZY5A 2G01A 4IC8A 4DEEA 5K5XA 4YZDA 2W5BA 4C59A 3FZ1A 5J8IA 5AUWA 1L8TA 4HVIA 1H0VA 2V7AA 3TIYA 3U54A 4Y85A 5LVNA 4YJNA 3LFCA 3CY2A 4OTHA 3FZOA 4E26A 3UQFA 3PE1A 5HE2A 4HGTA 4LMNA 3SAYA 2R5TA 2OXXA 3FXWA 4XX9A 3UQCA 3SDJA 4X3JA 2YEXA 4XOZA 5IQCA 1QPCA 1PXKA 1XJDA 2HOGA 3ORMA 5IDPA 4DEDA 2VTMA 5HG9A 4PNKA 3Q9XA 4FNWA 4IXPA 4ASXA 3L9PA 1K2PA 3HUBA 4O7ZA 5AV0A 5AUTA 5F95A 3IECA 3AC2A 2VWIA 4O22A 4R5YA 2IO6A 3CE3A 5DIAA 3R7IA 4L44A 2YLFA 3MFRA 5BUIA 4YZCA 1DM2A 2ZB1A 4FV3A 2W05A 2UZEA 4AGWA 3ZSIA 2P0CA 4AFEA 3IS5A 4FL3A 4QTDA 1YXXA 4IFGA 2ESMA 3M11A 5ETCA 4XOYA 3ZHPC 4BI2A 2KULA 2WQNA 2ITUA 5ANOA 4PMSA 4JQEA 4LOOA 3PRFA 4ZSEA 4MXOA 4WNOA 3NS9A 4U8ZA 4E20A 3PJ2A 3TKHA 4TWCA 4Q9ZA 2VTNA 4E5WA 4FKSA 2DS1A 4JDJA 3ALNA 1Q62A 3PP1A 4HOKA 2BMCA 5AIRA 4OBOA 2ITOA 2GS2A 3FBVA 4O81A 2QKRA 1NT2A 1RJBA 1ZLTA 4IANA 5CEPA 4FKTA 3O8UA 2W06A 3OF0A 3LFFA 4X2GA 3RWQA 5CAUA 2ZVAA 4UWCA 2GNFA 3ORKA 1QMZA 3BU6A 4C61A 3LXLA 4J96A 4RG0A 2J5FA 3IW7A 3ODYX 4FR4A 4DEBA 4FGRA 1W83A 1WBSA 2PSQA 1GIJA 4NFNA 4EOJA 2R4BA 4B8MA 4UYAA 3VUDA 4FUXA 3PVUA 4YC6A 3ZXTA 2FSTX 4R6VA 5KMNA 4RIYA 4J52A 2HYYA 2I7QA 3TKIA 5A4CA 5JGAA 4FIGA 5C1QB 4EWHA 5K9IA 3EQHA 5KUPA 3EFJA 3KA0A 2HIWA 2O63A 5CXZA 4UYNA 3Q4TA 4UB7A 3AGMA 4X21A 2J2IB 2PK9A 4C4JA 4UMRA 4BL1A 3DGKA 2C3LA 4AGCA 3KK8A 2GNHA 5D7VA 4G9CA 2VZ6A 4AA5A 4PL5A 3AMYA 4N70A 3UE4A 3ITZA 3VBXA 4CMOA 3KXZA 5IA2A 2R7IA 4X3FB 3QZIA 1MUOA 1YI6A 3EKKA 1G5SA 4G3FA 4JDIA 4IAIA 4LV5A 4XBRA 3SA0A 3A7FA 3IW5A 3PY0A 3SG8A 4D58A 2E9NA 3R0TA 3W2CA 3E92A 4UMUA 1RQQA 4EOOA 5JFSA 3S2PA 2QOLA 2RGPA 3E8DA 1ZOHA 3VJNA 2WFYA 3ODZX 4O7TA 3OUNB 2C0TA 3FI2A 4CD0A 3Q4ZA 3VN9A 3JVSA 2IVVA 4RZVA 4O83A 2XKEA 4APPA 5E8WA 4TL0A 2JC6A 3DQXA 4ITJA 4M84A 1GY3A 2YJSA 4XH6A 3VAPA 4CFFA 3BPRA 1CKJA 4I6FA 5DE2A 2F4JA 3K54A 2OLCA 4KNBA 4F7NA 4FV1A 2FB8A 5AMNA 3SRVA 4V0GB 4NJDA 3NMUF 4XLVA 4A07A 1JQHA 5TKDA 3MDYA 3HP5A 3OY1A 4YJSA 3NDMA 4YSMA 4DGGA 2CNQA 2I0VA 3CQEA 2WEVA 2QCSA 3MVHA 1YOMA 2RFSA 4BB4A 4H05A 2B53A 4A4LA 3KC3A 4RX9A 4F6UA 