5I9WA

Crystal structure of ephrin a2 (epha2) receptor protein kinase with anp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
291
structure length
267
Chain Sequence
b'TTEIHPSCVTRQKVIGAGEFGEVYKGMLKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 267
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9wA01
4J96A 4QMLA 3U9CA 2BRHA 3LQ3A 1K3AA 3EQIA 3LQ5A 4ACDA 5IA2A 3F82A 5BX0A 3FLNC 2SRCA 2XKEA 4CMTA 5LXMA 4FG7A 4KBKA 1NVRA 4FC0A 3U4UA 5CLPA 1YDSE 2PSQA 5DYJA 5BYYA 4NYEA 3GU5A 4W8DA 3P0MA 1ZOEA 5IDNA 4FTQA 3BHVA 1E1VA 1REKA 2G2IA 3H9RA 3B2WA 1YDTE 4M8TA 2DYLA 3E92A 4LRJA 1UV5A 4DGMA 4ZSLA 4U9AA 3QHWA 4YZCA 3EQDA 3PJ3A 4QMXA 2HOGA 5HD4A 2UW5A 5I4NA 5ANJA 1FBNA 3VUMA 5CEOA 4RMZA 4I92A 2ITYA 1V0BA 2EB3A 3WI6A 3AG9A 4O0TA 1OKZA 5FGKA 2LAVA 2C5XA 2CPKE 1U59A 4I1ZA 4JG7A 1XBCA 3ZEWA 2C6MA 4EBWA 5A4LA 3THBA 3JR1A 3HMPA 4FX3A 5M51A 1CTPE 3UP7A 3DBCA 1Q41A 2VV9A 3E8CA 5EW8A 4DA5A 4DT9A 3I7BA 3NUAA 4UZDA 1I09A 3GXLA 2J9MA 3BHHA 4IC8A 2JKQA 5D9HA 4ZY4A 3EFWA 5IA3A 5ETIA 4GV1A 1B39A 4YTFA 3POOA 1V1KA 3ZYAA 4M68A 2OJJA 2ZOQA 3DBQA 4QP2A 5JGDA 4FODA 4RJ4A 2OXXA 3RHKA 3AXWA 4BCGA 5CAPA 2G1TA 3DV3A 4FV4A 4O0WA 5JZNA 4BBEA 2B9IA 4W9WA 4EHVA 3L9NA 2GS6A 4RVMA 2EUFB 3UYSA 2GS2A 2CN8A 2WTKC 4X7QA 4AZEA 3WYXA 3UBDA 2J0JA 3FXWA 1Q8WA 2P0CA 3D83A 3PXRA 4FT5A 4LRMA 4RWJA 4XHKB 4AGDA 5IQGA 4ZTQA 4D0WA 3C1XA 4IX6A 3DZOA 5CZIA 4IIRA 2HCKA 1LEWA 4IZ5A 2R64A 3QUEA 2GSFA 3C4XA 3E8EA 1XBAA 5EFQA 4R1YA 3FLYA 3IS5A 1WAKA 1GY3A 4NKSA 3OWLA 4EQUA 3TWJA 2P2IA 3S0OA 3H0ZA 3SX9A 2OZAA 4RC2A 3G51A 5AV0A 1P4FA 3NDMA 3ZEPA 3KXXA 2X8DA 4GU9A 3EOCA 4FG9A 3AGMA 3AMAA 2QD9A 4HGLA 4I41A 2XCKA 4RZVA 3G9NA 1H07A 5GNKA 1SVHA 4MNEB 3UQFA 4QRCA 2YIXA 3HMOA 4IAZA 4G1WA 1FVVA 2NP8A 3TN8A 5HLWA 2XEYA 4P90A 5CU4A 4AFEA 5AADA 3NRMA 2VTLA 2WTIA 2BRBA 3QKLA 4EZ3A 1J7IA 4O7ZA 5ANGA 3A4PA 5JFVA 3BQRA 5HE3A 3ZUTA 2OJGA 3QZGA 3B2TA 4F6UA 4RX8A 4ZTMA 4LV8A 2RG5A 4JX3A 4R7HA 2OSCA 3FMHA 5AUWA 3R2BA 4W9XA 4R8QA 3GFEA 5FXQA 4B8LA 2W0JA 3DAJA 3BGZA 4TRLA 3RNIA 3Q4CA 3UC4A 5J5SA 2WIPA 3VW6A 4UX9A 2QU5A 1G8SA 3VS5A 4M69B 4IMYA 4JOAA 5BVDA 2C3JA 2V22A 3EQGA 4JRNA 3ULZA 4LMUA 4FGRA 2FYSA 4LL5A 4Y5QA 1WBNA 3I7CA 4HCTA 4RJ3A 3MBLA 1VR2A 4FEXA 3BHUA 4M14A 3KEXA 3QQFA 3ORXA 3ZC6A 4XRJA 5BVEA 4WBOA 3SC1A 2PZPA 4E20A 4RIXA 4AOJA 4EL9A 5LVMA 1YXSA 4G2FA 2ZJWA 1UU3A 2HY0A 2PUUA 1CMKE 2XVDA 3ALNA 4O96A 