5I9WA

Crystal structure of ephrin a2 (epha2) receptor protein kinase with anp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
291
structure length
267
Chain Sequence
TTEIHPSCVTRQKVIGAGEFGEVYKGMLKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 267
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9wA01
5GNKA 4QYHA 4CEGA 3UE4A 4NM5A 4AE9A 3NIEA 4FIHA 3L1SA 4UWCA 3QA8A 3S0OA 1H1RA 4E4XA 1OPLA 1UKIA 4FBXA 3H30A 2E9NA 4FV2A 2NPQA 4C7TA 3S00A 4WNOA 2BIKB 3E93A 3F3TA 3JPVA 4I93A 2YM8A 4PDOA 2B0QA 3SGCA 2G2FA 2WTVA 4JG7A 2JIUA 3MPMA 3R00A 3KF4A 5D9HA 4MXZA 4DHFA 3AMAA 4YU2A 4AA5A 4R1YA 4FEXA 4CFWA 3LVPA 3R7GA 3HAMA 2ITNA 4IAKA 4BCKA 2C5OA 4LL0A 3QZGA 2QNJA 3N4UA 2QOCA 4CG9A 3KGAA 2QOLA 3Q4UA 4DH8A 3I7BA 4YJRA 1IG1A 5HTBA 4V04A 3OF0A 4EI4A 4FTKA 3ATSA 4XBRA 3VF8A 2OWBA 4NM3A 4MCVA 4IBMA 3I0OA 4BDEA 3FE3A 2JIVA 3EQFA 2EU9A 3SOCA 3I0QA 3LCKA 4G6LA 4U81A 2W4KA 2BCJA 4J95A 4KA3A 5EYKA 3ZM4A 3EL8A 4B8LA 5DI1A 4QYFA 3PIXA 3QCXA 2W1IA 4HGLA 4QP4A 4BDIA 4IAYA 2PZYA 4I0RA 1CMKE 1W84A 2HWPA 2P55A 3PYYA 4GVAA 3ZONA 1LP4A 5BVWA 1ZYLA 5HEZA 5ANOA 4GK4A 5B0XA 2R3GA 1UNHA 2A2AA 4HGEA 4R5SA 2C3IB 3UC3A 3HAVA 1XBBA 4WG3A 3OWLA 4BCGA 4EOSA 4AZTA 1LEZA 3ZEWA 2XKFA 1MQBA 2AYPA 4NW5A 2GFSA 3DFAA 4G5JA 4LGGA 4O2PA 3OWJA 5HTIA 2Z60A 3FI4A 3ORMA 4BR3A 1YWNA 1HOWA 2ZV2A 5AAEA 3N51A 1G8AA 3CD3A 5BVDA 4YBJA 3GU7A 4G9RA 2UV2A 4DE4A 3SQQA 2VTQA 3EN7A 3ENHA 3MWUA 3PJ3A 4N4SA 4NCTC 4OTGA 5D1JA 3VUKA 2IVUA 5FBOA 2NNWB 4JG8A 1J7UA 2R7IA 4GUEA 4JAIA 3LMGA 1H1SA 2CPKE 2FB8A 3E88A 5C8NA 3AC3A 4IX4A 5AR4A 3L8XA 4ERKA 3HRBA 5KX8A 3CQEA 3OTVA 5K0XA 2PMOX 1PF8A 4TNBA 2EXMA 4I5PA 2FSOX 3D7TA 4R77A 2HZIA 3NWWA 3FMMA 3TZ8A 4YNOA 2XCKA 4Q9ZA 3OXZA 5A46A 3PE2A 3BU3A 2Y0AA 3U87A 4A7CA 4KBAA 2Q0NA 3TTIA 3DBQA 5AEPA 4DA5A 2C6MA 4WNPA 5AIRA 4HVDA 2XJ2A 1XBCA 3ORKA 4M0ZA 5CSVA 2WMXA 2ITQA 4DLJA 3CGFA 4CZYB 3RKBA 4IADA 1P14A 4LM5A 1OL5A 1M7QA 3AC8A 2QCSA 5DRBA 2V5QA 5AP6A 3NUYA 3UTOA 3EFJA 4BHNA 4O38A 3QQUA 3MA3A 4J97A 2JD5A 2QOQA 4I41A 1WVXA 3OY3A 3RVGA 5CXZA 4XS2A 4FEUA 1W7HA 3F2AA 4DCEA 3IW4A 3GFEA 4X6QC 5LVPA 3DB6A 1MRUA 2UVYA 4QP9A 3FEGA 3AT3A 3LCOA 2W5AA 2G9XA 4A9RA 4XV1A 3HVCA 3FMNA 4XMOA 4Z7HA 3IDCA 4X0MA 1GNGA 1FVRA 2B52A 2IO6A 4Z55A 2VTHA 4G3FA 4C37A 2VTTA 3R01A 3TNPC 1F0QA 2W06A 4BZOA 3MY0A 3Q6UA 4A06A 5ANDA 4L3PA 3ORLA 1B6CB 2I0VA 2OJIA 5M4FA 2REIA 2EXEA 4I94A 2ITOA 3BHYA 4J52A 4QP6A 1WFCA 1PXLA 2O8YA 4FUXA 4M69B 3ELJA 4MQ2A 5D11A 5DVRA 2X1NA 3RWPA 3UODA 3ZXTA 4XUFA 3VBYA 5JZJA 4TL0A 4WUNA 4FF8A 3R6XA 4JAJA 4XNEA 4BIEA 3Q2JA 4Y5HA 3D7ZA 2JLDA 3S95A 5I0BA 2IJMA 4UEUA 5CSWA 4O7NA 3RK9A 4EOIA 3S1HA 4YSJA 1ZMWA 5EHYA 3RWQA 3CJGA 4L43A 3ZUTA 3E87A 4JQ8A 3UZRA 5JQ5A 3SXRA 4FKJA 4ACDA 5CU3A 4J96A 2C5YA 4FV4A 4OAUC 4S2ZA 3PDTA 1HCLA 3CBLA 2BZJA 2BRNA 4I24A 2WMBA 4RWKA 4YC3A 1OMWA 2A19B 2C6OA 3Q4TA 4QQJA 5HHWA 4FTMA 1Q8TA 3NSZA 2YM3A 4YZ9A 4BTKA 5J9ZA 3KB7A 1PXKA 1R0EA 5CALA 1KSWA 4DEAA 4GSBA 4MH7A 5L8KA 3OY1A 3Q4ZA 2WMSA 4HYIA 3N4VA 4R6VA 2VTPA 3LCDA 3S4QA 2VUWA 5E8XA 5TOZA 3ZLXA 5KBQA 3BE2A 4RFMA 5E7RA 4DEIA 3CP9A 2R3JA 2WQEA 5C8KA 4R1VA 2EVAA 4HCUA 5FEQA 5C27A 4BKJA 4PTEA 1IA9A 4FZDB 2UW4A 3PE1A 2VV9A 2BALA 3MESA 3TL8A 3KN6A 1O6LA 3ZUVA 3REPA 3QQJA 5TE0A 4MK0A 3K3JA 2F57A 3ZO3A 2AC3A 3FKOA 3ZDUA 5HGIA 3TM0A 3K5UA 3G15A 1XHAA 3TT0A 1BI8A 2QHMA 5DEWA 4E6CA 1XH9A 4TNDA 4W8EA 3R8VA 5HE0A 5LCKA 3TKIA 3VUMA 4RA5A 3NAYA 3PLSA 4QMSA 2PVJA 5FG8A 4FTQA 2R5TA 5KZIA 2XM9A 3PVWA 4H36A 5J79A 1H28A 2B7AA 3QUEA 4AT4A 4FTRA 1H0VA 2Z7QA 5K3YA 5IEYA 1APME 1YXUA 1PKDA 2XF0A 2R9SA 4TTHB 5LMKA 1IR3A 4Y83A 4XG7A 5IQIA 1CM8A 5I9UA 4BDBA 4C33A 2I6LA 4LG4A 1WBSA 5KMNA 3KREA 4CSVA 1H00A 1QMZA 3V8SA 3QYWA 4E5AX 3A99A 2HYYA 5CNOA 3QUDA 3QTZA 4W9WA 5DEYA 5H9BA 2WTCA 5FRIA 4C4IA 4NFMA 4EYMA 3BHTA 4UN0C 5M51A 5IQDA 4LRMA 5L2TA 1MP8A 1XKKA 4WD5A 3DNDA 4AN9A 5FGKA 2NRUA 4E1ZA 4D2VA 3R2BA 4O22A 4TY1A 2WHBA 3K2LA 4YZNA 1YW2A 1QL6A 2ZV8A 3KXGA 3TXOA 3W16A 3ODYX 5T3QA 3OOMA 4TN6A 3C51A 4C4GA 3LFAA 3OUKA 1S9JA 5AAFA 4ENYA 2JDVA 3VIDA 4J8NA 5IMEA 3NMUF 3RAHA 2QKWB 4JIKA 3VBTA 3PIZA 4PNIA 1NVSA 4DFNA 3QTXA 4IX5A 4LL5A 4IVCA 3MH0A 3BI6A 2UW9A 4FV5A 4U8ZA 3VVHA 1FBNA 3ATTA 2XIZA 3ROCA 4F63A 5AA9A 2XB7A 5HBEA 5KMIA 4JBOA 5AUVA 3WZEA 3FL5A 4FNWA 1Q4LA 1XH8A 2WD1A 3PVGA 3B2TA 4IVAA 5DRDA 5E1EA 3PG3A 3ZO4A 3KXZA 4QMTA 4CFXA 2OH0E 2YAKA 3QC9A 3RPYA 4XLIA 5DA3A 4CRLA 3PUPA 4YTCA 3G51A 4S31A 4PF4A 4XCUA 4G6NA 3T3UA 4GT4A 2OF2A 4O96A 3KRWA 4AGUA 4K33A 4FTCA 5CZIA 3NUAA 3LFSA 3BKBA 4MXAA 3EKKA 3MFTA 4APCA 5IQGA 3PY3A 4BBEA 4CNHA 2NO3A 5EM7A 1J7LA 3QKKA 3N9XA 1HCKA 4DCAA 3Q6WA 3DKFA 4ZOGA 3BYVA 4OTQA 4QMMA 3SXSA 4X3FA 2YERA 3VS4A 4D5HA 4CD0A 3VBXA 3OW3A 3OCSA 3QL8A 5D41A 5FEDA 5EI8A 4H3BA 4AE6A 4PP9A 3I1AA 2YEXA 3FLZA 4I0TA 4TYHA 5AV2A 4RX5A 5AAGA 4MX9A 5EHOA 3HV4A 2ZV7A 4QYGA 4OLIA 5DR9A 5AP1A 4R5YA 4AF3A 2BKKA 3EQGA 2PL0A 3PY1A 4L00A 3OFMA 3V5LA 3DDPA 4HYSA 1XQZA 2VAGA 2OZOA 4UXQA 4FOCA 4H05A 2DYLA 3QD3A 2HZ4A 2PVRA 4ZXTA 2WQMA 3KXNA 3RMFA 2WFYA 5IPJA 3DKCA 5GHVA 4DGGA 2RFEA 2FGIA 4G3EA 2EUFB 2ITWA 