4K11A 3S1HA 4RIXB 4FTQA 3SXSA 2YFXA 1IRKA 5AR3A 1K3AA 4BVUA 4O27B 5D7AA 2JDTA 2WTCA 4IMYA 5CXHA 1VEBA 4WUNA 2R3HA 3QC4A 3RPVA 4ARKA 3MTFA 2BRBA 4EH2A 4IH8A 5FWKK 4L67A 3VHEA 4RRVA 2JITA 1IAHA 4BFMA 4BCMA 2PUNA 1OKWA 4CCBA 1O6KA 1LUFA 3VF9A 2H6DA 3E7OA 3R2YA 3DAEA 5AEPA 3V51A 3OY3A 5L2TA 3VIDA 2VTRA 4QMZA 4KKGA 3BWJA 2V62A 4HYSA 3TT0A 1ZMVA 4YZMA 4OT6A 3G90X 3S4QA 1Q5KA 4Z7GA 2W1FA 4ZXTA 2J51A 3DQWA 3R00A 4FV7A 3V5LA 1M14A 3ALOA 2PZPA 2CKQA 1XH7A 2QOCA 2Z60A 4W4XA 1Q41A 4FSWA 5FEEA 2J50A 2WU7A 3MWUA 2C6EA 4DITA 5JRQA 3CIKA 1YOJA
chains in the Genus database with same CATH superfamily
4TYIA 4BKJA 5LWNA 5HESA 4W4VA 2YCQA 4W4YA 3NVMB 2GQGA 3TZ9A 3GI3A 4O7VA 1UU9A 4RC4A 2VD5A 5J7HA 4EZ3A 2XIKA 1VR2A 4NM7A 3UVQA 3QD3A 3NW5A 5EFQA 3GCVA 3PP0A 5EG3A 1HCKA 5L4QA 4FTKA 3FZSA 4MH7A 3IGOA 1CM8A 4PL3A 4RJ5A 3P5JC 1Q61A 3VW8A 4E1ZA 3E87A 3OD6X 4AT4A 5I9YA 3V6SA 4QMVA 5AR8A 3U6IA 3I4BA 5EKOA 5CI6A 1OBDA 3MFUA 4AGDA 3W0RA 4NTTA 3TNPC 3O96A 3K5UA 3OHTA 2XYUA 4LMUA 4AX8A 3V5WA 3ZS5A 5DYJA 2XKDA 2CHLA 1OB3A 1ND4A 3WOWA 2Y8OA 3R02A 1OZ1A 4WIHA 3FL4A 3K3IA 2QU5A 3GCUA 2YHVA 5ETIA 1PKDA 3FXXA 2YWPA 1NVSA 1GNGA 5HLPA 1AD5A 3O7LD 5CU2A 4CFVA 5AV4A 4USEA 3QLFA 4WOVA 2V0DA 4I5HA 2CNUA 1H25A 2UZLA 4KIQA 3ZO2A 4U6RA 4FNZA 5M51A 4EKKA 4U80A 2UZDA 2E9UA 4EHZA 2YZAA 2GFSA 2FVDA 3ZFYA 2XNNA 4DH5A 4AXEA 1YOLA 3LCSA 4X3FC 3SC1A 4WG3A 4TYEA 1OPKA 3FI3A 4XMOA 4F1TA 4ALVA 4DGOA 3V5JA 1YQJA 4FIFA 3GGFA 2Z7SA 1GIHA 3M1SA 3Q32A 4IX4A 2AC5A 4F6WA 5C9CA 1FPUA 2QG5A 3MJ1A 5EW8A 4CGAA 1WMKA 2XJ2A 3VBVA 4YUQA 3GB2A 4MBLA 3C7QA 2QOBA 2R0IA 3WIKA 3OFMA 4O4DA 4QTAA 2XM8A 1FMOE 5EI2A 4CNHA 4EYJA 3BL9A 4C36A 4AE9A 3F82A 2JIIA 4DEIA 1GZ8A 4BDKA 5HTIA 1UU8A 3R71A 3PG3A 2CPKE 5FTQA 4AP7A 4MNEA 4UMQA 3KXMA 3M2WA 1XWSA 4GVJA 4MXZA 4FSUA 4R3CA 4O4BB 2IW9A 3UVPA 4U43A 1B38A 3NCGA 3W18A 3VWAA 4F9BA 1Z5MA 4C37A 2YA9A 3CQUA 4AACA 1U4DA 4UV0A 4G6OA 4TYJA 4EQMA 1J7LA 3MPTA 3PUFC 5DEYA 3ZC5A 1R1WA 1UNLA 2VWUA 4IAZA 5CU4A 4AGUA 3A99A 3WF8A 5A4EA 4EH3A 4L6QA 3KF7A 