5I9WA

Crystal structure of ephrin a2 (epha2) receptor protein kinase with anp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
291
structure length
267
Chain Sequence
TTEIHPSCVTRQKVIGAGEFGEVYKGMLKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 267
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9wA01
2OH4A 3BLHA 2A2AA 5JK3A 3RNIA 5CF4A 3P1AA 4AF3A 4UWYA 2XK3A 2CN5A 2JIVA 3R2BA 4FKTA 3R9HA 4AG8A 3G51A 3GC0A 3OF0A 3P7BA 1BLXA 1JBPE 4FSYA 1REJA 4L3JA 4LGHA 4UALA 4YURA 4E4XA 2GNIA 2X1NA 1H25A 5K4JA 3CTQA 2J0JA 3IONA 3LCSA 4BCFA 3FZOA 4XRLA 1H27A 5J95A 2WIHA 4XG2A 1FVRA 4ERWA 2OF4A 3QUDA 3ZXTA 5BVOA 5IA0A 1WZYA 4NSTA 4XV2A 4E4NA 3G15A 3U6JA 1ZY4A 1UNHA 5AP4A 3E63A 4ACCA 4C33A 4JL9A 4D58A 1M7NA 5T68A 2G9XA 2R5TA 2UUEA 5A14A 5CENA 3VHKA 5CU4A 2PYWA 5LVNA 3ANRA 3RCJA 3UIUA 3RK5A 1CSNA 4BTFA 5BPYA 4EHGA 4FZAB 2Z02A 1H0WA 3GU7A 4BI1A 3O23A 2VTTA 3BWFA 4PTCA 4AP7A 4LRJA 4A9UA 1IA9A 3Q2JA 1YXTA 3FXWA 5HO6A 1TQPA 4TYEA 3DJ7A 5DI1A 2BUJA 3FLQA 4FR4A 3WYXA 3GNIB 3UVRA 2UVYA 3ZOSA 2OJGA 5AMNA 4D4VA 5DIAA 3W32A 1YDRE 4LYNA 1UVRA 5KBQA 4HVGA 4AT4A 4RQKA 4ACMA 4AFEA 1UKIA 2HW6A 4IJ9A 4NWMA 4JAJA 5K0KA 5A4EA 3WF7A 3AT2A 3EZRA 4FVQA 2BILB 2BHHA 4I1ZA 4Q9ZA 1OVEA 1H08A 1PXKA 4GW8A 4ZTRA 4F7SA 4MF1A 4MH7A 4WRSA 5DT3A 5CXZA 1BUHA 3QGYA 5KMNA 3HRBA 3T3VA 4BGQA 5BUIA 4K9YA 4XH6A 2JKMA 4IVCA 3NDMA 3ZSIA 5IH6A 5BVNA 1FVTA 4MQ1A 5LMAA 4O7LA 1XJDA 5CLPA 5BYZA 3FQSA 2PUIA 1WAKA 3NS9A 2ZM1A 3SRVB 5IQFA 3DKGA 2LGCA 5KMKA 4CG8A 3LFCA 5C9CA 4DEBA 4KKEA 3DCVA 2XVDA 4IAFA 2YDJA 3BLRA 1VEBA 4O6LA 1YRPA 4FKVA 3UIBA 4AW5A 3NWWA 5FP6A 4WBOA 5D7VA 4EH7A 5EM7A 3SGCA 4JI9A 3JUHA 1WBVA 4BWXA 2B9IA 3C0HA 4BDEA 4M69A 4I92A 2UW7A 5HLNA 2IPXA 2YIRA 3FZTA 1CKPA 5CVGA 2BRBA 2PHKA 3KXMA 3FY2A 1ZYJA 4U40A 4J96A 2PSQA 4BCGA 3BWJA 3Q52A 4E6QA 4Y85A 5KKRC 2VTAA 3KRWA 2BPMA 4BKJA 3G6GA 2ZMDA 4IH8A 2YN8A 5EHOA 2X8EA 4J1RA 2G2FA 3ZUTA 4DEHA 3JVSA 3GQIA 3HMPA 1YI3A 4TWOA 2O63A 4F1OA 1ZYSA 5GIPE 3R02A 5DT0A 3BCEA 3ENHA 3S2PA 4BVUA 1Y91A 4FSTA 1XH4A 3I5NA 5E9EA 2HZ4A 4PY1A 4R5SA 3C5IA 4EOPA 4D5KA 3CD8A 4EJNA 5JFVA 3OFMA 3VJNA 5H9BA 2QR7A 3OXTA 5C4LA 3MY1A 5AV2A 4RBLA 2QLUA 1R3CA 2P33A 3IOPA 4XG7A 4F9YA 3T9TA 3TDVA 4X2JA 4ZP5A 4DT8A 5EDQA 3WZJA 2PVJA 4ZTSA 5FWKK 2R64A 5M08A 1H1WA 3SW4A 4ZLZA 5DE2A 3BBTB 1OUYA 4M8TA 5J5TA 3PVWA 4HOKA 5EG3A 5CU2A 4TTHB 1Q97A 4CLJA 5CTPA 3CD3A 3S95A 1MRUA 4BRXA 3QHRA 4NUSA 5CSWA 4WRGA 5IDPA 5A9UA 3NCZA 3FMEA 2C5OA 1E9HA 3LM0A 4GG7A 5I9XA 3RK7A 1OIUA 4Y83A 4E93A 4FTMA 3P5KA 4TWNA 3BLQA 4I4FA 4AGWA 4NM7A 3QBNA 2B4SB 3ZLYA 4PNIA 2ZV7A 4DFZE 4PTEA 4AGCA 3CTHA 5BQ0A 1H07A 4CFUA 4ASXA 1OIYA 3F3UA 3QLFA 1PXOA 1OIRA 5FD2A 5JH6A 4AXAA 4ZTNA 2C5NA 5E90A 3HV5A 5AX9A 3CQUA 4DTKA 3POZA 4O6EA 4BDHA 2QKRA 1QPCA 3SXSA 3QU0A 2XIKA 3NNWA 4BCIA 4L42A 4IZ5A 1F0QA 1U54A 4HVHA 4HYSA 4EBWA 5GHVA 2IW8A 3R9NA 3PXFA 4IAYA 4YJNA 3R7UA 3PRIA 1OL5A 2ITZA 4BCHA 3DLSA 2BMCA 1W98A 4RLLA 2IJMA 2R3NA 2W1EA 4A06A 2P0CA 1YOMA 4RWLA 3DU8A 4JG7A 4NL0A 4TWCA 4X6QC 4JIAA 3VBYA 4DH8A 2ESMA 3VS3A 1Y6BA 4BBMA 1ZOGA 4RJ5A 3TUCA 3MFRA 1DM2A 2FSLX 4E4LA 2B0QA 4PRJA 4UMRA 5IQBA 3WE4A 3KCFA 3LFAA 4A9TA 3DZOA 3QTIA 1BX6A 4YZBA 4KRDA 4D1SA 3H9FA 3Q4ZA 4CYJA 2VTNA 4YTIA 4A07A 3O71A 4J98A 1YWRA 2C5VA 4FV0A 4A9SA 1NVSA 1OI9A 2HZIA 3RINA 4NT4A 4QYEA 1UU3A 2V7AA 3II5A 3S1HA 1ZXEA 2OIQA 3AC5A 3PJ2A 3WF5A 2FH9A 3UYSA 4C8BA 3U55A 2V5QA 1OL1A 5M56A 3FLSA 3WF6A 4XS2A 4XMOA 2GS6A 4IB0A 3A61A 3KF7A 2CKQA 3UE4A 2B9FA 4EORA 5LWMA 1H00A 4MD8E 2A4LA 3E93A 4BI2A 5DMZA 5LMKA 4NIFB 5DRBA 1Q8WA 2J2IB 3DFAA 4CQGA 4R3PA 2VD5A 4YJRA 2SRCA 3QRTA 4QP8A 3BKBA 2F9GA 3ZHPC 4ENYA 4M97A 4U3ZA 3V01A 2C68A 4DFBA 5F94A 4BCOA 4DA5A 2ZJWA 2DS1A 1PMVA 1U59A 3HAMA 1XBBA 3Q4TA 1YWVA 4RIXA 2IO6A 1ZOEA 2OSCA 4NW6A 5D7AA 2Y6MA 4IFGA 2XIZA 3ATTA 3RHKA 2DQ7X 4WBBB 3TG1A 4FOCA 4C62A 3C9WA 3HA8A 4FNYA 5JFSA 1MQ4A 2G01A 3WILA 1I44A 2OXYA 4QMSA 4U6RA 3LXPA 1W82A 1UNLA 2YAAA 1ZZLA 3TL8A 2W99B 3EQIA 4DN5A 1DI9A 4UXQA 5HG8A 2JDRA 4FVPA 1UKHA 3KULB 1WBOA 5AWMA 3NNXA 3UMXA 1PKGA 2E9NA 2XS0A 2PZRA 3H3CA 3PP1A 4FIGA 2JEDA 4FTCA 4IB5A 4JJRA 3RK9A 5M4CA 3SG9A 4FV2A 2W1HA 5BVEA 1K9AA 2W9FB 3JYAA 1ZARA 3EQDA 3QQKA 4O0VA 4GT5A 4MHAA 4U8ZA 2VX0A 4CEGA 1M17A 2E9OA 5FBNC 4G3CA 3D7TA 5ETIA 4E1ZA 3RWQA 2QO7A 3BU6A 4HYHA 3TNQB 3COIA 5K0XA 4O83A 3NUXA 2IZSA 4IM0A 4LOOA 4AZVA 2C5YA 4JOAA 3HLLA 4G3EA 4RIWA 3MJ2A 3RHXA 4O27B 3LZBA 4PQNA 4RFYA 4H3PA 4BHZA 4CMUA 3LVPA 4ITHA 4KKGA 3HMMA 2XNNA 2UZTA 3KXNA 3MVLA 5DOSA 5CEKA 3DA6A 3IK3A 4QMQA 4O86A 3BGZA 4HVDA 3L8VA 4WT6A 3FLWA 3LXNA 4Y73A 4AOTA 4IX6A 3ZCLA 5JMSA 2O8YA 4EUTA 5F1ZA 2XCHA 1B6CB 2QU5A 2WMQA 2ZB0A 3CTJA 4NEUA 3MN3A 5AA9A 2W05A 2WTIA 4ANOA 5LJJA 2X7GA 3W16A 4J53A 5KMLA 2JDVA 2YAKA 3RCDA 1MRYA 3H9OA 5LQFA 4MWHA 5J9YA 2R4BA 1E1XA 2YM3A 4U42A 4DGLC 4DCAA 2W4OA 3A7HA 5E8WA 1GAGA 2OW3A 2YLEA 2C1AA 1P2AA 3E7VA 5BMMA 5IISA 2C6MA 2WMXA 4FZ6A 1STCE 3QZGA 3E87A 2F7EE 3CE3A 4V04A 5E8YA 5ACKA 3MA6A 3ORLA 3WZEA 4F99A 3HV4A 4A4LA 4UX9A 3TACA 3GFEA 4R5YA 2VTIA 3F5PA 4ZS0A 3D4QA 2E9PA 1XR1A 5CXHA 3D9VA 