4E8AA 2DUVA 1FVTA 4EZ7A 1Q5KA 3U6JA 5JT2A 4IDVA 3BLRA 2CGUA 2X9EA 4UYAA 2VTRA 3PSBA 1YWVA 3BV2A 3WF7A 3ULIA 2ZJWA 2RL5A 2VTMA 3U9NA 3OW4A 4LOOA 2GMXA 3TV7A 4L45A 1ZARA 5CU2A 3SX9A 3ZO2A 5L8LA 5EDPA 4ZY6A 4DTAA 2WMUA 2X7GA 1PRYA 3V3VA 3FMLA 3R83A 1YKRA 3FMDA 5BUJA 4CG8A 1YHVA 1L3RE 4BCMA 1OUKA 3PJ2A 4WIHA 1XH5A 1CKPA 1BI7A 1XO2B 4JDKA 3D5UA 4FTNA 3EQBA 1YQJA 4RX7A 5KMKA 4EH2A 3G90X 3MGYA 4X2KA 4NEUA 3PPZA 3QLGA 2YABA 2X6DA 5HBHA 1PMVA 2XNBA 4RPVA 3ID6C 4KS8A 4ZS0A 3WARA 1YRPA 3R7EA 2ACXA 4MVFA 5D7VA 4D9UA 5L2SA 1U4DA 4Q2AA 4OBQA 4LMUA 4O0UA 4YO4A 3UG2A 4CCBA 3UYSA 2QU5A 3CEKA 3GU4A 5JFSA 5KKRC 3FXZA 4QO9A 4O81A 3MIAA 4LV8A 5CEPA 2RIOA 4NH1A 1M52A 4K77A 2DWBA 4XV2A 3ZSHA 1R1WA 3D2KA 4EH7A 4IFGA 3V8TA 5DR6A 2IZTA 4F1TA 4E73A 4YJSA 2VTLA 2VTNA 3TUDA 3LFQA 5FP5A 5HX6A 4OTWA 4C3FA 3C4XA 3MJ1A 3P0MA 3R9NA 3BELA 3FV8A 4XG2A 4F0GA 4CFNA 2VWVA 3PFQA 3PLAE 3SD0A 5CNNA 1X8BA 3T3VA 3U51A 4C34A 2XRWA 3OG7A 1NT2A 3E8NA 4ZZMA 5LVNA 1FGIA 4QTBA 3C0GA 4XP0A 3Q9WA 4X2FA 5EQEA 2WTJA 3G6HA 4QP8A 4KB8A 1WAKA 1IAHA 2XCHA 3O0GA 3HMPA 2OJGA 3GBZA 3K5VA 3QRIA 3IGGA 5C03A 1Y6AA 3WYYA 2Y8OA 5IF1A 1OBGA 2F9GA 3V8WA 3WZJA 5CU4A 1R0PA 3W1FA 4KAOA 4EJNA 4FNYA 3AD6A 2WMRA 3ANRA 4FMQA 3GI3A 4C4EA 5BVFA 3FKLA 4FEVA 3ZCLA 4OTDA 3JVSA 5CSHA 4I6BA 4YJTA 1SM2A 3TDVA 4QT1A 4PMPA 5LQFA 2XNEA 4RIWB 5HX8A 2WTKC 4YP8A 5HI2A 3IO7A 3FZOA 3UVPA 5BVNA 5EW9A 4PTGA 5AUZA 4C02A 3B8RA 4L68A 1UNGA 2GHLA 3PA4A 4C2VA 3DLSA 2XZSA 3WILA 3CCNA 2R3LA 3QQFA 4RIXA 4QMPA 4WHZA 4BDGA 5AV4A 1KE5A 2ZM1A 4QMNA 1H1QA 4G9CA 1QCFA 3MY1A 5LMKC 4AW5A 2PZIA 3CQWA 3Q3BA 1J1CA 3AD4A 2JGZA 4IIRA 4E93A 4QP7A 3SHEA 1GZOA 4EJ7A 1PMNA 2PVFA 4KNBA 5HG8A 4DAWA 3QZFA 5CX9A 3U6HA 4LMNA 2X2KA 4JQEA 2QR8A 3KY2A 4FC0A 4FT0A 5FM2A 4MXXA 1ZOHA 4BWXA 3W2PA 4MBIA 4TRLA 2OFVA 5HIDA 3RPVA 3RAKA 2V7AA 2VD5A 4OTFA 4EK8A 3P1AA 3PSCA 4X2GA 4W4WA 3I81A 3GB2A 3KXHA 4XHKB 3R8UA 3W18A 3O50A 4M84A 5CU6A 2X8IA 4O7WA 1F3MC 4U3ZA 5ANIA 4ZTNA 4OTHA 2R3PA 5AUXA 3E62A 4WSQA 4GFMA 4MNFA 4IE9A 3ORXA 3OT8A 5E4HA 4C62A 4UB7A 3OP5A 5EFQA 4IW0A 1Q8ZA 1WBVA 3HX4A 3FYJX 3R28A 4TYJA 4IMYA 4G5PA 4D2WA 4F70A 4O91A 4CV8A 3QRKA 3OEZA 4H39A 5CAQA 3WF6A 3QU0A 3RNYA 3OMVA 4E5BA 1Y57A 2J5EA 3IOPA 4H1JA 3UJGA 4CZTA 4R7BA 3LHJA 1WVWA 2QOKA 4HCVA 1Z9XA 3SAYA 3TZ7A 3DB8A 4PRJA 4Z3VA 4UX9A 4PMSA 3ZOSA 3IW5A 4RJ3A 1FINA 4ANNA 2XUUA 2ZM4A 4PPCA 3TNHA 4AOJA 4BCQA 4DGLC 4EH5A 2J6MA 4ALUA 1H1WA 4AGCA 5EOBA 4C8BA 3W8QA 4EYJA 3RI1A 4U44A 3NUNA 4BI0A 5K4JA 4IQ6A 2PSQA 2C69A 1KE8A 3EJ1A 4YZBA 2WNTA 1MRYA 2OJJA 4F99A 4L7FA 2JBOA 4I6QA 4X3FC 1UV5A 1VZOA 3ENMA 4UMPA 1YDTE 3Q9ZA 3IONA 4LYNA 4MNEA 2ONLA 1OPKA 5CSXA 4LOQA 5CTPA 2VTOA 4D4SA 4YMJA 2WMVA 2GU8A 4IVDA 5D12A 2BIYA 4I4EA 5C9CA 1UKHA 4JT3A 4AXAA 5JSMA 3R9RA 4YC6A 2XRUA 4J8MA 4YBKA 2WQOA 4RVLA 3CSVA 1V1KA 4H3PA 4YPSA 3F2RA 2CKEA 4DGOA 2Q0BA 3QCYA 1OL7A 2WB8A 3OC1A 4FI1A 4FT7A 4FV3A 5FTQA 3R9OA 3VS5A 4AT3A 4D2TA 4EWQA 2OF4A 3Q5ZA 1WCCA 2PK9A 3HMOA 1URWA 3L8SA 3H3CA 3MPTA 3R8ZA 5BPYA 1OUYA 2I40A 4KWPA 3U4WA 3ACKA 1LR4A 3QTIA 1JBPE 3DOGA 2J2IB 2Z02A 2C30A 3EWHA 1W0XC 5KMJA 2RGPA 4C3RA 2XNNA 3RPSA 4FSNA 3HUCA 3TJDA 1H0WA 2NRYA 4AFJA 2HY81 4AS0A 4M14A 4GRBA 4CZUA 3C5IA 2W1GA 1DI9A 3O8PA 1IAJA 1DAYA 4KS7A 5AV1A 3ZC5A 3I6WA 3MIYA 1RW8A 4O6EA 3E92A 2JBPA 3L9NA 3F7ZA 3IDBA 4YTIA 4ANLA 4CVAA 3II5A 4R3RA 5IMXA 3EQRA 3NNWA 3LKMA 3FMHA 2QU6A 1I44A 5DHJA 2CDZA 2CGVA 3ALNA 4NIFB 3W10A 3UO5A 4MQ1A 3UQGA 3Q2MA 4I3ZA 4CTBA 4DGNA 4EH4A 3HLLA 5ACKA 2ZVAA 3AC5A 1XH4A 3D2IA 4FKLA 2JAVA 3GCVA 2OGVA 4QQTA 4O0TA 1YDRE 3RTPA 4AA0A 3HL7A 2P2IA 4DTKA 4L7SA 1J3HA 4XLVA 3BQCA 2WMWA 3W2CA 3GU6A 4FV1A 5A6NA 3SG8A 3FQHA 2QHNA 4FKIA 3R1YA 5JEBA 4RMZA 4YZCA 1CTPE 1PW2A 4PDPA 3HP2A 3RM7A 4O27B 4RC2A 5IDPA 4QMLA 3A7IA 3V04A 3TNWA 2JKKA 4R8QA 3IK3A 5FXRA 4MBLA 5BVOA 2YCSA 3TACA 4DFUA 2PVLA 5CAVA 5B7VA 2GTMA 3MA6A 3QQGA 5DH3A 1AQ1A 2BRHA 3QCQA 3ET7A 3W2QA 1U5QA 4F64A 1OL1A 3AXWA 4BBFA 3RALA 1JKSA 1WMKA 3DK6A 3C0HA 4FSUA 4NFNA 4KKGA 4E6AA 4BTFA 2CLQA 4GYIA 3BLHA 2HW6A 3QTWA 4AUAA 5FDPA 5M09A 1BUHA 5GJGA 4HNIA 4EBWA 5EKOA 3GEQA 4M67A 4JQ7A 2X2MA 4KIKB 1YHSA 4PWNA 4BGGA 2B53A 4CMUA 4O0VA 2XEYA 3D83A 4HVSA 1OKWA 2VO6A 3FSFA 4M0YA 2WMQA 2Y7JA 4B6LA 3PY0A 2JKMA 3KK8A 2OICA 2QO9A 2XK7A 2GHMA 2XH5A 3I4BA 2XNPA 3KRLA 1UNLA 4YJUA 5HD7A 5BVEA 4BCOA 3FQEA 4O6LA 4V0GB 1ZLTA 2I1MA 3CLYA 2HXQA 3A7GA 4IX6A 2HK5A 1DM2A 3K3IA 3TUCA 1PXMA 2C1BA 3LJ0A 3RZBA 4BDDA 1ZRZA 4AN3A 1Z5MA 4XG9A 3QHWA 5L6WL 4IZ5A 3LFCA 4EOOA 4Y5QA 4EOKA 3LM0A 3RHXA 5HU3A 2QOIA 3UVQA 2XKDA 4BCPA 1SMHA 4ASDA 3MW1A 3ALOA 3UIMA 4J99A 1O6YA 2VWXA 5DOSA 2PVKA 3RBWA 1K2PA 2BZIB 3EL7A 4X6RA 4F7SA 5CEMA 5IA1A 4L3LA 2PMLX 3BLQA 1WBOA 5KO1A 3EB0A 4IJ9A 2QURA 2PVNA 3C7QA 4BGHA 4DFLA 3DLZA 1H4LA 3CJFA 3E8EA 3KULB 3ORIA 4RLLA 5CXHA 5K9IA 4DITA 3BIZA 3RK7A 3QXOA 5HE3A 5HU9A 1PYXA 3GOPA 5DT0A 2V0DA 4BCFA 4NJ3A 4YNEA 3UZPA 4BBMA 1TQMA 2A1AB 2XK3A 3LXKA 2YITA 4FTTA 1WZYA 2HIWA 4TXCA 4AZEA 3I5ZA 4ITJA 2XKCA 1GAGA 5HNIX 4TZRA 5KMLA 5L2WA 3ETAA 4MD7E 4QMYA 4C35A 5CANA 5C4KA 2O3PA 2GS2A 2VO0A 