4QTCA 3AC4A 3TXOA 2J5EA 5JMSA 3IGGA 3DJ7A 3ZRMA 5C4KA 3BHTA 5DR2A 4DHZA 4KSPA 5HICA 3ZLSA 4BTMA 3FHIA 3SXRA 4QP6A 1M17A 2R3QA 3Q52A 3ZU7A 3UPXA 4FG7A 3W2OA 3ANQA 1YW2A 1J1CA 4ACDA 3VVHA 4FZAB 2VWXA 3HAMA 4BBEA 4I22A 4D0XA 4CT1A 3L8XA 3CR0A 2XUUA 4AN9A 3L9NA 5DFPA 5C4LA 3EZVA 4G6NA 3CY3A 3FEGA 1XBAA 1Z9XA 1OITA 3LJ2A 2QR8A 4PWNA 2LAVA 4BCFA 5GJGA 1WFCA 1KE7A 4FVRA 4FKIA 1YXUA 3ZLWA 5LJJA 3UNKA 3IDPA 3HDNA 3VNTA 4FSMA 4K8AA 4EBWA 4IC7A 1P5EA 5M4IA 2PMLX 2VUWA 5DVRA 2PYWA 1JKSA 4PMMA 1TQMA 3MIYA 4WSYA 5FXQA 1DS5A 5J95A 5DT0A 1PXNA 2W5HA 3D94A 4IVDA 4RX5A 5H8BA 4QMMA 2UZBA 3TN8A 4DGLC 3OWLA 3FL5A 3CGFA 3IDBA 4D9UA 2PWLA 3TCPA 2BRGA 5IQAA 3D7TA 4WG4A 4ZJIA 5EM5A 4AZWA 5IA4A 4F99A 1A06A 5FXSA 5AP3A 2J9MA 2WMQA 3S0OA 5IQBA 3PZHA 4JJRA 4UMTA 2OH4A 4O7NA 4DFZE 4E6CA 4RLLA 3UGCA 3IO7A 3K2LA 3QTQA 5BUJA 1ZY4A 3QX4A 2OZAB 5LVLA 3D2IA 2WMBA 2E9PA 3WILA 3CCNA 4ANMA 1H8FA 4I0SA 4RQKA 3R8MA 4LG4A 1H27A 3QHWA 4K33A 2C3IB 2BR1A 3BE9A 3JPVA 2X7FA 2C5XA 4JIAA 4QP9A 3H4JA 2QO2A 3LOKA 5A4QA 1M2PA 4ZTQA 3IDCA 1OBGA 5JZNA 2HY0A 2X0PA 4IZAA 4ZEGA 1ZAOA 1R3CA 4G3EA 4S30A 2VAGA 3IG7A 4EK5A 1UWHA 2A4LA 2CJMA 4J8NA 5DHJA 3ZRLA 3RINA 4JRVA 1LPUA 4NWMA 3DTCA 1KV2A 4MWHA 4OTIA 4L01A 3F2RA 5I3RA 3E8NA 4FT0A 1JKLA 4J97A 2X0OA 4QQ5A 3D2KA 3VC4A 4NCTA 4FKRA 5IZFA 3UOHA 3SD0A 1IR3A 2GS7A 2WOTA 4MKCA 3RMFA 2QHMA 1RDQE 1SYKA 4OUCA 4HVSA 3UO5A 4DCAA 4YO6A 4E7WA 5CT0A 4O1PA 3DAKA 4YMJA 4C0TA 5CAPA 4YTIA 2E9VA 5I5ZA 3VBWA 3R83A 2YABA 2XNBA 2F49A 4QMWA 3Q5ZA 3BRBA 3DLZA 4O82A 5L8KA 5FLFA 4RJ8A 3IQ7A 1YWVA 4ACMA 1HOWA 4IACA 4LGGA 4ZSGA 5HO6A 4ANQA 4WG5A 4G17A 4OAUC 2BILB 3KRWA 4U45A 4ACHA 4C4EA 3U6HA 3PXZA 4XV3A 3AG9A 4B99A 4BWPA 3O0GA 5E9EA 2YN8A 5CNNA 1WBPA 2YACA 4GL9A 2ITYA 4YLJA 5ANJA 5JSMA 3WIGA 4FTCA 5M4UA 3IONA 4AN2A 4OAVB 4BF2A 3FJQE 3BL7A 3WARA 1U59A 3PE2A 5BVEA 4JBOA 2YDJA 5CZHA 1KWPA 1Q8UA 3M42A 3TJDA 4BIEA 4D2VA 3PFYA 4I3ZA 5EDRA 2XYNA 4BDJA 3BV2A 4GK4A 4IAKA 5HLNA 3MH2A 2XBAA 2P33A 1B39A 2DQ7X 4CQEA 1PF8A 4BCNA 5IUIA 2UW0A 3DXQA 4CZTA 