3C5UA

P38 alpha map kinase complexed with a benzothiazole based inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
349
structure length
338
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Benzothiazole based inhibitors of p38alpha MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 338
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c5uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c5uA01
4D5KA 3ZXZA 2Q0NA 2R3NA 5HD7A 1L3RE 3OFMA 4FSWA 5HG5A 3GB2A 2CSNA 2VNWA 3H4JA 4CTCA 3MIYA 4JAIA 5IH5A 4AACA 1OVEA 2OJ9A 2A1AB 3IO7A 3O7LD 4HYUA 4XLIA 5ETFA 2OH4A 4CQGA 4FV1A 2OWBA 2PVMA 4XP2A 2ITWA 1OPLA 3R30A 5F1ZA 2WTDA 2W9ZB 4FEUA 3OROA 4MX9A 3PZEA 3TACA 3UMXA 4EQCA 1MRVA 2HXQA 3DK3A 1I44A 3W8QA 1W83A 2VTQA 3E5AA 5DYJA 1WCCA 3F88A 2R3MA 2OIDA 4LRJA 5M51A 4EK5A 5IA4A 1OBDA 2YACA 3AD5A 3LHJA 3PY1A 4GEOA 4PDPA 1KE7A 4UWCA 2V7OA 3BCEA 1HCLA 3LZBA 4IVDA 4YZDA 5EDRA 1A48A 5EQEA 2YM7A 2ONLA 5TT7A 3WZKA 3N4UA 4MCVA 3ANQA 5JGBA 4BN1A 4UMUA 2QOCA 4L6QA 3EJ1A 2HW6A 1M7NA 2WU7A 3FY0A 4LL0A 3LFFA 4XUFA 5FTQA 4B6LA 1FGKA 4FV8A 5CEPA 3OP5A 5AIRA 2B53A 3ZC6A 4F0FA 4ONAA 3BQCA 1F0QA 5CF6A 4UMTA 4FV3A 2XKEA 5H3QA 2W0JA 1XJDA 3NRMA 2XP2A 3ZU7A 2PPQA 2QOQA 3BHTA 2QOHA 5IEXA 4NK9A 3ANRA 4HYSA 3QD4A 3FLNC 4MNEB 4TWNA 3ZO2A 4MWIA 3S00A 4DHFA 2EVAA 2OFUA 5K0XA 1J7LA 5CSWA 5IDNA 2CKEA 2J0KA 3RPSA 1H26A 3F2RA 4YJSA 3OUKA 4I4EA 4AZEA 4FTTA 2ITYA 5A3XA 4HVSA 1JKTA 4N6YA 2OZAA 1U59A 4EC9A 3CSVA 4AU8A 4F0GA 4E26A 1WBSA 2E9PA 5E7RA 3DOGA 2GNHA 2ZM3A 4CFMA 3PPJA 3PXFA 1STCE 2WEVA 3P86A 3PY0A 5J95A 4NUSA 4ID7A 2VAGA 4RLKA 1Q8TA 5E8SA 4M12A 3TNPC 4KRCA 5L8LA 3N9XA 4O83A 3QC9A 3I0QA 2F4JA 3FI2A 4D4RA 2YCSA 2O5KA 3F69A 4KIKB 4GFOA 4LMUA 3MW1A 4QPAA 3RAWA 3IW4A 4HVIA 3JVSA 3SKCA 3PZHA 3E8EA 2F7XE 4G9RA 4Y73A 4O2PA 3R8UA 5AV4A 1BUHA 1WBPA 3RCJA 3V04A 2Z2WA 3F2AA 4G31A 4K8AA 2VO6A 5I9ZA 3VS3A 2HYYA 4W9XA 3TTJA 3VBQA 5AP6A 4PL5A 3ZLYA 1WBOA 3EN5A 5BVEA 1MQ4A 2J90A 2QLQA 3IW6A 3RAIA 4DEEA 1REJA 5AAGA 4FV6A 5DT4A 4YNEA 3BLHA 4CYJA 1URWA 4PPBA 5CI6A 3ZM4A 1YHVA 4XG2A 3C4CA 1H0WA 3OT8A 3FZTA 4YC6A 4CG8A 5HI2A 3U6JA 4RG0A 4F08A 3PA4A 4FV2A 4FZ7A 5FEDA 1OKYA 2VWWA 4IZ7A 4HVHA 5BX0A 3FPMA 3RTPA 4YHTA 3RINA 4NKAA 3R83A 1PRYA 1KOAA 4NCTA 3GU7A 4D2SA 2R3RA 3I7CA 1JAMA 4R3CA 1PXOA 1U54A 1YI4A 3HMNA 4YO4A 1V0BA 1KSWA 4FKSA 4O1OA 4I20A 5A4CA 4X3JA 2UZNA 3A4OX 4KRDA 3LJ0A 3P1AA 4M3QA 2OIBA 3ZLSA 5A9UA 3TWJA 4O7NA 5AX9A 1ZOGA 1G8SA 3U9CA 2A0CX 5KMKA 2J50A 3KXZA 4RWKA 2OXYA 3UPZA 2BUJA 2QCSA 4IWDA 3TUCA 3E92A 1WBWA 3PG1A 1J7UA 4MF0A 3H30A 4O7TA 1XQZA 4TNDA 4QYEA 4D4SA 4GL9A 4WKQA 4Y95A 3FYJX 2VX3A 2XK9A 4U41A 4ZTSA 2XBAA 2OU7A 3BGZA 3BELA 3VJOA 5KMIA 4WSQA 5ANDA 4GJ2A 3ZMMA 4GU6A 2X7OA 2E9OA 5HBEA 5EW3A 4X2KA 3OY1A 3QCYA 3SV0A 4O0VA 4J52A 4PNKA 5M44A 2F49A 3DDQA 5EM5A 3MH0A 5D41A 2JAVA 4DCEA 1NVQA 5KMNA 4FT5A 2V0DA 1IAJA 3LFNA 4FTUA 3ODZX 2PUUA 5FM3A 5HNIX 1QPEA 3FEGA 1U4DA 4BFMA 3RPRA 4IX3A 4DA5A 5GHVA 5CS6A 4H1MA 3MFUA 1BL6A 3I1AA 3F3VA 4FL2A 2UVYA 4G3DA 2YM3A 4Q9SA 4BKZA 3M11A 4DLJA 2AUHA 3PSCA 3QZHA 3NVMB 4F64A 3P5KA 5DPVA 3P9JA 2UZBA 2IVVA 5DE2A 3IOKA 3U51A 1ATPE 4GV1A 2Y7JA 3ZCLA 5CU0A 3ZRLA 5G1XA 3TZMA 2I0VA 3TUBA 2W1ZA 3CR0A 2CKOA 3MGYA 3C50A 4BDKA 4CKRA 2WMUA 2JFMA 2OXXA 4J99A 3POOA 3IDPA 3L8VA 4U3ZA 5FDXA 5M55A 3DBQA 4FZDB 1LR4A 3RJCA 5C8KA 4EZ5A 2DWBA 4PWNA 4GK3A 5BVNA 3R9RA 2C6TA 4LOOA 4TY1A 3DA6A 5C4LA 4XV3A 1Q8YA 4BI1A 4KS7A 5KMOA 4R78A 2HZNA 5BNJA 4OAUC 3NUAA 2O0UA 4GT5A 4NTTA 4I0SA 5CI7A 4AGUA 4JVGA 2WFYA 4EEVA 5J9YA 1PXLA 2C6KA 3GOPA 4Y83A 5BVWA 4L7SA 4E93A 3Q4ZA 4RC2A 5CT7A 4RC4A 5JGDA 2B4SB 4X3FB 3F6XA 5C01A 1FQ1B 2ZV9A 2Z60A 3F7WA 1ZARA 1ZLTA 4YC8A 3VQHA 3W2QA 4L53A 4XLVA 2ZYBA 3ZO3A 1B39A 2XJ0A 2JAMA 1I09A 1IRKA 5AM7A 4EYMA 1Q41A 3QTIA 4QYHA 3EN9A 3FMDA 4FVRA 4O38A 4QQ5A 4DEAA 5HIDA 4JBOA 4USDA 3ZDIA 4AWIA 3QTUA 3D9VA 1YI6A 1Q3DA 3FDNA 4FZFB 3UC4A 2C3IB 5CAQA 3LMHA 2VD5A 5JFXA 2CMWA 3KGAA 4RWJA 5HBHA 1LEWA 5CU2A 2WHBA 2RFDA 2XCHA 5CWZA 3E3PA 3OCSA 2QG7A 4XH6A 2G2IA 2F2UA 4L3LA 2WIPA 3GU6A 4MXCA 2R3LA 4RZVA 5CXZA 3WE8A 3D7TB 4BDCA 2PU8A 4O7RA 4R7IA 3A61A 3SGCA 2ERKA 4NIFB 1XH5A 3D94A 1DAYA 3UDBA 5C03A 5CAUA 4JRNA 5AP7A 1UV5A 1ERKA 1Q62A 4BWKA 3GCUA 4W8EA 3ZUTA 5FXSA 3EL8A 4GS6A 5M06A 2CNUA 2QU6A 2GTNA 4C37A 2Y9QA 2P33A 1LUFA 4M13A 4NEUA 2WQNA 5HVKA 2PZYA 4E7WA 5D12A 2SRCA 1ZXEA 3B2WA 4O82A 3II5A 5HORA 5IQGA 2B7AA 2Y4IC 3CQUA 4L01A 4G2FA 1FINA 4YTHA 3UZPA 2IG7A 3ZEPA 4EWQA 1PMUA 2XJ1A 3W1FA 4MAOA 2WU6A 4QTEA 4KKHA 3TM0A 1AGWA 3WYYA 5HTBA 4FKVA 3LFBA 2VTPA 3L9MA 4S30A 4ZZOA 4G1WA 4YSMA 2X81A 3U8WA 3ACKA 2OXDA 3FJQE 4UWYA 2PE1A 2XNGA 3HUCA 5E92A 4FKWA 1P5EA 5CX9A 4C3FA 2ITQA 3PVGA 4HOKA 4K1BA 4MBJA 3O8PA 4PMMA 3FMJA 1GNGA 2BPMA 4IX5A 4DBXA 3GQIA 2G9XA 2W4JA 3PJ1A 4FNZA 4ITIA 4PV0A 4BIBA 5IF1A 3R7IA 1EH4A 3UO6A 4E5WA 1GJOA 2BVAA 2X7GA 3QXOA 4M8TA 2VWIA 1RJBA 3ROYA 4BTMA 4FNWA 1BL7A 4U9AA 3IGOA 2ONLC 3EN7A 3ENMA 3FL5A 3SG8A 3RZFA 3D0EA 5JQ5A 4EHZA 3UOLA 2X39A 2IN6A 1OI9A 3JY0A 4XJ0A 4I0RA 3H10A 3QHRA 1KV1A 3BU3A 5ANGA 1VR2A 4QP2A 1VZOA 