3CD8A 3I7CA 3LFFA 3FSKA 4FTUA 4PPBA 1JKKA 2VTIA 4DGMA 3BE9A 2E9UA 2C47A 2YCQA 1Q97A 3ZBXA 3Q60A 1P4FA 2W1FA 4H3QA 4NWMA 4AW0A 3PPJA 4TKSA 1I09A 4BDJA 3D5WA 3PPKA 4UYNA 3NNXA 5CEQA 3HV5A 2IVSA 4FZ6A 2BROA 3TIYA 3SVVA 1M2PA 2Z7LA 4JJRA 4FV9A 4KUJA 3D94A 4G6OA 2W5HA 1BL7A 5ANJA 3BV3A 4FTAA 4BRXA 3AGLA 4EORA 3UNZA 4N57A 5F20A 1S9IA 5M06A 3WE8A 5CT7A 2OH4A 2YACA 4TYGA 4ZTMA 3LMIA 4ZP5A 5HQ0A 5A4LA 3DPKA 3VRYA 4YLKA 5TT7A 5AV0A 4RJ6A 4DFBA 4CKIA 4K18A 5CVHA 5M4CA 5HCZA 5CENA 1YHWA 4IWPA 4O0WA 3DXPA 4QNYA 5CVGA 5LWMA 3D15A 3MB7A 1ZOGA 3CIKA 2VWYA 4CV9A 2PMIA 4F08A 1TQIA 4JG6A 4C61A 2RFDA 1WBPA 1F5QA 2GNFA 2GNJA 4OT6A 3RK5A 4EHEA 1OBDA 1Q8WA 3F82A 1NXKA 2BHHA 4G2FA 2YLFA 3DAJA 3SDJA 4FZFB 1KE7A 1KV1A 4F09A 3WZDA 4OTRA 2ONLC 4FTIA 1YOJA 4A4XA 4IM3A 3MH2A 4D55A 3M42A 4C58A 2BFYA 3CTQA 3KMMA 2BRGA 4PDYA 1U54B 2I7QA 4JIAA 2BAJA 4WRGA 4B7TA 4XYFA 5ETAA 3QC4A 3EN4A 2B9FA 4EHGA 3T8OA 3OCBA 5I5ZA 3PA5A 5CS6A 2XJ1A 4GUBA 4CT2A 1E1XA 3DAKA 2WTWA 1KUTA 3KC3A 1OVEA 2YWPA 3CKWA 3NPCA 1VYWA 2XKEA 3NYOA 4F7JA 4CLIA 3QRUA 3QTRA 1AD5A 4K0YA 2GHGA 4GFGA 3BU6A 4EHZA 2IPXA 2XYNA 2BRMA 4JVGA 2J9MA 4XEYA 2I0EA 4UMRA 3NCGA 4A9TA 3F69A 4ZK5A 3MTLA 1H27A 2XEZA 3KK9A 5DBXA 3SRVB 4CQGA 5BYYA 5JKGA 2CNUA 3VULA 4BKZA 3ITZA 2YJRA 3BRBA 3S3IA 3KKVA 4FE2A 4TT7A 1Y8YA 3W33A 4MF1A 4QYYA 2BZKB 2VZ6A 5HVJA 4F6WA 2E9OA 4CCUA 2YZLA 2OZAA 2PVHA 4NYEA 3C4EA 4D4VA 4DN5A 5I9VA 2UW6A 3TIZA 2JC6A 3ORZA 3GC7A 2WQNA 3VNTA 4CFMA 3C4ZA 3H9RA 4ZEGA 5FM3A 4YTHA 3E3PA 3VS6A 2ESMA 2JDSA 2FSLX 2OXDA 4XV9A 3FDNA 1AGWA 5FTGA 1NY3A 2C5VA 5A54A 2RFNA 1YI4A 2XIYA 4DFZE 2WU6A 4GU6A 1FMOE 2UW8A 3GFWA 2YISA 3O51A 4IM2A 4HNFA 3FPQA 5JMSA 4D1XA 4UMQA 3E8DA 3OZ6A 3MV5A 3DJ6A 4GU9A 4AQCA 4GKHA 3ZZWA 4FGRA 4FK3A 4FYNA 1H07A 4RWLA 3NVKI 2F4JA 2YHVA 3IPHA 4QQ5A 3G33A 3PA3A 5DYJA 4EEVA 3P7BA 4XRJA 4JBQA 1ZYSA 2R3RA 3PP0A 5M4IA 5C8MA 4FT9A 4RFZA 4ZTQA 2G01A 3UBDA 2BFXA 3P23A 5DNRA 3RINA 4Z16A 2FH9A 2E9VA 4BB4A 3KMUA 4M97A 2XYUA 5IDNA 2PUNA 1J1BA 3FMJA 3ZLYA 1M2QA 4F1MA 4KKEA 4W4XA 5EM8A 4W4YA 3LXLA 4OR5A 3P5KA 2F2UA 3DDQA 2QOFA 4JOAA 3MFRA 3UQFA 4FIJA 5EYDA 2V62A 4AOTA 3TZ9A 5M44A 5H8EA 4JR7A 4K1BA 3QRTA 2W96B 5LMAA 2C68A 4FSMA 3OWPA 1JVPP 4FV0A 4I20A 4OT5A 2C4GA 3CPCA 3KEXA 2YN8A 4G31A 3GVUA 3MPAA 3IGOA 3ZH8A 5M57A 2FSTX 1PKGA 1U46A 2X0GA 4FIGA 4BN1A 4KIKA 2OXYA 2KULA 3V5TA 5LXMA 3FI3A 4BY9E 3R22A 4XP2A 4APPA 1GZKA 2VN9A 3N4TA 5IEVA 3W2RA 3QTUA 1WBWA 4TWOA 3KFAA 2CHLA 4IWQA 3Q4CA 4MKCA 1BX6A 3VQUA 4YJVA 4XOYA 4UXLA 4V0GA 3S2PA 2ZV9A 3SOAA 4EOQA 3DT1A 2JKQA 3TTJA 1BMKA 4CMOA 2YIYA 4WG5A 3ANQA 2W1HA 4G3CA 3ZU7A 5GZ9A 4FTOA 4OUCA 5FWKK 2E2BA 3A7FA 4MAOA 5IUIA 4D5KA 3F88A 5FD2A 3U4UA 4U41A 4HJOA 5IQBA 4RX8A 4RIOA 3G0EA 4ERWA 2XK9A 4IEBA 4HYUA 2R3FA 3OCGA 3QQHA 2ERZE 3H10A 3NNVA 2GQGA 1WBNA 2UZTA 1PMUA 4DEEA 3H9OA 4AG8A 1NA7A 5L6PA 2IVTA 3R9DA 1WVYA 4BWKA 4CFFA 4IX3A 4DT9A 3R1NA 5BUEA 5CAOA 4O86A 2CJMA 3M1SA 3COMA 4YZMA 5AFVA 2WTDA 4PDSA 4E5WA 4KBKA 5EYCA 4Z7GA 1SVEA 4TPTA 3NGAA 1M2RA 3E3BX 1O6KA 5G1XA 4CGAA 5KBRA 1JQHA 4IB3A 4OBOA 4AFEA 5I4NA 4DTBA 2P33A 2R3QA 3F3UA 5FEEA 3ZS5A 3R1QA 3UOHA 3BYUA 3NW7A 3UPZA 2LAVA 1CKJA 5CQUA 3FZSA 3ODZX 5LVMA 2ITXA 2IZUA 3FLYA 3DBEA 1UU8A 2QODA 5ICPA 3R8PA 4ZTHA 4M13A 3QCSA 2OK1A 3BGPA 2X81A 4C0TA 4EOJA 3VJOA 2UW5A 2CGXA 1XWSA 3FKNA 3HYHA 1IA8A 2A4LA 2B9HA 4FNXA 4FGBA 4B4LA 4CQEA 4BC6A 4RVMA 1ZWSA 4MWIA 5HG7A 3QLFA 5I9YA 3NUUA 4IVBA 4RBLA 4O1OA 2UZLA 2C3KA 2YM7A 1G3NA 3V5PA 3FI2A 4E20A 4F9WA 2H9VA 4GW8A 4O7SA 4FTJA 4C3PA 5G6VA 5HIBA 4Z9LA 5AUYA 2Y6MA 4UBAA 4BICA 3ROYA 4I5HA 3FC2A 3QKMA 2IN6A 3UDBA 4BL1A 4BFMA 5E8TA 5KHWA 3ORNA 4LUEA 2UZEA 3VJNA 3PXZA 5L8JA 1ZYJA 2VRXA 3UP2A 3HDNA 3C1XA 1NVQA 3JY9A 5BYZA 3Q5IA 4GL9A 4WBBB 5AJQA 2Y4IC 3MJ2A 3U9CA 4ACGA 4R78A 3C4FA 2JDTA 4P2KA 5AP3A 5A6OA 3HEGA 4UZDA 5JFVA 3LMHA 3VN9A 1H01A 1ZMVA 4NZWB 3Q96A 2LGCA 3RM6A 4BTJA 4O7YA 3HDMA 2OXXA 2OO8X 4MXCA 2YCFA 2F7ZE 3PWDA 5EM6A 3SKCA 3VBQA 3NEWA 3NS9A 2J0MB 4ITIA 1OIUA 4ENXA 2JFLA 2CCIA 3FZ1A 4Q5HA 1YXTA 4Y8DA 2XNMA 3BCEA 4FVPA 5AM7A 3O71A 2A27A 2C6TA 5BYLA 4S30A 2C6IA 3H0ZA 3KCFA 2GNIA 4FT3A 3FLNC 2G2IA 1JAMA 1J91A 4IWOA 5EH0A 2R0UA 3E7OA 5K4IA 2JIIA 4U43A 1GOLA 3BBTB 5T68A 3VS1A 5HVKA 4BI1A 4M15A 4LFIA 4F4PA 4PP7A 2VWZA 4ARKA 3LXPA 1OB3A 4E4NA 3EZVA 2PY3A 3DY7A 5EHLA 1VYZA 4U42A 4H58A 2C0TA 3DZQA 5IQFA 4ZLYA 1Q8YA 5J7BA 3BWJA 4MD9E 4O7RA 3E63A 4EHVA 4FKRA 4M69A 4P90A 2UZUE 3DZOA 4X3JA 5HO6A 3RCDA 4M66A 1E9HA 4YJOA 3JR1A 1YVJA 4UZHA 4YO6A 5ETIA 3FL4A 4EOMA 2WQBA 2VU3A 5TKDA 4ACMA 5DLSA 2YM4A 3AGMA 3EH9A 3PSDA 4UWYA 4L67A 1OZ1A 4FKGA 1KE9A 4ZSGA 2X8EA 4M3QA 4DH5A 3R73A 4HCTA 3AMYA 2BZHB 4FKSA 4PTCA 4FUYA 4WA9A 4C4FA 4I21A 1P4OA 3NYVA 3EIDA 1BLXA 5IKWA 4C57A 3KRJA 3AC1A 2H34A 4R7HA 3FHIA 5ITAA 3JS2A 1J7IA 4RJ8A 3P86A 1W82A 5B2KA 4FVRA 1Q41A 4E26A 5ANGA 1LPUA 3K54A 5J9LA 5F1ZA 2CN8A 3UGCA 2ZDTA 4GG7A 4L42A 2Z2WA 3DNEA 3ZMMA 3H0YA 5HOAA 3ZFMA 4P4CA 4PY1A 5CZHA 3PG1A 3TKHA 4PL4A 3WF5A 3LLTA 2GQRA 4X7QA 3IDPA 4KINA 2DQ7X 3QWKA 4WSYA 4Y85A 5IA2A 5IQEA 1W83A 3VC4A 2VWBA 5AV3A 3T9IA 