3HMPA 3FLWA 3W33A 1M2QA 3Q2JA 4D28A 5I9WA 2C5VA 5B7VA 2Y9QA 3W10A 3EL8A 3U6JA 4BYJA 2GFCA 2BRNA 4GJ2A 5IQEA 4A06A 2GNIA 3EWHA 3FC1X 5BVWA 3DAJA 3LFAA 3HL7A 3LAUA 3HRFA 4BDIA 1GZOA 2R2PA 2QOOA 2XNGA 3D4QA 4A9UA 4BTKA 4GT4A 1VYWA 3HMOA 4EJ7A 5IQHA 4XG7A 4G34A 4FV0A 3ZMMA 4NM0A 2BZJA 4BDGA 3VS7A 5IUGA 2JKKA 4XRLA 3PZEA 2AEGA 4F9AA 5EQYA 4FSTA 5JH6A 5FEDA 4NKSA 4TW9A 3UYSA 4EONA 4EH5A 5B2LA 4Q5EA 3SW4A 4JLCA 4NL0A 2R3NA 3PVGA 5ANGA 4TKSA 4B9DA 1U46A 5GHVA 4EK8A 4C58A 5KZIA 5L8JA 2VGPA 1G8KA 4FV6A 4O0SA 3RAKA 3RCJA 3RCDA 2JAVA 3FKLA 2R9SA 5FD2A 4L45A 4BCOA 4LRKA 4C8BA 2XZSA 2WTKC 4OTFA 2XP2A 4U0IA 4E73A 2LGCA 4V05A 2VTPA 3QTWA 2YIRA 1E9HA 2ZV2A 4D1ZA 3I5ZA 3R04A 4XG6A 2HWPA 3R9DA 4YJTA 1KE5A 3CGOA 3OCBA 4FYNA 2A1AB 1NA7A 1R0PA 4ONAA 3WF5A 5F9EA 3KIOC 4KS7A 1IA8A 3WZKA 3DKGA 2PMNX 2WMSA 3FQHA 2HELA 3LQ5A 3D5UA 4CLJA 3QX2A 3TTJA 4G3DA 2R3IA 2F2CB 3ORTA 3POOA 4RIOA 4H39A 4IWOA 5A9UA 5CF5A 5FTOA 2YM5A 3PXFA 3D0EA 3W2QA 4UEUA 4EOMA 4Z16A 4RIWB 3DZOA 5A3XA 3ATSA 1PXOA 3EMGA 3VUTA 3GU6A 3NUUA 3RM7A 2Y4IB 1K9AA 1W0XC 3T8OA 4CZUA 5CZIA 2X0QA 4IJPA 5BYZA 4W8DA 3T3UA 4G3GA 1OECA 4P90A 3VS2A 3Q04A 3O2MA 3PWDA 3G0FA 2DWBA 4FZFB 2VWBA 4X6RA 4KBKA 4CZYB 3NPCA 4K2RA 4CCUA 3BYOA 2G2IA 3DBCA 4YJVA 5E8TA 2WTKB 4KD1A 3U4UA 4O6EA 2XVDA 2GHGA 5DI1A 5HVYA 1X8BA 5CALA 3KU2A 4A9RA 1MRUA 3GBZA 2WTVA 4ZTSA 3SOCA 4AT5A 1WBTA 2ZM3A 5AP5A 3C4XA 4YJUA 4Z7HA 4IB0A 4JRNA 5L2QA 3KRRA 3B2TA 3D14A 2WTDA 4FNYA 4YGAA 5B0XA 4NIFA 1PRYA 2GQRA 4DTAA 4U41A 3AOXA 5CSVA 3UTOA 1G3NA 3QHRA 2W1ZA 4DTKA 3DB8A 4QQJA 2VNYA 4O96A 2VTQA 3LMGA 4CFMA 3UYTA 3TUCA 2A27A 2YERA 3DS6A 4JI9A 4V0GA 4E6AA 2GQSA 4KUJA 2BFXA 2X0GA 4FSRA 4TRLA 3VS4A 1CMKE 4AE6A 5M09A 4LRJA 1JNKA 2JFLA 2XK9A 2Z7QA 4AF3A 3HV4A 4R77A 5CVGA 1UNGA 2BVAA 4JQ8A 4MAOA 4RZWA 2NRUA 4IVAA 3LPBA 5KBRA 2PMIA 2YDKA 2ZMCA 3EB0A 3E64A 3E7VA 4GCJA 5HHWA 3ZBXA 4H58A 5AM6A 3ZEPA 4E4MA 5A6NA 5IQIA 4IX3A 3F3ZA 4XYFA 3OXZA 2BRMA 3C1XA 3ERKA 2ITWA 2WQMA 2R7BA 3MIAA 4PX6A 3TUBA 4DN5A 2YAKA 5CAOA 1E1XA 3FMKA 