2B1PA 1H26A 2C0IA 3RVGA 3SXFA 1KSWA 2OO8X 4K0YA 5C1QB 3FAAA 2OIDA 2V0DA 4LL5A 4RC2A 3VS7A 4C3FA 1KOBA 4DH1A 4CVAA 2B54A 2PE0A 4EYMA 4C59A 5CU6A 2OJFE 3L8SA 4TYIA 1NVRA 1OL2A 5EK7A 3OWPA 4IE9A 2BKZA 5D10A 4IEBA 4QQTA 5IQGA 3I60A 3UOLA 4JG6A 4PL4A 2RFNA 2VTQA 3F3WA 4KRCA 1VYWA 2ITQA 4RA4A 5C8MA 3EFWA 4WIHA 3UC3A 5IMEA 4DAWA 4LM5A 2QONA 3CCNA 2YCSA 5HOAA 2HOGA 3R9RA 1ATPE 4QMMA 4C58A 1YOJA 4O91A 4OTRA 2Y7JA 3BYMA 4Y8DA 5KX8A 3C5UA 4O22A 3DNDA 3G0FA 1J7IA 2CLXA 2YDKA 2EUFB 4RWIA 4RJ6A 4MXOA 4C37A 2X7OA 3K2LA 3GCUA 4DE4A 4MNEA 2JC6A 3QQUA 3CKXA 1XWSA 4J99A 4GCJA 2H96A 4GFGA 3WI6A 4ZY5A 2C6LA 5CY3A 4N6YA 4JRNA 4IC8A 5HE2A 3L9PA 4AAAA 1YHVA 4EH9A 2Q0BA 3KK9A 2H6DA 2J50A 2PMLX 1E1VA 3F66A 5AP7A 5DA3A 4FTRA 3ET7A 4ALWA 2XK9A 4FV9A 3VC4A 3LPBA 4ZZNA 1FMKA 3QCQA 5GJGA 2WEVA 5LXMA 4FSMA 4E5AX 4FT0A 4GUBA 3V8SA 2BRMA 5K5XA 3WYYA 2QC6A 4UYNA 4DF3A 2R3PA 1DI8A 5GZ9A 3TZ8A 4AGUA 3SG8A 3EIDA 1YVJA 2QODA 2CN8A 2OIBA 3DGKA 2JDSA 4BBFA 4KSPA 3OBJA 2PL0A 3DPKA 4R7BA 5AV1A 1QL6A 4AA5A 1A48A 3GU4A 2X6EA 3C51A 3I7CA 2Y4IB 3R22A 3VUHA 4FKQA 1URCA 2QKWB 5EI8A 3Q3BA 3DB6A 3AT3A 3O8TA 5FM2A 3GCVA 2CPKE 2HYYA 4K18A 2I0HA 4NCTA 2C3LA 3BYUA 3NCGA 3QTZA 2NP8A 4M0ZA 4EK4A 2UW8A 4YUQA 3PZEA 2HK5A 5EI6A 2DYLA 3V6RA 1HOWA 2WEIA 2QOCA 3OCBA 4FL2A 1FVVA 2F57A 2BVAA 1V1KA 3DZQA 2OH0E 4JX7A 4XBRA 4USDA 3PXZA 3R9DA 4BZDA 4I20A 4AW2A 3K54A 3E8CA 3PIXA 4J8MA 5EM8A 3RM7A 3R8VA 3DAKA 4FOBA 2FSMX 4QT1A 3EN6A 3R30A 4O7YA 2WU6A 4TZRA 4FTIA 3ROYA 3D5VA 3H9RA 2BFXA 3I79A 4GMYA 2ITOA 4RIOA 1XQZA 2GTMA 1XO2B 4OT5A 2C0OA 3VBQA 3ZC5A 4C3PA 2GCDA 5FTOA 4F7NA 2QOFA 2WMAA 4HW7A 3QCXA 4CRSA 5CAQA 4L00A 3LE6A 5AP5A 4FG9A 4RX8A 1PF8A 2FVDA 3Q60A 2UVXA 2VX1A 3UQGA 4KNBA 2XYNA 2ITUA 5C01A 5IA2A 4RVKA 4AA0A 4IAZA 3WZDA 1PXJA 5BYLA 2JKOA 2PVNA 3FSFA 3NX8A 3QRUA 4MXZA 5CT0A 3R9OA 2PU8A 1KE9A 2W1DA 3SV0A 4I21A 4OTWA 3V5WA 1Q24A 2HZNA 4GSBA 4GYIA 3RMFA 3PVBA 4CNHA 2CGUA 1SVEA 3HNGA 2WD1A 4G3DA 3EQFA 1U4DA 5CQUA 4QMLA 2JGZA 2OJJA 3C1XA 3TZ7A 3HDMA 1IA8A 3I6UA 3VS2A 4EH8A 1FBNA 4EHEA 4NZWB 4UBAA 4FKRA 2OI4X 4GL9A 3FMJA 4Y5HA 3QTWA 3KRJA 4FI1A 4V0GA 2A27A 4IQ6A 3COKA 4S2ZA 2BTRA 4ZTLA 4FTAA 3SOCA 2BRGA 1OZ1A 2XBAA 4XV1A 4EBVA 3NUAA 3MH2A 4QTAA 3N4VA 4KIKB 4GVJA 2GPHA 3PA4A 3GBZA 5L2SA 3LMGA 4ID7A 2G1TA 5A4QA 5CSPA 2ONLC 2BR1A 2OZAB 3QUPA 4GIIA 5EKOA 4EOSA 4K77A 2BAJA 3G33A 4C2VA 1QCFA 2BROA 4YHFA 3WOWA 3KXGA 3LFEA 4KBCA 2BDWA 4L53A 3LFNA 4QQ5A 3CC6A 2RKUA 3ORXA 5HVJA 4HYIA 3UG1A 2C6OA 3M42A 3VBVA 4GKHA 3O7LB 3NYNA 4F64A 2O5KA 4UB7A 5EQYA 3QKKA 1DAYA 5HIBA 2XK8A 3OOGA 2V22A 2QCSA 4WSQA 4YLLA 4DFYA 4UV0A 5JSMA 5BVDA 3EN9A 4IZ7A 3NUNA 3VBXA 3DXNA 3ERKA 4E6DA 5JZNA 1KE5A 2C47A 1G8SA 4DGOA 3IW4A 3NEWA 3L8XA 4IWDA 5HNBA 1BI7A 1JKKA 2YIXA 2VWBA 3HRFA 1VZOA 1UA2A 2IZUA 3Q9ZA 2QD9A 3S00A 2ETRA 3P86A 5HLWA 3NYOA 3V8TA 2WQNA 2UZLA 5AUXA 3O0GA 2QOKA 3HEGA 2I6LA 5HNGA 3I7BA 4PP7A 3ZO1A 4LOPA 5M44A 5HORA 1R78A 1F5QA 1YOLA 2R7IA 4C3RA 4NFNA 4DBXA 2P2IA 4O7WA 4HZRA 5F9EA 2WAJA 5DEWA 4K6ZA 4FT5A 3R1NA 3UP2A 4FV5A 3IQ7A 4FT7A 2CGXA 4WA9A 4G3GA 3QC9A 5DLSA 1JQHA 2WQEA 4YTCA 4Y72A 2OZOA 2YZLA 3DAJA 4M13A 4NTSA 4EKLA 4QP3A 3U4WA 3S0OA 1MP8A 3V3VA 5KUPA 4O7SA 4H36A 3W2CA 3QL8A 2EB3A 4BB4A 4FZFB 2QOLA 3KRRA 2XP2A 3O50A 4MBJA 2OF2A 4E6CA 5CSVA 1LUFA 4Z9LA 5A46A 5AEPA 5HBHA 2XYUA 4XHKB 3TIZA 4EOQA 4EZ5A 2GQSA 2HAKA 5CI7A 3EKNA 3FLNC 4ZSLA 3GFWA 4RIYB 3BQRA 4QD6A 5I9ZA 1DS5A 4BYJA 2X7FA 4G34A 3R7VA 1OMWA 3A99A 4DLIA 4X21A 2WMSA 3Q4CA 3W8LA 2PWLA 1ZMUA 5M57A 3DKOA 2W1GA 4P4CA 3P79A 3UVPA 3ZZWA 4E3CA 5IQDA 1A9UA 3R28A 2J0KA 3NGAA 3OZ6A 4OAVB 2RG6A 3MIYA 5ANGA 1J7UA 4QMOA 3JPVA 4U97A 2H9VA 2UW4A 3EYHA 3W55A 4BCQA 2PZPA 2JITA 4RG0A 3KEXA 3NLBA 4ZSEA 3K3IA 4KIPA 3G6HA 3OTUA 3W2PA 4RPVA 5ACBC 4L7SA 1XBCA 2R3IA 3KB7A 3GI3A 3QWKA 4WSYA 1M7QA 2RL5A 5JRQA 4PUZA 1Q41A 2VTPA 3UODA 3UTOA 5HU3A 1IRKA 2WGJA 1EH4A 2XUUA 3IW5A 3OTVA 3DQXA 3AG9A 4JQ7A 3RP9A 3PWYA 3SA0A 1J1BA 1JLUE 4AT3A 3HECA 4BKZA 2VUWA 4J95A 2ERKA 3F3ZA 4RFMA 1ZYCA 4XP2A 4A9RA 1H1QA 3GP0A 2YIWA 4OTFA 1T46A 5HG9A 4B7TA 4D9UA 3Q2MA 4GRBA 3QALE 4HZSA 4F0IA 3UIMA 3RPSA 3VBTA 3I0OA 3I4BA 1UU7A 4FV1A 4MXYA 4QTDA 3PDTA 4FKOA 4YZNA 2XIXA 3G2FA 5HICA 4MXCA 4AA4A 2JIIA 4FTNA 1LEZA 3BHHA 3NUPA 4JBPA 4TXCA 4BDBA 3HMNA 3IDPA 5AUYA 2E9UA 2C1BA 2YJRA 3BGQA 5DNRA 5HTBA 3RM6A 3DT1A 4G17A 5H3QA 3ZU7A 5EQEA 3Q4UA 5D9HA 4CKIA 4UMPA 4EQCA 4AW0A 4RX9A 4MAOA 3LCDA 1R1WA 4M7IA 3POOA 4HGTA 3VULA 3ZUUA 2R3GA 3FC1X 1OL7A 4J71A 3VAPA 3MESA 4LGDA 3CSVA 3VF8A 2X6DA 5FUTA 5J7BA 2HENA 4IX3A 3AXWA 4UMQA 1Q8ZA 3KF4A 3GU6A 3RPOA 4DHFA 4ANLA 2WKMA 4IW0A 3UYTA 2GNGA 4BDAA 4FUYA 4L3PA 1YW2A 3EQCA 4BDDA 3GU8A 5CAUA 2XM8A 4ZMFA 2EXMA 3CBLA 4FTUA 4LMNA 4PPBA 3VUIA 4GKIA 2HWPA 4GVAA 4S31A 2J90A 4G16A 4JBQA 3BYSA 4M66A 3UO6A 5CI6A 3A8WA 3CQEA 5I3RA 4F7JA 3R8PA 3TCPA 4E5BA 5HNIX 2Y0AA 1IG1A 5C4KA 3R63A 2ZYBA 3UDBA 4R6VA 5F4NA 4N6ZA 4QRCA 3TIYA 5IQIA 4ZTMA 3HX4A 3OCTA 4U41A 1Q5KA 5FGKA 3S4QA 3A7IA 3MH1A 3EYGA 5GZAA 2P3GX 4O81A 4LG4A 3VS1A 1YXXA 2QU6A 4IVAA 4BN1A 4UMUA 1ZY5A 3IGOA 4W8EA 5TE0A 