4BZNA 4LV5A 5LARA 1PXIA 2YZAA 4JL9A 4EUTA 2VO3A 3FY2A 5HLNA 3QQKA 3PZHA 5KKRB 1GZNA 3Q53A 3POZA 4BVUA 4EOPA 4FA2A 3GNIB 3B2WA 4U0IA 4B8MA 4LRKA 3C0IA 2BHEA 4ALVA 4DF3A 2ITPA 4IH8A 1BYGA 2WAJA 4I6HA 4ANBA 2OIDA 3BWFA 1OL2A 4AZWA 3GT8A 2XS0A 5HE2A 1JNKA 3TJCA 3UP7A 4ACCA 4BYJA 4G16A 4ACHA 1IEPA 4C38A 2XNOA 3R7YA 1H26A 3DFCB 4CTCA 3FLQA 2HENA 4GIIA 3MH1A 4JNWA 3WIKA 4FEQA 5TO8A 1OKZA 2F7XE 4OTPA 3R8LA 5HG9A 4PX6A 4GH2A 4EUUA 4I0SA 3DJ7A 1OECA 3CE3A 2RKUA 4O7TA 1XJDA 4FV8A 4IM0A 5AUWA 3UIXA 4CKRA 5JZNA 2VX3A 3ZM9A 5J95A 5IQCA 2HZNA 5CEKA 4E6DA 1UVRA 2IWIA 4YC8A 2YIWA 2WTIA 2YA9A 3G0FA 5E1SA 3D5XA 4D28A 3JUHA 4FG8A 4ANMA 5AWMA 4MXYA 3VUHA 3QALE 4GMYA 4AGDA 1U5RA 3SW4A 3LW0A 4ALWA 2RG6A 4TWPA 3V5QA 3JY0A 5CVFA 5AR7A 4FEWA 3OOGA 3E8CA 2BR1A 3FUPA 2WZJA 3OBJA 5LJJA 1JWHA 2J90A 3DS6A 2IW9A 3KVXA 3TZMA 3PTGA 3VUGA 1FQ1B 4J71A 4RC4A 4FKOA 4DFYA 4Y46A 1JSTA 1XH7A 2W4OA 1QPDA 3R63A 2PHKA 3COIA 3KCKA 4K2RA 5IUGA 2QLQA 2XMYA 1OIYA 5KCVA 1RQQA 3EYHA 2QOHA 4BZDA 2OBJA 4D2PA 4QMUA 2BILB 4RX9A 3V5WA 2WPAA 2X4ZA 3NRMA 5EK7A 1BKXA 1OM1A 3DK3A 2HXLA 4EWHA 4DBXA 5J5TA 5C01A 3QYZA 5CASA 1JLUE 2R3MA 3DBDA 3FHRA 4UMUA 2BKZA 3ZYAA 3KRXA 2VO7A 3VUIA 4U7ZA 4KSQA 1KWPA 4W9XA 3DQWA 3KF7A 2WMTA 3R7UA 4KBCA 4CFVA 1JSUA 3GU5A 4RZVA 3QTSA 2ETMA 4Y72A 4QP2A 4YZDA 3VBVA 1L8TA 3E64A 4E3CA 4BDHA 2DS1A 3AOXA 4QTAA 3KXXA 5HNGA 3SG9A 2JITA 1PJKA 3GU8A 4P5QA 3L9LA 1MRVA 1RE8A 3A61A 2UVXA 4OTIA 1CDKA 3WE4A 1GZ8A 4D1ZA 3CY2A 2EB3A 3M11A 3P08A 4L6QA 5CF4A 5IA4A 3RGFA 4RGJA 1PYEA 4IZYA 5JFXA 1BL6A 5K0KA 3FJQE 4MBJA 3G2FA 1JKTA 4F9AA 4O7LA 3RNIA 3VS7A 3HECA 3V6SA 3LZBA 4RG0A 5F4NA 4EOLA 5CF5A 3GQLA 1XR1A 5HO8A 2FO0A 1PMEA 4AX8A 5HZNA 2W4JA 1KV2A 2QLUA 4JBVA 4F9BA 2HOGA 3GP0A 2FYSA 2RG5A 5HCXA 2HWOA 4KIOA 2QO7A 4O83A 2WIPA 4WG4A 4RLKA 3KN5A 1SVHA 3ZO1A 3VS3A 1NW1A 3O8TA 3ZTXA 2BTRA 2VGPA 4FV7A 4UV0A 5HLPA 3DK7A 2C5NA 4F0FA 4IZAA 4D58A 5AX3A 1LUFA 2QR7A 2GFCA 2ZMDA 3I5NA 5M56A 3CY3A 3BX5A 3VS2A 1YI6A 1M7NA 4C4JA 3UIBA 3VUTA 3FI8A 5HTCA 4BCJA 2HELA 5DG5A 4R3CA 2QKRA 2QG7A 3LAUA 2X2LA 5M53A 4FYOA 4R7IA 3NUSA 4WRSA 3EFKA 4M8TA 5DN3A 5J87A 4O7VA 3WBLA 4DEGA 1K3AA 5HIEA 2FA2A 3NNUA 3P9JA 4FSRA 4ANSA 2ZYBA 4RIYB 4LGHA 5JK3A 1OL6A 5E90A 3CQUA 4U80A 2NP8A 3D5VA 4D0WA 4F9CA 3LPBA 3R2YA 4LOPA 4P7EA 2PPQA 3LQ5A 1V0PA 3WYXA 4EH9A 2EWAA 4NKSA 4F7NA 3EFLA 3A60A 4K8AA 4RQKA 4ZTSA 4AZVA 3CR0A 4FIIA 3T9TA 3LOKA 5FTOA 4ANQA 2GTNA 3UOKA 5IH5A 4QMZA 4QTCA 2HY0A 2ITVA 3LJ1A 4I4FA 3EMGA 5AA8A 3E7VA 2BAQA 2WTKB 3HV7A 4FT5A 3P78A 4S32A 3F5PA 3H9FA 3MDYA 4C36A 4JR3A 4YUQA 2UUEA 4YTFA 5A3XA 2VX0A 3TG1A 4FVQA 4CYIA 4ZTRA 2GPHA 3O17A 3TV4A 4O0YA 4CFUA 1SNXA 2GQSA 3A4OX 3GGFA 3IG7A 3GQIA 3F2NA 2Y6OA 1FOTA 2YJSA 3FBVA 4YR8A 2UZOA 1KOAA 2W1EA 3OROA 2Z7RA 1SYKA 5DR2A 1E1VA 5BNJA 2ETKA 4KRCA 5IUHA 2OIBA 3VAPA 5I9WA 2IG7A 5IH6A 1RDQE 5JQ8A 3VW8A 3O7LB 4ZLZA 2OLCA 5F9EA 4ITHA 5AR3A 3RPRA 5GIPE 4IB5A 5E92A 4G3DA 1VJYA 3CKXA 5CEOA 1JSVA 3F3VA 2XIKA 5KHXA 4WT6A 3LE6A 4M12A 4RC3A 2A0CX 2X6EA 5IU2A 3LFEA 4ZS4A 2OKRA 5CI7A 5IH4A 1YXVA 3NVMB 4MTAA 2QVSE 1Q99A 4HZSA 4DEBA 3A8WA 5E8SA 4RVTA 4KIQA 4RWIA 4DYMA 4S34A 4FG9A 5E8YA 3IW8A 5CWZA 4LQMA 3QQLA 4I5MA 5JH6A 4FK6A 4L53A 5AR5A 3ACJA 1YI3A 5IISA 3TEIA 3C5UA 2J0LA 3RPOA 1B38A 4RIWA 2X7OA 2ZAZA 4XG8A 4UALA 2O5KA 3NCZA 2IVVA 5HLWA 2I0YA 2UZWE 3CPBA 4AA4A 2WMAA 4FZAB 2PVMA 4U9AA 5B2MA 5L3AA 2WOTA 4E7WA 4JDIA 5CQWA 4FSQA 5H8GA 5GZAA 4ZLOA 4QNAA 3R21A 3PWYA 5EQYA 4NKAA 2I0HA 4RVKA 1SVGA 3EYGA 3G6GA 3V51A 4D4RA 2WU7A 4EQMA 5JRQA 4TWNA 1Q3WA 3D4QA 5K5XA 2UZDA 4BIBA 5IZFA 3GXLA 2XNGA 1YOMA 2W1CA 4Y95A 3BHVA 4X3FB 3QKLA 4AT5A 4LI5A 4O0RA 4WBOA 3NW5A 4ZSAA 3DBFA 2HW7A 1LEWA 3AC4A 3KXMA 4MF0A 1REKA 1TVOA 4NM7A 4GEOA 1TKIA 4TYHB 2WXVA 3W8LA 1H25A 2XK6A 3QX4A 5FP6A 3BZ3A 5I9ZA 2ZOQA 3MTFA 2PWLA 4NJDA 2GNLA 2GDOA 4DLIA 1GIHA 3BHUA 4U45A 4XRLA 5J8IA 3R9HA 2XJ0A 4D2RA 2YAAA 5E8WA 2P0CA 2C0OA 4X2JA 3VO3A 3EQDA 2GNGA 4U6RA 2B9IA 3AT4A 3LJ2A 4O21A 3R04A 3WIGA 1CSNA 3EQHA 4V01A 3UIUA 4DG0E 3ZUUA 5CT0A 4ID7A 5AP0A 4U79A 4HPUE 2RSVA 1Y8GA 4FIEA 1ZXEA 3UNJA 4U97A 4BWPA 2WELA 2HCKA 3OXIA 2F49A 4A4LA 2CCHA 2ZDUA 1ZYDA 2W1DA 5AP5A 2BDJA 4FR4A 4W4VA 2QOBA 3ZDIA 3MB6A 1OIQA 4UY9A 4EK5A 3DTCA 3A4PA 4AZSA 2WKMA 3EOCA 1U59A 5E8UA 4OGRA 4TYIA 3BPRA 3TNIA 4IANA 3UC4A 4G17A 4IXPA 4C4HA 3PIYA 3H4JA 3OT3A 3VQHA 3EQCA 3A62A 2ZB1A 5AX9A 5EDQA 2X7FA 5GZ8A 5KMOA 4FSWA 2Z7SA 2W9ZB 4RWJA 4XH6A 3A7JA 5CSPA 2Y9QA 4QMWA 2GCDA 3NYXA 4EONA 1FMKA 3PXFA 4AN2A 4F1OA 3R7VA 4EK3A 2H8HA 3ZLSA 3U8WA 3HMNA 2BRBA 3LCTA 3OWKA 3SW7A 2C6LA 5CF8A 1G5SA 3RAWA 1P5EA 2WEVA 2XP2A 1Q24A 2WO6A 2Y4PA 3LCSA 4BTMA 4E6QA 2CKQA 2QD9A 3L8VA 2B55A 3IKAA 4YGAA 4AW2A 5EW8A 3Q9XA 3OUNB 3UMXA 3NDMA 4HOKA 2Q83A 4GK2A 4JDJA 3OHTA 4JX3A 3DKOA 3NX8A 5CF6A 4JS8A 4FL2A 1Q8UA 5M55A 2PMNX 3Q9YA 3SV0A 3GENA 3TWJA 4ZSLA 4NIFA 1DAWA 3C9WA 1R78A 5JRSA 4NTTA 3FY0A 4HVGA 4G1WA 3MVMA 3DXQA 3UVRA 3HMMA 3ZRLA 4Q9SA 2O65A 1A48A 5BQ0A 1OGUA 2B1PA 3WZKA 2W17A 1O9UA 3O7LD 4FICA 1PXPA 3AC2A 2X4FA 2C3JA 3LXNA 4BDCA 4NW6A 2UW3A 4HVIA 4MYGA 1XH6A 