5TO8A 4IM2A 5HG5A 5HIBA 2QI8A 2I0YA 4GU6A 3VO3A 1G8AA 4LGHA 3CTQA 4BGGA 2VTLA 1APME 4IM3A 2OXYA 1YRPA 5EM7A 4WO5A 3NGAA 3BHUA 5FDXA 5GZ9A 4O7YA 3THBA 5B2KA 4DH8A 4FTIA 4G5JA 3UIMA 5HBJA 1YWNA 4D9TA 4YO4A 3KN6A 3NAXA 5AP2A 4QYGA 1LEWA 3AT3A 2XK6A 3E3BX 4C38A 3UOJA 1FQ1B 1ZYJA 2OO8X 4MNEB 3QGYA 4XP0A 3AMBA 4ANNA 4ZLOA 3NRMA 2PUIA 5IH5A 2JEDA 4UXQA 2H96A 3CLYA 5KMOA 2A2AA 3DZQA 4JG7A 5TT7A 5AFVA 4XJ0A 3R1YA 2XJ1A 3RPSA 4AUAA 2Y6OA 3C4WA 4AXFA 3QBNA 3A7IA 4FKPA 4BTJA 1ZYSA 5CLPA 4LFIA 5HVKA 3FLZA 4DG0E 2CMWA 4I5PA 4NK9A 3NYOA 5GZAA 1ST0A 3OBGA 3NWWA 1Q3WA 3UG2A 4GS6A 3NNXA 5JK3A 4HVHA 4OLIA 5IQGA 2NP8A 2XK4A 5I9UA 4L8MA 3VUIA 4W4WA 2VO3A 4Z3VA 5FGKA 3OOMA 1BKXA 2C6OA 4RSSA 2VTIA 4AU8A 3EN6A 2VWVA 3DFCB 1H4LA 3NYXA 4FTAA 2FGIA 1UU3A 2Y7JA 4G16A 2W17A 4MD8E 1RW8A 4A7CA 3QC9A 1PMEA 3BI6A 3V5TA 4D0WA 3R6XA 4F9WA 3KVWA 3PJCA 4ANBA 4C3PA 4EC9A 3KXXA 5IEXA 5I9XA 2QOFA 3GVUA 3QAME 3BQCA 3SVVA 2WU6A 3MY1A 4I6BA 2QD9A 2YIXA 4D2TA 3ZONA 1JBPE 4GYIA 4ALWA 4U44A 2UUEA 3QYWA 2GHLA 5DBXA 2KTYA 4D4RA 4K0YA 4HW7A 3JS2A 2BIYA 3R1NA 1PXMA 3BIZA 3U8WA 2F7EE 5ICPA 2BZIB 4YHTA 5ANEA 3DDQA 4TWPA 4XG8A 3PLSA 3TNQB 4BDDA 1MRVA 3GOKA 5ITAA 2FH9A 3UOKA 2YISA 3B8QA 3I79A 1QPEA 4L68A 1XO2B 3P79A 5HG8A 2GNGA 3UMWA 2X2LA 4A9TA 3ORZA 4YZNA 2NPQA 5CX9A 5ETAA 3MJ2A 5JRSA 5KCVA 3A60A 2C69A 1OKYA 3I81A 1YDTE 4RX8A 4U40A 4Y95A 2YZLA 5AP6A 4ZSLA 4QMNA 2VO0A 5AR2A 4FKLA 3U9NA 4Y5QA 3EQIA 2B0QA 1U54B 4RX7A 1Q4LA 4O0VA 4BDCA 2OZAA 4PUZA 4S33A 5EHOA 4I41A 3G2FA 4QYFA 4PPCA 4CVAA 3U51A 3H10A 4P5ZA 4OTPA 2XKCA 4L53A 5HG7A 4ZTMA 4HNFA 4O0XA 2OFUA 2R3OA 4IBMA 2SRCA 4ZS4A 3ZXZA 3C5UA 3OG7A 3EQCA 4AS0A 4FF8A 3JR1A 1TVOA 5I3OA 4F64A 3NNWA 4GFMA 3PTGA 5LXMA 2JKMA 3JYAA 1BL6A 1OUKA 5EKNA 4FTUA 4AXAA 3D9VA 4DH1A 1V0PA 1O9UA 1YVJA 3MVMA 1F0QA 4KKEA 4C3FA 2ZB0A 2JDRA 4WRSA 5IKWA 2GSFA 1P4FA 5IH4A 5HNIX 4IWPA 1OKVA 2V5QA 4QTBA 1WBVA 4ORKA 2GDOA 3ROCA 3PPKA 2HK5A 5EHYA 4F6SA 1XKKA 4XS2A 4DHIB 3QU0A 4Q2AA 3N4UA 2EXEA 4IZYA 4JAJA 3BU5A 1OL6A 3L9MA 5A54A 3LFDA 4GW8A 