3KXHA 4AWIA 1J3HA 3Q6WA 4M3QA 1IR3A 3U87A 5HU9A 5J7HA 2GQGA 3ANQA 3I0QA 5CEPA 3MGYA 5AJQA 4RVTA 1YDSE 5A3XA 3DOGA 5CX9A 1Y57A 5FP5A 1GIHA 1IASA 2XBJA 2FA2A 1TVOA 1R0PA 2XKDA 5CS6A 3LIJA 5KMIA 4JG8A 4MD9E 3EQHA 3GEQA 3A60A 3B8QA 3QFVA 2B7AA 3BZ3A 4CV9A 3U6IA 4FSWA 2GHGA 5F20A 2UW3A 5T3QA 4RZVA 4FVRA 3AQVA 2PZ5A 3MI9A 1OKVA 4GG5A 5ANIA 4BL1A 1KV2A 2V55A 1Y8YA 2VTRA 2Y8OA 5CEIA 1VJYA 3CS9A 1YDTE 4DEGA 3UMWA 1PXMA 2BZHB 3OEFX 2JDOA 3EL7A 4X0MA 4EK3A 4HGSA 3HYHA 4C38A 5DEYA 3OP5A 4FKSA 3UVQA 5TR6A 2J0IA 4BY9E 1PXLA 4YZMA 2YIQA 3PYYA 3EOCA 3BHVA 2E2BA 4FG7A 4QMVA 5KE0A 4JLCA 5EYMA 5HZNA 3CGOA 3U54A 3PPZA 3Q53A 3Q5IA 3AC4A 5BYYA 4QPMA 2OICA 4GJ2A 2VU3A 4WG5A 4DGGA 4IB3A 2WMTA 4KKHA 3MTLA 4PL3A 5LARA 4C57A 3BGPA 3LQ3A 3QCYA 4EH3A 3P23A 4I5CA 4X2GA 3VQUA 3P08A 4RSSA 3VRZA 3QZIA 4YO6A 3ZO4A 4BKYA 4X2KA 2GFCA 4HGEA 5EOLA 5IA5A 5HIDA 2VX3A 3SXRA 4E7WA 3UOJA 2ERZE 2R3KA 3C4ZA 2YFXA 4U81A 5GJFA 5L4QA 4U7ZA 3DK7A 2YA9A 5KO1A 1JKTA 4GK2A 4ANBA 4F6UA 3MVHA 5FTGA 5IQHA 3L9MA 2UZDA 4Q5HA 4KINA 4L67A 3GCSA 4QMPA 4IDVA 3GU5A 4F6SA 2VAGA 2XNBA 2BALA 3NNUA 4CKRA 4OT6A 5D41A 4B8MA 1AD5A 4YP8A 4ZJIA 5L3AA 4DITA 3PP0A 3QZHA 2YACA 4I23A 5B2LA 5HKMA 3V8WA 2CNQA 4NKSA 1NT2A 4X2NA 1FOTA 3DS6A 2PY3A 2BZIB 4M14A 4IWPA 1NY3A 4JXFA 3QQFA 2XJ2A 3TJCA 4BZOA 2UW6A 4XNEA 4ZTQA 3EQRA 5HCXA 3MPTA 4KS8A 2YCRA 2GU8A 2VV9A 4UYAA 5AIRA 2XNPA 4LRKA 3QA8A 4ZIMA 4OTIA 1JAMA 3V04A 4D2SA 5KBRA 3KY2A 5IU2A 4PNKA 1SM2A 4WNOA 4FYOA 4UMTA 4AN3A 5M07A 4XP3A 4FNWA 3IECA 3VUKA 3P4KA 4LQMA 1UU9A 4QMNA 5HG7A 5JGBA 3SHEA 2OG8A 4NM3A 5JKGA 5DFPA 5LVOA 4MVFA 3Q9YA 5AUUA 2JDTA 3V51A 1H0VA 5AP0A 5CANA 4LFIA 4HNFA 4EHZA 5JGDA 4CYIA 4FEUA 3OOMA 4TYHA 5EQPA 5K9IA 1PY5A 1OKWA 3SRVA 1OPJA 3RKBA 2R3QA 2QG5A 5BVWA 4ALUA 4C0TA 4D4SA 5KHWA 4ACHA 5EYDA 2BIYA 4IXPA 1SMHA 2G2HA 4U80A 4FE2A 1M52A 2WPAA 3UNKA 3PSCA 1ZMVA 4LRMA 4JVGA 3GENA 4FZ7A 2IVSA 2I0EA 2CNVA 4FV8A 5HO7A 3LKMA 2UZEA 2W06A 1L3RE 1MRVA 4M15A 2X9EA 2PVKA 2OGVA 3L1SA 3GC8A 3FQHA 1PYEA 3BYVA 2CKEA 3E64A 4ERKA 1J1CA 1WVXA 2ITWA 3OHTA 1KUTA 3R7IA 3BQCA 3PXQA 5CZHA 2XIRA 1Q8UA 2QHNA 2G2IA 4K2RA 4S33A 2DWBA 4C34A 5DYJA 3U51A 4KWPA 2R0UA 4W9WA 4R3RA 1LR4A 4AN9A 4CZTA 4GT4A 2WIPA 2WELA 4I93A 4R3CA 3BV3A 2XA4A 3ZDIA 2J6MA 1Q8YA 3NSZA 2VO7A 2UZVA 2CKPA 2PVHA 2PMIA 3ZDUA 3QYZA 3QF9A 4D4YA 2WU7A 4YPDA 4BCJA 4OAUC 4JX3A 5KMJA 3UPXA 3FY0A 5IUHA 4FIJA 4FKIA 4QYGA 4W8DA 5H2UA 2ZV9A 5M51A 1V0OA 1O9UA 4I41A 4YSJA 1RE8A 5AM6A 4DFXE 3C4FA 3KC3A 4X6RA 4HCUA 3HV3A 4D1ZA 3BPRA 4DGNA 4H39A 4ITIA 1S9JA 2B53A 1H4LA 2JKQA 1QPDA 5L6OA 5TO8A 4YSMA 4D0XA 5GJDA 3WIGA 4ACGA 3MPAA 3TKHA 4BYIA 3ZBXA 5IA3A 5ITAA 2VNYA 4GT3A 4AN2A 3C0GA 3OXZA 3DDPA 5AA8A 2GS7A 5EDPA 4I24A 5JQ5A 5FBOA 1XHAA 5LMBA 3MS9A 4TYJA 2OXDA 1XH7A 4QTBA 3HZTA 3DB8A 3LCTA 5CU3A 5IDNA 1X8BA 4QQJA 3G5DA 5FEEA 1XKKA 3IDBA 1TQMA 3BHUA 2I1MA 3TNIA 3MY5A 4O84A 2UVZA 3QXOA 3KKVA 3TM0A 3ZEPA 4XV9A 5ANKA 1K3AA 3RPYA 2ITPA 3OCSA 3VVHA 4XV3A 5L6PA 4YR8A 1P4OA 1Q4LA 2VWIA 3FMMA 4C61A 2PUNA 4AE6A 4CLIA 3ZRLA 3ZUVA 4O0SA 3HMIA 4UEUA 3OEZA 2QR8A 3TTJA 4QTEA 4FBXA 1OM1A 2QO2A 3ACJA 4EOMA 4MNEB 5EH0A 3VRYA 2XH5A 3QKMA 1OKYA 1LPUA 3CPBA 4C7TA 2OLCA 1ZLTA 2XRUA 3VHEA 3ZM9A 4R77A 3RAKA 3HUCA 3VUTA 3GCQA 3NNVA 3ULIA 4K1BA 2UW9A 4YLJA 3R8MA 2YABA 2WQBA 3DJ5A 2ZDTA 3FZRA 3BHYA 3ORPA 3ORZA 1ZOHA 3ZXZA 4YU2A 2BKKA 3FC2A 4CTBA 1XH8A 3MW1A 1CTPE 1G5SA 2CHLA 3ZRKA 1JOWB 2UZWE 3ID6C 1PMNA 4BWPA 4EH6A 4IHPA 1IEPA 3FKNA 3MB7A 4ZOGA 2XNEA 4F08A 4ZAUA 3VN9A 4QMZA 4YPSA 5JEBA 3UJGA 3G90X 1WVWA 2QNJA 4FV7A 3E8DA 3NVMB 4FIHA 4AQCA 3BX5A 4QNAA 5L8JA 5AR8A 4G1WA 5LMKC 4PMMA 3PIYA 4C4EA 3H10A 4MCVA 4DGMA 5IUGA 3THBA 3N9XA 5I9VA 3V5LA 3VO3A 4IANA 3E88A 3UO5A 3HL7A 3OY1A 3R1SA 1KE8A 4X3FA 4FIFA 3QA0A 4A9YA 2OFVA 4NIFA 3FZ1A 2YM7A 4U44A 5EOBA 1OBGA 3KCKA 4ZJJA 4BFMA 1CDKA 4FTJA 2R3OA 4IFCA 5EYCA 3JR1A 4WUNA 5CAOA 4YC8A 4MD7E 1PMUA 3QQLA 3DV3A 3BRBA 3ORMA 3R0TA 4YZ9A 4FNXA 5HX8A 2XF0A 4FEVA 4L45A 3AMBA 1QPEA 3U8WA 1PXPA 4DTAA 1U5QA 1V0BA 4LV5A 4QP7A 3E8EA 4QPSA 4EH4A 1BMKA 4PDOA 2IG7A 4N4SA 1FGIA 3C4CA 2R3RA 2REIA 4YJQA 2VTOA 4CTCA 4DG3E 4RVMA 2Z2WA 4YBKA 5E8ZA 4BDFA 1WMKA 2I7QA 4ZMEA 2G15A 3KULA 4G9RA 3MIAA 3MWUA 2AYPA 2XK6A 2JBPA 4WHZA 2GNLA 4NJDA 4EZ7A 4DG2E 2PVFA 3I81A 4QOXA 3R8LA 4L7FA 3RPVA 4F70A 3GB2A 3TNPC 3JS2A 4NW5A 4TL0A 5TF9A 4DCEA 4D1XA 1GJOA 4IBMA 2VTLA 2PULA 4LI5A 4O7ZA 3BEGA 5AAGA 5IQAA 1Q3WA 3F82A 1R0EA 2QURA 3A7JA 4EKKA 3OCGA 4D2RA 2QOQA 3R7YA 4O82A 3OW4A 4JDIA 4PL5A 4FF8A 2YM6A 2WTCA 5IH4A 4OGRA 2GDOA 3TUDA 2WMBA 3VS5A 4YJOA 4RLKA 3REPA 2A19B 2AC3A 5J87A 4ZY6A 4UN0C 4M84A 2WQMA 3F5UA 1KOAA 2OXXA 4JT3A 4XP0A 5TKDA 2C69A 3SQQA 3IOKA 1OGUA 2OJIA 4KAOA 3WIKA 5GIOE 4FKWA 1ZYLA 5ICPA 4IM3A 4V05A 1GZOA 3OS3A 4FNZA 3T8OA 3W10A 4JR7A 3LLTA 4S34A 5AUWA 3DXPA 5E8UA 4OTPA 2IVVA 4PX6A 4EC9A 3EFLA 2PK9A 4F0GA 3BI6A 4U79A 4I3ZA 3R83A 3R7OA 4FK3A 4ZSAA 3A2CA 1L8TA 3PA5A 4OTGA 4WNPA 5KZ0A 4QP4A 1OUKA 2ZV2A 1W84A 2BAQA 1FPUA 2C3KA 2R0IA 2X8DA 3DTWA 3OD6X 5HE0A 2YERA 3UIXA 4B0GA 5IPJA 4EH2A 1BI8A 4HVIA 5CALA 4MK0A 4FL3A 2W1CA 