2VGOA 4EBVA 2P4IA 5AUUA 1PXNA 4FSZA 4R3PA 5A9UA 3C13A 2BAKA 5IQHA 4NUSA 5AIKA 4EKKA 2BMCA 4RIYA 4A9SA 4BKYA 1UU9A 4FSTA 4N6ZA 3EKNA 2PZ5A 2PZRA 4GVJA 4I92A 4LRJA 3WI6A 4AGWA 5A14A 2XM8A 3VUDA 3A2CA 2G1TA 3VS0A 2X9FA 5DFPA 1H8FA 5EOLA 1JOWB 3PJ1A 4RIXB 2ITUA 3ULZA 3NR9A 1MUOA 4D1SA 4FL3A 1ERKA 5GJFA 3THBA 3D9VA 3U55A 3QFVA 4DG2E 3DCVA 2CKOA 3D14A 5BUIA 2CMWA 4K6ZA 4LUDA 4J1RA 3PXQA 5HD4A 3MYGA 4RJ5A 5DE2A 4PMMA 2JDRA 3QGYA 4AWIA 4DH3A 2GS6A 2B9JA 2XVDA 2YCRA 4ZAUA 4I22A 1YOLA 5KMMA 4M68A 2CNVA 2JDOA 5CY3A 2Z8CA 3BHHA 3JYAA 3LFBA 3WOWA 2UW7A 5ANKA 2XK8A 4KSPA 3G9NA 1PY5A 3NYNA 2OW3A 5TR6A 3ORTA 3QZHA 3F6XA 3F9NA 5EYMA 1ZAOA 5DPVA 3TNQB 5M07A 3MFSA 1IASA 4AACA 1SZMA 2PVYA 3RAIA 1Y6BA 1V0BA 2C6EA 3BEGA 3EHAA 4HZRA 4FODA 3BYOA 2VWIA 4W8DA 1OIRA 3LFDA 3RHKA 4X21A 4AOIA 4RQVA 3AG9A 3OD6X 3HMIA 2BDFA 4B9DA 2P3GX 3NW6A 1EH4A 4I23A 4J53A 4A9YA 3PJ8A 3KVWA 3UMWA 3HKOA 4M7IA 3HV3A 3C4WA 5E91A 3BEAA 2ZB0A 4GT3A 4IAZA 4JBPA 4PL3A 4JRVA 4PPAA 3IW7A 3O96A 5I9XA 4YHTA 2VTJA 4WKQA 4AZFA 5LVLA 4I5CA 4BDFA 4N0SA 2W5BA 4RJ7A 4PL5A 1Y91A 3KULA 2QOOA 2QC6A 3QX2A 4CKJA 1NVRA 2R3NA 2UW0A 1ZY5A 3R02A 4ZTLA 4CXAA 3I6UA 2GSFA 3ZSGA 3JVRA 3QAME 4ASXA 2YDKA 4CT1A 2PULA 5J1WA 3L9MA 4IC8A 4MHAA 4MNEB 4CLJA 2W0JA 3LLAA 3ZC6A 2R3HA 5JGDA 4IACA 2BUJA 4K9YA 4RZWA 3DAEA 4AP7A 4I1ZA 5KUPA 4IC7A 3LFNA 3O2MA 4WOVA 2HAKA 3MBLA 4DFXE 4EC9A 2C3LA 3HNGA 4JXFA 4J98A 4PQNA 5AM6A 5HORA 4QYEA 3P7AA 5A4CA 3W2OA 3C4CA 4O82A 5L6OA 2JEDA 2YWVA 3DV3A 4FV6A 3R7IA 5CAUA 5ETFA 1G8SA 3QA0A 2WOUA 3OXTA 4GT5A 1GJOA 4NM0A 4X2NA 4ZIMA 4BCNA 3DA6A 2R3KA 1YXSA 2VNYA 3ZZEA 2R3OA 4EK4A 4NT4A 3MI9A 3TKUA 4DG3E 5KE0A 3IW6A 5JGAA 4JDHA 4QP3A 3BGQA 3ZXZA 2YM5A 4GK3A 3PXYA 3FXWA 2R0IA 4GJ3A 4P5ZA 4EKLA 3L8PA 3RJCA 4CYJA 4DEHA 1QPJA 5I3RA 3FLSA 2VWWA 3FYKX 2ZMCA 5EG3A 2R3IA 3DU8A 2QQ7A 1UU3A 4HYHA 4MD8E 3SA0A 3GC8A 4NK9A 4ZY4A 4MWHA 4PV0A 2WEIA 3QD0A 1FVVA 5K5NA 3G9LX 3F3WA 4FTLA 1STCE 4XG6A 2P2HA 2PUUA 5L2IA 3FXXA 3UOJA 4GS6A 5FLFA 4DC2A 4BI2A 4D9TA 5EQPA 4FKTA 5CI6A 5EI6A 3UYTA 3VHEA 3IECA 5TF9A 4Y73A 4ASEA 4IAFA 4DH7A 4YURA 1U54A 5M4UA 3UPXA 2B54A 2PE1A 3DQXA 4I6FA 1UWJA 3TDWA 2IZRA 1URCA 4ZSEA 4ZJVA 5GIOE 2C6DA 5AP7A 5BMSA 5ETCA 2OG8A 2VWUA 4BF2A 3QRJA 2FUMA 1XBAA 2BTSA 3BYMA 1YXXA 4FKPA 5FQDC 5L2QA 4ZMEA 2QONA 2QG5A 4EH8A 4EH6A 2H6DA 3MS9A 2J5FA 5CYIA 2H96A 4EK6A 5T6KA 3PRIA 4FZ7A 3F5UA 5EKNA 5IEXA 1A06A 2J50A 3Q52A 1W98A 4ANOA 4LGDA 2C1AA 3SRVA 2UZBA 3F3ZA 3BQRA 1T45A 3FMEA 5F94A 3NLBA 4S33A 2BVAA 2FSMX 3E5AA 2ZM3A 4JX7A 2VNWA 2KTYA 3ZFYA 5CU0A 2OIQA 3KQ7A 5J7HA 3F66A 3ZEPA 1M14A 5DIAA 3LIJA 3CXWA 5D7AA 2O63A 4QP1A 3VBWA 2YDJA 3V01A 3TCPA 2HZ0A 1UA2A 5HE1A 5J9YA 4MXOA 3GCPA 3VHKA 4QTDA 4IDTA 3GCQA 5D10A 2AC5A 5AADA 5AR2A 3AD5A 3OBGA 3QZIA 5EI2A 4BDKA 4GV1A 3CC6A 4NTSA 5LOHA 2XIXA 2CGWA 4CMTA 4IWDA 3UG1A 2OI4X 5E8ZA 4GG5A 3MY5A 1K9AA 2V55A 4F65A 4KD1A 5C4LA 2ETRA 3SLSA 2OSCA 2YFXA 1FPUA 2PUIA 5L4QA 4B0GA 2F7EE 4D2SA 2IW6A 2J0IA 2CN5A 4YJQA 4A07A 2GS7A 1PXOA 4DBNA 3MFUA 4O0XA 2W1ZA 3R7OA 4PUZA 1OKYA 4EC8A 3Q04A 2CLXA 4G34A 3IS5A 4V05A 5E9EA 2UZVA 3C50A 3VW6A 4YHJA 3F5XA 5EW3A 4YJNA 4F6SA 4HGTA 3UZTA 1OI9A 5GINE 4XJ0A 4E4LA 2W7XA 4YLJA 3CGOA 2O2UA 4EZ3A 2CKPA 1REJA 3QTQA 4USEA 5J1VA 2JKOA 3PP1A 3GCUA 3OTUA 3CTJA 3D0EA 4QD6A 3AMBA 3COHA 3TUBA 4QMVA 4WNMA 3QGWA 2R4BA 2YIXA 4XOZA 1JPAA 5HICA 5AP2A 3FZPA 2OFUA 4AW1A 1ZZ2A 2E9PA 3UNKA 4L46A 5EM5A 1TQPA 2EB2A 4K11A 1Q3DA 3GUBA 3EN9A 4QRCA 4WNKA 1R3CA 4IFCA 3R8MA 3POOA 4Q5EA 4XV3A 4OBPA 3WZUA 2OJFE 5DMZA 4H1MA 2FVDA 5LMBA 4ORKA 4ZMFA 2V7OA 5E8VA 5IA0A 3NAXA 1V0OA 4RSSA 4DH1A 4J7BA 2G2HA 4MEDA 4GFOA 5DGZA 4FNZA 4FX3A 2XK4A 4WUAA 3ZHPC 2R2PA 4DEDA 5EDRA 4ZZNA 3BGZA 4HGSA 3DBCA 4UMTA 1YDSE 5HO7A 5CLPA 3R30A 4QTEA 4DINA 5IG1A 2J0KA 4BCIA 5F95A 3KU2A 2XA4A 3FC1X 3BYSA 3NIZA 4EZ5A 4L52A 1ZZLA 2J51A 2PZPA 4L9IA 4O0SA 3O8UA 2PE0A 3BBWA 4N6YA 2PU8A 5HBJA 2R64A 2R7BA 3F7WA 3RP9A 3EQIA 4KKHA 3FAAA 3LM5A 2J0JA 4D4YA 5KNJA 2V22A 2PTKA 2RF9A 3B8QA 3I79A 1CKIA 1M17A 3P79A 2QI8A 2ERKA 5HCYA 3UO4A 4C59A 4NSTA 3FPMA 5JFWA 3KA0A 3QD4A 4FKQA 5IQAA 2EXCX 3EZRA 2IZSA 4EH3A 4AAAA 2PE2A 3D7TB 1KOBA 4ASZA 2J4ZA 4BIDA 4QPSA 1B39A 3OVVA 3QXPA 3HRCA 3HV6A 4FG7A 5B2LA 3DKGA 3IQ7A 4XG3A 4RJ4A 5BX0A 3FMKA 5DT4A 3DJ5A 3ZFXA 4NCTA 3V6RA 4A4OA 2ITZA 2QO2A 3QHRA 4ONAA 4HPTE 4BDAA 3U6IA 5FUTA 1DI8A 1PHKA 2UZNA 3P7CA 4FKUA 4GCJA 4IB0A 4FSYA 5I3OA 5C1QB 2X39A 3UQCA 1PXJA 4YJPA 4GYGA 1QPEA 3L9PA 2C0IA 2J7TA 3QUPA 5DWRA 3F5GA 3MSSA 4GJ2A 4WO5A 2CSNA 3FLWA 4B99A 3P4KA 4FKVA 3FZRA 4D0XA 2UVZA 4EQCA 2C6KA 3MN3A 4GKIA 1H1PA 4G3GA 1ZY4A 4UWBA 5LVOA 2YDIA 3A7HA 2Y4IB 2JAMA 3A8XA 4EL9A 3UO6A 3FQSA 5ANEA 1ZYCA 3GC9A 3PXRA 4RFYA 1DS5A 3WF9A 5JN2A 4YPDA 1VR2A 4PMTA 3NUPA 4ZSJA 3KRRA 3LQ3A 3FWQA 1VEBA 3PXKA 5HVYA 1T46A 3TN8A 3VF9A 4OAVB 4EQUA 4DT8A 2YLEA 5CEIA 3PRFA 3PVBA 3EQPA 3AQVA 1OPJA 1Q62A 2WIHA 3OS3A 4L8MA 3RZFA 4QPAA 4HW7A 2OJ9A 2G15A 4QQCA 2BPMA 1P2AA 3SC1A 3NUXA 4II5A 3RCJA 3CTHA 1ZMUA 3UOLA 3AT2A 4U3YA 4E4MA 4U40A 3EN5A 3HA6A 2W9FB 1FGKA 3ZSIA 2O64A 3R0TA 1Z57A 3M2WA 4FKWA 