3CC6A 3KMUA 4HZSA 1OZ1A 3WZUA 3ZFYA 2X1NA 3FMLA 1H1PA 2A27A 4HVGA 5A6OA 3HDNA 3QRKA 4LOPA 5JT2A 4BL1A 2NNWB 2RSVA 4IC8A 3RPOA 4YZNA 2GHGA 3SXSA 4C3RA 3R0TA 3LPBA 4L8MA 1Y8GA 3MPTA 5DR9A 3E87A 1PMNA 2BZIB 4BHZA 5GZAA 3D14A 3VS7A 4UMPA 1FMOE 2XIKA 4H3PA 4TWCA 3VHKA 4BDJA 4F7JA 3I6WA 3LFCA 4JR7A 3VULA 1TVOA 4UZHA 3NAYA 4ZY6A 4IAAA 4DGGA 2LGCA 4JXFA 3PP1A 4K11A 4L9IA 2CKPA 3QTWA 4PDOA 4C62A 5E8TA 3OG7A 3R9DA 3HMMA 4KSQA 2QQ7A 4V04A 4W9WA 3UGCA 3ZEWA 4BCOA 3C1XA 5CYIA 4CKIA 5M4CA 3KXNA 1G3NA 3W16A 2CKQA 3TNQB 4JS8A 2BTRA 3IW5A 1XHAA 4R1VA 1P4FA 4FIJA 4I5CA 2CNVA 2QURA 1QMZA 3BYOA 3DBFA 3B2TA 3KFAA 4CFXA 3TDWA 3QRJA 4OTFA 3REPA 2R3PA 3NWWA 4YC3A 4FT9A 2EB2A 2JDSA 2YCRA 2QHNA 3IKAA 2YZAA 4MXOA 4DN5A 2XKDA 3NGAA 5IH6A 4UYAA 4BKYA 4D2TA 5EQPA 3W2OA 2QKRA 2BDWA 3VF9A 4PDYA 2QOFA 3R02A 3HL7A 3JUHA 2V7AA 4GIIA 1B6CB 3BBTB 3UTOA 1M17A 4MD7E 2XIRA 3F3ZA 4D28A 3AC8A 4Z7HA 2C0OA 4YZCA 1DI9A 3DZOA 3MWUA 5BVDA 5J5TA 4EC8A 3LJ2A 3NSZA 4L3PA 3PA5A 4R8QA 5J79A 3NS9A 3TV6A 2VO0A 5E91A 5EHOA 3CTQA 2WTWA 4FIGA 5M56A 4AGWA 2QOBA 4ENXA 5CVFA 4RPVA 1GIJA 2O3PA 3L1SA 4H05A 3SHEA 4NCTC 1OIRA 1OL7A 4ZSGA 4O1PA 3RM6A 5E8VA 2R5TA 2YM4A 4MNEA 5FP5A 3QRTA 2NPQA 3NZ0A 4RVMA 3RMFA 4CZYB 4DINA 2O8YA 5KCVA 5C4KA 4NFNA 4I24A 1FBNA 2VTOA 4CNHA 4ITJA 1IG1A 3QD0A 5HNBA 1U5QA 3EN6A 2E9VA 4IAZA 3RP9A 3Q3BA 4QOXA 3SLSA 1L8TA 3A4PA 3DGKA 4L43A 2I40A 3EMGA 3HEGA 4QYGA 2OK1A 4I3ZA 5CSVA 3AGMA 3FI4A 3EQPA 5E1EA 2PVLA 4FV5A 4OBOA 3U9NA 3THBA 5ANOA 1LPUA 2PVRA 4RJ6A 4ZOGA 4AOJA 3VF8A 4DF3A 2B55A 2OGVA 4Q2AA 5D7VA 2IPXA 2QU5A 2VO7A 4QNAA 4KIKA 2YABA 5D1JA 5EW8A 3G6GA 3KRRA 5GNKA 3LCTA 1SVEA 5JZJA 4MXZA 4D2PA 4EHVA 5FBOA 3WZJA 4ZEGA 4C61A 4NSTA 4MWHA 3TKUA 3HNGA 4FEVA 5IQEA 4QTAA 4JL9A 1Q5KA 3DFAA 4FBXA 4W4YA 4MH7A 5CQWA 4RQKA 4ZZMA 4O6LA 1ZY4A 4CCUA 2W1CA 4FT7A 3GC7A 2BRBA 4FVPA 3Q4UA 5FEEA 4WBOA 2XUUA 3BE9A 1VJYA 4Z16A 3PXRA 4UXLA 4QQCA 5DH3A 1UVRA 3C5UA 3EZRA 4GYIA 3DXNA 3HKOA 4EOIA 5AA9A 5AFVA 4R77A 5DNRA 2R7IA 3QA8A 4WNOA 4JIAA 3A7HA 1W0XC 3GC0A 5CU4A 2XNMA 3K3IA 2XIXA 2ETKA 3EFWA 2X2KA 2C30A 2C6MA 1A06A 4TYJA 4RSSA 4F1OA 5AA8A 5LWMA 4IHPA 3PA3A 4OUCA 1MP8A 4UWBA 4J98A 1BI8A 3BX5A 3C7QA 4GIHA 4Q9ZA 3AD6A 4EORA 2YLEA 3LCDA 4FTMA 5L6WL 3GT8A 4IX6A 2OLCA 1Y57A 1JSTA 5DWRA 3TI1A 4AN3A 4G3FA 4V01A 5CEOA 4DT8A 3ZYAA 5LOHA 5M4UA 3KXGA 3BU6A 3HRCA 4GU9A 4RJ4A 5AUYA 2FGIA 5A4TA 2Y8OA 4C3PA 2C5YA 5EH0A 5M07A 3ORKA 3D5VA 5TF9A 2PY3A 4ITHA 1UKHA 4A9TA 3BLQA 4IM3A 3LE6A 3DAEA 1JKKA 2PK9A 3MDYA 3DDPA 3ZOSA 3R9NA 2AYPA 4GK2A 1H4LA 4U42A 5IH4A 4ZMEA 3KK9A 3DB6A 3DKGA 4NWMA 4D1XA 4YZ9A 4U40A 4IM2A 5T68A 4IJ9A 3VUHA 3LMGA 5JN2A 3VBVA 2I6LA 4AW1A 4K0YA 4TT7A 1R39A 3NYXA 3MV5A 3QRIA 2JD5A 4C4GA 3KMWA 3V8TA 2ITXA 4C8BA 3MN3A 4HYIA 5AX3A 3PTGA 5TKDA 5GIOE 2QR8A 5IQFA 4U45A 2XIZA 4O0UA 4Q5EA 3PLAE 3F9NA 5CNOA 5HTCA 3AMYA 4R5YA 4WO5A 2HW7A 4IE9A 3CGOA 3EKKA 3BV3A 3EKNA 4JDKA 5CVHA 4UMQA 2ITUA 4DEGA 2JIUA 2UW4A 1PXMA 1KE6A 3R2BA 4GMYA 5H8EA 2QVSE 3L8SA 1E1VA 3QZGA 5EI2A 4AZSA 4EK8A 3R7VA 5F95A 3ZTXA 2WELA 2XK8A 3A60A 2GNIA 3T8OA 3UODA 3DTCA 3QLGA 5GZ8A 3HV4A 5JFSA 3CKXA 2UW9A 4I5MA 4J8MA 3Q52A 5DR6A 3V6RA 3BEAA 4CFNA 4O7SA 4DGNA 4F99A 4OTDA 1SVGA 3C4EA 5DBXA 2W9FB 1IA9A 2QD9A 3DNEA 3VS6A 2C0TA 2UZWE 4ZLYA 2VTRA 4ERKA 2IO6A 3FV8A 2C68A 4JBVA 5AV2A 3RZBA 5KKRB 4FG9A 4QTCA 4MQ1A 4IX4A 2CGVA 1FOTA 3AGLA 3ORXA 3PSDA 3OS3A 1OL5A 2VUWA 4C36A 4HCVA 5CEQA 3OBGA 3W33A 3UOKA 3O8TA 3F82A 3PVUA 4RVTA 4RT7A 5IDPA 1XBBA 3KCFA 3R7YA 2JFLA 3BHHA 4I22A 4YR8A 4I41A 3NNWA 2Q83A 4ZJVA 4JDIA 4TNBA 2ITPA 4ARKA 4X3FA 4EH6A 3CPCA 3D2KA 1ZOEA 3AC4A 4CKJA 3QGYA 5HHWA 1IAHA 4E20A 2UZTA 2QG5A 3TV4A 2JDOA 1CDKA 3OOGA 2WIHA 1REKA 4XG6A 4AA5A 4AN2A 3U6HA 2CNQA 5EQYA 5CEKA 3IPHA 4RWLA 3MVMA 3N51A 4UBAA 3DCVA 2FSOX 2WTKB 5LWNA 2PVYA 2OKRA 4L3JA 3MTLA 1ZZLA 5LVNA 2XEZA 3FL4A 2WMQA 3OC1A 3BWJA 1GIHA 1ZYJA 4DG2E 2HWOA 2CDZA 2VNYA 2W5AA 4O0XA 4IADA 3MPAA 5CLPA 3VNTA 4F70A 2P2HA 2UVZA 4L42A 4WG4A 4LM5A 5IA0A 3OW3A 4UY9A 5HO7A 2YM8A 4BRXA 3OXTA 2XBJA 1XH6A 2ZMDA 3D7TA 4QP9A 3TCPA 4CQEA 2QO9A 3FI8A 3QWKA 5AV1A 4QMQA 1T46A 4L68A 3TEIA 1XBAA 4XEYA 4CYIA 4NIFA 1DAWA 2RG5A 2J2IB 3AC2A 3PSBA 4FOBA 4FSYA 5EKOA 1AD5A 2E2BA 4R3RA 3ZO4A 4ANOA 2WTIA 2OI4X 2PE0A 5FEQA 2PULA 3CD3A 3V3VA 1Y91A 5BQ0A 1FVRA 2XK7A 3HMPA 2P0CA 2XH5A 5LMKA 2ZV2A 4MXAA 5CU3A 4OTGA 4ZTMA 5CZIA 3PIZA 2ZB1A 3FAAA 1QL6A 1TKIA 2BIYA 3T3UA 5FTGA 4N4SA 1SZMA 5I9XA 4FE2A 4M66A 3FZOA 2IVUA 3PJ3A 3MFSA 3WZDA 4DG0E 3BPRA 3KRXA 3N4VA 3LIJA 4FTNA 3RGFA 1UNGA 2OF4A 2XM9A 4A4OA 4F9AA 4EBVA 4Y8DA 1GY3A 4WUNA 4ANLA 3AXWA 2C3KA 3AC1A 2Z7RA 4RC3A 4RLLA 2EXMA 5J9LA 1Y6AA 5AR4A 2CN5A 3Q5IA 1PJKA 3GCQA 4OBPA 1OUYA 3AT4A 1M14A 5ANIA 5F4NA 3VBWA 2PE2A 4A9SA 1MRYA 3LXLA 2X0GA 5L8JA 2W17A 1BI7A 2C1AA 2ITNA 2OJFE 2VGOA 1KE5A 4E73A 3D15A 4QP6A 4YU2A 5AADA 4M68A 4C33A 4D9TA 3W10A 1OUKA 1ZMWA 3D2IA 4ERWA 3QU0A 1IASA 4LRKA 3TL8A 5H2UA 3UPXA 4FEWA 3A2CA 4W8DA 4D2VA 3BV2A 2QOLA 2QOOA 5C8NA 4CZTA 4AA0A 2IZUA 4C4FA 3S95A 1OKZA 4CFVA 2PTKA 4TPTA 1O6YA 3ALOA 3FKNA 5I9YA 2XYNA 3VRZA 2C6EA 1F3MC 