5M53A 4C4HA 1SVGA 3R8ZA 2OKRA 2JBOA 4MNFA 4PDYA 3UC4A 4CFWA 1VR2A 3VQHA 3VW8A 3ZYAA 3EKKA 3RALA 2IWIA 3SDJA 3HAVA 2CCIA 2VWUA 2WTJA 4OTDA 4BICA 3ULZA 5JFWA 5JN2A 4M12A 3ACKA 3TWJA 3BE9A 3ZMMA 4DH7A 1QPJA 3AC3A 4O0WA 5AP3A 3Q5ZA 4EOLA 4YC3A 2OFUA 4FKLA 5DWRA 4QP6A 3TV7A 3O8UA 2GNFA 2OU7A 3NYVA 3PE1A 2ITNA 3QZFA 4PF4A 4Y5QA 2YZAA 3UGCA 3H30A 4PDSA 3NVKI 1YXVA 1Q61A 2GS2A 2WO6A 3FMHA 5HQ0A 4CG9A 3WF8A 3FEGA 3FMDA 2CSNA 1H8FA 3QWJA 1PW2A 4EEVA 3LFBA 2R3HA 4ENXA 5HBJA 1YHSA 4S30A 4YNEA 3ZO3A 3E92A 3HP5A 5J8IA 2YDIA 2IW6A 3UG2A 4TKSA 5IF1A 2EB2A 4BTKA 2KTYA 3CKWA 1PHKA 3MYGA 2UZNA 5HVYA 4GU6A 3KK8A 4R78A 2XNOA 5E91A 4OTHA 2WOUA 4E5WA 4NFMA 2ZM3A 4R8QA 2EXCX 5DT4A 1R39A 1GIJA 3QTXA 2WHBA 4UZHA 3GVUA 4FUXA 4RX5A 2C6IA 5AX3A 2QHMA 3SLSA 4CD0A 2QO9A 2OWBA 4ZLOA 1WBNA 1BKXA 1WVYA 2RF9A 3FYKX 1ERKA 2YISA 4HJOA 4K11A 4B99A 4FTQA 4CFVA 5AAEA 4AZFA 4F09A 5FM3A 2W4JA 1REKA 3FDNA 4KS7A 4NM0A 2F7ZE 2XNGA 5DG5A 5JZJA 2QG7A 1W7HA 1YKRA 3PXKA 4EONA 1Y6AA 3ZFYA 3M2WA 5E1EA 5M4FA 3FI8A 4UWBA 3AC8A 3B8RA 2WMVA 3MPMA 3NUSA 3W8QA 4DT9A 2JIUA 3F61A 4ZSJA 3IDCA 3MH3A 4XYFA 3ZC6A 4O2PA 3H0YA 1RJBA 4IAAA 2XK7A 4O21A 4TN6A 4FSNA 4UXLA 3LCKA 3QXPA 4FTTA 3GCPA 3T9IA 1OIQA 2XK4A 3EQGA 5HESA 3GOKA 2WMUA 3VF9A 3C4WA 4LV8A 3C7QA 3C0IA 3EHAA 4CV8A 2PMOX 3FPMA 5LVLA 2WB8A 3N51A 4I6BA 5J9ZA 5CF6A 2VWXA 2VGOA 4IB1A 5EM5A 3EB0A 5CEMA 3KMWA 4AZTA 4D2WA 5AV3A 5L2WA 1OL6A 3Q04A 3LJ0A 4GFMA 5HVKA 3OBGA 4JS8A 2UZBA 4ANSA 5A6OA 2EWAA 4RJ4A 3R2YA 4W9XA 2V62A 5DVRA 5A54A 3F9NA 5L8KA 2VTMA 3TV6A 3VW6A 5IH5A 3PA3A 5CAVA 2WTVA 4R1YA 4YHJA 3PE2A 4FKUA 4WUAA 2XZSA 4XG6A 1GOLA 3JXWA 4EC8A 4FX3A 3UP7A 3JY0A 2GNJA 3V5PA 5M4IA 4OLIA 4WO5A 1A06A 5I4NA 3UQCA 4LMUA 3OMVA 2XCKA 3LFSA 4A7CA 3SD0A 3TDWA 4U45A 4IC7A 2XJ1A 3F2RA 2PVYA 2ZM4A 5L6WL 4XG9A 4GEOA 5JFXA 4ZS4A 3DBQA 4CMTA 3PY1A 2W17A 4PPCA 2XNMA 3FLZA 5E8SA 2AUHA 2WZJA 1WBTA 3QX2A 4NM5A 3FI2A 2YIYA 3FXZA 3VIDA 4D2VA 4IWQA 5HBEA 3H0ZA 4BIDA 5BMSA 2FSTX 5AR3A 3OUNB 3R6XA 3QYWA 3VNTA 3V6SA 2YM5A 3GC7A 3P9JA 4DC2A 2QVSE 1SVHA 3F69A 4YNOA 4YJUA 3ETAA 2BRNA 1OB3A 3QKLA 3QRJA 4LUDA 4P2KA 4P5QA 1UV5A 2CMWA 2F7XE 2X4FA 5FEDA 5E92A 4AE9A 4U43A 4F9BA 4ZJVA 3PWDA 4GFOA 2BZKB 3FMNA 3E3BX 4KIKA 3ENMA 5FQDC 4BDKA 4MXAA 3F7ZA 3I1AA 3S3IA 5CU0A 1RDQE 3GT8A 5M09A 4E8AA 4EOIA 3IKAA 4JBVA 5EW9A 5HTIA 2P2HA 5AM7A 3HVCA 5FRIA 4G6OA 4AUAA 3OROA 4E20A 4ZK5A 2JFLA 2F4JA 2X0GA 3SW7A 4BCPA 2ZVAA 2X81A 4D55A 3I6WA 1WBPA 3IGGA 4TNBA 2Z7RA 3RNYA 3O8PA 4G6LA 4C35A 3L9LA 3TTIA 4RVLA 5CVHA 4FSUA 1XH9A 1RQQA 4EWQA 5HX6A 4TRLA 1CMKE 3FPQA 5TT7A 4DFLA 1OPLA 4FT9A 4R7HA 3UNZA 3PSBA 4CRLA 4F0FA 3Q6UA 4APPA 2QOIA 4FKPA 4M69B 5A6NA 2VTJA 4TPTA 3EN7A 5I9WA 3GXLA 3IW6A 4ZY4A 3C4XA 5FDPA 5BUEA 4OBOA 4JR3A 1S9IA 3UZPA 3PVGA 3VS6A 4ASEA 1ZWSA 2ACXA 3CPCA 3MJ1A 5C8KA 1UU8A 1JSUA 3C50A 3W2RA 4FEQA 4QMUA 5EW8A 4EOOA 4M68A 4QTCA 2A1AB 2CDZA 3EL8A 5GNKA 5D12A 3R04A 3D2KA 3FZSA 5IQCA 4QMWA 3F88A 5DHJA 2R9SA 3VS0A 4RWJA 4CZUA 4H05A 1SNXA 4QP1A 3RZBA 5A4CA 1WBSA 4WOVA 4GH2A 4ASZA 3KVWA 5A4TA 2RG5A 2W7XA 2ZMCA 3W2QA 4E4MA 3QTRA 3ZLXA 5CZIA 4D9TA 2OBJA 1OBDA 3VJOA 3MDYA 4ALVA 4I0SA 3MTFA 5M55A 1H28A 4CMOA 4I4EA 1H1RA 1YI4A 2VO3A 4A4XA 1Z5MA 4DFNA 2XMYA 5ANDA 2W1ZA 1Z57A 1BYGA 1ZYDA 4I94A 4YHTA 3R7EA 4BCKA 4L8MA 2HY81 3TZ9A 3WARA 4FSQA 3QD3A 3IPHA 3P7CA 3R1YA 4F9CA 3F2AA 4R7IA 3D83A 4CFMA 3DXQA 5AUTA 3A4PA 1WCCA 3LM5A 1JKSA 2FUMA 2IN6A 4ZEGA 2O2UA 4BTMA 3ZFXA 4KB8A 3BU5A 4NTTA 3AD6A 2XJ0A 4FKGA 3GC9A 4W4XA 4DLJA 1J7LA 3HRCA 1UWHA 2BIKB 2VWWA 4HGLA 4N0SA 1CM8A 5CT7A 2FYSA 1P4FA 5DH3A 3BBWA 3QTSA 4IDTA 4CXAA 3QUEA 4RIYA 3F5GA 3D7ZA 5C26A 3MA3A 4IIRA 3TZMA 1APME 3CP9A 2J7TA 3FZPA 3ZO2A 1PYXA 2GHLA 4XUFA 3TKUA 4U3YA 4J8NA 2B9JA 1QMZA 3PJ3A 2BFYA 3P78A 4U9AA 4BWKA 3ZFMA 2H8HA 3PTGA 2WTDA 3MFTA 4C2WA 4DEEA 3EJ1A 5KMMA 3ELJA 4FL1A 2VNWA 3COMA 1U5RA 4B6LA 4F6WA 3LMIA 4EOJA 4EJ7A 4FODA 4HVSA 4Q5EA 2VZ6A 2IZTA 4CQEA 2W9ZB 3O2MA 4Y46A 3UOHA 1U54B 4D28A 3DQWA 5E8TA 2WXVA 4FC0A 4TWPA 1I09A 3QC4A 4F4PA 2UW5A 3MY0A 2XEYA 4BIEA 4TYHB 1HCLA 4Q2AA 1GZNA 3NAYA 2YJSA 5AV0A 3COHA 5HLPA 3RBWA 5CF5A 4QQCA 4GS6A 5I5ZA 2IVUA 3LCOA 4G31A 4GK4A 4OBQA 5FXSA 3U4UA 5DRDA 5B0XA 5K3YA 1M2RA 3RAWA 3OWJA 3MV5A 3LOKA 1O6YA 2F2CB 3KREA 1H24A 2F2UA 2EVAA 5CSHA 4GUEA 4OR5A 1SZMA 3ORKA 4B4LA 3SC1A 3BYOA 3R01A 4YZCA 3LQ5A 4BDJA 3UQFA 3FKOA 5E1SA 4G2FA 4TNDA 3TXOA 3AMYA 4CT1A 3R71A 1O6LA 4DINA 4FEXA 4J97A 1Y8GA 2IZRA 3F3VA 3NYXA 5BNJA 4YJVA 2YHVA 2ZDUA 3KRLA 3OG7A 4JDHA 5ETAA 5HO8A 2Y6OA 3LJ1A 4J7BA 3LFFA 3QQHA 2OJ9A 4NKAA 3ZBFA 5CAPA 2CNUA 4E73A 5KNJA 4YMJA 2ITVA 5DR2A 3BE2A 3E7OA 3QLGA 2QOBA 4S32A 4O2ZA 3SX9A 4D5HA 2YCQA 4F63A 3NW6A 4YTFA 5HCZA 4WD5A 3BU3A 5AP6A 5HIEA 4CKJA 5FTQA 3GUBA 4J52A 4QPAA 5I9YA 1G8AA 4CCBA 5FXQA 3FMLA 4RIXB 4IX4A 5LOHA 2DUVA 4NJ3A 5H8EA 1Q99A 3E62A 3OW3A 3FE3A 3PJ1A 4JDKA 1K2PA 4LOQA 5LVPA 4BTJA 5C27A 3DKCA 2ETMA 2C5XA 4DG0E 3MH0A 5FEQA 4FZDB 3TKIA 2RGPA 4RRVA 4U0IA 3JY9A 3CR0A 4RWKA 2CCHA 3MBLA 4QMYA 4KD1A 4CFXA 3Q32A 1XH6A 5HD7A 2WFYA 3KMUA 4OW8A 3W33A 3ZLSA 4E6AA 1B39A 2X4ZA 