4HVHA 2YIRA 3O23A 5DT3A 4FL1A 2O0UA 2OZAB 1Q61A 1ND4A 4FOBA 5FBNC 1SNUA 1YWRA 1WBTA 3CS9A 1RJBA 4TW9A 4JLCA 3LQ8A 4XG4A 4AU8A 1IRKA 4BHZA 5J5SA 2RFSA 2X8DA 4XBUA 4KRDA 4BGQA 2C5XA 2ITTA 3W32A 3ZRMA 3ERKA 3R1SA 2XBAA 4N70A 2SRCA 4U5JA 5KZ0A 2OU7A 2B4SB 3COKA 2VX1A 4FIFA 5FDXA 3HRFA 4IHPA 4OW8A 5JGBA 3HUBA 5FXQA 4IAAA 5AR8A 5HNBA 5AP4A 3ZRKA 5M08A 2PYWA 3HZTA 1UU7A 3DTWA 4XX9A 5H3QA 4QMQA 4O2ZA 4IZ7A 4NL0A 5GJDA 2XBJA 1OKVA 1GIJA 4F7LA 4A9UA 3DXNA 5BVKA 4F6UA 2JFMA 5A4TA 1KE6A 3GCSA 2PUPA 3HGKA 2BDWA 2W99B 3SXFA 1A9UA 4ZJIA 3VWAA 4RRVA 3ZBFA 2CNQA 3MVJA 2F2CB 2VTAA 3DGKA 3MVLA 4XP3A 4O7ZA 5CAPA 3FZTA 1ZOEA 3OCTA 1H24A 1H08A 5H8BA 3VRZA 3ZLWA 5BMMA 3TI1A 3EN6A 5FXSA 3WF8A 5C26A 3MVHA 1R39A 4USFA 2VTSA 2XIRA 3PVUA 2YIQA 5HESA 4QMXA 3W2SA 1W8CA 5A4EA 4O84A 5AUTA 4BCHA 3U54A 3QBNA 5HG5A 4YLLA 4TWCA 4YSMA 4ZJJA 5ACBC 3HA8A 3IOKA 4F9YA 4GIHA 1JKLA 3TV6A 4NU1A 3KL8A 4BYIA 4CRSA 4C2WA 2AUHA 3R71A 5H2UA 4L3JA 2W05A 5LWNA 2IW8A 5AMNA 3PJCA 3BU5A 4USDA 2WGJA 4O1PA 2YM6A 4IJPA 4ZY5A 3QD2B 3F61A 4KABA 3HP5A 3I60A 4JRNA 5IA5A 4PNKA 1MQ4A 2GNHA 4QMOA 5A4QA 4F0IA 3V5JA 4IB1A 1ATPE 4QPMA 5LCJA 3NZ0A 4RA4A 4L44A 4KIPA 3W55A 4ZZOA 5HKMA 1QPCA 3MH3A 4TYEA 3GC0A 3QF9A 3QWJA 3ORPA 5IA3A 1UWHA 4JI9A 3G5DA 3JXWA 3KMWA 4RT7A 3OEFX 4QOXA 4YHFA 4IAIA 2ITYA 3GOKA 1GIIA 3PZEA 3Q32A 1OITA 1GY3A 3EFWA 4L01A
chains in the Genus database with same CATH superfamily
5GNKA 4QYHA 4CEGA 3UE4A 4NM5A 4AE9A 3NIEA 4FIHA 3L1SA 4UWCA 3QA8A 3S0OA 1H1RA 4E4XA 1OPLA 1UKIA 4FBXA 3H30A 2E9NA 4FV2A 2NPQA 4C7TA 3S00A 4WNOA 2BIKB 3VONA 3E93A 3F3TA 3JPVA 4I93A 2YM8A 4PDOA 2B0QA 3SGCA 2G2FA 2WTVA 4JG7A 2JIUA 3MPMA 3R00A 3KF4A 5D9HA 4MXZA 4DHFA 3AMAA 4YU2A 4AA5A 4R1YA 4FEXA 4CFWA 3LVPA 3R7GA 3HAMA 2ITNA 4IAKA 4BCKA 2C5OA 4LL0A 3QZGA 2QNJA 3N4UA 2QOCA 4CG9A 3KGAA 2QOLA 3Q4UA 4DH8A 3I7BA 4YJRA 1IG1A 5HTBA 4V04A 3OF0A 4EI4A 4FTKA 3ATSA 4XBRA 3VF8A 2OWBA 4NM3A 4MCVA 4IBMA 3I0OA 4BDEA 3FE3A 2JIVA 3EQFA 2EU9A 3SOCA 3I0QA 3LCKA 4G6LA 4U81A 2W4KA 2BCJA 4J95A 4KA3A 5EYKA 3ZM4A 3EL8A 4B8LA 5DI1A 4QYFA 3PIXA 3QCXA 2W1IA 4HGLA 4QP4A 4BDIA 4IAYA 2PZYA 4I0RA 1CMKE 1W84A 2HWPA 2P55A 3PYYA 4GVAA 3ZONA 1LP4A 5BVWA 1ZYLA 5HEZA 5ANOA 4GK4A 5B0XA 2R3GA 1UNHA 2A2AA 4HGEA 4R5SA 2C3IB 3UC3A 3HAVA 1XBBA 4WG3A 3OWLA 4BCGA 4EOSA 4AZTA 1LEZA 3ZEWA 4LV7A 2XKFA 1MQBA 2AYPA 4NW5A 2GFSA 3DFAA 4G5JA 4LGGA 4O2PA 3OWJA 5HTIA 2Z60A 3FI4A 3ORMA 4BR3A 1YWNA 1HOWA 2ZV2A 5AAEA 3N51A 1G8AA 3CD3A 5BVDA 4YBJA 3GU7A 4G9RA 2UV2A 4DE4A 3SQQA 2VTQA 3EN7A 3ENHA 3MWUA 3PJ3A 4N4SA 4NCTC 4OTGA 5D1JA 3VUKA 2IVUA 5FBOA 2NNWB 4JG8A 1J7UA 2R7IA 4GUEA 4JAIA 3LMGA 1H1SA 2CPKE 2FB8A 3E88A 5C8NA 3AC3A 4IX4A 5AR4A 3L8XA 4ERKA 3HRBA 5KX8A 3CQEA 3OTVA 5K0XA 2PMOX 1PF8A 4TNBA 3PUFC 2EXMA 4I5PA 2FSOX 3D7TA 4R77A 2HZIA 3NWWA 3FMMA 3TZ8A 4YNOA 2XCKA 4Q9ZA 3OXZA 5A46A 3PE2A 3BU3A 2Y0AA 3U87A 4A7CA 4KBAA 2Q0NA 3TTIA 3DBQA 5AEPA 4DA5A 2C6MA 4WNPA 5AIRA 4HVDA 2XJ2A 1XBCA 3ORKA 4M0ZA 5CSVA 2WMXA 2ITQA 4DLJA 3CGFA 4CZYB 3RKBA 4IADA 1P14A 4LM5A 1OL5A 1M7QA 3AC8A 2QCSA 5DRBA 2V5QA 5AP6A 3NUYA 3UTOA 3EFJA 4BHNA 4O38A 3QQUA 3MA3A 4J97A 2JD5A 2QOQA 4I41A 1WVXA 3OY3A 3RVGA 5CXZA 4XS2A 4FEUA 1W7HA 3F2AA 4DCEA 3IW4A 3GFEA 4X6QC 5LVPA 3DB6A 1MRUA 2UVYA 4QP9A 3FEGA 3AT3A 3LCOA 2W5AA 2G9XA 4A9RA 4XV1A 3HVCA 3FMNA 4XMOA 4Z7HA 3IDCA 4X0MA 1GNGA 1FVRA 2B52A 2IO6A 4Z55A 2VTHA 4G3FA 4C37A 2VTTA 3R01A 3TNPC 1F0QA 2W06A 4BZOA 3MY0A 3Q6UA 4A06A 5ANDA 4L3PA 3ORLA 1B6CB 2I0VA 2OJIA 5M4FA 2REIA 2EXEA 4I94A 2ITOA 3BHYA 4J52A 4QP6A 1WFCA 1PXLA 2O8YA 4FUXA 4M69B 3ELJA 4MQ2A 5D11A 5DVRA 2X1NA 3RWPA 3UODA 3ZXTA 4XUFA 3VBYA 5JZJA 4TL0A 4WUNA 4FF8A 3R6XA 4JAJA 4XNEA 4BIEA 3Q2JA 3W0QA 4Y5HA 3D7ZA 2JLDA 3S95A 5I0BA 2IJMA 4UEUA 5CSWA 4O7NA 3RK9A 4EOIA 3S1HA 4YSJA 1ZMWA 5EHYA 3RWQA 3CJGA 4L43A 3ZUTA 3E87A 4JQ8A 3UZRA 5JQ5A 3SXRA 4FKJA 4ACDA 5CU3A 4J96A 2C5YA 4FV4A 4OAUC 4S2ZA 3PDTA 1HCLA 3CBLA 2BZJA 2BRNA 4I24A 2WMBA 4RWKA 4YC3A 1OMWA 2A19B 2C6OA 3Q4TA 4QQJA 5HHWA 4FTMA 1Q8TA 3NSZA 2YM3A 4YZ9A 4BTKA 4FJVA 5J9ZA 3KB7A 1PXKA 1R0EA 5CALA 1KSWA 4DEAA 4GSBA 4MH7A 5L8KA 3OY1A 3Q4ZA 2WMSA 4HYIA 3N4VA 4R6VA 2VTPA 3LCDA 3S4QA 2VUWA 5E8XA 5TOZA 3ZLXA 5KBQA 3BE2A 4RFMA 5E7RA 4DEIA 3CP9A 2R3JA 2WQEA 5C8KA 4R1VA 2EVAA 4HCUA 5FEQA 5C27A 4BKJA 4PTEA 1IA9A 4FZDB 2UW4A 3PE1A 2VV9A 2BALA 3MESA 3TL8A 3PFYA 3KN6A 1O6LA 3ZUVA 3REPA 3QQJA 5TE0A 4MK0A 3K3JA 2F57A 3ZO3A 2AC3A 3FKOA 3ZDUA 5HGIA 3TM0A 3K5UA 3G15A 1XHAA 3TT0A 1BI8A 2QHMA 5DEWA 4E6CA 1XH9A 4TNDA 4W8EA 3R8VA 5HE0A 5LCKA 3TKIA 3VUMA 4RA5A 3NAYA 3PLSA 4QMSA 2PVJA 5FG8A 4FTQA 2R5TA 5KZIA 2XM9A 3PVWA 4H36A 5J79A 1H28A 2B7AA 3QUEA 4AT4A 4FTRA 1H0VA 2Z7QA 5K3YA 5IEYA 1APME 1YXUA 1PKDA 2XF0A 2R9SA 4TTHB 5LMKA 1IR3A 4Y83A 4XG7A 5IQIA 1CM8A 5I9UA 4BDBA 4C33A 2I6LA 4LG4A 1WBSA 5KMNA 3KREA 4CSVA 1H00A 1QMZA 3V8SA 3QYWA 4E5AX 3A99A 2HYYA 5CNOA 3QUDA 3QTZA 4W9WA 5DEYA 5H9BA 2WTCA 5FRIA 4C4IA 4NFMA 4EYMA 3BHTA 4UN0C 5M51A 5IQDA 4LRMA 5L2TA 1MP8A 1XKKA 4WD5A 3DNDA 4AN9A 5FGKA 2NRUA 4E1ZA 4D2VA 3R2BA 4O22A 4TY1A 2WHBA 3K2LA 4YZNA 1W2DA 1QL6A 