4CLJA 2HCKA 3AQVA 1P4OA 3ORNA 4IVCA 2BROA 2G15A 4MYGA 4QP8A 2VTLA 4IZYA 5EM8A 4FL1A 4I0TA 5HCYA 5HO6A 5HG7A 3LXNA 3Q9XA 5H8BA 3Q9YA 3OCBA 3SXRA 4YNOA 4HCTA 1OL1A 1WFCA 2CLXA 3FQHA 2XKFA 4QMSA 3R7UA 5KUPA 2BZHB 4PP7A 5ETCA 4EH2A 1Q97A 3KULB 4D2RA 3EFKA 3IW8A 1Q8UA 3DKFA 3QA0A 2ETMA 2OG8A 3MY0A 3F66A 5AEPA 4KNBA 5FQDC 3VUDA 1J91A 1HOWA 1H1WA 5L6OA 4U5JA 3RI1A 1SYKA 5CNNA 5CT0A 5HVYA 3CQEA 4EOKA 5K5XA 4CFFA 4YURA 2XK6A 4O2ZA 2R3JA 1WBVA 3Q9WA 3AT3A 1PYXA 2OIQA 2YJRA 3LCKA 5EOBA 5IA5A 2A4LA 2GS2A 3CIKA 2GFSA 3P79A 4G6OA 4RIWB 4WRSA 4YLJA 4BCHA 4CT2A 3LFAA 4FTLA 2VTHA 1JSVA 4G6LA 4H1JA 4JG7A 5HD4A 4USFA 4CMUA 4PDSA 3D5XA 1NVRA 1ZYCA 3G33A 1J3HA 4TTHB 3ZC5A 5DVRA 5LMAA 4O96A 3T9IA 2BRGA 3I81A 3LJ1A 1SM2A 4YJOA 2B52A 2KTYA 4HW7A 4X2NA 4IC7A 3BQRA 2XK4A 4GK4A 2VX1A 5GINE 3BYSA 3EQHA 4NZWB 5HEZA 2C69A 4UB7A 5C27A 2XRWA 4X0MA 4YJNA 2F57A 4P90A 3P7BA 4ZJJA 3VS4A 2PVFA 4YZMA 2E9NA 2VWYA 5DN3A 3DJ5A 3TIZA 1PXIA 4E4NA 3CE3A 4CD0A 4U97A 4AXAA 1PKDA 4PY1A 3K54A 4H36A 1E9HA 2OJGA 4WNKA 1W82A 4LGHA 2UUEA 5JEBA 1S9JA 1AQ1A 3SXFA 3LXKA 4E5AX 4JRVA 3DPKA 4LV5A 4XOZA 3R9HA 2XKCA 3TV7A 3VQUA 3CGFA 4MXYA 2QC6A 4LUDA 2ITVA 3HMOA 4H58A 3PIYA 4FNYA 5EYDA 3V5JA 2WQBA 3NVKI 3LM5A 3ZRMA 4GH2A 4FA2A 3RAKA 4ZLOA 5IISA 4FKGA 2X4ZA 3PRIA 3ENHA 4IFCA 3RK9A 4NU1A 4KINA 4OW8A 4CZUA 3ELJA 4IXPA 4C34A 3O96A 3WIGA 4EHEA 2R0IA 3L9LA 2YM5A 2IW9A 4QMTA 2QHMA 3COIA 2GQSA 3GGFA 4YGAA 1Q8WA 2XNPA 3S0OA 3F61A 4CMTA 3LCSA 4OBQA 2WXVA 3H3CA 4JX3A 3PXYA 4FSUA 3PRFA 4CGAA 3I7BA 4AE6A 4F7SA 5LJJA 3PLSA 3JS2A 4GG7A 1YWRA 4GFMA 2WMWA 2RFNA 3FXXA 3KRJA 5CSXA 4BKJA 1PKGA 3CPBA 2XZSA 3ET7A 1A9UA 1YOLA 5DFPA 2VV9A 4XCUA 4EH3A 5L2IA 4JOAA 3DFCB 3OWPA 2RG6A 4G17A 3E63A 2RFSA 4RQVA 4TN6A 3R7OA 3O71A 4A9UA 3RWPA 2VTJA 4BTKA 4EQMA 1TQIA 2JITA 2A19B 3IONA 5JMSA 4XBRA 2VX0A 4PQNA 2X8DA 3PVBA 5ANEA 4DTAA 2W4KA 2YZLA 2HIWA 4L7FA 4FV0A 5BVKA 4E6AA 4F7LA 1JNKA 4GJ3A 2WMAA 2XK3A 4EJNA 4JAJA 3QQGA 4O6EA 4LYNA 4GRBA 3UIXA 4D1ZA 3UIBA 3O23A 4GCJA 4H3QA 4J96A 4TYEA 5LCKA 3UBDA 3EWHA 3O7LB 4FG8A 5EW9A 3TXOA 4G9CA 3TZ8A 2QOKA 2XMYA 3FMEA 1QPCA 2Y6MA 5K3YA 4BF2A 4N6ZA 5CEMA 4BDBA 3K2LA 2JDRA 4BDHA 2GFCA 3KMMA 3QCSA 4WRGA 3HP5A 3FE3A 4RRVA 3GP0A 5LVMA 1O9UA 5L2TA 3ITZA 3R28A 1ZWSA 2H9VA 4PL3A 5E8ZA 4ENYA 3E7VA 5FXRA 1OITA 1UU8A 2UZUE 4BTJA 5F94A 5J87A 5AAEA 4I4FA 3TZ7A 5LVOA 4S33A 4FNXA 4MTAA 5E4HA 2I0EA 5GZ9A 4TXCA 5FM2A 3M1SA 4BBFA 2JIIA 2P2IA 4YSJA 3WYXA 4DH7A 3FKOA 4C0TA 4NT4A 4GT4A 2O63A 4X3FC 1FVTA 1V1KA 4M7IA 4GSBA 5C26A 4DCAA 4N0SA 4QMWA 5M08A 4YO6A 4FF8A 3KN6A 3FUPA 2GS6A 4EOQA 5J8IA 1Q61A 3ZSGA 4CFUA 4ZIMA 1Q3WA 4ZP5A 5A14A 4CSVA 3HLLA 1H0VA 4GVJA 3HRBA 4KA3A 5TE0A 4I93A 2JDVA 2BZKB 3T3VA 3I79A 4O27B 4UV0A 3R00A 5AMNA 1PMVA 3QUDA 4YLKA 5IUIA 4S31A 3GOKA 4C57A 1X8BA 5E8YA 3UJGA 3NUYA 3OTUA 2YITA 3HV3A 3I60A 4CFWA 3S2PA 3C0HA 3UVQA 3ZZEA 4FKRA 2BRHA 2HAKA 2C6DA 4FKIA 4HPTE 5IG1A 2YFXA 3QQJA 1M2QA 4GKIA 3IOPA 4RIYB 1ZAOA 3LFDA 4W4WA 3GXLA 5DMZA 4AZFA 4O81A 4YBKA 2GHMA 2WEIA 1YI3A 3LQ5A 3GFEA 3MA6A 3NR9A 3HUBA 4JG6A 4NJ3A 1BX6A 2WTJA 4R3PA 2YCQA 4RIXB 4MQ2A 3F3TA 4MBLA 3TNWA 1T45A 3EFJA 4ZXTA 1P2AA 2V55A 4EHGA 5AV3A 4CVAA 3MSSA 4DFLA 4WUAA 5LMKC 3IECA 5IQIA 3DBCA 1ZY5A 3UC3A 4TRLA 5CTPA 3KXMA 2QKWB 3G0EA 3WARA 4CCBA 1GZOA 3Q6WA 3GENA 3ZLXA 4F1TA 5K4JA 1DI8A 3F5GA 3DK6A 5L2QA 3HDMA 3QF9A 2UZOA 1Z57A 5LVPA 4LV8A 1H28A 4X2JA 5AR7A 5T6KA 4AW0A 4FTJA 3CKWA 5HE0A 4HGLA 4H3BA 4U6RA 3KVWA 5DRDA 3VJNA 4EOOA 2VN9A 3ZHPC 3ORPA 3ZONA 3VBTA 4LMNA 4XS2A 5I9WA 3ZRKA 3JR1A 1M2PA 4OT6A 3ZH8A 2ZV7A 4B8MA 2OO8X 4D2WA 2EXEA 2VWBA 3KA0A 3F2NA 3BKBA 5FXQA 2X6DA 3A62A 4RJ3A 3VIDA 4AFJA 5IEYA 3PDTA 3VUIA 5KHWA 4QPSA 2ESMA 2PYWA 4PF4A 3DJ6A 2UW8A 3NIZA 5BUJA 4BBMA 4IIRA 3U6IA 3FZRA 3MFTA 5HICA 4IBMA 1ZMUA 3Q2MA 4IM0A 2F9GA 4H39A 3PE1A 5TOZA 2C6LA 2CJMA 2PL0A 1OIUA 2UW0A 2PMOX 3GBZA 3HA6A 3MBLA 4FV4A 3NUPA 1BLXA 4AT4A 2FSMX 4KKEA 4F4PA 4FIFA 2CCIA 3W2SA 5J7HA 2I0HA 1W8CA 4O0WA 2ZM4A 4UYNA 4FV7A 3L8PA 4ANMA 4K77A 5CAOA 3PP0A 4IZ5A 2QONA 3HYHA 4II5A 4XRLA 4Y5QA 4IDVA 5EG3A 4FTKA 4J97A 4P5QA 2OJIA 5CU6A 3QQUA 4IZAA 5CASA 4K9YA 4BDGA 4PP9A 4IH8A 3BHUA 4O7ZA 3U87A 1PY5A 2YHVA 4QQJA 1APME 3MVLA 3KQ7A 3OOMA 2YWVA 2W7XA 3O0GA 1YWVA 4WIHA 3OBJA 3HAVA 4O7WA 4HGSA 3A99A 1JBPE 3V5PA 3S4QA 4B7TA 2BCJA 2YDJA 2B9HA 4JQ7A 1K3AA 2DS1A 2R3IA 2BFXA 2YAAA 2B9IA 2YEXA 4QMUA 3OZ6A 2ZDUA 1H01A 2B1PA 4JNWA 2QNJA 3UOJA 3QD2B 3WI6A 1UA2A 3OWLA 4ZMFA 3UOHA 2WMBA 1K9AA 4ALVA 2IJMA 3R1QA 2IW8A 4J95A 2JC6A 4M14A 5AUXA 4NM7A 1OKVA 2BIKB 4FI1A 4S2ZA 4M0ZA 5AR3A 5HNGA 3PPZA 5BMSA 4WBBB 3SX9A 4R7HA 4ANQA 5A6NA 5AUUA 1CKJA 3V5QA 5LVLA 3SRVB 2WOTA 4WG3A 3R71A 2REIA 4KWPA 5DEWA 2GSFA 2W5HA 4ZAUA 3UIUA 2VO3A 3WOWA 2C6OA 3DLZA 3SQQA 3QTSA 2PUIA 1E1XA 4O7VA 4IAFA 1OBGA 4XRJA 3H9FA 3DLSA 2ERZE 5IQAA 3VUMA 5HCZA 2EB3A 3L9PA 2W96B 4FTCA 5A4EA 4KIPA 3UZTA 2J7TA 4IW0A 3OCTA 3ZUUA 3UNJA 1OIYA 4BCMA 4DFZE 5B2MA 3F3UA 2Y6OA 3R8PA 4A4LA 5KNJA 1UWHA 3SC1A 2OJJA 2VTIA 4ASXA 3GCVA 3W18A 3FPQA 4ACGA 4ACHA 1Q99A 2VGPA 4BDIA 4XX9A 5CENA 2C5XA 4ALWA 4AQCA 2HZ0A 