4KD1A 4X2NA 3ORTA 2OJFE 1PYXA 5K5XA 4ANMA 5L2SA 3ZC5A 5J9ZA 4O1OA 4ASZA 4YJQA 1QCFA 1MQ4A 2WTJA 2VWXA 4BCIA 3ZO4A 3MA3A 4B6LA 3PVBA 4I4EA 4UALA 3T3UA 4C57A 4CT1A 2Y9QA 5GIOE 2OJ9A 1J1CA 1MQBA 2F2CB 4YSJA 5F9EA 2RKUA 3R8LA 2VZ6A 3RAHA 4FIFA 5FEEA 2WIHA 2G15A 2VO3A 3E93A 4FOBA 4E6DA 4AT5A 3EQRA 1ZZ2A 3VWAA 2P55A 4AXAA 5KKRC 2OF2A 4FV8A 4X3FB 1YKRA 4EJ7A 3DKOA 4YPSA 4FV9A 3SHEA 3HA8A 2QQ7A 2WQBA 2VTPA 3FY2A 4B8MA 4C3FA 5IG1A 2O8YA 3QRIA 3I0OA 3VUTA 2ZDUA 3CTJA 3PZEA 1PF8A 3RM7A 5GHVA 4PWNA 5ETFA 5FD2A 5ETAA 4PDYA 4E4NA 1H24A 4D2VA 4ASDA 2R0IA 3RZBA 2OFUA 2C69A 3V8TA 4F09A 5BUJA 3R8ZA 1LUFA 5HE0A 2QHNA 4C36A 4Z9LA 5CF4A 2Y8OA 4CXAA 1W83A 3NNXA 3PXKA 4N6YA 4RA5A 2RIOA 3KRWA 4JIAA 2R7BA 3OEZA 5AWMA 3KXNA 3C51A 3P9JA 4CLIA 1XH4A 3F3WA 2W1CA 3F9NA 3KVWA 5B2LA 4WOVA 5LVOA 4S33A 4R5YA 2JKOA 4B9DA 4AA5A 4LGHA 2W06A 4I0RA 3EKNA 3KL8A 3TNQB 3UNZA 4IB0A 4TWNA 4JAJA 1XHAA 4RIYB 3O8PA 4G3DA 4ANSA 4B0GA 5JK3A 3W8LA 3DK7A 3NWWA 1DAWA 3E5AA 1WBPA 1O6KA 2QOLA 4GH2A 4GG7A 3GU4A 3W2CA 3ZU7A 3DLZA 3RVGA 4JIKA 4BCJA 3UE4A 2E2BA 5BUEA 3ZMMA 3UVQA 5IEYA 2QOIA 2JDTA 4C3PA 4ZTNA 5JKGA 2J2IB 3MTFA 2C0OA 4QP4A 5DGZA 4E7WA 3OXTA 3RJCA 3HA6A 1UWHA 3PVUA 4CKJA 2UZEA 3QXPA 2XMYA 5HOAA 1DS5A 2BZKB 2WMTA 3VW8A 3R02A 4OGRA 4ACGA 1YI6A 2P2HA 2QOCA 4BIDA 3ORKA 5GZ8A 4Y46A 2A19B 4BWXA 4TW9A 5BVFA 5DRBA 2BZIB 3SV0A 1UA2A 2EVAA 2UVXA 2XK4A 4G6LA 4J1RA 3CKXA 2R4BA 4J53A 1CM8A 4O22A 1VJYA 4QT1A 4D5KA 3PWYA 4TYIA 4RVLA 5CWZA 5FEDA 4R78A 5AA9A 2GNGA 3ODZX 1PKDA 4IX3A 3D94A 3QLFA 2XM8A 3QQKA 3BLRA 4MD7E 4YJUA 4O7YA 5HX6A 5DT4A 3VS7A 4MQ2A 5HU3A 4JDKA 4IADA 4X2KA 3UZPA 3ORNA 3HLLA 3IONA 4U6RA 3NR9A 4IZ7A 1R0PA 3NSZA 2VX1A 4ANNA 1KV2A 3HV7A 2YM3A 1ZZLA 1YWVA 3GGFA 5FQDC 4ZSJA 1APME 1L8TA 2CGUA 4EK4A 4P5QA 5DLSA 3E7OA 5KO1A 3IOPA 4FKIA 3Q9XA 2G2FA 4FSTA 4MD9E 5L2TA 4MXCA 1UKIA 4NTSA 3R7VA 3P23A 4PMPA 5IQEA 4QMOA 3SLSA 5KBQA 4ERWA 4QQCA 3SW4A 4S32A 3UIUA 4D4SA 4YC3A 3H0YA 5F95A 4EQMA 3KMMA 3NW7A 3R6XA 4I5MA 4M12A 4FKGA 2OF4A 3A8XA 4FK6A 3SD0A 4O81A 2GHGA 2VTOA 1YOMA 4FSZA 4NFMA 4QTCA 2UZOA 4S31A 1Z9XA 2IZUA 2RF9A 3GCSA 3H3CA 3H9OA 4IM3A 4TYHA 1OL5A 5IUGA 4YJPA 2QURA 5LOHA 5CTPA 5DA3A 3RAIA 5IA0A 4BGHA 1NY3A 2X2KA 5EM7A 4O84A 1H1PA 4DH7A 3E64A 5AP5A 4DH8A 4UMUA 2W1EA 5JGAA 2XA4A 3DXQA 4QQJA 3PA4A 4G5JA 4OTQA 5ANIA 3TTJA 3VS4A 2CKEA 5L2WA 1A9UA 4PMTA 3DDPA 5HTBA 4GKHA 3LXLA 1PMUA 