1YW2A 2ZV8A 3KXGA 3TXOA 3W16A 3ODYX 5T3QA 3OOMA 4TN6A 3C51A 4C4GA 3LFAA 3OUKA 1S9JA 5AAFA 4ENYA 2JDVA 3VIDA 4J8NA 5IMEA 3NMUF 3RAHA 2QKWB 4JIKA 3VBTA 3PIZA 4PNIA 1NVSA 4DFNA 3QTXA 4IX5A 4LL5A 4IVCA 3MH0A 3BI6A 2UW9A 4FV5A 4U8ZA 3VVHA 1FBNA 3ATTA 2XIZA 3ROCA 4F63A 5AA9A 2XB7A 5HBEA 5KMIA 4JBOA 5AUVA 3WZEA 3FL5A 4FNWA 1Q4LA 1XH8A 2WD1A 3PVGA 3B2TA 4IVAA 5DRDA 5E1EA 3PG3A 3ZO4A 3KXZA 4QMTA 4CFXA 2OH0E 2YAKA 3QC9A 3RPYA 4XLIA 5DA3A 4CRLA 3PUPA 4YTCA 3G51A 4S31A 4PF4A 4XCUA 4G6NA 3T3UA 4GT4A 2OF2A 4O96A 3KRWA 4AGUA 4K33A 4FTCA 5CZIA 3NUAA 3LFSA 3BKBA 2X0QA 3EKKA 3MFTA 4MXAA 4APCA 3PY3A 4BBEA 4CNHA 2NO3A 5EM7A 1J7LA 3QKKA 3N9XA 1HCKA 4DCAA 3Q6WA 3DKFA 4ZOGA 3BYVA 4OTQA 4QMMA 3SXSA 4X3FA 2YERA 3VS4A 4D5HA 4CD0A 3VBXA 3OW3A 3OCSA 3QL8A 5D41A 5FEDA 5EI8A 4H3BA 4AE6A 4PP9A 3I1AA 2YEXA 3FLZA 4I0TA 4TYHA 5AV2A 4RX5A 5AAGA 4MX9A 5EHOA 3HV4A 2ZV7A 4QYGA 4OLIA 5DR9A 5AP1A 4R5YA 4AF3A 2BKKA 3EQGA 2PL0A 3PY1A 4L00A 3OFMA 3V5LA 3DDPA 4HYSA 1XQZA 2VAGA 2OZOA 4UXQA 4FOCA 4H05A 2DYLA 3QD3A 2HZ4A 2PVRA 4ZXTA 2WQMA 3KXNA 3RMFA 2WFYA 5IPJA 3DKCA 5GHVA 4DGGA 2RFEA 2FGIA 4G3EA 2EUFB 2ITWA 4E8AA 2DUVA 1FVTA 4EZ7A 1Q5KA 3U6JA 5JT2A 3W0MA 4IDVA 3BLRA 2CGUA 2X9EA 4UYAA 2VTRA 3PSBA 1YWVA 3BV2A 3WF7A 3ULIA 2ZJWA 2RL5A 2VTMA 3U9NA 3OW4A 4LOOA 2GMXA 3TV7A 4L45A 1ZARA 5CU2A 3SX9A 3ZO2A 5L8LA 5EDPA 4ZY6A 4DTAA 2WMUA 2X7GA 1PRYA 3V3VA 3FMLA 3R83A 1YKRA 3FMDA 5BUJA 4CG8A 1YHVA 1L3RE 4BCMA 1OUKA 3PJ2A 4WIHA 1XH5A 1CKPA 1BI7A 1XO2B 4JDKA 3D5UA 4FTNA 3EQBA 1YQJA 4RX7A 5KMKA 4EH2A 3G90X 3MGYA 4X2KA 4NEUA 3PPZA 3QLGA 2YABA 2X6DA 5HBHA 1PMVA 2XNBA 4RPVA 3ID6C 4KS8A 4ZS0A 3WARA 1YRPA 3R7EA 2ACXA 4MVFA 5D7VA 4D9UA 5L2SA 1U4DA 4Q2AA 4OBQA 4LMUA 4O0UA 4YO4A 3UG2A 4CCBA 3UYSA 2QU5A 3CEKA 3GU4A 5JFSA 5KKRC 3FXZA 4QO9A 4O81A 3MIAA 4LV8A 5CEPA 2RIOA 4NH1A 1M52A 4K77A 2DWBA 4XV2A 3ZSHA 1R1WA 3D2KA 4EH7A 2IF8A 4IFGA 3V8TA 3KIOC 5DR6A 2AEGA 2IZTA 4F1TA 4E73A 4YJSA 2VTLA 2VTNA 3TUDA 3LFQA 5FP5A 5HX6A 4OTWA 4C3FA 3C4XA 3MJ1A 3P0MA 3R9NA 3BELA 3FV8A 4XG2A 4F0GA 4CFNA 2VWVA 3PFQA 3PLAE 3SD0A 5CNNA 1X8BA 3T3VA 3U51A 4C34A 2XRWA 3OG7A 1NT2A 3E8NA 4ZZMA 5LVNA 1FGIA 4QTBA 3C0GA 4XP0A 3Q9WA 4X2FA 5EQEA 2WTJA 3G6HA 4QP8A 4KB8A 1WAKA 1IAHA 2XCHA 3O0GA 3HMPA 2OJGA 3GBZA 3K5VA 3QRIA 3IGGA 5C03A 1Y6AA 3WYYA 2Y8OA 5IF1A 1OBGA 2F9GA 3V8WA 3WZJA 5CU4A 1R0PA 3W1FA 4KAOA 4EJNA 4FNYA 2XANA 3AD6A 2WMRA 3ANRA 4FMQA 3GI3A 4C4EA 5BVFA 3FKLA 4FEVA 3ZCLA 4OTDA 3JVSA 5CSHA 4I6BA 4YJTA 1SM2A 3TDVA 4QT1A 4PMPA 5LQFA 2XNEA 4RIWB 3UDTA 5HX8A 2WTKC 4YP8A 5HI2A 3IO7A 3FZOA 3UVPA 5BVNA 5EW9A 4PTGA 5AUZA 4C02A 3B8RA 4L68A 1UNGA 2GHLA 3PA4A 4C2VA 3DLSA 2XZSA 3WILA 3CCNA 2R3LA 3QQFA 4RIXA 4QMPA 4WHZA 4BDGA 5AV4A 1KE5A 2ZM1A 4QMNA 1H1QA 4G9CA 1QCFA 3MY1A 5LMKC 4AW5A 2PZIA 3CQWA 3Q3BA 1J1CA 3AD4A 2JGZA 4IIRA 4E93A 4QP7A 3SHEA 1GZOA 4EJ7A 1PMNA 2PVFA 4KNBA 5HG8A 4DAWA 3QZFA 5CX9A 3U6HA 4LMNA 2X2KA 4JQEA 2QR8A 3KY2A 4FC0A 4FT0A 5FM2A 4MXXA 1ZOHA 4BWXA 3W2PA 4MBIA 4TRLA 2OFVA 5HIDA 3RPVA 3RAKA 2V7AA 2VD5A 4OTFA 4EK8A 3P1AA 3PSCA 4X2GA 4DDIA 4W4WA 3I81A 3GB2A 3KXHA 4XHKB 3R8UA 3W18A 3O50A 4M84A 5CU6A 2X8IA 4O7WA 1F3MC 4U3ZA 5ANIA 4ZTNA 4OTHA 2R3PA 5AUXA 3E62A 4WSQA 4GFMA 4MNFA 4IE9A 3ORXA 3OT8A 5E4HA 4C62A 4UB7A 3OP5A 5EFQA 4IW0A 1Q8ZA 1WBVA 3HX4A 3FYJX 3R28A 4TYJA 4IMYA 4G5PA 4D2WA 4F70A 4O91A 4CV8A 3QRKA 3OEZA 4H39A 5CAQA 3WF6A 3QU0A 3RNYA 3OMVA 4E5BA 1Y57A 2J5EA 3IOPA 4H1JA 3UJGA 4CZTA 4R7BA 3LHJA 1WVWA 2QOKA 4HCVA 1Z9XA 3SAYA 3TZ7A 3DB8A 4PRJA 4Z3VA 4UX9A 4PMSA 3ZOSA 3IW5A 4RJ3A 1FINA 4ANNA 2XUUA 2ZM4A 4PPCA 3TNHA 4AOJA 4BCQA 4DGLC 4EH5A 2J6MA 4ALUA 1H1WA 4AGCA 5EOBA 4C8BA 3W8QA 4EYJA 3RI1A 4U44A 3NUNA 4BI0A 5K4JA 4IQ6A 2PSQA 2C69A 1KE8A 3EJ1A 4YZBA 2WNTA 1MRYA 2OJJA 4F99A 4L7FA 2JBOA 4I6QA 4X3FC 1UV5A 1VZOA 3ENMA 4UMPA 1YDTE 3Q9ZA 3IONA 4LYNA 4MNEA 2ONLA 1OPKA 5CSXA 4LOQA 5CTPA 2VTOA 4D4SA 4YMJA 2WMVA 2GU8A 4IVDA 5D12A 2BIYA 4I4EA 5C9CA 1UKHA 4JT3A 4AXAA 5JSMA 3R9RA 4YC6A 2XRUA 4J8MA 4YBKA 2WQOA 4RVLA 2X0OA 3CSVA 1V1KA 5BV3A 4H3PA 4YPSA 3F2RA 2CKEA 4DGOA 2Q0BA 3QCYA 1OL7A 2WB8A 3OC1A 4FI1A 4FT7A 4FV3A 5FTQA 3R9OA 3VS5A 4AT3A 4D2TA 4EWQA 4O4DA 2OF4A 3Q5ZA 1WCCA 2PK9A 3HMOA 1URWA 3L8SA 3H3CA 3MPTA 3R8ZA 5BPYA 1OUYA 2I40A 4KWPA 3U4WA 3ACKA 1LR4A 3QTIA 1JBPE 3DOGA 2J2IB 2Z02A 2C30A 3EWHA 1W0XC 5KMJA 2RGPA 4C3RA 2XNNA 3RPSA 4FSNA 3HUCA 3TJDA 1H0WA 2NRYA 4AFJA 2HY81 4AS0A 4M14A 4GRBA 4CZUA 3C5IA 2W1GA 1DI9A 3O8PA 1IAJA 1DAYA 4KS7A 4MUQA 5AV1A 3ZC5A 3I6WA 3MIYA 1RW8A 4O6EA 3E92A 2JBPA 3L9NA 3F7ZA 3IDBA 4YTIA 4ANLA 4CVAA 3II5A 4R3RA 5IMXA 3EQRA 3NNWA 3LKMA 3FMHA 2QU6A 1I44A 5DHJA 2CDZA 2CGVA 3ALNA 4NIFB 3W10A 3UO5A 4MQ1A 3UQGA 3Q2MA 4I3ZA 4CTBA 4DGNA 4EH4A 3HLLA 5ACKA 2ZVAA 3AC5A 1XH4A 3D2IA 4FKLA 2JAVA 3GCVA 2OGVA 4QQTA 4O0TA 1YDRE 3RTPA 4AA0A 3HL7A 3W0OA 2P2IA 4DTKA 4L7SA 1J3HA 4XLVA 3BQCA 2WMWA 3W2CA 3GU6A 4FV1A 5A6NA 3SG8A 3FQHA 2QHNA 4FKIA 3R1YA 5JEBA 4RMZA 4YZCA 1CTPE 1PW2A 4PDPA 3HP2A 3RM7A 4O27B 4RC2A 5IDPA 4QMLA 3A7IA 3V04A 3TNWA 2JKKA 4R8QA 3IK3A 5FXRA 4MBLA 5BVOA 2YCSA 3TACA 4DFUA 2PVLA 5CAVA 