3C9WA 4RVKA 3DAJA 4O84A 4FKPA 2EXCX 3E8CA 3OD6X 3KULA 5BUIA 2XS0A 5BYLA 3QYZA 4BYJA 2JKMA 5JFWA 3EN4A 4BGHA 1WVXA 3PYYA 3D7ZA 4QMNA 4I94A 4RWIA 5AP3A 2UZLA 2CGXA 4GG5A 4FK6A 3VO3A 1WAKA 2BMCA 2ZAZA 5BMMA 5L2SA 2UW6A 3UG2A 4BWXA 3LKMA 1JOWB 3SOAA 3QUEA 4FUXA 4I6BA 2R3QA 3OXZA 3BYMA 3C0GA 4A07A 2HENA 4EONA 4EZ3A 3UP7A 4RIWA 3N4TA 3ZM9A 3KL8A 3UYSA 2NRUA 2GNLA 5KMLA 2LAVA 3WF8A 3R6XA 5DEYA 4TL0A 1HCKA 4FIHA 3VAPA 2WQOA 4BIEA 4J71A 3UMWA 3CEKA 3MPMA 3OTVA 4QYYA 5EOLA 3TDVA 3P0MA 4EH4A 3MFRA 4EKKA 3E8DA 2V62A 3IQ7A 4OGRA 5HU9A 1ZYSA 3HZTA 5CAPA 1YKRA 2ZDTA 3PIXA 1JKLA 4ZSLA 4UALA 5AUZA 3KRWA 1GOLA 3UNKA 1YHWA 3CY3A 1IEPA 1MQBA 2OH0E 4EK3A 1K2PA 3OW4A 4DFBA 4YUQA 2C5VA 1RQQA 3W32A 3MH3A 4UN0C 4AOTA 3Q04A 4YHJA 4JBPA 3CD8A 4UXQA 4CRLA 2BAQA 2F7EE 2BKZA 2VTNA 4XNEA 4YJTA 3QL8A 3HVCA 3KXHA 2ETRA 3EQDA 1OKWA 2OFVA 3F3WA 3FHIA 1W84A 2XYUA 3Q4TA 2JLDA 3QBNA 4IAIA 3JXWA 1P14A 3E8NA 3LAUA 4LRMA 5DLSA 4D5HA 5KBRA 3SG9A 2HELA 5C8MA 3COKA 1XH7A 4KIQA 3ZBXA 3G90X 4O21A 4X2GA 3GQLA 4FSMA 5AP4A 4BB4A 3QGWA 2G1TA 4YJVA 3VUTA 4B9DA 3ID6C 2W99B 3DKCA 5JQ8A 2AC5A 3BYVA 3C4ZA 4L46A 3WILA 4QMMA 4JDHA 2YERA 3B8RA 3QZFA 3VW8A 5AWMA 4FEXA 3EQRA 1YQJA 1Z5MA 2X6EA 3K5VA 4AG8A 4Z7GA 5CXHA 4BIDA 5F9EA 4IWOA 2ZB0A 4EH7A 3P23A 5T3QA 4YLLA 4J7BA 5AV0A 3VS2A 4EL9A 2BZJA 5HGIA 2C1BA 4IAYA 4A06A 4YBJA 4O91A 5AP5A 3O8UA 3P4KA 1O6LA 1MUOA 4YMJA 1YOJA 4ZTNA 3PVWA 2Z7QA 3KY2A 1UNHA 4HGTA 2R64A 2B54A 3LXPA 4DYMA 5EDPA 3DXQA 5IUHA 5JSMA 4YJRA 4X6RA 2YM6A 2C0IA 4AX8A 4DAWA 2OZOA 2WOUA 4JIKA 3ORLA 4X6QC 1SNXA 2GS7A 3TTIA 3MH2A 4ACDA 1J1BA 4ZK5A 4USEA 2JBOA 3IS5A 3PFQA 4N57A 3RHXA 4DEIA 2RIOA 4QP3A 2O65A 1YXTA 2XB7A 3L8XA 4JX7A 2J5EA 4EOSA 2BHEA 4YJPA 2FO0A 5HZNA 4G3CA 5IPJA 4QMZA 3FBVA 3QTXA 4NJDA 2W1DA 4PPCA 2GU8A 4CLIA 1H08A 3QWJA 2C47A 5D9HA 4QQTA 4AZVA 5I0BA 4KAOA 4IANA 3Q4CA 5ICPA 1PMEA 2YIYA 3UQFA 4HYHA 3EQFA 3FZPA 4OTQA 4Y46A 4BYIA 3NLBA 5CSPA 4OTHA 4MEDA 5BYYA 3R8MA 3RHKA 3IK3A 5TR6A 2BKKA 4KB8A 3TN8A 3W2CA 2W05A 2W1HA 4HNIA 2G2HA 3VRYA 1FMKA 4BCPA 5KKRC 1KUTA 4FTAA 2VWVA 5H9BA 4FT0A 1PHKA 4DH5A 4RJ5A 5AP2A 3LFSA 4ZTRA 3Q32A 4RFYA 5H8GA 2W1IA 5IA2A 4TYIA 2CLQA 4GT3A 2BAKA 5KO1A 3P08A 3HX4A 3PXQA 3RKBA 3H9OA 4AP7A 3LMIA 1XH8A 1YVJA 3H0ZA 1J7IA 2CGWA 1QCFA 1TQPA 4F9YA 1VYZA 2GNGA 1OL2A 4E3CA 2IVSA 4XOYA 5HG9A 5KHXA 4LI5A 5L8KA 3QFVA 4DH8A 4WA9A 1RE8A 4AOIA 3DT1A 4DEHA 2EWAA 3ZUVA 1WVWA 3A8WA 1UU9A 4RMZA 3RK5A 2W5BA 5EM6A 3NNVA 2WNTA 3LFEA 2R2PA 3QKLA 2UZVA 3VBXA 4JQEA 5DGZA 3V5WA 2X8EA 4V0GB 2WTKC 2HZ4A 3SW4A 4W4XA 3AMAA 3PXZA 4E1ZA 3DQWA 4DFNA 5E90A 1W98A 4M15A 4RFZA 4YTIA 4BC6A 3E3BX 3PPKA 2C3LA 4WSYA 3ZS5A 4TWPA 2GQRA 5K9IA 4XYFA 2NRYA 5JGAA 5IA3A 1OPKA 4M69B 2GTMA 4IEBA 4FICA 4HJOA 2ZMCA 4XP0A 3FI3A 4O0YA 5HKMA 4O0RA 3H0YA 5HESA 5L4QA 3GNIB 4DGOA 3R8ZA 5DRBA 4E6DA 3AC3A 2UV2A 1LEZA 4RIYA 3TKIA 4TYHB 4J8NA 3NDMA 3DNDA 2JKOA 5DA3A 3EOCA 3Q53A 3NAXA 4U0IA 5ACBC 2O2UA 4O22A 4MD8E 3TZ9A 4B99A 3D5WA 4K6ZA 4EK6A 2J51A 2C6IA 3R04A 2UW7A 3H9RA 3K5UA 3Q96A 4RIXA 4WNMA 2H6DA 2VTTA 4B8LA 4DTKA 1UNLA 5M09A 5DR2A 3CS9A 2UVXA 4AGCA 4JJRA 4YP8A 3U4WA 3ULZA 4FZAB 4XG8A 1UU3A 3SW7A 2BDFA 4ANSA 3QRUA 4F1MA 2BDJA 4ZZNA 5K5NA 3ZSIA 2WQEA 4EYJA 3PE2A 2GNFA 1OPJA 3DBDA 4RIOA 5IKWA 5FTOA 3AT2A 3DK7A 3G5DA 3QLFA 5DT0A 5EI8A 3ORMA 3NIEA 3NCZA 3DB8A 3U4UA 2WMSA 4EWHA 3ZFXA 4C7TA 5K4IA 3MY5A 4MD9E 2WMTA 3QYWA 3BU5A 2VTAA 4E8AA 5IMXA 5HBJA 1KWPA 5M4FA 1YRPA 4RX7A 3TT0A 4PMPA 1NW1A 4GVAA 3UZRA 3BRBA 1KV2A 3WIKA 3TKHA 3I5ZA 3LLTA 5B0XA 5IQHA 3M42A 2RFEA 5HX6A 4P7EA 4PUZA 3BBWA 3FKLA 3NCGA 3F5PA 3A8XA 5EDQA 5FP6A 2Z7SA 2QI8A 3PWYA 3A7FA 4C2VA 4FSNA 2RF9A 3DBEA 3W2PA 2B9FA 4HZRA 3V5LA 3R21A 2PZIA 3OWKA 3NW5A 4TZRA 3DV3A 4EI4A 4RA4A 4RGJA 3VHEA 5HO8A 4FKLA 4FK3A 4QNYA 3WF7A 4GFGA 4HGEA 2IWIA 4RJ7A 4F09A 5AUTA 1ZOHA 1SMHA 4ASDA 4IWQA 1FVVA 5B2KA 4Z55A 2YLFA 5ANKA 5HIBA 3NMUF 4NYEA 2XNEA 3R1NA 3TIYA 2BRNA 3R01A 5I9UA 3EZVA 5FGKA 4OTPA 5HQ0A 3B8QA 3R8LA 1XWSA 2ITTA 3COHA 2EU9A 2YAKA 4I21A 4QD6A 2ZV8A 5DI1A 4X2FA 2RL5A 3G6HA 2C3JA 3DS6A 4I5PA 4APCA 1WBNA 2Y0AA 3CLYA 2ZJWA 3NUUA 3RALA 1DS5A 1Q8ZA 1CSNA 3RM7A 5GIPE 3FQSA 1OGUA 4M0YA 2YIWA 5K0KA 5KX8A 4IWPA 4MK0A 1GZNA 3FWQA 5KMMA 4LL5A 1NVSA 5EHLA 3BYUA 3DZQA 2Y4PA 3PG3A 3TUDA 1PXJA 2YJSA 2X7FA 5DG5A 4N70A 3RWQA 3S3IA 3KCKA 2ACXA 4BCIA 1XO2B 1H25A 2WKMA 3IG7A 5J1VA 3MB7A 4IACA 3I6UA 4I92A 4CMOA 4EUUA 4ZSEA 3OY3A 5EYKA 3SOCA 5M53A 3FMKA 4D0WA 5A4LA 4GW8A 5JKGA 3JPVA 2F7ZE 2P55A 3KN5A 4R6VA 5E8XA 3TNIA 3UQCA 3SRVA 2XM8A 4BWPA 2OSCA 4AT5A 4FTOA 5G6VA 3L9NA 1ZMVA 4FODA 3E62A 5CAVA 2O64A 5E8UA 5EYMA 4E4LA 4G34A 2GPHA 4BZNA 2FVDA 4IB3A 3SAYA 4UEUA 4FIIA 4GUEA 4KS8A 4DITA 1KE9A 1MRUA 4NW5A 4BCGA 3QTZA 4QTDA 3UIMA 4OTWA 3FSKA 4IB0A 4PL4A 3VC4A 2XVDA 2VTSA 4GUBA 3ZXTA 2PZ5A 3QTRA 1CTPE 4XP3A 2GQGA 1GZKA 2C4GA 4Q5HA 2UZDA 2P4IA 1YXVA 3ZDUA 2C5OA 1F5QA 2QR7A 2PVHA 4FSRA 1OMWA 3R22A 4U3YA 3ACJA 4YZBA 4JDJA 4D9UA 3LFQA 5M4IA 4ORKA 1U5RA 3M2WA 4NW6A 3CQWA 4Y72A 3ULIA 3HGKA 3MJ2A 3HMIA 3QKKA 5F20A 3WF9A 3O51A 5HLWA 3ZFMA 1OIQA 2V5QA 5B2LA 4FYOA 4ZTQA 