4RLKA 5A3XA 5HE2A 2BHEA 2OI4X 1ZAOA 4E4LA 3FMNA 4MYGA 4ZSAA 5JFWA 3K3IA 2WEVA 3IGGA 5AP7A 4DBXA 4KKGA 2W5HA 4LG4A 4NIFA 3MV5A 4WA9A 3MTLA 4ZIMA 5FP5A 4XOYA 4U97A 2OH4A 3NEWA 1W98A 5A4EA 4FSQA 3UPZA 3LCKA 3VN9A 2W1GA 3C4WA 3I0QA 4YMJA 4AN3A 4YJSA 4AUAA 2ERZE 2Q0BA 5CF5A 2XIKA 3BIZA 3VAPA 4FSRA 5D7AA 3HEGA 4QP9A 1P2AA 1WZYA 2C6EA 5DR9A 4CKRA 4L01A 2R3IA 2XNEA 3BYUA 4BDEA 2BTRA 4O82A 4L7FA 4A06A 2YIYA 1E1XA 2UV2A 2W4JA 4IHPA 3VNTA 1CKIA 3HV3A 2JLDA 4JL9A 2YISA 1OM1A 1S9JA 1KE8A 2YCFA 3JVRA 1H08A 3LHJA 4AN9A 5AFVA 2V62A 2YM4A 3B8QA 3UIBA 4FTAA 4JI9A 3DA6A 1IRKA 4A4XA 2V55A 4UB7A 1TKIA 1HCLA 4GRBA 4U80A 1DM2A 3LIJA 4OTWA 3A7JA 5DG5A 4NM7A 2OICA 4RGJA 3AC3A 4OBPA 1UU8A 5FBNC 3RGFA 2UZNA 3HDNA 4FNXA 3PE1A 4QO9A 4PNKA 3R9HA 1Q99A 4CVAA 2C5VA 4JVGA 3LW0A 3ZHPC 1WBSA 5A4TA 4GT5A 4WSQA 2X2LA 2OJIA 5E8VA 3AT3A 4GL9A 5A14A 2YDIA 2YDKA 2ETMA 3MH1A 4J8MA 3OP5A 5M4CA 5IF1A 3B8RA 4JQ8A 3NCGA 4ITJA 4LYNA 2QOBA 3LQ8A 4HPUE 3NVMB 3TCPA 4AU8A 1WVXA 3DU8A 3UO6A 2WHBA 1OIRA 2B55A 4PDOA 3IW7A 5M09A 2GNFA 4FTLA 2EWAA 2YJRA 4EK8A 3DNDA 4U79A 3GENA 2FSTX 4YJOA 4G3FA 5AR5A 4BHNA 2YZAA 5DT3A 5J87A 3HV4A 2XS0A 5AP0A 4C7TA 4FTKA 4DG2E 2F9GA 4O7RA 1PJKA 3LXNA 3PXZA 3QZHA 4G16A 3PIYA 2WQMA 5A4QA 5L2QA 1RW8A 3EWHA 4LUDA 4TZRA 1WBWA 4EKLA 5J8IA 2BROA 2O63A 2VGPA 5M55A 2QO7A 3DBDA 5J1VA 2WFYA 4QYFA 4X6QC 4AOTA 3EYHA 3W1FA 4KIKB 4EK6A 3Q2MA 4CYJA 3O7LD 1G3NA 2XNNA 4Z7GA 2QG7A 3FMDA 3QZIA 2XBAA 3UO4A 5CANA 3R63A 4XG9A 5E8YA 5KE0A 4D4VA 3KK8A 4ANBA 5EDRA 2W9FB 4XBRA 2Z7SA 4XV2A 4GUBA 4MWIA 3MS9A 3PG1A 4NSTA 2PUNA 3Q6UA 5CAQA 4YHFA 5HIDA 2PMNX 5FDPA 3AQVA 3IW5A 2PMLX 3V8WA 2PVYA 3V01A 5K0XA 3DB6A 1OL7A 3CIKA 3FYKX 3MY1A 5EDQA 4FVQA 4ALWA 3SGCA 4FZ7A 5HIBA 5C8KA 5L8JA 4IW0A 4DE4A 3SAYA 5DVRA 4N0SA 4NM0A 3CGOA 3QCXA 3V5JA 5AUZA 5AAGA 3MVHA 3QTXA 1ZY5A 5AR4A 4CV9A 4HVDA 4FV2A 2LGCA 3QU0A 1XWSA 2QU6A 1JSTA 4I0TA 3V04A 3OC1A 4S2ZA 2GQSA 2EU9A 3ELJA 1ZYSA 4L8MA 3OCGA 2YAAA 3UTOA 3DXNA 4WRSA 3MFUA 5BUIA 2BAQA 3CQEA 3NAYA 3IPHA 3C4EA 2FSLX 3IW4A 4YURA 5EQPA 4MBLA 4DG0E 5C1QB 2Z2WA 1HOWA 3AT4A 4F1OA 3LMIA 3WF5A 2X0GA 4R5SA 3UC3A 4F1TA 4RZWA 2OW3A 4L3PA 4UN0C 3M42A 2XEZA 3UP2A 1Y57A 2C3KA 3L8VA 2WO6A 3R28A 4U40A 4IFGA 4XP3A 3VS1A 1U4DA 3QGYA 4DEGA 2ONLC 5D11A 2IPXA 2XM9A 3EN9A 3FHRA 1RE8A 4CG8A 4KSPA 1JKKA 2ETKA 4USEA 4L45A 3OWPA 5HIEA 5GIPE 1IAHA 2QHMA 3GC7A 3WE4A 5M4UA 1ZYJA 4IVDA 