3D7TB 1OKZA 2V7OA 2BCJA 3QTUA 3OVVA 4BGHA 1KE7A 4P90A 4GV1A 4YGAA 3CLYA 3FHRA 5LCKA 3V5JA 2YM8A 3PPKA 1U46A 3A7FA 4QO9A 4RIWB 5IA4A 3NW7A 1B38A 1YI6A 3RAHA 2GHMA 5JT2A 2X39A 4BIBA 4EK8A 4MBLA 4YC6A 5DN3A 4QMXA 2WTKC 3NAXA 3FV8A 5AR7A 5HTCA 3PFQA 3F3TA 4L46A 4MEDA 4PP9A 1HCKA 4APCA 3FQEA 4FEWA 2UV2A 3ALNA 2XKEA 4AZSA 2XRWA 4I6QA 4DEAA 4KIOA 3KU2A 3QAME 3WZKA 1PRYA 4YZDA 2R3JA 4PDPA 4BHNA 3RJCA 5BX0A 4QMTA 3QHWA 2C3JA 3UO4A 4MBIA 3FBVA 2CKOA 2GNHA 2YWPA 4TW9A 2R2PA 1Q3DA 1Z9XA 1XBAA 4FSRA 2QLQA 2RIOA 3F6XA 4G9CA 3SOAA 2AC5A 5CEQA 4CSVA 2VTHA 3CXWA 4MKCA 3LXKA 3FJQE 2NPQA 3PPJA 4ANNA 3ZM4A 2BDJA 3OT3A 4G6NA 2WNTA 5CVFA 2OK1A 4IM2A 4O1OA 4XOZA 5IEVA 4D2PA 4QP2A 3HP2A 4FIIA 3TT0A 3RGFA 4O7NA 3AD5A 3OC1A 4IJPA 2C0TA 2A0CX 2ZOQA 4N70A 4YBJA 4AZEA 5C8NA 3GQLA 4I0TA 4A4OA 3NR9A 3E8NA 4M67A 1OECA 3R1QA 3TEIA 5AR2A 4CGAA 3G9NA 4YJTA 4BDCA 5EDRA 4PPAA 3AOXA 4Z7GA 5ETCA 1GZKA 4FV3A 4X3FB 5BVKA 3E3PA 3FI4A 5LVMA 2NO3A 1M14A 2PUUA 3C13A 3QCSA 5IKWA 3KN6A 1LEWA 3MVMA 2R3LA 5ANJA 4IZAA 3P7AA 5B2KA 2HY0A 4GU9A 2HCKA 4FYNA 3FHIA 4BDGA 4EUUA 3UPZA 3LFQA 3EFJA 5DR9A 5HHWA 3I5ZA 4N57A 2F49A 4PMTA 4AX8A 5M06A 3P0MA 4PV0A 4KBAA 3CJFA 3W18A 2WTWA 3R00A 5K5NA 2UZUE 3K5UA 5H8BA 3FUPA 4QYYA 4X7QA 4IAKA 4AACA 2PVLA 4K33A 4L3LA 3D2IA 2W5HA 2Z7QA 3ORTA 1ZZ2A 3H4JA 3KGAA 3HV7A 4II5A 3ZS5A 5LCJA 1OPKA 3HDNA 4QYHA 5FLFA 1OITA 1WBWA 2X2KA 3ITZA 3ZEWA 5HD4A 3IW7A 4FG8A 3LW0A 3QRIA 4DFUA 2B55A 3GOPA 3O96A 2ZAZA 4JQEA 3NZ0A 4RFZA 5HGIA 1M2PA 2C6DA 4Y95A 4NH1A 4O7TA 1SNUA 3FXXA 4FICA 2B52A 3FWQA 4LUEA 4NU1A 2GTNA 3EQBA 1KV1A 3ODYX 4RA5A 4YLKA 5AIKA 4DYMA 5IA1A 4ITJA 3R7GA 4O0XA 3D15A 4MF0A 5E4HA 1ZAOA 5IZFA 1J91A 3HA6A 4AT5A 3CGFA 3IO7A 4AGDA 1JSVA 3HMOA 3KRXA 5IUIA 5E8XA 2BTSA 3D5WA 4P7EA 4C4JA 3U9CA 4C4IA 2PMNX 4WNKA 4FKJA 3PXYA 5CYIA 3ZONA 2X8IA 3UOKA 3ZRMA 4I22A 1H01A 3DJ6A 3KVXA 4G5JA 4ACDA 3ODZX 5DGZA 3TJDA 4BBEA 2W4KA 4AZWA 1H1SA 3CY3A 2QOOA 3PVUA 5D11A 2GSFA 4AW1A 3OT8A 1YXSA 2XM9A 4L43A 3LLAA 4D2TA 3KN5A 4L68A 5K4IA 4KSQA 1PKDA 3B2WA 5FG8A 3KXZA 4B8LA 5L2QA 3DK6A 1URWA 3FL5A 4XX9A 2UW0A 4EK6A 4FMQA 4BF2A 4UY9A 2JKKA 4QYFA 4XJ0A 1GZ8A 3NUUA 3ZLWA 4M0YA 1H1PA 2YCFA 2C6TA 3V5QA 4W4YA 4JIKA 3RWPA 3KA0A 3LHJA 5J1VA 3D94A 4RMZA 5IMXA 3PSDA 4FIEA 4FV6A 4RQVA 3ROCA 4BDIA 3EMGA 5HE3A 2JD5A 3Q9XA 4ORKA 3FLYA 5AP2A 3RI1A 2CGWA 3KL8A 2RFDA 3ALOA 3GGFA 3MB6A 4I5PA 4PWNA 5KZIA 3W1FA 4BZNA 5D1JA 2J0LA 3DLZA 3FL4A 3DAEA 3PIZA 3LFDA 3HV6A 4FT3A 4I5HA 3ZSHA 4PMPA 3LJ2A 3LAUA 4UZDA 4ZZMA 1JWHA 2PZIA 4TYGA 3KMMA 2W5BA 2Z8CA 1W0XC 4LGGA 3OY3A 2CLQA 4IADA 4LL0A 3M1SA 2C6EA 5AUVA 4IVDA 3VS4A 2VGPA 4OTQA 3O51A 5E7RA 4XEYA 4I6HA 3CEKA 4BGGA 2X2LA 4BI0A 2WQOA 1RW8A 2JFMA 4U5JA 3FYJX 4Z55A 4WKQA 4EQMA 2C6KA 5AADA 1CKJA 2Y9QA 4ANQA 1PXIA 4FA2A 4TY1A 3RPRA 3LXLA 3Q96A 4OBPA 3D5UA 4EHVA 4WG4A 4F65A 2JLDA 4F7LA 1VYZA 1WFCA 2BZJA 3NPCA 4MQ2A 3UNJA 4I0RA 3QTQA 4CCUA 1PMEA 4QNYA 3AT4A 5HG5A 4FSZA 1NW1A 3DFCB 3NUYA 4USFA 4K8AA 5G1XA 4V0GB 2UZOA 3ZTXA 2VWZA 4Q9SA 2VO0A 3PJ8A 2HELA 5DBXA 1O6KA 3BHTA 4MX9A 5AR5A 3CY2A 1NA7A 3QQGA 3PZHA 5ANEA 2VWVA 2VRXA 4R1VA 3W2OA 1FQ1B 4EL9A 3DNEA 2W5AA 4BC6A 4IVBA 3AD4A 2C3IB 4AS0A 5CF8A 5AUZA 4RX7A 3G9LX 2W0JA 3QD0A 4CZYB 3EFKA 4NK9A 5JRSA 3RAIA 4AOIA 3NW5A 2Y4PA 3DY7A 3OWKA 3PLAE 5CQWA 4BCMA 1BL6A 1CKIA 3VUDA 5CNOA 2NRYA 2HZ0A 3BIZA 3VWAA 2BDFA 3EN5A 2EU9A 4RGJA 2HWOA 5JQ8A 3R73A 4V01A 5EM6A 4BR3A 3OXIA 2NRUA 4W4WA 2X2MA 5HCYA 2ONLA 1IAHA 5G6VA 4O0YA 1YQJA 2J4ZA 1DAWA 3EQPA 2XKCA 2GFSA 4L6QA 4KUJA 3NIZA 4AOJA 2QOHA 5EFQA 2QQ7A 4YJSA 2NNWB 3RZFA 2VO6A 2PTKA 2BHEA 1PJKA 2ITTA 3NMUF 4O7VA 3A62A 5BUJA 2CGVA 4EYJA 1GNGA 4CFFA 3EN4A 3TI1A 1AQ1A 4FV4A 3Q9WA 4D0WA 5KHXA 3DBEA 4F1TA 1NVQA 4X3FC 2J0MB 3QX4A 1JPAA 3HGKA 3A7GA 3PG1A 4P5ZA 4YTHA 5AP1A 3DBFA 4Z16A 2FO0A 4L52A 2Q83A 3PG3A 4H1MA 4C02A 2VN9A 4RJ8A 4FTKA 3FI3A 3QD4A 5HEZA 3ZH8A 1W83A 4F9AA 5EYKA 4GJ3A 5B7VA 2HW7A 3NRMA 5KCVA 4HCTA 4DH3A 3LMHA 4EZ3A 5IQEA 4FGRA 2KULA 4FGBA 5FDXA 3DDQA 2YWVA 2P4IA 5AR4A 3A4OX 5AV4A 5EW3A 3BELA 4O0RA 3TN8A 3EH9A 1P14A 4ZZOA 2ITXA 3IS5A 4G5PA 4RC4A 3F2NA 4ASDA 5IEYA 2RFEA 4L44A 4WNMA 3FMKA 2R3FA 3ORIA 2GMXA 3O7LD 3IW8A 3QQJA 4IWOA 4FTOA 5H8GA 1BL7A 4JBOA 3DKFA 2WMWA 3B2TA 3PRFA 1JKLA 4EWHA 4XLIA 4D4RA 3AMAA 4IACA 2IVTA 2O65A 4HPTE 4KA3A 4YO4A 4Z3VA 3CJGA 4MWIA 3MFSA 5F95A 3U6HA 5L8LA 4ZXTA 3FKLA 3PY0A 3K5VA 3QGWA 4DH5A 3DTCA 3EWHA 4PMSA 4HNIA 4RJ3A 4XBUA 1MQBA 2YITA 3UZTA 1Q8TA 1SYKA 3VUMA 4HCVA 3R8UA 5ETFA 4DEIA 3ORNA 4USEA 1PXNA 1FINA 3R21A 3TV4A 2GQRA 1IAJA 3T3UA 2PUPA 3D0EA 4EH5A 2I40A 3DBCA 4C4GA 3AGMA 2PVMA 1NXKA 2FB8A 4O0TA 3MVJA 3CIKA 2RFSA 4XG3A 2P55A 4IZYA 4ZTHA 4G3FA 2YEXA 4I6FA 2Z7LA 2LAVA 2HIWA 1YWNA 3WZUA 1KWPA 2C4GA 3CQWA 5J5SA 4H1JA 5DPVA 4O0UA 3K3JA 3KXXA 3W2SA 3SVVA 4NCTC 3WE8A 3ATSA 3TNHA 4TT7A 2ZB1A 4C4FA 4RC3A 5FXRA 2Q0NA 3ZZEA 2X9FA 3F7WA 3NIEA 4JRVA 5KMOA 3FSKA 4E26A 3O17A 5JGAA 3L9NA 3MFUA 3JVRA 5I3OA 4O96A 3VUGA 4DTBA 3DK3A 4L9IA 2J51A 2YM4A 3BV2A 1W8CA 2Z60A 3QRKA 1MUOA 5EI2A 1UNGA 2FGIA 3EZVA 4ANMA 5LWNA 4NYEA 2XEZA 3G0EA 5CASA 5J1WA 