1O6KA 4DC2A 1XH4A 4CEGA 4D1SA 1G5SA 3FXWA 4CXAA 3SA0A 3FMNA 1NA7A 2JKKA 3LM0A 4B0GA 1YDTE 4IDTA 4V05A 4QMXA 4J53A 3SDJA 3WZEA 4FGRA 4O86A 4E4MA 2BALA 3PY3A 5GJGA 4EKLA 4KABA 5JZNA 5BVOA 4JQ8A 1YDRE 3NUNA 3Q6UA 3HECA 3VUGA 4E5BA 4MVFA 3R7EA 3ODYX 1M2RA 2ZVAA 4PRJA 4IFGA 3GCPA 5FLFA 4BCKA 4IQ6A 5BPYA 4UX9A 3CCNA 5IA1A 3F5UA 3VS0A 4APPA 1H00A 4BICA 4BGQA 3A7IA 4C02A 2DUVA 2PVKA 3EFLA 3EQCA 3NEWA 5I3OA 4BHNA 5J7BA 5IQBA 2ITZA 3G9LX 3C4WA 1UKIA 4Y5HA 4DH3A 4EOJA 4FKOA 5J1WA 5HLNA 2VWXA 4PX6A 1WZYA 4QP7A 4BZOA 5L3AA 3BZ3A 2H8HA 3DJ7A 1PXKA 4CTBA 2UW5A 1JQHA 2R4BA 4LOQA 1YXXA 4J1RA 4AN9A 5IMEA 3JYAA 3G0FA 4C35A 3HV7A 3KVXA 4A7CA 4AW2A 4FKQA 4AS0A 3QCXA 4L44A 4RFMA 4BI0A 5JRSA 1GZ8A 1OB3A 2WPAA 3ZSHA 3O2MA 5LARA 5I4NA 2R9SA 1ZZ2A 2YWPA 5BVFA 1VEBA 3DAKA 4NM0A 3QX4A 2YIRA 3COMA 4P5ZA 4PMTA 4C2WA 4F6SA 5EKNA 5FWKK 2CGUA 2PMLX 3LLAA 4FX3A 3W8LA 4CRSA 2WMVA 3MTFA 2WTCA 2NP8A 2W1EA 2H96A 2JDTA 2PWLA 3AOXA 3AD4A 2VTMA 3BEGA 3EYHA 4HNFA 4ALUA 4ASEA 3FC1X 3DXPA 3NNUA 3R7GA 1UU7A 3ETAA 4KSPA 3GI3A 3NPCA 2WMRA 3VWAA 4BCFA 4QT1A 3E64A 4NTSA 2F2CB 3MI9A 2X9FA 3QQKA 4C58A 5AJQA 3BHYA 5EHYA 3EH9A 3CY2A 5CALA 4XBUA 3FLZA 3LCOA 4AFEA 5E8WA 5DT3A 4A4XA 2X9EA 5HLPA 3C4FA 3O50A 3UYTA 1PF8A 4AUAA 5JK3A 4NKSA 4D58A 4I6HA 3OHTA 3FYKX 2A2AA 3GC9A 2H34A 2HWPA 3IW7A 4KKGA 5CF8A 4DT9A 4RX8A 3SD0A 2JKQA 3R1YA 3I5NA 4K2RA 3TJCA 2JEDA 4BDDA 4U8ZA 2OF2A 4TW9A 3V5TA 4FMQA 5D10A 3GFWA 4NFMA 2DQ7X 5ITAA 4HCUA 5AP1A 3VBYA 3QD3A 1R1WA 2I1MA 2HOGA 3W55A 4HPUE 2R7BA 3UE4A 1NT2A 4KBAA 2WGJA 3FLWA 4D55A 2IW6A 4I5HA 4KBKA 3EB0A 2W06A 4ACCA 1YW2A 2VZ6A 3WF5A 1VYWA 2X2MA 3WE4A 4AT3A 1BKXA 3QKMA 3UVRA 1SNUA 3UO5A 4FL3A 2Y4IB 1KOBA 2B0QA 2ITOA 4K18A 4TWOA 3UO4A 2ZOQA 3AC5A 2OICA 3E88A 5DHJA 2CPKE 1DM2A 1W7HA 3BI6A 4R7BA 1G8AA 4R5SA 3FZ1A 3IDBA 4JT3A 1XR1A 2R3OA 2IVTA 1R3CA 5HOAA 2E9UA 2R3FA 4QRCA 5CQUA 4UMRA 3RNYA 2BTSA 5AR5A 1XBCA 4KBCA 3RPYA 1PXPA 5HE2A 4DFYA 2PVNA 2W4OA 2EUFB 3AG9A 3GU5A 3PUPA 4IMYA 5C9CA 4A9YA 1R78A 3O17A 3KREA 3MYGA 3JVRA 3Q5ZA 2QO2A 2HY81 3EYGA 5BYZA 3QALE 2VWUA 3KXXA 4ZTLA 5KZ0A 3FMHA 4ACMA 3ERKA 3RK7A 2CN8A 2JGZA 1GAGA 3ALNA 4AA4A 3C51A 4MNFA 4JBQA 4QP4A 2R3HA 4IVAA 5ANJA 4QMYA 4FTQA 5IQCA 4EBWA 4K33A 2YDIA 2XRUA 4IB5A 1CKPA 3UQGA 4FKJA 3FLSA 2FB8A 4CV9A 3MVHA 5ACKA 3RPVA 5L6PA 3KF7A 2GCDA 4EH9A 4EOLA 5IQDA 4F6WA 5FD2A 4DEBA 4AF3A 3FQEA 2RGPA 2XF0A 5EFQA 5HIEA 3KKVA 4BDEA 1H1QA 2XA4A 3QQFA 1Y6BA 2BAJA 2HK5A 2J0MB 2HY0A 4FSZA 3EQGA 3QQHA 3R1SA 4V0GA 3V01A 3VS5A 3VS1A 3W2RA 5B7VA 1CM8A 3EHAA 3NYNA 3VN9A 4XV2A 3QQLA 5I3RA 3OEFX 2XNNA 2WQMA 3E93A 2OZAB 2QOIA 4ZTHA 4U43A 4MKCA 5CZHA 4YPSA 4M69A 4QMLA 2Z7LA 3IDCA 3GEQA 3NUXA 1YWNA 1OECA 3LVPA 4U79A 4IB1A 3KF4A 2PMNX 3CJGA 4BVUA 4ANNA 4D4VA 3EIDA 4YJQA 4JR3A 4TYHA 1H1SA 3CJFA 3MB6A 4FOCA 5E9EA 2YN8A 1J1CA 3VW6A 3RNIA 2YISA 2CHLA 4RZWA 4B4LA 3OXIA 3TNHA 3PXKA 3Q2JA 2J0IA 1ZRZA 2PZRA 4CT1A 2WB8A 3D4QA 3GU8A 4FR4A 4L45A 5EM7A 5HG8A 4D0XA 2PSQA 1ZYLA 4DE4A 4G3GA 3JY9A 4O0TA 1JPAA 1KE8A 4GKHA 4YJUA 3NW6A 4RX9A 3BGQA 5JH6A 2DYLA 3FXZA 4FTIA 3WF6A 2OW3A 3C13A 1WMKA 4Z9LA 4EOMA 4JG8A 3G51A 3T9TA 4MXXA 5HCXA 2X8IA 5AAFA 5KBQA 4F7NA 4Z3VA 4F9CA 3VVHA 4DH1A 4UZDA 4DGLC 4WG5A 2WAJA 2WO6A 2W1FA 2XCKA 3C0IA 3ZLWA 4ZY5A 5EI6A 4BTFA 2JBPA 4AGDA 3QHWA 1U54B 3TG1A 4AZWA 4X21A 4FSQA 1OL6A 4QPMA 2B9JA 4RBLA 3OMVA 4EJ7A 2J0JA 3FY2A 4LFIA 4YPDA 4LQMA 4E4XA 4ZSAA 3GC8A 4XG4A 4DTBA 3TJDA 3C4XA 3MS9A 4AZTA 3OWJA 2YIQA 2ZM1A 3R63A 1FPUA 4AE9A 4FTRA 5CSHA 4BR3A 3FLYA 4PPAA 3V8WA 3RBWA 3AMBA 4FGBA 4DFXE 5CF5A 3U55A 4TYGA 4FUYA 3PWDA 4I6FA 3MIAA 3A7JA 3OUNB 4FYNA 4WD5A 4QP1A 4X7QA 4ZS0A 4OTIA 2R3GA 1B38A 2UW3A 4EH8A 3HAMA 3RCDA 5CY3A 4ZJIA 1NXKA 1WVYA 2BHHA 3MY1A 1QPJA 1CMKE 1RW8A 4FSTA 4LG4A 5CVGA 2NO3A 4A9RA 5I9VA 4E6CA 3KRLA 4BCQA 4MF1A 3QC4A 4FKUA 1M52A 4EH5A 5JRQA 4OR5A 1YDSE 3OT3A 4WOVA 3NX8A 3NUSA 4F9BA 3UVPA 4EZ7A 4XHKB 2IZTA 3CXWA 5EYCA 5FG8A 3BHVA 1BYGA 5IZFA 1BMKA 5GJDA 3PJ2A 4S34A 4LUEA 5J9ZA 3NYVA 4LGGA 4XV1A 4ZSJA 3OVVA 3Q9ZA 1GIIA 2J0LA 2GDOA 4R1YA 4W4VA 4YHFA 1IR3A 2XJ2A 5FBNC 3ZO1A 5HTIA 5AUVA 2PUPA 2R0UA 5TO8A 1QPDA 4IJPA 4U80A 3ORTA 4BI2A 3BWFA 4KD1A 3DQXA 3QUPA 2RKUA 5AR8A 3ATSA 3MESA 2WD1A 5D11A 3VUKA 1JKSA 5HVJA 4DEDA 2XNOA 4KIOA 2BR1A 2UZEA 4Y85A 4F9WA 4FKTA 1S9IA 5DOSA 4BZDA 5AM6A 4OLIA 4PTGA 2FYSA 1WBTA 4FEQA 5I5ZA 3CTHA 4BDAA 3E7OA 1SVHA 2YA9A 4M97A 4L67A 5LCJA 2PHKA 3UP2A 5AR2A 2KULA 4PNIA 1YXUA 2QO7A 3QX2A 5ETIA 4C38A 1Z9XA 3QZIA 2Q0BA 2IZSA 5CF4A 4C4IA 4EQUA 5GJFA 3DY7A 1URCA 3I4BA 4D4YA 4EK4A 4O7YA 4G5JA 4C59A 3SVVA 3HA8A 3NYOA 1H27A 2J4ZA 1U46A 4TKSA 3POZA 4FVQA 4NL0A 1V0PA 4I1ZA 3HP2A 4QO9A 3GUBA 3KB7A 5HU3A 4BDFA 3PJ8A 4FIEA 3LOKA 5KZIA 4I6QA 5LMBA 1IA8A 3R8VA 4RVLA 2PUNA 5HE3A 5M57A 3GVUA 3WBLA 2JIVA 3QTQA 3DKOA 3HV5A 1R0EA 2GNJA 4I23A 3HV6A 1OM1A 5LXMA 2FA2A 3HRFA 1UWJA 4FC0A 4DLIA 4GYGA 3DTWA 4LGDA 3QCQA 1PXNA 2J9MA 4RA5A 5HX8A 2Z8CA 3LQ3A 1XH9A 4IAKA 2XEYA 4AW5A 3FLQA 3FHRA 1NY3A 3R73A 5IUGA 2G2FA 1Y8YA 2BFYA 2IZRA 2OBJA 4ZS4A 3QXPA 3A7GA 1H24A 1M7QA 1XKKA 3BE2A 3MVJA 1FGIA 2HXLA 4ZLZA 