3UG2A 1GOLA 2XIRA 1PMVA 2YFXA 4O6LA 4FV7A 4EWQA 5CALA 2W17A 2CNVA 4C8BA 4UMRA 5L6OA 4A07A 4S34A 3RZFA 3FBVA 4E73A 2OG8A 2W5AA 4B4LA 3UZRA 5AP2A 3V51A 4KABA 5HICA 2QKWB 5DHJA 4C35A 4MXOA 4D55A 3M11A 1ZYDA 2BKZA 2BCJA 4CFVA 3PZHA 5EKNA 3R21A 4FSMA 3MVLA 1NXKA 4PPBA 1YI4A 3FC1X 1FGIA 3R2YA 5AP3A 4GMYA 4JNWA 2UW0A 3EQHA 4F6SA 2C6TA 2Q83A 1A48A 4BIEA 5JT2A 4M13A 1DI9A 3NIZA 2EXMA 4FYOA 2X7FA 2ZV7A 3LCSA 5D1JA 1WVWA 4YZMA 3FUPA 3I5NA 2WTKB 4NJ3A 5A54A 3L9MA 3VRZA 3D5XA 3I79A 3P1AA 1T45A 2X6DA 3DFAA 4UYAA 4G6NA 4ZTLA 5CVHA 5FG8A 3ZFMA 3LFNA 5I3OA 1REJA 4E93A 3PSDA 4KIKA 3O17A 4HVHA 4EOLA 4IXPA 4TNDA 5AUVA 2JBPA 1BMKA 1Q8ZA 4FZ6A 3UOJA 1MUOA 1P4OA 4AA0A 5ITAA 3GQLA 5L4QA 1ZARA 4H39A 4IB3A 2FGIA 4IJ9A 4ZY5A 1GZ8A 4ZXTA 3VHKA 4MF1A 4AP7A 2C5YA 3ID6C 4DEIA 4O6EA 4BBFA 2FH9A 3LFDA 3CJFA 4MWHA 1WBTA 3OHTA 3COHA 4AT3A 2CKPA 2BZHB 1Y6AA 2F7EE 1JVPP 2R3FA 2OBJA 1KOBA 3Q52A 3OF0A 4IX5A 3PY0A 5HNGA 4LMNA 3PJCA 5FBOA 3ATTA 3SG9A 3OROA 3CGFA 3FKOA 4I24A 3OS3A 5HVYA 4EOSA 2P33A 1MRVA 1IA9A 2PHKA 4JBQA 4FL2A 2B0QA 3NGAA 4CRLA 3MSSA 4XV9A 2YIQA 5BVNA 2X9FA 3VBTA 3DTWA 3ENMA 5EQEA 1P14A 3P78A 3MFTA 4F0GA 4MXAA 2GFSA 3BQCA 4IDVA 3ROCA 1YXXA 1XJDA 3LAUA 2XK6A 2XNGA 4I6FA 5HGIA 5CENA 1M7NA 1PW2A 5KNJA 1J91A 2GNHA 2XNOA 2HXQA 4L53A 2XK7A 3UDBA 3WZUA 1OUKA 2C5OA 3DS6A 4C62A 5HTIA 2CLXA 2XCHA 1PXJA 5J5TA 4JLCA 4L3LA 4NKAA 5H8GA 4NZWB 5H2UA 4V05A 4EZ7A 4D1ZA 3ZM9A 3QTIA 2J51A 5KBRA 3WE8A 4JG6A 4FKVA 2GQGA 3I81A 5BVOA 3FLZA 2OZAB 3UOLA 4F63A 5H3QA 1JWHA 2IO6A 3N4VA 4LFIA 4ASEA 5IQFA 4AW0A 2HXLA 3FKNA 3SRVA 4AZTA 4PP9A 4YLJA 4Z16A 3LKMA 2AC3A 4LUEA 2XUUA 2PVKA 4D2WA 2CGVA 1OUYA 3LFAA 2IZSA 4DLIA 3LLAA 5C01A 2A27A 2ITTA 2VTQA 3A99A 4ZS0A 3PJ1A 1IAJA 5EHLA 4BTJA 3CKWA 5KKRB 1BUHA 1XQZA 4IANA 3S4QA 3NUXA 3PLSA 3SOCA 3MWUA 4HNFA 3VBQA 2GHLA 3O8UA 4FKOA 4KRDA 5E1EA 4EH4A 3D5UA 3D14A 5EYKA 4O0UA 5CSPA 4BDJA 3MH2A 2JITA 5FM2A 2XH5A 3EJ1A 4AOIA 3KXZA 3F3ZA 4D9UA 4P7EA 3GU7A 4DFZE 1F0QA 2WTDA 3SDJA 3EB0A 4PL3A 5AIRA 3F5PA 3TIZA 5LMAA 4HCUA 4MD8E 2HW6A 3EN4A 5JEBA 2XIXA 5JN2A 5H8EA 3RHXA 4RIXB 2YITA 4NH1A 3W2PA 1FOTA 4CTCA 2EB2A 3BE2A 3HV6A 4KBAA 3G6GA 3SXSA 2IVTA 4I6HA 3NUSA 3R7YA 3UIMA 4QP6A 2I1MA 3TJCA 4AE9A 4XV3A 3NYXA 2ESMA 5HZNA 4WO5A 5M07A 1GIHA 1R3CA 5HCXA 2P4IA 5CX9A 3R9DA 3ZLWA 3DJ6A 5E1SA 3R1NA 2CCHA 3R73A 4YNOA 3KK9A 5HHWA 2DWBA 3W2QA 4BCNA 2IWIA 3D15A 1S9IA 2C6KA 