1TKIA 3U9NA 3TUBA 1ND4A 1TQIA 2I0YA 3D14A 2EXEA 4KBKA 4AU8A 5ANOA 2VTSA 5EKNA 1UWJA 4HYUA 2WOTA 4O1PA 5I0BA 3AGLA 5L2TA 4H3BA 4YJPA 5CWZA 1GIIA 5J9LA 5DR6A 3LQ8A 3PXRA 2FSOX 2WMRA 1V0PA 1T45A 5AFVA 1JNKA 2JAMA 2PVRA 3V5TA 4ZLYA 4KABA 4XLVA 1Q62A 3HUBA 4EOKA 1ZMWA 2CJMA 2O0UA 3BEAA 1FMOE 4ONAA 1P5EA 2W1IA 5HE1A 3WF9A 2BAKA 4RJ7A 4BCNA 5KKRB 4GK3A 2J5EA 4RZWA 4EI4A 4X2FA 2J9MA 2R3MA 4MXXA 4MYGA 4WG3A 2O64A 3VBWA 4XRJA 4AFJA 3AC1A 5IEXA 1FGKA 4KIQA 4XG4A 4PTGA 5CEOA 1YHWA 2PZYA 4OUCA 3UZRA 5AAFA 3PY3A 3N4UA 4B9DA 1JSTA 4JNWA 2HXLA 2J5FA 4CFNA 4ZSGA 2HXQA 2XIYA 3HKOA 4XCUA 1YXUA 2ETKA 1M2QA 5E8VA 4JQ8A 2R7BA 5TOZA 2BRHA 3IG7A 4XOYA 5HI2A 4FTLA 4L01A 1F3MC 5C03A 3C4EA 4GYGA 4XG8A 2ZV8A 4F1MA 4GIHA 3SAYA 2PPQA 4CT2A 5M4UA 3D5XA 4JAIA 3N4TA 3AC2A 2O3PA 3OWLA 4H58A 4FK6A 2W1FA 2YLFA 5IG1A 5EHLA 4I5MA 2PE1A 3PUPA 4IMYA 5L2IA 4MTAA 4C36A 2Z7SA 4IAIA 5EHYA 5CNNA 4UWCA 2OZAA 5J79A 4IX5A 1AGWA 3MSSA 1G3NA 1LP4A 2B9HA 2I0VA 2QI8A 3TNWA 5A4LA 3L8PA 1KE6A 3A8XA 2VWYA 3RTPA 3SKCA 4JDJA 1GY3A 4RT7A 3DBDA 3QD2B 5B2MA 2IW9A 2RSVA 4DEDA 2ITYA 5T6KA 5CSXA 4DBNA 2XKFA 3OUKA 2Y4IC 3M11A 3PLSA 3WBLA 4ARKA 4EK5A 5GINE 3PJCA 4F9WA 5I9UA 4X3JA 2C30A 4QP9A 3ZSGA 2PE2A 5GZ8A 4O38A 2W96B 4Z7HA 4O7RA 1JVPP 1XH5A 3F5XA 4H3QA 4EQUA 1ZRZA 2E9VA 5BVFA 3KFAA 4HPUE 3UBDA 2JAVA 3E5AA 2H34A 4W4VA 3KQ7A 2WTKB 2XB7A
chains in the Genus database with same CATH superfamily
2OH4A 3BLHA 2A2AA 5JK3A 3RNIA 5CF4A 3P1AA 4AF3A 4UWYA 2XK3A 2CN5A 2JIVA 3R2BA 4FKTA 3R9HA 4AG8A 3G51A 3GC0A 3OF0A 3P7BA 1BLXA 1JBPE 4FSYA 1REJA 4L3JA 4LGHA 4UALA 4YURA 4E4XA 2GNIA 2X1NA 1H25A 5K4JA 3CTQA 2J0JA 3IONA 3LCSA 4BCFA 3FZOA 4XRLA 1H27A 5J95A 2WIHA 4XG2A 1FVRA 4ERWA 2OF4A 3QUDA 3ZXTA 5BVOA 5IA0A 1WZYA 4NSTA 4XV2A 4E4NA 3G15A 3U6JA 1ZY4A 1UNHA 5AP4A 3E63A 4ACCA 4C33A 4JL9A 4D58A 1M7NA 5T68A 2G9XA 2R5TA 2UUEA 5A14A 5CENA 3VHKA 5CU4A 2PYWA 5LVNA 3ANRA 3RCJA 3UIUA 3RK5A 1CSNA 4BTFA 5BPYA 4EHGA 4FZAB 2Z02A 1H0WA 3GU7A 4BI1A 3O23A 2VTTA 3BWFA 4PTCA 4AP7A 4LRJA 4A9UA 1IA9A 3Q2JA 1YXTA 3FXWA 5HO6A 1TQPA 4TYEA 3DJ7A 5DI1A 2BUJA 3FLQA 4FR4A 3WYXA 3GNIB 3UVRA 2UVYA 3ZOSA 2OJGA 5AMNA 4D4VA 5DIAA 3W32A 1YDRE 4LYNA 1UVRA 5KBQA 4HVGA 4AT4A 4RQKA 4ACMA 4AFEA 1UKIA 2HW6A 4IJ9A 4NWMA 4JMQA 4JAJA 5K0KA 5A4EA 3WF7A 3AT2A 3EZRA 4FVQA 2BILB 2BHHA 4I1ZA 4Q9ZA 1OVEA 1H08A 1PXKA 4GW8A 4ZTRA 4F7SA 4MF1A 4MH7A 4WRSA 5DT3A 5CXZA 1BUHA 3QGYA 5KMNA 3HRBA 3T3VA 4BGQA 5BUIA 4K9YA 4XH6A 2JKMA 4IVCA 3NDMA 3ZSIA 5IH6A 5BVNA 1FVTA 4MQ1A 5LMAA 4O7LA 1W2DA 1XJDA 5CLPA 5BYZA 4QEBA 3FQSA 2PUIA 1WAKA 3NS9A 2ZM1A 3SRVB 5IQFA 3DKGA 2LGCA 5KMKA 4CG8A 3LFCA 5C9CA 4DEBA 4KKEA 3DCVA 2XVDA 4IAFA 2YDJA 3BLRA 1VEBA 4O6LA 1YRPA 4FKVA 3UIBA 2NYAA 4QDVA 4AW5A 3NWWA 5FP6A 4WBOA 5D7VA 4EH7A 5EM7A 3SGCA 4JI9A 3JUHA 1WBVA 4BWXA 2B9IA 3C0HA 4O4BB 4BDEA 4M69A 4I92A 2UW7A 5HLNA 2IPXA 2YIRA 3FZTA 1CKPA 5CVGA 2BRBA 2PHKA 3KXMA 3FY2A 1ZYJA 4U40A 4J96A 2PSQA 4DDIA 4BCGA 3BWJA 3Q52A 4E6QA 4Y85A 5KKRC 2VTAA 3KRWA 2BPMA 4BKJA 3G6GA 2ZMDA 4IH8A 2YN8A 5EHOA 2X8EA 4J1RA 2G2FA 3ZUTA 4DEHA 3JVSA 3GQIA 3HMPA 1YI3A 4TWOA 2O63A 4F1OA 1ZYSA 5GIPE 3R02A 5DT0A 3BCEA 3ENHA 3S2PA 4BVUA 1Y91A 4FSTA 1XH4A 3I5NA 5E9EA 2HZ4A 4PY1A 4R5SA 3C5IA 4EOPA 4D5KA 3CD8A 4EJNA 5JFVA 3OFMA 3VJNA 5H9BA 2QR7A 3OXTA 5C4LA 3MY1A 5AV2A 4RBLA 2QLUA 3VONA 1R3CA 2P33A 3IOPA 4XG7A 4F9YA 3T9TA 3TDVA 4X2JA 4ZP5A 4DT8A 5EDQA 3WZJA 2PVJA 4ZTSA 3UDZA 5FWKK 2R64A 5M08A 1H1WA 3SW4A 4ZLZA 5DE2A 3BBTB 1OUYA 4M8TA 5J5TA 3PVWA 4HOKA 5EG3A 5CU2A 4TTHB 1Q97A 4CLJA 5CTPA 3P5JC 3CD3A 3S95A 1MRUA 4BRXA 3QHRA 4NUSA 5CSWA 4WRGA 5IDPA 5A9UA 3NCZA 3FMEA 2C5OA 1E9HA 3LM0A 4GG7A 5I9XA 3RK7A 1OIUA 4Y83A 4E93A 4FTMA 3P5KA 4TWNA 3BLQA 4I4FA 4AGWA 4NM7A 3QBNA 2B4SB 3ZLYA 4BJJB 4PNIA 2ZV7A 4DFZE 4PTEA 4AGCA 3CTHA 5BQ0A 1H07A 4CFUA 4AQKA 4ASXA 1OIYA 3F3UA 3QLFA 1PXOA 1OIRA 5FD2A 5JH6A 4AXAA 4ZTNA 2C5NA 5E90A 3HV5A 5AX9A 3CQUA 4DTKA 3POZA 4O6EA 4BDHA 2QKRA 1QPCA 3SXSA 3QU0A 2XIKA 3NNWA 4BCIA 4L42A 4IZ5A 1F0QA 1U54A 4HVHA 4HYSA 4EBWA 5GHVA 2IW8A 3R9NA 3PXFA 4IAYA 4YJNA 3R7UA 3PRIA 1OL5A 2ITZA 4BCHA 3DLSA 2BMCA 1W98A 4RLLA 2IJMA 2R3NA 2W1EA 4A06A 2P0CA 1YOMA 4RWLA 3DU8A 4JG7A 4NL0A 4TWCA 4X6QC 4JIAA 3VBYA 4DH8A 2ESMA 3VS3A 1Y6BA 4BBMA 1ZOGA 4RJ5A 3TUCA 3MFRA 1DM2A 2FSLX 4E4LA 2B0QA 4PRJA 4UMRA 5IQBA 3WE4A 3KCFA 3LFAA 4A9TA 3DZOA 3QTIA 1BX6A 4YZBA 4KRDA 4D1SA 3H9FA 3Q4ZA 1G8KA 4CYJA 2VTNA 4YTIA 4A07A 3O71A 4J98A 1YWRA 2C5VA 4FV0A 4A9SA 1NVSA 1OI9A 2HZIA 3RINA 4NT4A 4QYEA 1UU3A 2V7AA 3II5A 3S1HA 1ZXEA 2OIQA 3AC5A 3PJ2A 3WF5A 2FH9A 3UYSA 4C8BA 3U55A 2V5QA 1OL1A 5M56A 3FLSA 3WF6A 4XS2A 4XMOA 2GS6A 4IB0A 3A61A 3KF7A 2CKQA 2IF8A 3UE4A 2B9FA 4EORA 5LWMA 1H00A 4MD8E 2A4LA 3E93A 4BI2A 5DMZA 5LMKA 4NIFB 5DRBA 1Q8WA 2J2IB 3DFAA 4CQGA 4O4CA 4R3PA 2VD5A 4YJRA 2SRCA 3QRTA 4QP8A 3BKBA 2F9GA 3ZHPC 4ENYA 4M97A 4U3ZA 3V01A 2C68A 4DFBA 5F94A 4BCOA 4DA5A 2ZJWA 2DS1A 1PMVA 1U59A 3HAMA 1XBBA 3Q4TA 1YWVA 4RIXA 2IO6A 1ZOEA 2OSCA 4NW6A 4AXDA 5D7AA 2Y6MA 4IFGA 2XIZA 3ATTA 3RHKA 2DQ7X 4WBBB 3TG1A 4FOCA 4C62A 3C9WA 3HA8A 4FNYA 5JFSA 