3P7AA 5JFVA 2I7QA 2I0YA 4C4JA 3KC3A 2FSTX 3OF0A 3KK8A 3DU8A 2BRMA 3PJCA 4U81A 4ANBA 4XG3A 5IU2A 3P78A 1JLUE 4CG9A 5AP0A 3KU2A 4JI9A 4E6QA 2AC3A 4QMPA 2WTVA 3RVGA 4RX5A 5A54A 4C4EA 3CBLA 4BCNA 5A46A 2W1GA 2GHLA 2R3KA 4F0IA 4FZ6A 4F65A 3Q60A 3V8SA 5CANA 4WNPA 3BGPA 3MH1A 1JSUA 4HVDA 2J5FA 4XV9A 3ROCA 2G01A 2FUMA 2HZIA 5CEIA 4KUJA 3FZSA 4QMVA 3BIZA 3LQ8A 4FT3A 5C1QB 3ZBFA 3GU4A 2P3GX 4JLCA 3P7CA 4P4CA 2QODA 3ORIA 2FH9A 5KE0A 2YIXA 4IVBA 4L52A 5E1SA 4L00A 3NW7A 4F6UA 2XIYA 3R9OA 1ND4A 1JWHA 5AUWA 1Q24A 2PZPA 1YOMA 2WMXA 4PTCA 4C4HA 3D83A 3G9NA 4G6NA 4WHZA 3U54A 1PYEA 4NM3A 2QLUA 4P2KA 4QYFA 3LW0A 1PW2A 4XG7A 1JVPP 5ETAA 2PMIA 1R0PA 1H1RA 1V0OA 4M67A 4BCJA 4F63A 4YTCA 1H07A 3EQBA 3CP9A 4G5PA 4FG7A 2C5NA 2YCFA 3R2YA 4WT6A 1LP4A 4QMOA 3BLRA 2VU3A 5HE1A 1CKIA 5A4QA 3C5IA 1ZYDA 4DFUA 4FV9A 5AIKA 4RJ8A 3MJ1A 3G15A 3ORZA 1YHSA 2GMXA 3FSFA 2FSLX 4G16A 2V22A 2BILB 3EQIA 5D7AA 4U44A 4ASZA 2X2LA 4G3EA 4DBNA 5KMJA 3F5XA 3OEZA 3G2FA 5LQFA 3KEXA 4PTEA 3V6SA 4DGMA 4AAAA 4DG3E 3F7ZA 2J6MA 5BUEA 2X4FA 3IGGA 2CCHA 5J5SA 5L2WA 3EL7A 3GCSA 5IEVA 1Q4LA 4M84A 4BY9E 3UNZA 4QTBA 3OCGA 2PVJA 4BBEA 3FC2A 4XG9A 2VWZA 4ZY4A 3S1HA 4S32A 4OAVB 5FUTA 4O7LA 3RAHA 5DIAA 3D5UA 3MA3A 4MBIA 3UG1A 4CV8A 4MHAA 2Z02A 3NNXA 2WZJA 2VRXA 4U7ZA 5EK7A 5FDPA 2YDKA 4OTRA 4NH1A 4EOPA 4NM5A 4O0SA 4EUTA 4PMSA 3QAME 1YXSA 2XNBA 4OT5A 3FMMA 4YTFA 1H8FA 1RDQE 3K3JA 4BGGA 3ZZWA 3ATTA 5FRIA 3V51A 1TQMA 3CTJA 3I0OA 4XMOA
chains in the Genus database with same CATH superfamily
4D5KA 3ZXZA 2Q0NA 2R3NA 5HD7A 1L3RE 3OFMA 4FSWA 5HG5A 3GB2A 2CSNA 2VNWA 3H4JA 4CTCA 3MIYA 4JAIA 5IH5A 4AACA 1OVEA 2OJ9A 2A1AB 3IO7A 3O7LD 4HYUA 4XLIA 5ETFA 2OH4A 4CQGA 4FV1A 2OWBA 2PVMA 4XP2A 2ITWA 1OPLA 3R30A 5F1ZA 2WTDA 2W9ZB 4FEUA 3OROA 2A98A 3PZEA 4MX9A 3TACA 3UMXA 4EQCA 1MRVA 2HXQA 3DK3A 1I44A 3W8QA 1W83A 2VTQA 3E5AA 5DYJA 1WCCA 3F88A 2R3MA 2OIDA 4LRJA 5M51A 4EK5A 5IA4A 1OBDA 2YACA 3AD5A 3LHJA 3PY1A 4GEOA 4PDPA 1KE7A 4UWCA 2V7OA 3BCEA 1HCLA 3LZBA 4IVDA 4YZDA 5EDRA 1A48A 5EQEA 2YM7A 2ONLA 5TT7A 3WZKA 3N4UA 4MCVA 3ANQA 5JGBA 4BN1A 4UMUA 2QOCA 4L6QA 3EJ1A 2HW6A 1M7NA 2WU7A 3FY0A 4LL0A 3LFFA 4XUFA 5FTQA 4B6LA 1FGKA 4FV8A 5CEPA 3OP5A 5AIRA 2B53A 3ZC6A 4F0FA 4ONAA 3BQCA 1F0QA 5CF6A 4UMTA 4FV3A 2XKEA 5H3QA 2W0JA 1XJDA 3NRMA 2XP2A 3ZU7A 2PPQA 2QOQA 3BHTA 2QOHA 5IEXA 4NK9A 3ANRA 4HYSA 3QD4A 3FLNC 4MNEB 4TWNA 3ZO2A 4MWIA 3S00A 4DHFA 2EVAA 2OFUA 5K0XA 1J7LA 5CSWA 5IDNA 2CKEA 2J0KA 3RPSA 1H26A 3F2RA 4YJSA 3OUKA 4I4EA 4AZEA 4FTTA 2ITYA 5A3XA 4HVSA 1JKTA 4N6YA 2OZAA 1U59A 4EC9A 3CSVA 4AU8A 4F0GA 4E26A 1WBSA 2E9PA 5E7RA 3DOGA 2GNHA 2ZM3A 4CFMA 3PPJA 3PXFA 1STCE 2WEVA 3P86A 3PY0A 5J95A 4NUSA 4ID7A 2VAGA 4RLKA 1Q8TA 5E8SA 4M12A 3TNPC 4KRCA 5L8LA 3N9XA 4O83A 3QC9A 3I0QA 2F4JA 3FI2A 4D4RA 2YCSA 2O5KA 3F69A 4KIKB 4GFOA 4LMUA 3MW1A 4QPAA 3RAWA 3IW4A 4HVIA 3JVSA 3SKCA 3PZHA 3E8EA 2F7XE 4G9RA 4Y73A 4O2PA 3R8UA 5AV4A 1BUHA 1WBPA 3RCJA 3V04A 2Z2WA 3F2AA 4G31A 4K8AA 2VO6A 5I9ZA 3VS3A 2HYYA 4W9XA 3TTJA 3VBQA 5AP6A 4PL5A 3ZLYA 1WBOA 3EN5A 5BVEA 1MQ4A 2J90A 2QLQA 3IW6A 3RAIA 4DEEA 1REJA 5AAGA 4FV6A 5DT4A 4YNEA 3BLHA 4CYJA 1URWA 4PPBA 5CI6A 3ZM4A 1YHVA 4XG2A 3C4CA 1H0WA 3OT8A 3FZTA 4YC6A 4CG8A 5HI2A 4F78A 4O4EA 3U6JA 4RG0A 4F08A 3PA4A 4FV2A 4FZ7A 5FEDA 1OKYA 2VWWA 4IZ7A 4HVHA 5BX0A 3FPMA 3RTPA 4YHTA 3RINA 4NKAA 3R83A 1PRYA 1KOAA 4NCTA 3GU7A 4D2SA 2R3RA 3I7CA 1JAMA 4R3CA 1PXOA 1U54A 1YI4A 3HMNA 4YO4A 1V0BA 1KSWA 4FKSA 4O1OA 4I20A 5A4CA 4X3JA 2UZNA 3A4OX 3W0QA 4KRDA 3LJ0A 3P1AA 1ST0A 4M3QA 2OIBA 3ZLSA 5A9UA 3TWJA 4O7NA 5AX9A 1ZOGA 1G8SA 3U9CA 2A0CX 5KMKA 2J50A 3KXZA 4RWKA 2OXYA 3UPZA 2BUJA 2QCSA 4IWDA 3TUCA 3E92A 1WBWA 3PG1A 1J7UA 4MF0A 3H30A 4O7TA 1XQZA 4TNDA 4QYEA 2IF8A 4GL9A 4WKQA 4Y95A 4D4SA 3FYJX 2VX3A 2XK9A 4U41A 4ZTSA 2XBAA 2OU7A 3BGZA 3BELA 3VJOA 5KMIA 4WSQA 5ANDA 4GJ2A 3ZMMA 4GU6A 2X7OA 2E9OA 5HBEA 3AKLA 5EW3A 4X2KA 3OY1A 3QCYA 3SV0A 4O0VA 4J52A 4PNKA 5M44A 2F49A 3DDQA 5EM5A 3MH0A 5D41A 2JAVA 4DCEA 1NVQA 5KMNA 4FT5A 2V0DA 1IAJA 3LFNA 4FTUA 3ODZX 2PUUA 5FM3A 5HNIX 1QPEA 3FEGA 1U4DA 4BFMA 3RPRA 4IX3A 4DA5A 5GHVA 5CS6A 4H1MA 3MFUA 1BL6A 3I1AA 3F3VA 4FL2A 2UVYA 4G3DA 2YM3A 4Q9SA 4BKZA 3M11A 4DLJA 2AUHA 3PSCA 3QZHA 3UDSA 3NVMB 4F64A 3P5KA 5DPVA 3P9JA 2UZBA 2IVVA 5DE2A 3IOKA 3U51A 1ATPE 4GV1A 2Y7JA 3ZCLA 5CU0A 3ZRLA 5G1XA 3TZMA 2I0VA 3TUBA 2XANA 2W1ZA 3CR0A 4DHJA 2CKOA 3MGYA 3C50A 4BDKA 4CKRA 2WMUA 2JFMA 2OXXA 4J99A 3POOA 3IDPA 3L8VA 4U3ZA 5FDXA 5M55A 3DBQA 4FZDB 1LR4A 3RJCA 5C8KA 4EZ5A 2DWBA 4PWNA 4GK3A 5BVNA 3R9RA 2C6TA 4LOOA 4TY1A 3DA6A 5C4LA 4XV3A 1Q8YA 4BI1A 4KS7A 5KMOA 4R78A 2HZNA 5BNJA 4OAUC 3NUAA 2O0UA 4GT5A 4NTTA 4I0SA 5CI7A 4AGUA 4JVGA 2WFYA 4EEVA 5J9YA 1PXLA 2C6KA 3GOPA 4Y83A 5BVWA 4L7SA 4E93A 3Q4ZA 4RC2A 5CT7A 4RC4A 5JGDA 2B4SB 4X3FB 3F6XA 5C01A 1FQ1B 2ZV9A 2Z60A 3F7WA 1ZARA 1ZLTA 4YC8A 3VQHA 3W2QA 4L53A 4XLVA 2ZYBA 3ZO3A 1B39A 2XJ0A 2JAMA 1I09A 1IRKA 5AM7A 4EYMA 1Q41A 3QTIA 4QYHA 3EN9A 3FMDA 4FVRA 4O38A 4QQ5A 4DEAA 5HIDA 4JBOA 4USDA 3ZDIA 4AWIA 3QTUA 3D9VA 1YI6A 1Q3DA 3FDNA 4FZFB 3UC4A 2C3IB 5CAQA 3LMHA 2VD5A 