5GJFA 3VHEA 4YO4A 1YI3A 3DQXA 4QP7A 4FIJA 4W4YA 4EWHA 4BDKA 4L52A 4AFJA 3VUDA 4U8ZA 4QQTA 4BWKA 4ZS4A 3SA0A 4AGWA 3R7IA 3UO5A 2HZ0A 2V0DA 2Y7JA 4F0FA 4Y5HA 4JX7A 1M52A 2J7TA 2I40A 5KCVA 2UUEA 3TDVA 4OT5A 3R8UA 1YWRA 3A2CA 3VO3A 3QCYA 5L6WL 3FXXA 4L44A 3OUNB 3QWKA 4UXQA 3KQ7A 4BI1A 2OLCA 2W1HA 1JKSA 2QR8A 3IW8A 3QUPA 4IM0A 1FPUA 3LFSA 1KV1A 4KIOA 3VBVA 5FXRA 5LQFA 5LVNA 5CXHA 3IO7A 3CLYA 2UVYA 2WMAA 3R9OA 5JQ5A 5HG9A 4PQNA 2X6EA 5M53A 2XIZA 2BAKA 4FI1A 3FL4A 1QPCA 4FT0A 4EH7A 4QYHA 2Y6MA 2C68A 4OR5A 3CTHA 5CQUA 1H26A 3UJGA 2XYNA 3KXHA 4DGOA 4TWCA 4A9YA 3CC6A 3ALOA 3NUNA 3VF9A 5IU2A 3EYGA 1DAYA 4XG3A 1PHKA 5EI2A 1OIUA 3HP2A 3F6XA 4IWOA 4KS7A 5H8BA 1OKVA 3RPOA 3UVRA 4ERKA 3R22A 5HVKA 2HENA 3CCNA 2EXEA 3OMVA 3ODYX 3RPSA 3HMNA 2J6MA 3Q3BA 3AGLA 4GFGA 3G90X 4QPSA 4R7IA 4AW5A 4BTKA 4F64A 3NW6A 3V5WA 3F3TA 5D41A 3PVWA 5AP4A 5F94A 1JLUE 4FSUA 3BU3A 3I6UA 4DFUA 3KA0A 4DTKA 3KN6A 3DJ7A 4FV5A 5CYIA 3GCPA 1OL1A 2ZB1A 4A9RA 1W84A 1FVTA 2B54A 2ZM3A 3QTUA 3BELA 2XKCA 4JRVA 4LGGA 3A4OX 5E8WA 1HCKA 2ERKA 2VTIA 3K2LA 4RJ5A 3HP5A 3PA5A 4E1ZA 4RWKA 3GC0A 1GIIA 2UW4A 1Y8GA 3NUPA 5CT0A 5CXZA 3TG1A 4IACA 4FV3A 3UVPA 2OK1A 4GJ2A 1YDRE 3ETAA 4L3JA 4BGGA 4DG3E 2VTHA 5J95A 3ZFXA 2VTMA 2XRUA 4JT3A 5ACKA 3QQJA 2WOTA 4ASXA 4NW5A 4FVPA 3BEGA 4CRSA 3BLQA 4EH3A 4YZNA 4BTMA 2GTNA 4MTAA 2VWBA 4NT4A 5DI1A 3MFRA 4C34A 5FM3A 4D58A 4ZJJA 3NX8A 3VUIA 1PRYA 4D1SA 4CCBA 5EH0A 5HESA 1CKPA 3KC3A 5M4IA 4WG5A 3PJ2A 1ZXEA 5JQ8A 3C4FA 2BAJA 2FVDA 3KXMA 3ZXTA 1OL2A 4PP7A 3PRIA 4D4RA 5CAOA 1KWPA 4E6CA 5LCJA 1GZOA 4YTHA 3PVGA 4YJTA 4L46A 4BZOA 4J8NA 4R1VA 2C30A 2Y4IB 4ZY6A 1FGKA 2ITOA 4YU2A 1QPEA 4IEBA 2VTAA 4ACHA 4PDSA 4EH9A 3ACKA 4MHAA 3TKUA 2XNMA 3TM0A 5CSWA 2YERA 5GJDA 2RL5A 5L3AA 1OI9A 2ITUA 4TYHB 2BR1A 3DAKA 3DKFA 5EHYA 5L8KA 4HYUA 5TT7A 3R83A 4CQEA 3BYSA 1YHWA 2OGVA 2VWYA 4UBAA 3PTGA 3CPCA 2X1NA 4EC8A 2ITQA 4PUZA 5CU6A 3FLSA 4CG9A 2PMOX 3ZZEA 4BTFA 2A1AB 4IWPA 5E92A 2PU8A 4CCUA 1OECA 4D28A 3FMLA 4FKLA 5F4NA 4E4XA 3KY2A 5TOZA 3RAWA 5EOBA 4IX4A 4RFZA 2ZAZA 3FDNA 3F66A 2W1FA 2B1PA 4U42A 3SKCA 3QALE 4ARKA 4DFLA 5B7VA 2VN9A 4R3RA 5JFXA 3TDWA 4C61A 4CZYB 4GK2A 1W8CA 5DN3A 3QD3A 3U87A 3ZBXA 4CFXA 3VJNA 4MQ1A 4A9SA 3MDYA 4O7TA 2BFYA 4EH5A 3KCFA 5AUUA 4NIFB 3OG7A 3ZFYA 4GK4A 4EYJA 2UZTA 1Y8YA 4MK0A 4QMMA 4BF2A 2VWZA 3HMMA 4AE6A 3N51A 4AZSA 4PTGA 3L1SA 4MXXA 2ITNA 3C13A 3QA8A 1MRYA 4BKYA 