5B7VA 2GTMA 3MA6A 3QQGA 5DH3A 1AQ1A 2BRHA 3QCQA 3ET7A 3W2QA 1U5QA 4F64A 1OL1A 3AXWA 4BBFA 3RALA 1JKSA 1WMKA 3DK6A 3C0HA 4FSUA 4NFNA 4KKGA 4E6AA 4BTFA 2CLQA 4GYIA 3BLHA 2HW6A 3QTWA 4AUAA 5FDPA 5M09A 1BUHA 5GJGA 4HNIA 4EBWA 5EKOA 3GEQA 4M67A 4JQ7A 2X2MA 4KIKB 1YHSA 4PWNA 4BGGA 2B53A 4CMUA 4O0VA 2XEYA 3D83A 4HVSA 1OKWA 2VO6A 3FSFA 4M0YA 2WMQA 2Y7JA 1ST0A 4B6LA 3PY0A 2JKMA 3KK8A 2OICA 2QO9A 2XK7A 2GHMA 2XH5A 3I4BA 2XNPA 3KRLA 1UNLA 4YJUA 5HD7A 5BVEA 4BCOA 3FQEA 4O6LA 4V0GB 1ZLTA 2I1MA 3CLYA 2HXQA 3A7GA 4IX6A 2HK5A 1DM2A 3K3IA 3TUCA 1PXMA 2C1BA 3LJ0A 3RZBA 4BDDA 1ZRZA 4AN3A 1Z5MA 4XG9A 3QHWA 5L6WL 4IZ5A 3LFCA 4EOOA 4Y5QA 4EOKA 3LM0A 3RHXA 5HU3A 2QOIA 3UVQA 2XKDA 4O4FA 4BCPA 1SMHA 4ASDA 3MW1A 3ALOA 3UIMA 4J99A 1O6YA 2VWXA 5DOSA 2PVKA 3RBWA 1K2PA 2BZIB 3EL7A 4X6RA 4F7SA 5CEMA 5IA1A 4L3LA 2PMLX 3BLQA 1WBOA 5KO1A 3EB0A 4DDGA 4IJ9A 2QURA 2PVNA 3C7QA 4BGHA 4DFLA 3DLZA 1H4LA 3CJFA 3E8EA 3KULB 3ORIA 4RLLA 1G8KA 5CXHA 5K9IA 4DITA 3BIZA 3RK7A 3QXOA 5HE3A 5HU9A 1PYXA 3GOPA 5DT0A 2V0DA 4BCFA 4NJ3A 4YNEA 3UZPA 2AQXA 4BBMA 1TQMA 2A1AB 2XK3A 3LXKA 2YITA 4FTTA 1WZYA 2HIWA 4TXCA 4AZEA 3I5ZA 4ITJA 2XKCA 1GAGA 5HNIX 4TZRA 5KMLA 5L2WA 3ETAA 4MD7E 4QMYA 4C35A 5CANA 5C4KA 2O3PA 2GS2A 2VO0A 3CD8A 3I7CA 3LFFA 3FSKA 2A98A 4FTUA 1JKKA 2VTIA 4PPBA 3BE9A 4DGMA 2E9UA 2C47A 2YCQA 1Q97A 3ZBXA 3Q60A 1P4FA 2W1FA 4H3QA 4NWMA 4AW0A 3PPJA 4TKSA 1I09A 4BDJA 3D5WA 3PPKA 4UYNA 3NNXA 5CEQA 3HV5A 2IVSA 4FZ6A 2BROA 3TIYA 3SVVA 1M2PA 2Z7LA 4JJRA 4FV9A 4KUJA 3D94A 4G6OA 2W5HA 1BL7A 5ANJA 3BV3A 2X0PA 4FTAA 4BRXA 3AGLA 4EORA 3UNZA 4N57A 5F20A 1S9IA 5M06A 3WE8A 5CT7A 2OH4A 2YACA 4TYGA 4ZTMA 3LMIA 4ZP5A 5HQ0A 5A4LA 3DPKA 3VRYA 4YLKA 5TT7A 5AV0A 4RJ6A 3AKJA 4DFBA 3P5JC 4CKIA 4K18A 5CVHA 5M4CA 5HCZA 5CENA 1YHWA 4IWPA 4O0WA 3DXPA 4QNYA 5CVGA 5LWMA 3D15A 3MB7A 1ZOGA 3CIKA 2VWYA 4CV9A 2PMIA 4F08A 1TQIA 4JG6A 4C61A 2RFDA 1WBPA 1F5QA 2GNFA 2GNJA 4OT6A 4O4EA 3RK5A 4EHEA 1OBDA 1Q8WA 3F82A 1NXKA 2BHHA 4G2FA 2YLFA 3DAJA 3SDJA 4FZFB 1KE7A 1KV1A 4F09A 3WZDA 4OTRA 2ONLC 4FTIA 1YOJA 4A4XA 4IM3A 3MH2A 4D55A 3M42A 4C58A 2BFYA 3CTQA 3KMMA 2BRGA 4PDYA 1U54B 2I7QA 4JIAA 2BAJA 4WRGA 4B7TA 4XYFA 5ETAA 3QC4A 3EN4A 2B9FA 4EHGA 3T8OA 3OCBA 4QDEA 5I5ZA 3PA5A 5CS6A 2XJ1A 4QDVA 4GUBA 4CT2A 3NFFB 1E1XA 3DAKA 2WTWA 1KUTA 3KC3A 1OVEA 2YWPA 3CKWA 3NPCA 1VYWA 2XKEA 3NYOA 4F7JA 4CLIA 3QRUA 3QTRA 1AD5A 4K0YA 2GHGA 4GFGA 3BU6A 4EHZA 2IPXA 2XYNA 2BRMA 4JVGA 2J9MA 4XEYA 2I0EA 4UMRA 3NCGA 4A9TA 3F69A 4ZK5A 3MTLA 1H27A 2XEZA 3KK9A 5DBXA 3SRVB 4CQGA 5BYYA 5JKGA 2CNUA 3VULA 4BKZA 3ITZA 2YJRA 3BRBA 3S3IA 3KKVA 4FE2A 4TT7A 1Y8YA 3W33A 4MF1A 4QYYA 2BZKB 2VZ6A 5HVJA 4F6WA 2E9OA 4CCUA 2YZLA 2OZAA 2PVHA 4NYEA 3C4EA 4D4VA 4DN5A 5I9VA 2UW6A 3TIZA 2JC6A 3ORZA 3GC7A 2WQNA 3VNTA 4CFMA 3C4ZA 3H9RA 4ZEGA 5FM3A 4YTHA 3E3PA 3VS6A 2ESMA 2JDSA 2FSLX 2OXDA 4XV9A 3FDNA 1AGWA 5FTGA 1NY3A 2C5VA 5A54A 2RFNA 1YI4A 2XIYA 4DFZE 2WU6A 4GU6A 1FMOE 2UW8A 3GFWA 2YISA 3O51A 4IM2A 4HNFA 3FPQA 5JMSA 4D1XA 4UMQA 3E8DA 3OZ6A 3MV5A 3DJ6A 4GU9A 4AQCA 4GKHA 3ZZWA 4FGRA 4FK3A 4FYNA 1H07A 4RWLA 3NVKI 2F4JA 2YHVA 3IPHA 4QQ5A 3G33A 3PA3A 5DYJA 1TFFA 4EEVA 3P7BA 4XRJA 4JBQA 1ZYSA 2R3RA 3PP0A 5M4IA 5C8MA 4FT9A 4RFZA 4ZTQA 2G01A 3UBDA 2BFXA 3P23A 5DNRA 3RINA 4Z16A 2FH9A 2E9VA 4BB4A 3KMUA 4M97A 2XYUA 5IDNA 2PUNA 1J1BA 3FMJA 3ZLYA 1M2QA 4F1MA 4KKEA 4W4XA 5EM8A 4W4YA 3LXLA 4OR5A 3P5KA 2F2UA 3DDQA 2QOFA 4JOAA 3MFRA 3UQFA 4FIJA 5EYDA 2V62A 4AOTA 4LDTA 3TZ9A 5M44A 5H8EA 4JR7A 4K1BA 3QRTA 2W96B 5LMAA 4AXFA 2C68A 4FSMA 3OWPA 1JVPP 4JMQA 4FV0A 4I20A 4OT5A 2C4GA 3CPCA 3KEXA 2YN8A 4G31A 3GVUA 3MPAA 3IGOA 3ZH8A 5M57A 2FSTX 1PKGA 1U46A 2X0GA 4FIGA 4BN1A 4KIKA 2OXYA 2KULA 3BLAA 3V5TA 4FRFA 5LXMA 3FI3A 4BY9E 3R22A 4XP2A 4APPA 1GZKA 2VN9A 3N4TA 5IEVA 3W2RA 3QTUA 1WBWA 4TWOA 3KFAA 2CHLA 4IWQA 3Q4CA 4MKCA 1BX6A 3VQUA 4YJVA 4XOYA 4UXLA 4V0GA 3S2PA 2ZV9A 3SOAA 4EOQA 3DT1A 2JKQA 3TTJA 1BMKA 4CMOA 2YIYA 4WG5A 3ANQA 2W1HA 4G3CA 3ZU7A 5GZ9A 4FTOA 4OUCA 5FWKK 2E2BA 3A7FA 4MAOA 5IUIA 4D5KA 3F88A 5FD2A 3U4UA 4U41A 4HJOA 5IQBA 4RX8A 4RIOA 3G0EA 4ERWA 2XK9A 4IEBA 4HYUA 2NYAA 2R3FA 3OCGA 3QQHA 2ERZE 3H10A 3NNVA 2GQGA 1WBNA 2UZTA 1PMUA 4DEEA 3H9OA 4AG8A 1NA7A 5L6PA 2IVTA 3R9DA 1WVYA 4BWKA 4CFFA 4IX3A 4DT9A 3R1NA 5BUEA 5CAOA 4O86A 2CJMA 3M1SA 3COMA 4YZMA 5AFVA 2WTDA 4PDSA 4E5WA 4KBKA 5EYCA 4Z7GA 1SVEA 4TPTA 3NGAA 1M2RA 3E3BX 1O6KA 5G1XA 3W0SA 4CGAA 5KBRA 1JQHA 4IB3A 4OBOA 4AFEA 5I4NA 4DTBA 2P33A 2R3QA 3F3UA 5FEEA 3ZS5A 3R1QA 3UOHA 3BYUA 3NW7A 3UPZA 2LAVA 1CKJA 5CQUA 3FZSA 3ODZX 5LVMA 2ITXA 2IZUA 3FLYA 3DBEA 1UU8A 2QODA 5ICPA 3R8PA 4ZTHA 4M13A 3QCSA 2OK1A 3BGPA 2X81A 4C0TA 4EOJA 3VJOA 2UW5A 2CGXA 1XWSA 3FKNA 3HYHA 1IA8A 2A4LA 2B9HA 4FNXA 4FGBA 4B4LA 4CQEA 4BC6A 4RVMA 1ZWSA 4MWIA 5HG7A 3QLFA 5I9YA 3NUUA 4IVBA 4RBLA 4O1OA 2UZLA 2C3KA 2YM7A 1G3NA 3V5PA 3FI2A 4E20A 4F9WA 2H9VA 4GW8A 4O7SA 4FTJA 4C3PA 5G6VA 5HIBA 4Z9LA 5AUYA 2Y6MA 4UBAA 4BICA 3ROYA 4I5HA 3FC2A 1G8JA 3QKMA 2IN6A 3UDBA 4BJJB 4BL1A 4BFMA 5E8TA 5KHWA 3ORNA 4LUEA 2UZEA 3VJNA 3PXZA 5L8JA 1ZYJA 2VRXA 3UP2A 3HDNA 3C1XA 1NVQA