5JFXA 2CMWA 3KGAA 4RWJA 5HBHA 1LEWA 5CU2A 2WHBA 2RFDA 2XCHA 5CWZA 3E3PA 3OCSA 2QG7A 4XH6A 2G2IA 3W0MA 2F2UA 4L3LA 2WIPA 3GU6A 4MXCA 2R3LA 4RZVA 5CXZA 3WE8A 3D7TB 4BDCA 2PU8A 4O7RA 4R7IA 3A61A 3SGCA 2ERKA 4NIFB 1XH5A 3D94A 1DAYA 3UDBA 5C03A 5CAUA 4JRNA 5AP7A 1UV5A 1ERKA 1Q62A 4BWKA 3GCUA 4W8EA 3ZUTA 5FXSA 3EL8A 4GS6A 5M06A 2CNUA 2QU6A 2GTNA 4C37A 2Y9QA 2P33A 1LUFA 4M13A 4NEUA 2WQNA 5HVKA 2PZYA 4E7WA 5D12A 2SRCA 1ZXEA 3B2WA 4O82A 3II5A 5HORA 5IQGA 2B7AA 2Y4IC 3CQUA 4L01A 4G2FA 1FINA 4YTHA 3UZPA 2IG7A 3ZEPA 4EWQA 1PMUA 2XJ1A 3W1FA 4MAOA 2WU6A 4QTEA 4KKHA 3TM0A 1AGWA 3WYYA 5HTBA 4FKVA 3LFBA 2VTPA 3L9MA 4S30A 4ZZOA 4G1WA 4YSMA 2X81A 3U8WA 3ACKA 2OXDA 3FJQE 4UWYA 2PE1A 2XNGA 3HUCA 5E92A 4FKWA 1P5EA 5CX9A 4C3FA 2ITQA 3PVGA 4HOKA 4K1BA 4MBJA 4QEBA 3O8PA 4PMMA 3FMJA 1GNGA 2BPMA 4IX5A 4DBXA 3GQIA 2G9XA 2W4JA 3PJ1A 4FNZA 4ITIA 4PV0A 4BIBA 5IF1A 3R7IA 1EH4A 3UO6A 4E5WA 1GJOA 2BVAA 2X7GA 3QXOA 4M8TA 2VWIA 1RJBA 3ROYA 4BTMA 4FNWA 1BL7A 4U9AA 3IGOA 2ONLC 3EN7A 3ENMA 3FL5A 3SG8A 3RZFA 5BV3A 3D0EA 5JQ5A 4EHZA 3UOLA 2X39A 2IN6A 1OI9A 3JY0A 4XJ0A 4I0RA 3H10A 3QHRA 1KV1A 3BU3A 5ANGA 1VR2A 4QP2A 1VZOA 3CC6A 3KMUA 4HZSA 1OZ1A 3WZUA 3ZFYA 2X1NA 3FMLA 1H1PA 2A27A 4HVGA 5A6OA 3HDNA 3QRKA 4LOPA 5JT2A 4BL1A 2NNWB 2RSVA 4IC8A 3RPOA 4YZNA 2GHGA 3SXSA 4C3RA 3R0TA 3LPBA 4L8MA 1Y8GA 3MPTA 5DR9A 1W2FA 1PMNA 2BZIB 3E87A 4BHZA 3D14A 3VS7A 5GZAA 4UMPA 1ST4A 1FMOE 2XIKA 4H3PA 4TWCA 3VHKA 4BDJA 4F7JA 3I6WA 3LFCA 4JR7A 3VULA 1TVOA 4UZHA 3NAYA 4ZY6A 4IAAA 4DGGA 2LGCA 4JXFA 3PP1A 4K11A 4L9IA 2CKPA 3QTWA 4PDOA 3PFYA 4C62A 5E8TA 3OG7A 3R9DA 3HMMA 4KSQA 2QQ7A 4V04A 4W9WA 3UGCA 3ZEWA 4BCOA 3C1XA 5CYIA 4CKIA 5M4CA 3KXNA 1G3NA 3W16A 2CKQA 3TNQB 4JS8A 4AQKA 2BTRA 3IW5A 1XHAA 1XMLA 4R1VA 1P4FA 4FIJA 4I5CA 2CNVA 2QURA 1QMZA 3BYOA 3DBFA 3B2TA 3KFAA 4CFXA 3TDWA 3QRJA 4OTFA 3REPA 2R3PA 3NWWA 4YC3A 4FT9A 2EB2A 2JDSA 2YCRA 2QHNA 3IKAA 2YZAA 4MXOA 4DN5A 2XKDA 3NGAA 5IH6A 4UYAA 4BKYA 4D2TA 5EQPA 3W2OA 2QKRA 2BDWA 3VF9A 4PDYA 2QOFA 3R02A 3HL7A 3JUHA 2V7AA 4GIIA 1B6CB 3BBTB 3UTOA 1M17A 4MD7E 2XIRA 3F3ZA 4D28A 3AC8A 4Z7HA 2C0OA 4YZCA 1DI9A 3DZOA 3MWUA 5BVDA 5J5TA 4EC8A 3LJ2A 3NSZA 4L3PA 3PA5A 4R8QA 5J79A 3NS9A 3TV6A 2VO0A 5E91A 5EHOA 3CTQA 2WTWA 4FIGA 5M56A 4AGWA 2QOBA 4ENXA 5CVFA 4RPVA 1GIJA 2O3PA 3L1SA 4H05A 3SHEA 4NCTC 1OIRA 1OL7A 4ZSGA 4O1PA 3RM6A 5E8VA 2R5TA 2YM4A 4MNEA 5FP5A 3QRTA 2NPQA 3NZ0A 4RVMA 3RMFA 4CZYB 4DINA 2O8YA 5KCVA 5C4KA 4DDIA 4NFNA 4I24A 1FBNA 2VTOA 4CNHA 4ITJA 1IG1A 3QD0A 5HNBA 1U5QA 3EN6A 2E9VA 4IAZA 3RP9A 3Q3BA 4QOXA 3SLSA 1L8TA 3A4PA 3DGKA 4L43A 2I40A 3EMGA 3HEGA 4QYGA 2OK1A 4I3ZA 5CSVA 3AGMA 3FI4A 3EQPA 5E1EA 2PVLA 4FV5A 4OBOA 3U9NA 3THBA 5ANOA 1LPUA 2PVRA 4RJ6A 4ZOGA 4AOJA 3VF8A 4DF3A 2B55A 2OGVA 4Q2AA 5D7VA 2IPXA 2QU5A 2VO7A 4QNAA 4KIKA 2YABA 5D1JA 5EW8A 3G6GA 3KRRA 5GNKA 3LCTA 1SVEA 1G8JA 5JZJA 4MXZA 4D2PA 4EHVA 5FBOA 3WZJA 4ZEGA 4C61A 4NSTA 4MWHA 3TKUA 3HNGA 4FEVA 5IQEA 4QTAA 4JL9A 1Q5KA 3DFAA 4FBXA 4W4YA 1TFFA 4MH7A 5CQWA 4RQKA 4ZZMA 4O6LA 1ZY4A 4CCUA 2W1CA 4FT7A 3GC7A 2BRBA 4FVPA 3Q4UA 5FEEA 4WBOA 2XUUA 3BE9A 1VJYA 4Z16A 3PXRA 4UXLA 4QQCA 5DH3A 1UVRA 3C5UA 3EZRA 4GYIA 3DXNA 3HKOA 4EOIA 5AA9A 5AFVA 4R77A 5DNRA 2R7IA 3QA8A 4WNOA 4JIAA 3A7HA 1W0XC 3GC0A 5CU4A 2XNMA 3K3IA 2XIXA 2ETKA 3EFWA 2X2KA 2C30A 2C6MA 1A06A 4TYJA 4RSSA 4F1OA 5AA8A 5LWMA 4IHPA 3PA3A 4OUCA 1MP8A 4UWBA 4J98A 1BI8A 3BX5A 3C7QA 4GIHA 4Q9ZA 3AD6A 4EORA 2YLEA 3LCDA 4FTMA 5L6WL 3GT8A 4IX6A 2OLCA 1Y57A 1JSTA 5DWRA 3TI1A 4AN3A 4G3FA 4V01A 5CEOA 4DT8A 3ZYAA 5LOHA 5M4UA 3KXGA 3BU6A 3HRCA 4GU9A 4RJ4A 5AUYA 2FGIA 5A4TA 2Y8OA 4C3PA 2C5YA 5EH0A 5M07A 3ORKA 3D5VA 5TF9A 2PY3A 4ITHA 1UKHA 4A9TA 3BLQA 4IM3A 3LE6A 3DAEA 1JKKA 2PK9A 3MDYA 3DDPA 3ZOSA 3R9NA 2AYPA 4GK2A 1H4LA 4U42A 5IH4A 4ZMEA 3KK9A 3DB6A 3DKGA 4NWMA 4D1XA 4YZ9A 4U40A 4IM2A 5T68A 4IJ9A 3VUHA 3LMGA 5JN2A 3VBVA 2I6LA 4AW1A 4K0YA 4TT7A 1R39A 3NYXA 3MV5A 3QRIA 2JD5A 4C4GA 3KMWA 3V8TA 2ITXA 4C8BA 3MN3A 4HYIA 5AX3A 3PTGA 5TKDA 5GIOE 2QR8A 5IQFA 4U45A 2XIZA 4O0UA 4Q5EA 3PLAE 3F9NA 5CNOA 5HTCA 3AMYA 4R5YA 4WO5A 2HW7A 4IE9A 3CGOA 3EKKA 3BV3A 3EKNA 4JDKA 5CVHA 4UMQA 2ITUA 4DEGA 2JIUA 2UW4A 1PXMA 1KE6A 3R2BA 4GMYA 5H8EA 2QVSE 3L8SA 1E1VA 3QZGA 5EI2A 4AZSA 4EK8A 2XAOA 3R7VA 5F95A 3ZTXA 2WELA 2XK8A 3A60A 2GNIA 3T8OA 3UODA 3DTCA 3QLGA 5GZ8A 3HV4A 5JFSA 3CKXA 2UW9A 4I5MA 4J8MA 3Q52A 5DR6A 3V6RA 3BEAA 4CFNA 4O7SA 4DGNA 4F99A 4OTDA 1SVGA 3C4EA 5DBXA 2W9FB 1IA9A 2QD9A 3DNEA 3VS6A 2C0TA 2UZWE 4ZLYA 4QDVA 2VTRA 4ERKA 2IO6A 3FV8A 2C68A 4JBVA 5AV2A 3RZBA 5KKRB 3KIOC 4FG9A 4QTCA 4MQ1A 4IX4A 2CGVA 1FOTA 3AGLA 3ORXA 3PSDA 3OS3A 1OL5A 2VUWA 4C36A 4HCVA 5CEQA 3OBGA 3W33A 3UOKA 3O8TA 3F82A 3PVUA 4RVTA 4RT7A 5IDPA 1XBBA 3KCFA 3R7YA 2JFLA 3BHHA 4I22A 1W2DA 4YR8A 4I41A 3NNWA 2Q83A 4ZJVA 4JDIA 4TNBA 2ITPA 4ARKA 4X3FA 4EH6A 3CPCA 3D2KA 1ZOEA 3AC4A 4CKJA 3QGYA 5HHWA 1IAHA 4E20A 2UZTA 2QG5A 3TV4A 2JDOA 1CDKA 3OOGA 2WIHA 1REKA 4XG6A 4AA5A 4AN2A 3U6HA 2CNQA 5EQYA 5CEKA 3IPHA 4RWLA 3MVMA 3N51A 4UBAA 4LDTA 3DCVA 2FSOX 2WTKB 5LWNA 2PVYA 2OKRA 4L3JA 3MTLA 1ZZLA 