3CR0A 3A7IA 3K54A 2GNJA 4FT7A 4U44A 1JQHA 2I0EA 4ZEGA 4UMQA 2QOHA 4YC6A 5CU0A 3L9PA 4HYSA 5HQ0A 5I3RA 1Q61A 3OOGA 4WIHA 3TIYA 1G8AA 5LCKA 3UPXA 3NNUA 4RJ8A 3HNGA 4IAKA 4R7BA 1SZMA 2J50A 3AMBA 4GVAA 2PUPA 2RFEA 2H8HA 3M1SA 4QMNA 4GS6A 3R01A 5C03A 4QNAA 3VRYA 1QPDA 4H1MA 4M0YA 2QKRA 5EYMA 4X0MA 3U6IA 1PY5A 3DPKA 4FGBA 5J79A 5CNOA 2R3JA 3KB7A 3DXPA 3W8QA 3KULA 4BKZA 2R3QA 2YA9A 3WBLA 4D4YA 5EI6A 4KIQA 2QNJA 1NVQA 2GU8A 3RAKA 5A6NA 4AZFA 2OIBA 3D7ZA 2RG6A 3R0TA 4OTFA 4TYJA 4FEWA 2X2MA 3UQCA 4O0SA 3HKOA 2C6OA 4DINA 5HG5A 4W4WA 2RSVA 4IH8A 2F7ZE 5FUTA 2JD5A 4OTRA 3BRBA 2WEIA 2ETRA 2IVUA 3COKA 4RA4A 5LVPA 2GNIA 2VWVA 2YAKA 4GT4A 2I0VA 4K6ZA 4J98A 3PIZA 3Q4UA 3MYGA 4I21A 3RWQA 3ITZA 4JR3A 2ITPA 2QO2A 3KMWA 5K5NA 4C4GA 4RVKA 2QONA 2X7GA 2QOOA 3PJ8A 2E9VA 3O8TA 3FWQA 4I20A 4USFA 1YHSA 4YZBA 4BKJA 4F6WA 3A7GA 3PP0A 4D2RA 4TWPA 3EN6A 4PV0A 3FPMA 4H05A 2PE1A 3VS0A 1OIQA 3QXOA 4FTRA 4FV0A 1NVSA 1GAGA 2C1AA 4EK5A 3TV7A 4CFMA 3PA3A 2HZ4A 5AV2A 3ZSIA 4NCTA 4DFYA 4IWDA 3WF7A 1PXIA 5KZIA 5GZ9A 4QMTA 3KF7A 3MJ1A 2PYWA 1IASA 1OIYA 2C0IA 3BYVA 1XKKA 4L67A 4RT7A 5HLNA 1XH5A 4K9YA 2UW8A 4TL0A 3S3IA 2F7XE 4DN5A 3W10A 4K1BA 1UNHA 2VNYA 3O0GA 4YZDA 3MN3A 4MBJA 3CQWA 5DOSA 3RBWA 3TZ9A 4M66A 5CSXA 1KSWA 4WNOA 3WIGA 3GCUA 3V5PA 4BYJA 5A9UA 2CNQA 3NZ0A 2OIQA 4BCHA 3QTRA 3H9FA 4WD5A 4FG8A 2AYPA 4FSYA 5D12A 3ORZA 2Z02A 4A4LA 5J7BA 4CFFA 5HD7A 3MJ2A 4I93A 2XYUA 4MCVA 4YHTA 2JIVA 5AM7A 3TL8A 4DLJA 3N9XA 5M08A 4HGEA 3ZRLA 3UQGA 1OKWA 2WD1A 2V5QA 1DI8A 4UZHA 3P7BA 4C58A 4DH1A 1AD5A 5HORA 4C4HA 4X6RA 2FSMX 4IJPA 4JBPA 1UVRA 4Y95A 3EQCA 1ZRZA 3M2WA 4FTNA 4TNBA 5HO6A 3PE2A 4BDHA 4CKIA 4XRLA 1OPLA 2WOUA 3G0EA 3Q04A 4NCTC 1O6YA 3RINA 5IQIA 3D9VA 4M0ZA 3HL7A 3QKKA 1FMKA 4ZSGA 4F9CA 4W4XA 1SMHA 1QL6A 3LCTA 5CT7A 4FNWA 2PPQA 4FEVA 3GC8A 5C8MA 3E63A 4NK9A 4H1JA 4PF4A 2Z8CA 2WMXA 3UMWA 3U51A 4AW1A 3VUKA 4YC8A 4F99A 1WBVA 2IVSA 3T8OA 3QD2B 4RFMA 2F2UA 1W7HA 4XP0A 3BGPA 4WKQA 2W4KA 2WMQA 4G17A 5KX8A 4D2PA 2JDSA 4EOOA 4UXLA 3QRJA 4FZAB 4JDHA 4I3ZA 2DUVA 5T3QA 4AAAA 3DGKA 4ALUA 2PVLA 1BI7A 3WYYA 5AAFA 3U6JA 4GG5A 4X3FC 4YGAA 3UGCA 3LJ0A 4C02A 5HX8A 3FLWA 3T9IA 3OZ6A 2E9OA 3QTSA 3BHYA 4K8AA 4ZK5A 5GJGA 1WVYA 4AGUA 5BYLA 4WSYA 1IG1A 3FZPA 4ZZOA 3R00A 1H1WA 3R7UA 1Q8UA 4JQ7A 2OU7A 3IKAA 2G9XA 4JJRA 3ORLA 4F0IA 1U54A 2HWOA 4G5PA 2B53A 4P5ZA 3U8WA 4EHGA 4FSNA 1PXKA 2XJ1A 3BEAA 3K3JA 4M84A 