1MQ4A 2G01A 3WILA 1I44A 2OXYA 4QMSA 4U6RA 3LXPA 1W82A 1UNLA 2YAAA 1ZZLA 3TL8A 2W99B 3EQIA 4DN5A 1DI9A 4UXQA 5HG8A 2JDRA 4FVPA 1UKHA 3KULB 1WBOA 5AWMA 3NNXA 3UMXA 1PKGA 2E9NA 2XS0A 2PZRA 3H3CA 3PP1A 4FIGA 2JEDA 4FTCA 4IB5A 4JJRA 3RK9A 5M4CA 3SG9A 4FV2A 2W1HA 5BVEA 1K9AA 2W9FB 3JYAA 1ZARA 3EQDA 3QQKA 4O0VA 4GT5A 4MHAA 4U8ZA 2VX0A 4CEGA 1M17A 2E9OA 5FBNC 4G3CA 3D7TA 5ETIA 4E1ZA 3RWQA 2QO7A 3BU6A 4HYHA 3TNQB 3COIA 5K0XA 4O83A 3NUXA 2IZSA 4IM0A 4LOOA 4AZVA 2C5YA 4JOAA 3HLLA 4G3EA 4RIWA 3MJ2A 3RHXA 4O27B 3LZBA 4PQNA 4RFYA 3O5AA 4H3PA 4BHZA 4CMUA 3LVPA 4ITHA 4KKGA 3HMMA 2XNNA 2UZTA 3KXNA 3MVLA 5DOSA 5CEKA 3DA6A 3IK3A 4QMQA 4O86A 3BGZA 4HVDA 3L8VA 3KIOC 4WT6A 3FLWA 3LXNA 4Y73A 4AOTA 4IX6A 3ZCLA 5JMSA 2O8YA 4EUTA 5F1ZA 2XCHA 1B6CB 2QU5A 2WMQA 2ZB0A 3CTJA 4NEUA 3MN3A 5AA9A 2W05A 2WTIA 4ANOA 5LJJA 2X7GA 3W16A 4J53A 5KMLA 2JDVA 2YAKA 3RCDA 1MRYA 3H9OA 5LQFA 4MWHA 5J9YA 2R4BA 1E1XA 2YM3A 4U42A 4DGLC 4DCAA 2W4OA 3A7HA 5E8WA 1GAGA 2OW3A 2YLEA 2C1AA 1P2AA 3E7VA 5BMMA 5IISA 2C6MA 2WMXA 4FZ6A 1STCE 3QZGA 3E87A 2F7EE 3CE3A 4V04A 5E8YA 3BL7A 5ACKA 3MA6A 3ORLA 3WZEA 4F99A 3HV4A 4A4LA 4UX9A 3TACA 3GFEA 4R5YA 2VTIA 3F5PA 4ZS0A 3D4QA 2E9PA 1XR1A 5CXHA 3D9VA 2B1PA 1H26A 2C0IA 3RVGA 3SXFA 1KSWA 2OO8X 4K0YA 5C1QB 3FAAA 2OIDA 2V0DA 4LL5A 4RC2A 3VS7A 4C3FA 1KOBA 4DH1A 4CVAA 2B54A 2PE0A 4EYMA 1TFFA 4C59A 5CU6A 2OJFE 3L8SA 4TYIA 1NVRA 1OL2A 5EK7A 3OWPA 4IE9A 2AQXA 2BKZA 5D10A 4IEBA 4QQTA 5IQGA 3I60A 3UOLA 4JG6A 4PL4A 2RFNA 2VTQA 3F3WA 4KRCA 1VYWA 2ITQA 4RA4A 5C8MA 3EFWA 4WIHA 3UC3A 5IMEA 4DAWA 4LM5A 2QONA 3CCNA 2YCSA 5HOAA 2HOGA 3R9RA 1ATPE 4QMMA 4C58A 1YOJA 4O91A 4OTRA 2Y7JA 3BYMA 4Y8DA 5KX8A 3C5UA 1G8JA 4O22A 3DNDA 3G0FA 1J7IA 2CLXA 1TZDA 2EUFB 2YDKA 4RWIA 4RJ6A 4MXOA 4C37A 2X7OA 3K2LA 3GCUA 4DE4A 4MNEA 2JC6A 3QQUA 3CKXA 1XWSA 4J99A 4GCJA 2H96A 4GFGA 3WI6A 4ZY5A 2C6LA 5CY3A 4N6YA 4JRNA 4IC8A 5HE2A 3L9PA 4AAAA 1YHVA 4EH9A 2Q0BA 3KK9A 2H6DA 2J50A 2PMLX 1E1VA 3F66A 5AP7A 5DA3A 4FTRA 3ET7A 4ALWA 2XK9A 4FV9A 3VC4A 3LPBA 4ZZNA 1FMKA 3QCQA 5GJGA 2WEVA 5LXMA 4FSMA 4E5AX 4FT0A 4GUBA 3V8SA 2BRMA 5K5XA 3WYYA 2QC6A 4UYNA 4DF3A 2R3PA 1DI8A 5GZ9A 3TZ8A 4AGUA 3SG8A 4AXEA 3EIDA 1YVJA 2QODA 2CN8A 2OIBA 3DGKA 2JDSA 4BBFA 4KSPA 3OBJA 2PL0A 3DPKA 4R7BA 5AV1A 1QL6A 4AA5A 1A48A 3GU4A 2X6EA 3C51A 3I7CA 2Y4IB 3R22A 3VUHA 4FKQA 1URCA 2QKWB 5EI8A 3Q3BA 3DB6A 3AT3A 3O8TA 5FM2A 3GCVA 2CPKE 2HYYA 4K18A 2I0HA 4NCTA 2C3LA 3BYUA 3NCGA 3QTZA 2NP8A 4M0ZA 4O4FA 4EK4A 2UW8A 3AKLA 4YUQA 3PZEA 2HK5A 5EI6A 2DYLA 3V6RA 2ZFYA 1HOWA 2WEIA 2QOCA 3OCBA 4FL2A 1FVVA 2F57A 2BVAA 1V1KA 3DZQA 2OH0E 4JX7A 4XBRA 4USDA 3PXZA 3R9DA 4BZDA 4I20A 4AW2A 3K54A 3E8CA 3PIXA 4J8MA 5EM8A 3RM7A 3R8VA 3DAKA 4FOBA 2FSMX 4QT1A 3EN6A 3R30A 4O7YA 2WU6A 4TZRA 4FTIA 3ROYA 3D5VA 3H9RA 2BFXA 3I79A 4GMYA 2ITOA 4RIOA 1XQZA 2GTMA 1XO2B 4OT5A 2C0OA 3VBQA 3ZC5A 4C3PA 2GCDA 5FTOA 4F7NA 2QOFA 2WMAA 4HW7A 3QCXA 4CRSA 5CAQA 4L00A 3LE6A 5AP5A 4FG9A 4RX8A 1PF8A 2FVDA 3Q60A 2UVXA 2VX1A 3UQGA 4KNBA 4I6LA 2XYNA 2ITUA 5C01A 5IA2A 4RVKA 4AA0A 4IAZA 3WZDA 1PXJA 5BYLA 2JKOA 2PVNA 3FSFA 3NX8A 3QRUA 4MXZA 5CT0A 3R9OA 2PU8A 1KE9A 2W1DA 3SV0A 4I21A 4OTWA 3V5WA 1Q24A 2HZNA 4GSBA 4GYIA 3RMFA 3PVBA 4CNHA 2CGUA 1SVEA 3HNGA 2WD1A 4G3DA 3EQFA 1U4DA 5CQUA 4QMLA 2JGZA 2OJJA 3C1XA 3TZ7A 3HDMA 1IA8A 3I6UA 3VS2A 4EH8A 1FBNA 4EHEA 4NZWB 4UBAA 4FKRA 2OI4X 4GL9A 3FMJA 4Y5HA 3QTWA 3KRJA 4FI1A 4V0GA 2A27A 4IQ6A 3COKA 4S2ZA 2BTRA 4ZTLA 2IEWA 4FTAA 3SOCA 2BRGA 1OZ1A 2XBAA 4XV1A 4EBVA 3NUAA 3MH2A 4QTAA 3N4VA 4KIKB 4GVJA 2GPHA 3PA4A 3GBZA 5L2SA 3LMGA 4ID7A 2G1TA 5A4QA 5CSPA 2ONLC 2BR1A 2OZAB 3QUPA 4GIIA 5EKOA 4EOSA 4K77A 2BAJA 3G33A 4C2VA 1QCFA 2BROA 4YHFA 3WOWA 3KXGA 3LFEA 4KBCA 2BDWA 4L53A 3LFNA 4QQ5A 3CC6A 2RKUA 3ORXA 5HVJA 4HYIA 3UG1A 4AXCA 2C6OA 3M42A 3VBVA 4GKHA 3O7LB 3NYNA 4F64A 2O5KA 4UB7A 5EQYA 3QKKA 1DAYA 5HIBA 2XK8A 3OOGA 2V22A 2QCSA 4WSQA 4YLLA 4DFYA 4UV0A 5JSMA 5BVDA 3EN9A 4IZ7A 3NUNA 3VBXA 3DXNA 3ERKA 4E6DA 5JZNA 1KE5A 2C47A 1G8SA 4DGOA 3BLAA 3IW4A 3NEWA 3L8XA 4IWDA 5HNBA 1BI7A 1JKKA 2YIXA 2VWBA 3HRFA 1VZOA 1UA2A 2IZUA 3Q9ZA 2QD9A 3S00A 2ETRA 3AKKA 3P86A 5HLWA 3NYOA 3V8TA 2WQNA 2UZLA 5AUXA 3O0GA 2QOKA 3HEGA 2I6LA 5HNGA 3I7BA 4PP7A 3ZO1A 4LOPA 5M44A 5HORA 1R78A 1F5QA 1YOLA 2R7IA 4C3RA 4NFNA 4DBXA 2P2IA 4O7WA 4HZRA 5F9EA 2WAJA 5DEWA 4K6ZA 4FT5A 3R1NA 3UP2A 4FV5A 3IQ7A 1W2FA 4FT7A 2CGXA 4WA9A 4G3GA 3QC9A 5DLSA 1JQHA 2WQEA 4YTCA 4Y72A 2OZOA 2YZLA 3DAJA 4M13A 4NTSA 4EKLA 4QP3A 3U4WA 3S0OA 1MP8A 3V3VA 5KUPA 4O7SA 4H36A 3W2CA 3QL8A 2EB3A 4BB4A 4FZFB 2QOLA 3KRRA 2XP2A 3O50A 4MBJA 2OF2A 2X0PA 4E6CA 5CSVA 1LUFA 4Z9LA 5A46A 5AEPA 5HBHA 2XYUA 4XHKB 3TIZA 4EOQA 4EZ5A 2GQSA 2HAKA 5CI7A 3EKNA 3FLNC 4ZSLA 3GFWA 4RIYB 3BQRA 4QD6A 5I9ZA 1DS5A 4BYJA 2X7FA 4G34A 3R7VA 1OMWA 3A99A 4DLIA 4X21A 2WMSA 3Q4CA 3W8LA 2PWLA 1ZMUA 3W0OA 5M57A 3DKOA 2W1GA 4P4CA 3P79A 3UVPA 3ZZWA 4E3CA 5IQDA 1A9UA 3R28A 2J0KA 3NGAA 3OZ6A 4OAVB 2RG6A 3MIYA 5ANGA 1J7UA 4QMOA 3JPVA 4U97A 2H9VA 2UW4A 3EYHA 3W55A 4BCQA 2PZPA 2JITA 4RG0A 3KEXA 3NLBA 4ZSEA 3K3IA 4KIPA 3G6HA 3OTUA 3W2PA 