5LVNA 2XEZA 3FL4A 2WMQA 3OC1A 3BWJA 1GIHA 1ZYJA 4DG2E 2HWOA 2CDZA 2VNYA 2W5AA 4O0XA 4IADA 3MPAA 5CLPA 3VNTA 4F70A 2P2HA 2UVZA 4L42A 4WG4A 4LM5A 5IA0A 3OW3A 4UY9A 5HO7A 2YM8A 4BRXA 3OXTA 2XBJA 1XH6A 2ZMDA 3D7TA 4QP9A 3TCPA 4CQEA 2QO9A 3FI8A 3QWKA 5AV1A 4QMQA 1T46A 4L68A 3TEIA 1XBAA 4XEYA 4CYIA 4NIFA 1DAWA 2RG5A 2J2IB 3AC2A 3PSBA 4FOBA 4FSYA 5EKOA 1AD5A 4QDEA 2E2BA 4R3RA 3ZO4A 4ANOA 2WTIA 2OI4X 2PE0A 5FEQA 2PULA 3CD3A 3V3VA 1Y91A 5BQ0A 1FVRA 2XK7A 4JMQA 3HMPA 2AQXA 2P0CA 2XH5A 2ZV2A 4MXAA 5CU3A 4OTGA 5LMKA 4ZTMA 5CZIA 3PIZA 2ZB1A 3FAAA 1QL6A 1TKIA 2BIYA 3T3UA 5FTGA 4N4SA 1SZMA 5I9XA 4FE2A 4M66A 3FZOA 2IVUA 3PJ3A 3MFSA 3WZDA 4DG0E 3BPRA 3KRXA 3N4VA 3LIJA 4FTNA 3RGFA 1UNGA 2OF4A 2XM9A 4A4OA 4F9AA 4EBVA 2ZFYA 4Y8DA 1GY3A 4WUNA 4ANLA 3AXWA 2C3KA 3AC1A 2Z7RA 4RC3A 4RLLA 2EXMA 5J9LA 1Y6AA 5AR4A 2CN5A 3Q5IA 1PJKA 3GCQA 4OBPA 1OUYA 3AT4A 1M14A 5ANIA 5F4NA 3VBWA 2PE2A 4A9SA 1MRYA 2XARA 3LXLA 2X0GA 5L8JA 2W17A 1BI7A 2C1AA 2ITNA 2OJFE 2VGOA 1KE5A 4E73A 3D15A 4QP6A 4YU2A 5AADA 3ML1A 4M68A 4C33A 4D9TA 3W10A 1OUKA 1ZMWA 3D2IA 4ERWA 3QU0A 1IASA 4LRKA 3TL8A 5H2UA 3UPXA 4FEWA 3A2CA 4W8DA 4D2VA 3BV2A 2QOLA 2QOOA 5C8NA 4CZTA 4AA0A 2IZUA 4C4FA 3S95A 1OKZA 4CFVA 2PTKA 4TPTA 1O6YA 3ALOA 3FKNA 5I9YA 2XYNA 3VRZA 3UDTA 2C6EA 1F3MC 4CLJA 2HCKA 3AQVA 1P4OA 3ORNA 4IVCA 2BROA 2G15A 4MYGA 4QP8A 2VTLA 4IZYA 5EM8A 4FL1A 4I0TA 5HCYA 5HO6A 5HG7A 3LXNA 3Q9XA 5H8BA 3Q9YA 3OCBA 3SXRA 4YNOA 4HCTA 1OL1A 1WFCA 2CLXA 3FQHA 2XKFA 4QMSA 3R7UA 5KUPA 3W0OA 2BZHB 4PP7A 5ETCA 4EH2A 1Q97A 3KULB 4D2RA 3EFKA 3IW8A 1Q8UA 3DKFA 3QA0A 2ETMA 2OG8A 3MY0A 3F66A 5AEPA 4DHZA 4KNBA 5FQDC 3VUDA 1J91A 1HOWA 1H1WA 5L6OA 4U5JA 3RI1A 1SYKA 5CNNA 5CT0A 5HVYA 3CQEA 4EOKA 5K5XA 4CFFA 4YURA 2XK6A 4O2ZA 2R3JA 1WBVA 3Q9WA 3AT3A 1PYXA 2OIQA 2YJRA 3LCKA 5EOBA 5IA5A 2A4LA 2GS2A 3CIKA 2GFSA 3P79A 4G6OA 4RIWB 4WRSA 4YLJA 4BCHA 4CT2A 3LFAA 4FTLA 2VTHA 1JSVA 4G6LA 4H1JA 4JG7A 5HD4A 4USFA 4CMUA 4PDSA 3D5XA 1NVRA 1ZYCA 3G33A 1J3HA 4TTHB 3ZC5A 5DVRA 5LMAA 4O96A 3T9IA 2BRGA 3I81A 3LJ1A 1SM2A 4YJOA 2B52A 2KTYA 4HW7A 4X2NA 4IC7A 3BQRA 2XK4A 4GK4A 2VX1A 5GINE 3BYSA 3EQHA 4NZWB 5HEZA 2C69A 4UB7A 5C27A 2XRWA 4X0MA 4YJNA 2F57A 4P90A 3P7BA 4ZJJA 3VS4A 2PVFA 4YZMA 2E9NA 2VWYA 5DN3A 3DJ5A 3TIZA 1PXIA 4E4NA 3CE3A 4CD0A 4U97A 4AXAA 1PKDA 3BL9A 4PY1A 3K54A 4H36A 1E9HA 2OJGA 4WNKA 1W82A 4LGHA 2UUEA 5JEBA 1S9JA 1AQ1A 3SXFA 3LXKA 4E5AX 4JRVA 3DPKA 4LV5A 4XOZA 3R9HA 2XKCA 3TV7A 3VQUA 3CGFA 4MXYA 2QC6A 4LUDA 2ITVA 3HMOA 4H58A 3PIYA 4FNYA 5EYDA 3V5JA 2WQBA 3NVKI 3LM5A 3ZRMA 4GH2A 4FA2A 3RAKA 4ZLOA 5IISA 4FKGA 2X4ZA 3PRIA 3ENHA 4IFCA 3RK9A 4NU1A 4KINA 4OW8A 4CZUA 3ELJA 4IXPA 4C34A 3O96A 3P5JC 3WIGA 4EHEA 2R0IA 3L9LA 2YM5A 2IW9A 4QMTA 2QHMA 3COIA 2GQSA 3GGFA 4YGAA 1Q8WA 2XNPA 3S0OA 3F61A 4CMTA 3LCSA 4OBQA 2WXVA 3H3CA 4JX3A 3PXYA 4FSUA 3PRFA 4CGAA 3I7BA 4O4DA 4AE6A 4F7SA 5LJJA 3PLSA 3JS2A 4GG7A 1YWRA 4GFMA 2WMWA 2RFNA 3FXXA 3KRJA 5CSXA 4BKJA 1PKGA 3CPBA 2XZSA 3ET7A 1A9UA 1YOLA 5DFPA 2IEWA 2VV9A 4XCUA 4EH3A 5L2IA 4JOAA 3DFCB 3OWPA 2RG6A 4G17A 3E63A 2RFSA 4RQVA 4TN6A 3R7OA 3O71A 4A9UA 3RWPA 2VTJA 4BTKA 4EQMA 1TQIA 2JITA 2A19B 3IONA 5JMSA 4XBRA 2VX0A 4PQNA 2X8DA 3PVBA 5ANEA 4DTAA 2W4KA 2YZLA 2HIWA 4L7FA 4FV0A 5BVKA 4E6AA 4F7LA 1JNKA 4GJ3A 2WMAA 2XK3A 4EJNA 4JAJA 3QQGA 4O6EA 4LYNA 4GRBA 3UIXA 4D1ZA 3UIBA 3O23A 4GCJA 4H3QA 4J96A 4TYEA 5LCKA 3UBDA 3EWHA 3O7LB 4FG8A 5EW9A 3TXOA 4G9CA 3TZ8A 4DDGA 2QOKA 2XMYA 3FMEA 1QPCA 2Y6MA 3W0NA 5K3YA 4BF2A 4N6ZA 5CEMA 4BDBA 3K2LA 2JDRA 4BDHA 2GFCA 3KMMA 3QCSA 4WRGA 3HP5A 3FE3A 4RRVA 3GP0A 5LVMA 1O9UA 5L2TA 3ITZA 3R28A 1ZWSA 2H9VA 4PL3A 5E8ZA 4ENYA 3E7VA 5FXRA 3TYKA 1OITA 1UU8A 2UZUE 4BTJA 5F94A 5J87A 5AAEA 4I4FA 3TZ7A 5LVOA 4S33A 4FNXA 4MTAA 5E4HA 2I0EA 5GZ9A 4TXCA 5FM2A 3M1SA 4BBFA 2JIIA 2P2IA 4YSJA 3WYXA 4DH7A 3FKOA 4C0TA 4NT4A 3W0RA 4GT4A 2O63A 4X3FC 1FVTA 1V1KA 4M7IA 4GSBA 5C26A 4DCAA 4N0SA 4QMWA 5M08A 4YO6A 4FF8A 3KN6A 3FUPA 2GS6A 4EOQA 5J8IA 1Q61A 3ZSGA 4CFUA 4ZIMA 1Q3WA 4ZP5A 5A14A 4CSVA 3HLLA 1H0VA 4GVJA 3HRBA 4KA3A 5TE0A 4MUQA 4I93A 2JDVA 2BZKB 3T3VA 3I79A 4O27B 4UV0A 3R00A 5AMNA 1PMVA 3QUDA 4YLKA 5IUIA 4S31A 3GOKA 4C57A 1X8BA 5E8YA 3UJGA 3NUYA 3OTUA 2YITA 3HV3A 3I60A 4CFWA 3S2PA 3C0HA 3UVQA 3ZZEA 4FKRA 2BRHA 2HAKA 2C6DA 4FKIA 4HPTE 5IG1A 2YFXA 3QQJA 1M2QA 4GKIA 3IOPA 4RIYB 1ZAOA 3LFDA 4W4WA 3GXLA 5DMZA 4AZFA 4O81A 4YBKA 2GHMA 2WEIA 1YI3A 3LQ5A 3GFEA 3MA6A 3NR9A 3HUBA 4JG6A 4NJ3A 1BX6A 2WTJA 4R3PA 2YCQA 4RIXB 4MQ2A 3F3TA 4MBLA 3TNWA 1T45A 3EFJA 4ZXTA 1P2AA 2V55A 4EHGA 5AV3A 4CVAA 3MSSA 4DFLA 4WUAA 5LMKC 3IECA 5IQIA 3DBCA 1ZY5A 3UC3A 4TRLA 5CTPA 3KXMA 2QKWB 3G0EA 3WARA 4CCBA 1GZOA 3Q6WA 3GENA 3ZLXA 4F1TA 5K4JA 1DI8A 3F5GA 3DK6A 5L2QA 3HDMA 3QF9A 2UZOA 1Z57A 5LVPA 4LV8A 1H28A 4X2JA 5AR7A 5T6KA 4AW0A 4FTJA 3CKWA 5HE0A 4HGLA 4H3BA 4U6RA 3KVWA 5DRDA 3VJNA 4EOOA 2VN9A 3ZHPC 4O4FA 3BLAA 3ORPA 3ZONA 3VBTA 4LMNA 4XS2A 5I9WA 4AAYA 3ZRKA 3JR1A 1M2PA 4OT6A 3ZH8A 2ZV7A 4B8MA 2OO8X 4D2WA 2EXEA 2VWBA 3KA0A 3F2NA 3BKBA 5FXQA 2X6DA 3A62A 4RJ3A 3VIDA 4AFJA 5IEYA 3PDTA 3VUIA 5KHWA 4QPSA 2ESMA 2P