4LM5A 4AZWA 3TNIA 2ZVAA 4O7VA 3DK6A 3PPKA 3R1SA 4BI2A 4FIEA 4ITIA 4QTBA 1QMZA 1TQIA 2Z7RA 4DEDA 4U81A 2IG7A 3EZVA 4O83A 4HNIA 4Q9SA 4FTTA 4FR4A 5IA4A 3G2FA 4AG8A 1SVGA 2QOFA 4G6OA 2PY3A 4LI5A 5HBJA 2XKFA 4FKSA 2JAVA 3D7TA 2B9JA 3Q32A 3KCKA 4IB5A 4Y85A 5HCZA 5E90A 3TT0A 3E88A 5B0XA 4RX5A 1X8BA 3A7FA 2CSNA 2H96A 2O65A 2YABA 1ZMVA 4IBMA 4U45A 4HGSA 2XNBA 4MVFA 5DBXA 3TKHA 4O7WA 2O3PA 2ONLA 3GOPA 2JC6A 3S95A 1JOWB 4I6BA 5HEZA 2WQNA 3PPJA 4BCKA 5DR6A 1OITA 4O91A 3NW5A 2PVMA 3FV8A 4TYGA 1Q62A 4O7LA 3PIXA 3O23A 2NPQA 2XF0A 4V0GA 2XK3A 1XH7A 4Z55A 3BI6A 4NWMA 3ZRMA 5A6OA 3TACA 4Q5EA 2GFCA 2VU3A 3LM5A 4GEOA 4E26A 5B2MA 3C0HA 3DT1A 2JEDA 3G6HA 3KN5A 3F2RA 2HYYA 5DEWA 2YCQA 3QD0A 5HTCA 3TNPC 2VWUA 3EFKA 3NNWA 3G9LX 1LPUA 1YRPA 4O7NA 3CY3A 3QA0A 1PMEA 3VBYA 4DGLC 4JQEA 1Q4LA 1ERKA 2QI8A 2QCSA 2WMSA 5JGBA 3WILA 4I4FA 4BI0A 3WIKA 1JKTA 4M15A 4J52A 4BR3A 3MFSA 3V5TA 4N4SA 5KHXA 1OPJA 4RG0A 5E8TA 3L8SA 3MA6A 1JSUA 2HW7A 2OH0E 3C5UA 1BL6A 1PKGA 2ITVA 3OVVA 3QLGA 2JGZA 4GIHA 2PZRA 4KIPA 3REPA 4BCQA 3UODA 4K18A 4BICA 1UNGA 2C3IB 3PXFA 2W4OA 3RCDA 4D9TA 4AW2A 4BDGA 4XV1A 3SRVB 5AX9A 1UWJA 2QVSE 3LCDA 4RSSA 2JDOA 1UNLA 4U3ZA 5K0KA 3DDQA 3R9RA 2KULA 2YIRA 3R7OA 4FZFB 2QOQA 4XG7A 4I5PA 4CV8A 3GP0A 3P5KA 3CP9A 4IDTA 1F3MC 4O27B 3W2SA 4KKHA 1KE5A 1Y6BA 4EHEA 1TVOA 3G5DA 3LCOA 4YSMA 3SXFA 2PZIA 3ZUVA 3PLAE 3OWJA 4OTPA 4APCA 3EN5A 5H9BA 1GJOA 3F3VA 3QGWA 4XG6A 2OFVA 5G6VA 5BVKA 5CEMA 4ACMA 5C26A 4HZSA 4CQGA 4P4CA 3VBWA 4DFXE 5CSVA 4YNEA 3PDTA 4AA4A 4FICA 5IA5A 4U41A 2GPHA 3LJ2A 3RP9A 2PVHA 3HRBA 4K2RA 5CZHA 3V8SA 4ANQA 5IDPA 4QP8A 5E8UA 2CNUA 4FEUA 1KE7A 4EH2A 3R8MA 2BDJA 4QYEA 1OVEA 3QRTA 4V04A 4Y73A 5IEXA 3R7EA 3QYZA 2BTSA 4M7IA 4CFWA 2YWPA 1OZ1A 4XYFA 4OTIA 4AT4A 3DOGA 4K11A 2VTTA 4CTBA 3VUGA 5CQWA 4ENYA 2ZYBA 4QMUA 4WUNA 4BIBA 4A9UA 3SVVA 3GOKA 4XCUA 4KRCA 5AEPA 2HY81 2JKMA 5JZJA 2XK9A 3LFBA 1CDKA 2YLEA 3CPBA 2OWBA 4APPA 2R3GA 2NRUA 3BGQA 5D7VA 3OY3A 2YCSA 4EOMA 4FTUA 2PTKA 2FA2A 3EKKA 4ZJIA 4O0YA 5CAVA 4KA3A 2VO0A 3UG1A 4E4MA 3Q4TA 3LMHA 2X81A 1F5QA 4YLLA 4QP3A 3SW7A 3U4WA 2ACXA 5F1ZA 4X3JA 2V7AA 3V6RA 1W0XC 4FUYA 5FDXA 2VTNA 4X2GA 4I22A 2PVRA 4IVCA 3PSCA 4OTGA 5KMKA 3FC2A 5JMSA 3RPVA 3IDBA 5ETCA 4BCMA 5CASA 4YJNA 2YZLA 3H4JA 4DCAA 1Q5KA 2R3NA 2UZDA 3DBEA 3OXIA 1PXOA 5IQCA 4KSQA 4FKPA 4I6QA 4EOQA 2IW9A 3TEIA 4ZLZA 4EEVA 2UW6A 4EOKA 1GZNA 5K4JA 2XKDA 2J90A 