3ZTXA 2PUPA 2X8EA 4RWJA 4M8TA 5HEZA 2XB7A 4X7QA 5E1SA 4F65A 1H00A 4FV8A 3TDVA 2ITNA 1L3RE 4RGJA 3P9JA 4OT5A 3MA3A 3QYZA 1JSTA 3DB6A 2CNVA 2ONLA 4U81A 3ROYA 2RFNA 1H24A 2ONLC 4XLIA 3P23A 4I94A 3TJCA 4X2JA 4HYUA 4L3LA 1IG1A 2BZHB 3ATTA 2CGXA 4E4NA 1URCA 2HZNA 1OIYA 4QDVA 3R30A 3FWQA 5C01A 2UVYA 4ZJJA 3BHYA 5KX8A 3NVKI 2W99B 4FOBA 4XV2A 2JIVA 4YTHA 4AN3A 1Q8WA 2VTHA 4QYEA 2C68A 4EQUA 1BL7A 2O2UA 5F20A 4QQTA 5D10A 1BLXA 1WAKA 5I9ZA 2YM7A 3KCFA 3BCEA 5DLSA 3NX8A 5DN3A 1MQ4A 5C8MA 3HV7A 4F08A 2RIOA 4AXCA 3O50A 3JY0A 1PYEA 5K4IA 4MVFA 4IW0A 5M44A 4V04A 3TUDA 4DBNA 4DEAA 5JFVA 2W9FB 4AAAA 4RQVA 2FSLX 4FKOA 3KGAA 3FPMA 1Q3DA 1WBNA 2R64A 4NCTC 2WMAA 3MTLA 5AUZA 2RFEA 5J87A 3PPJA 1CSNA 4L42A 4JIKA 2VNWA 3OT3A 4P2KA 2ZOQA 3AT4A 4L3JA 4N4SA 5TE0A 2OKRA 5JGBA 4DBXA 4EHVA 4JBQA 5GJDA 1WVYA 4MXYA 3OZ6A 1QL6A 3RAWA 2OJJA 2C3KA 3LM0A 2PVNA 4DYMA 4FEUA 2VV9A 2YDIA 3FMNA 2W4JA 2EB2A 3C51A 3C4FA 3GQIA 3OWPA 4TTHB 3R8UA 2G2FA 4DC2A 2X81A 2CDZA 3BBTB 3QQLA 1VLRA 3TACA 3KK9A 4FG8A 3D15A 5CU6A 3C0HA 1OUYA 4FX3A 3ZFMA 4BBMA 5JEBA 3QZFA 3ZLYA 3PJ1A 4J1RA 3I5NA 3H0YA 3MA6A 4GT5A 4MXXA 3WE4A 2OF2A 1U5RA 4O91A 1SM2A 4PDSA 2YM6A 1JSUA 4GVAA 4EH8A 2ZMDA 3HGKA 5A46A 2A0CX 3ORIA 4QOXA 3EJ1A 5M07A 4C4GA 2C6MA 1FOTA 4TYGA 2J0MB 2C0OA 3LW0A 4JOAA 4D4VA 3Q4UA 2OIBA 1GZKA 1AQ1A 4NH1A 3P1AA 3FXZA 4R5SA 1W2CA 1SVHA 1UV5A 2VTAA 1Q8YA 3Q6WA 4JNWA 4MF0A 3W32A 1FVTA 2XCKA 4F9CA 2C4GA 1FBNA 3QA0A 4YLKA 5AX3A 3TV4A 2C30A 1H0WA 2XF0A 4ZTHA 4CFUA 2QG7A 3GCQA 5LVMA 4RBLA 1W2FA 1PJKA 1YDRE 1WZYA 2Z2WA 4J53A 3O51A 4XV9A 3RVGA 3MI9A 1PY5A 3AC3A 3EQBA 2WTIA 4BI1A 2NNWB 3UDSA 3D7ZA 3EFKA 2XK7A 3GU4A 4LRMA 3FKOA 2O64A 3FMEA 4MWIA 4IVCA 3ZO1A 3GXLA 4BIDA 3NFGB 2I1MA 3V3VA 4IB3A 3L9LA 4XV1A 1UVRA 3FYKX 3H0ZA 2PMOX 5HNBA 4KA3A 2O8YA 3Q96A 3HECA 2W5AA 2X4FA 4RFZA 2PPQA 4EOIA 4FV9A 4TNDA 3UPZA 1CTPE 3F5XA 4K1BA 4O84A 3IKAA 2WEIA 2PVJA 2OXDA 4Z9LA 4UXLA 4O7SA 4FI1A 5CT7A 4CTCA 3ZLXA 5CASA 3PA5A 5A6OA 2W1CA 3FYJX 4NEUA 3Q5IA 1OL7A 2G15A 3P7AA 3AXWA 4QP1A 5EM6A 5D12A 