4RPVA 5ACBC 4L7SA 1XBCA 2R3IA 3KB7A 3GI3A 3QWKA 4WSYA 1M7QA 2RL5A 5JRQA 4PUZA 1Q41A 2VTPA 3UODA 3UTOA 5HU3A 1IRKA 2WGJA 1EH4A 2XUUA 3IW5A 3OTVA 3DQXA 3AG9A 4JQ7A 3RP9A 3PWYA 3SA0A 1J1BA 1JLUE 4AT3A 3HECA 4BKZA 2VUWA 4J95A 2ERKA 3F3ZA 4RFMA 1ZYCA 4XP2A 4A9RA 4QDEA 1H1QA 3GP0A 2YIWA 4OTFA 1T46A 5HG9A 4B7TA 4D9UA 3Q2MA 4GRBA 3QALE 4HZSA 4F0IA 3UIMA 3RPSA 3VBTA 3I0OA 3I4BA 1UU7A 4FV1A 4MXYA 4QTDA 3PDTA 4FKOA 4YZNA 2XIXA 3G2FA 5HICA 4MXCA 4AA4A 2JIIA 4FTNA 1LEZA 3BHHA 3NUPA 4JBPA 4TXCA 4BDBA 3HMNA 3IDPA 5AUYA 2E9UA 2C1BA 2YJRA 3BGQA 5DNRA 5HTBA 3RM6A 3DT1A 4G17A 5H3QA 3ZU7A 1XMMA 5EQEA 3Q4UA 5D9HA 4CKIA 4UMPA 4EQCA 4AW0A 4RX9A 4MAOA 3LCDA 1R1WA 4M7IA 3POOA 4HGTA 3VULA 3ZUUA 2R3GA 3FC1X 1OL7A 4J71A 3VAPA 3MESA 4LGDA 3CSVA 3VF8A 2X6DA 5FUTA 5J7BA 2HENA 4IX3A 3AXWA 4UMQA 1Q8ZA 3KF4A 3GU6A 3RPOA 4DHFA 4ANLA 2WKMA 4IW0A 3UYTA 2GNGA 4BDAA 4FUYA 4L3PA 1YW2A 3EQCA 4BDDA 3GU8A 5CAUA 2XM8A 4ZMFA 2EXMA 3CBLA 4FTUA 4LMNA 4PPBA 3VUIA 4GKIA 2HWPA 4GVAA 4S31A 2J90A 4G16A 4JBQA 3BYSA 4M66A 3UO6A 5CI6A 3A8WA 3CQEA 5I3RA 4F7JA 3R8PA 3TCPA 4E5BA 5HNIX 2Y0AA 1IG1A 5C4KA 3R63A 4DHJA 2ZYBA 3UDBA 4R6VA 5F4NA 4N6ZA 4QRCA 3TIYA 5IQIA 4ZTMA 3HX4A 3OCTA 4U41A 1Q5KA 5FGKA 3S4QA 3A7IA 3MH1A 3EYGA 5GZAA 2P3GX 4O81A 4LG4A 3VS1A 1YXXA 2QU6A 4IVAA 4BN1A 4UMUA 1ZY5A 3IGOA 4W8EA 5TE0A 3KXHA 4AWIA 1J3HA 3Q6WA 4M3QA 1IR3A 3U87A 5HU9A 5J7HA 2GQGA 3ANQA 3I0QA 5CEPA 3MGYA 5AJQA 4RVTA 1YDSE 5A3XA 3DOGA 5CX9A 1Y57A 5FP5A 1GIHA 1IASA 2XBJA 2FA2A 1TVOA 1R0PA 2XKDA 5CS6A 3LIJA 5KMIA 4JG8A 4MD9E 3EQHA 3GEQA 3A60A 3B8QA 3QFVA 2B7AA 3BZ3A 4CV9A 3U6IA 4F78A 4FSWA 2GHGA 5F20A 2UW3A 5T3QA 4RZVA 4FVRA 3AQVA 2PZ5A 3MI9A 1OKVA 4GG5A 5ANIA 4BL1A 1KV2A 2V55A 1Y8YA 2VTRA 2Y8OA 5CEIA 1VJYA 3CS9A 1YDTE 4DEGA 3UMWA 1PXMA 2BZHB 3OEFX 2JDOA 3EL7A 4X0MA 4EK3A 4HGSA 3HYHA 4C38A 5DEYA 3OP5A 4FKSA 3UVQA 5TR6A 2J0IA 4BY9E 1PXLA 4YZMA 2YIQA 3PYYA 3EOCA 3BHVA 2E2BA 4FG7A 4QMVA 5KE0A 4JLCA 5EYMA 5HZNA 3CGOA 3U54A 3PPZA 3Q53A 3Q5IA 3AC4A 5BYYA 4QPMA 2OICA 4GJ2A 2VU3A 4WG5A 4DGGA 4IB3A 2WMTA 4KKHA 3MTLA 4PL3A 5LARA 4C57A 3BGPA 3LQ3A 3QCYA 4EH3A 3P23A 4I5CA 4X2GA 3VQUA 3P08A 4RSSA 3VRZA 3QZIA 4YO6A 3ZO4A 4BKYA 4X2KA 2GFCA 4HGEA 5EOLA 5IA5A 5HIDA 2VX3A 3SXRA 4E7WA 3UOJA 2ERZE 2R3KA 3C4ZA 2YFXA 4U81A 5GJFA 5L4QA 4U7ZA 3DK7A 2YA9A 5KO1A 1JKTA 4GK2A 4ANBA 4F6UA 3MVHA 5FTGA 5IQHA 3L9MA 2UZDA 4Q5HA 4KINA 4L67A 3GCSA 4QMPA 4IDVA 3GU5A 4F6SA 2VAGA 2XNBA 2BALA 3NNUA 4CKRA 4OT6A 5D41A 4B8MA 1AD5A 4YP8A 4ZJIA 5L3AA 4DITA 3PP0A 3QZHA 2YACA 4I23A 5B2LA 5HKMA 3V8WA 2CNQA 4NKSA 1NT2A 4X2NA 1FOTA 3DS6A 2PY3A 2BZIB 4M14A 4IWPA 1NY3A 4JXFA 3QQFA 2XJ2A 3TJCA 4BZOA 2UW6A 4XNEA 4ZTQA 3EQRA 5HCXA 3MPTA 4KS8A 2YCRA 2GU8A 2VV9A 4UYAA 5AIRA 2XNPA 4LRKA 3QA8A 4ZIMA 4OTIA 1JAMA 3V04A 4D2SA 5KBRA 3KY2A 5IU2A 4PNKA 1SM2A 4WNOA 4FYOA 4UMTA 2XANA 4AN3A 5M07A 4XP3A 4FNWA 3IECA 3VUKA 3P4KA 4LQMA 1UU9A 4QMNA 5HG7A 5JGBA 3SHEA 2OG8A 4NM3A 5JKGA 5DFPA 5LVOA 4MVFA 3Q9YA 5AUUA 2JDTA 3V51A 1H0VA 5AP0A 5CANA 4LFIA 4HNFA 4EHZA 5JGDA 4CYIA 4FEUA 3OOMA 4TYHA 5EQPA 5K9IA 1PY5A 1OKWA 3SRVA 1OPJA 3RKBA 2R3QA 2QG5A 5BVWA 4ALUA 4C0TA 4D4SA 5KHWA 4ACHA 5EYDA 2BIYA 4IXPA 1SMHA 2G2HA 4U80A 4FE2A 1M52A 2WPAA 3UNKA 3PSCA 1ZMVA 4LRMA 4JVGA 3GENA 4FZ7A 2IVSA 2I0EA 2CNVA 4FV8A 5HO7A 3LKMA 2UZEA 2W06A 1L3RE 1MRVA 4M15A 2X9EA 2PVKA 2OGVA 3L1SA 3GC8A 3FQHA 1PYEA 3BYVA 2CKEA 3E64A 4ERKA 1J1CA 1WVXA 2ITWA 3OHTA 1KUTA 4O4DA 3R7IA 3BQCA 3PXQA 5CZHA 2XIRA 1Q8UA 2QHNA 2G2IA 4K2RA 4S33A 2DWBA 4C34A 5DYJA 3U51A 4KWPA 2R0UA 4W9WA 4R3RA 1LR4A 4AN9A 4CZTA 4GT4A 2WIPA 2WELA 4I93A 4R3CA 3BV3A 2XA4A 3ZDIA 2J6MA 1Q8YA 3NSZA 2VO7A 2UZVA 2CKPA 2PVHA 2PMIA 3ZDUA 3QYZA 3QF9A 4D4YA 2WU7A 4YPDA 4BCJA 4OAUC 4JX3A 5KMJA 4FJVA 3UPXA 3FY0A 5IUHA 1W2CA 4FIJA 4FKIA 4QYGA 4W8DA 5H2UA 2ZV9A 5M51A 1V0OA 1O9UA 4I41A 4YSJA 1RE8A 5AM6A 4DFXE 3C4FA 3KC3A 4X6RA 1ST4A 4HCUA 3HV3A 4D1ZA 3BPRA 4DGNA 4H39A 4ITIA 1S9JA 2B53A 4AXFA 1H4LA 2JKQA 1QPDA 5L6OA 5TO8A 4YSMA 4D0XA 5GJDA 3WIGA 4ACGA 3MPAA 3TKHA 4BYIA 3ZBXA 5IA3A 5ITAA 2VNYA 4GT3A 4AN2A 3C0GA 3OXZA 3DDPA 5AA8A 2GS7A 5EDPA 4I24A 5JQ5A 5FBOA 1XHAA 5LMBA 3MS9A 4TYJA 2OXDA 1XH7A 4QTBA 3HZTA 3DB8A 3LCTA 5CU3A 5IDNA 1X8BA 4QQJA 3G5DA 5FEEA 3NFFB 1XKKA 3IDBA 1TQMA 3BHUA 2I1MA 3TNIA 3MY5A 4O84A 2UVZA 3QXOA 3KKVA 3TM0A 3ZEPA 4XV9A 5ANKA 1K3AA 3RPYA 2ITPA 3OCSA 3VVHA 4XV3A 5L6PA 4YR8A 1P4OA 1Q4LA 2VWIA 3FMMA 4C61A 2PUNA 4AE6A 4CLIA 3ZRLA 3ZUVA 4O0SA 3HMIA 4UEUA 3OEZA 2QR8A 3TTJA 4QTEA 4FBXA 1OM1A 2QO2A 3ACJA 4EOMA 4MNEB 5EH0A 3VRYA 2XH5A 3QKMA 1OKYA 1LPUA 3CPBA 4C7TA 2OLCA 1ZLTA 2XRUA 3VHEA 3ZM9A 4R77A 3RAKA 3HUCA 3VUTA 3GCQA 3NNVA 3ULIA 4K1BA 2UW9A 4YLJA 3R8MA 2YABA 2WQBA 3DJ5A 2ZDTA 3FZRA 3BHYA 3ORPA 3ORZA 1ZOHA 3ZXZA 4YU2A 2BKKA 3FC2A 4CTBA 1XH8A 3MW1A 1CTPE 1G5SA 2CHLA 3ZRKA 1JOWB 2UZWE 3ID6C 1PMNA 4BWPA 4EH6A 4IHPA 1IEPA 3FKNA 3MB7A 4ZOGA 2XNEA 4F08A 4ZAUA 3VN9A 4QMZA 4YPSA 5JEBA 3PUFC 3UJGA 3G90X 1WVWA 2QNJA 4FV7A 3E8DA 3NVMB 4FIHA 4AQCA 3BX5A 4QNAA 5L8JA 5AR8A 4G1WA 5LMKC 4PMMA 3PIYA 4C4EA 3W0PA 3H10A 4MCVA 4DGMA 5IUGA 3THBA 3N9XA