4FOCA 4EL9A 3PVBA 3QWJA 1J91A 1KE8A 3EQPA 3CPCA 3ZFXA 3QKMA 4O7LA 3R9RA 3B8RA 5IF1A 1XMLA 2FYSA 5BMSA 5EDQA 2HWOA 3T9TA 1P14A 5K3YA 3WYXA 4FSQA 4LYNA 2WXVA 3ANRA 4HZRA 4RJ7A 5KMIA 2UW3A 5AADA 4MEDA 2B9HA 2QOHA 4D55A 3L8PA 3LCKA 4XP2A 1YHVA 4AT3A 4IQ6A 2OU7A 5CY3A 5E91A 2W1DA 3LMIA 4A4XA 2WQEA 3QUDA 4QMLA 3V8TA 4CFWA 3G9NA 3EFWA 4FEWA 5IG1A 4ZMEA 2BPMA 4XP3A 4C7TA 4GK2A 3RAIA 3V5QA 3KQ7A 3FQSA 4IAFA 4RC2A 4TYHA 4LI5A 4PQNA 2YITA 4BIBA 1PKGA 4H3QA 4LV7A 3P7BA 5BVKA 5JQ8A 2R3GA 3MY5A 5EK7A 3PIXA 4CEGA 3KXGA 5DWRA 5B2MA 5FXRA 3F7ZA 3BYUA 1Y91A 2IVUA 2W1EA 4FZ7A 4D5KA 3E3PA 5FM2A 3EFLA 3C4ZA 5CI7A 5G6VA 2X8IA 4YJRA 4E4LA 4QO9A 3BU3A 1H01A 3C4EA 2UZTA 3GFEA 3LQ8A 1M2RA 1SMHA 2OSCA 3EIDA 4S34A 3OWJA 4I93A 2C6LA 4HPUE 4B6LA 4YC3A 4XUFA 3ZDIA 4DE4A 4D2WA 3WI6A 5EW3A 2GS6A 2HW6A 4HCVA 5KBQA 2O3PA 3ENMA 3QRJA 1GZNA 4YNOA 5AAEA 2OGVA 4LUEA 4WRGA 2XK3A 3H9OA 4BR3A 3MSSA 5FEQA 4TNBA 5HOAA 5KMLA 5CYIA 1J1BA 4EORA 2WMRA 4M12A 1Y57A 2XEZA 5G1XA 3O7LB 4BYIA 4QMQA 4L43A 3BKBA 2PULA 4FA2A 3PVWA 4EQCA 1UWJA 3FE3A 2GTNA 3EH9A 5AR5A 4BWXA 4IDTA 3H3CA 4J95A 4R7IA 4Q5HA 5L2WA 5J1WA 3R63A 1MRYA 5C8NA 3EQDA 1KE6A 1XH5A 3FLQA 5D11A 4RWKA 2Q83A 4DHFA 2CKEA 4E6QA 4BZNA 5J9ZA 3QTXA 2A19B 2PVKA 1V0BA 3OW4A 1ZZLA 5GJFA 5M57A 3QCYA 3OXTA 5HX8A 3GCPA 3TV6A 1REKA 5KE0A 4E5AX 5KMKA 4GG5A 3KRJA 4G1WA 4KRCA 4JVGA 4I1ZA 3PA3A 3ULZA 5AUYA 2ZV7A 2C5OA 3KEXA 5IU2A 2UW7A 3OTUA 1VJYA 4IFCA 4NKAA 3HAVA 5CNOA 2X4ZA 4G3CA 3CJGA 4JDKA 4MCVA 4O38A 5H9BA 3MS9A 1GOLA 3F3WA 5LMAA 4Y46A 5J7BA 4II5A 4QYHA 4RJ4A 5IDNA 4V01A 3ENHA 4AW2A 3BHVA 4O0YA 2Z7RA 4BBFA 4YSJA 3LFNA 3A8WA 5CF4A 3HV5A 5LCJA 3DBFA 4ZOGA 3NIZA 4WNPA 1YXSA 2QOIA 4LQMA 4FK6A 1DI9A 5DRDA 5K0XA 4CG9A 3UO6A 4IAYA 4UALA 2Q0BA 3OCSA 4PP9A 4MHAA 2WTWA 3ZUTA 4S32A 2OW3A 3MB6A 4ZY4A 2ZJWA 4CYIA 4RIYB 3CKXA 4PF4A 3P0MA 1YDSE 4QT1A 5L6PA 2B9IA 2V22A 3R22A 5M4CA 4KIPA 4WKQA 1XR1A 2CGVA 1Q97A 3N9XA 3UP7A 2O5KA 4GT3A 4NYEA 2YCRA 1JVPP 4BCPA 3DV3A 3MYGA 3RALA 2C0IA 3BQRA 2YCSA 5F4NA 5H8EA 2C6KA 1JKTA 4FV2A 5KZ0A 3DBQA 3V04A 3NUAA 3UC3A 3MN3A 3NFFB 3AC1A 3QGWA 4MQ1A 4OBQA 2PZ5A 2WELA 3E8EA 4PPAA 1M7QA 2C47A 5HE0A 1DI8A 4M97A 1RE8A 1STCE 3TWJA 1R78A 5AR7A 4YBJA 5AP7A 1B6CB 4C02A 3GCSA 4G2FA 5TF9A 2PVFA 4FBXA 4R7BA 3R01A 4DAWA 1YI3A 2BDWA 2V55A 3G5DA 3I0OA 4RVKA 5AP1A 4X2KA 2QC6A 5HGIA 4B0GA 5JFWA 3Q53A 1S9IA 3QTSA 3Q3BA 4IVBA 4PV0A 4KBCA 4BKYA 2QU6A 2CLXA 2EU9A 2V7OA 3PXKA 4F9YA 3SG9A 2UZOA 3NZ0A 4TPTA 3VBYA 5CU0A 3HLLA 4KWPA 4TN6A 3K3JA 3B2WA 2B54A 4CFNA 3EYHA 3KY2A 4U5JA 4ANSA 4BZDA 3SLSA 1CKPA 2Y4IC 4I92A 2XM9A 3VRZA 1J7UA 4I4EA 2PVHA 5BMMA 1Z57A 3FSFA 4CT2A 3CPBA 2O0UA 1A48A 2R3MA 4O21A 5GIPE 4UBAA 2XCHA 2Y0AA 4CG8A 3NIEA 5CEOA 4YZBA 1YWRA 5DNRA 3FUPA 3I1AA 3KRLA 3TZ7A 4OGRA 2XS0A 3N4TA 4CRSA 4ZAUA 3FPQA 4RLKA 3QTIA 4FTLA 4BZOA 3BEAA 3VS0A 3SOAA 4FIIA 2ERKA 1IASA 2QLQA 3E63A 4DEHA 1H28A 2J7TA 4XNEA 5KKRC 3CTJA 3I60A 2ETKA 2UZUE 5A4LA 4MTAA 1WBOA 4IZ5A 4BGQA 5CANA 3FDNA 3HEGA 1NY3A 3DFAA 4NSTA 2BFYA 2W1IA 1XH6A 4M68A 4D2RA 4F0FA 3DTWA 2IG7A 4R1YA 2YM3A 1JPAA 3UIUA 5DH3A 3F3TA 2F57A 3F66A 5AP4A 2XNOA 3A62A 4OW8A 2P3GX 3GU8A 4EC8A 3E8CA 3EQGA 3ZEWA 2QURA 4JX7A 4C35A 1VZOA 4Y8DA 5E8SA 4ALUA 3VONA 3G0EA 3RHXA 5HX6A 4EOQA 3TNHA 5AUXA 4E3CA 1F5QA 3CJFA 2VTJA 4CV8A 5CSPA 5DMZA 2I40A 4NT4A 4EH9A 2YIYA 3GC8A 2H9VA 2CCHA 4IEBA 4WBOA 4DA5A 4AOJA 1SVEA 4EOKA 4ASDA 4B7TA 4CKJA 3VF8A 4W8EA 5DT4A 2EXCX 5J1VA 4L46A 5LWMA 3BLRA 4L52A 5CSWA 4H1MA 2OF4A 2JDOA 4FKQA 4GJ3A 1TQIA 4IIRA 4KAOA 5H3QA 5K0KA 3ORXA 4EBVA 3EN9A 2P4IA 4XEYA 1Y8YA 3LJ0A 4O2PA 4QQCA 3KRXA 4X6QC 2P2HA 2JKQA 4AOIA 3F5GA 4U42A 4BKZA 2J4ZA 3OC1A 4DFYA 5BUEA 5CEKA 3IOPA 3ZUVA 3G33A 4ACCA 5E8UA 4L00A 2J0IA 3HYHA 4FSYA 4QYYA 4GYGA 4QNYA 4JG8A 1H07A 4FTMA 3LXPA 3W1FA 1KUTA 3O23A 5DR6A 4MUQA 2W1GA 3MPAA 4HYHA 5DRBA 2IVSA 4MYGA 4QP7A 4TYHB 4H1JA 5AA8A 4BWKA 4DH7A 2O65A 5GINE 1FMKA 3FI8A 3CD3A 3QTUA 3IW8A 2HY81 4MQ2A 5IA1A 5AV2A 5EYCA 3BGZA 2PUUA 4K9YA 5CTPA 2BKZA 3A8XA 5TOZA 3BLHA 5CS6A 3RKBA 4GMYA 3V01A 3ZM4A 5FUTA 4J71A 3MY0A 4GV1A 5DOSA 1DAYA 1T45A 2ETRA