3QL8A 3MVMA 1Z57A 4YTIA 1SNUA 1BX6A 2C6DA 3TI1A 1J7LA 2KTYA 2X4FA 4D2SA 4L43A 3W16A 5ANOA 1URWA 4EUTA 1NA7A 3NYVA 3UNKA 4C0TA 4CLJA 4QOXA 2BDFA 5BQ0A 4UWYA 3MB7A 5LWNA 4MX9A 5AMNA 4DFNA 4BY9E 4FKWA 3JYAA 4IWQA 5KMIA 4XG2A 3MPMA 4FV6A 5IQBA 4YR8A 4O0VA 3RPYA 4NL0A 2VTJA 5CVFA 3HAVA 3CBLA 1KOAA 3LFQA 1TQMA 2O2UA 5I5ZA 3OEFX 5FWKK 2WMBA 4YTCA 1M17A 4J7BA 4QTAA 3KU2A 4GU6A 4BCFA 3JXWA 4OTHA 5DIAA 1BYGA 2J0IA 3QZFA 4C4IA 3PUPA 4YPDA 4ZLYA 4PMSA 4BBMA 3DZQA 2IVVA 2UZBA 4C4FA 4R3CA 3MIYA 5K4IA 3QHRA 3NMUF 5L8LA 3PY3A 5FXSA 3W33A 3N4TA 5HG7A 2W5BA 2VTSA 5HKMA 3QBNA 3TJDA 4ENXA 4Q9ZA 4F9AA 5HCYA 3F88A 2GTMA 3DKCA 4MEDA 4GKIA 3V3VA 5CVGA 2RFNA 4WT6A 3AMYA 4EHZA 2BIYA 3AD5A 5EK7A 3BWJA 5DPVA 1Q24A 5LVLA 2Q0NA 2UW7A 4BC6A 4DBNA 3T9TA 4PTCA 5E8SA 4QTDA 4YP8A 3UOHA 5JRQA 2XBJA 4TYEA 5LMKA 4XNEA 2CHLA 5EM6A 2PWLA 5DR2A 3OXZA 1XH9A 4NW6A 5BPYA 2WQOA 4F1MA 5IISA 4OUCA 4KINA 4BVUA 3EQFA 2PUIA 2GNLA 4RIOA 2OIDA 4F7SA 5FEQA 4RPVA 3F7WA 3HAMA 4FZDB 3R30A 3F5XA 4XMOA 3ERKA 4D2TA 5KZ0A 4CFNA 3HRCA 4RX7A 4JBVA 4KUJA 4F4PA 3FPQA 3NUUA 5AUTA 3MPAA 1XO2B 4XP2A 2REIA 2WTVA 2AUHA 2CCIA 3ZO3A 2GMXA 3P7AA 3QQGA 4FTJA 1O6LA 4OLIA 4CD0A 4TY1A 3KKVA 3HX4A 3S00A 2F49A 2OXDA 3RMFA 4O38A 1P5EA 4LOQA 4CZUA 2CKQA 1A06A 3ET7A 3CD8A 3DQWA 5HG8A 5EM8A 3ORPA 4YHJA 1FINA 2ITXA 3DFCB 3H30A 3BYMA 3ENHA 2BDWA 2WU7A 2W99B 2J5EA 4U0IA 5TO8A 2WAJA 5TF9A 4RWLA 5LMKC 4UY9A 1QPJA 1ZYLA 5HNIX 2Z7LA 3ANQA 3ZXZA 3FSKA 2WKMA 4ALVA 4C38A 2H34A 2J0MB 5TKDA 4J99A 1BI8A 2BFXA 3BLHA 4DGGA 3BU6A 3V5LA 4DHFA 3POZA 4L42A 2ZV9A 4GSBA 1BL7A 4H58A 4R3PA 5DWRA 4BZDA 4DITA 4RJ6A 4UMPA 3O71A 3FYJX 5AV1A 3PSBA 3MIAA 4ZMFA 3VULA 4CEGA 4QP1A 2PVFA 4XG4A 3EZRA 3ZLSA 1SYKA 3FSFA 5C27A 3IECA 4BDDA 4BFMA 4CNHA 1J1BA 4MF0A 1UU9A 3GUBA 3QFVA 4ZTSA 3U54A 2X7OA 3VS6A 5JSMA 2ZMCA 3S1HA 4ANLA 3FI4A 3RK7A 3LZBA 5HLPA 3F5GA 4GT3A 4PX6A 1Q8TA 3BCEA 2JAMA 4PL4A 4NEUA 4Y8DA 5AR7A 4H36A 4O1PA 4F70A 3DB8A 3LJ1A 2ZB0A 1GIJA 3A8WA 4IVBA 5IUHA 3G0FA 4ZMEA 4C33A 4RRVA 2OKRA 3GU6A 2BMCA 1PYEA 3MI9A 1JBPE 1Q3DA 3LLTA 5BVWA 4I0SA 3P7CA 4MXZA 3JVSA 3LM0A 4UMTA 4ANOA 4E5BA 1H01A 5FTOA 3HVCA 3F69A 4XX9A 4R77A 1J7UA 2JBOA 1H28A 3P4KA 4GYGA 3QCSA 2QLUA 4I5HA 4DAWA 4FNZA 2J5FA 2WNTA 4F9YA 5IA1A 4FKTA 4FMQA 2PK9A 3QTWA 3KULB 1CSNA 4LOPA 2W7XA 3NYNA 4GCJA 3ORMA 3IK3A 3Q96A 3ACJA 3C0GA 5AR8A 4AZVA 5I9XA 4JR7A 4OBOA 4YBJA 3HUCA 5IQHA 1OKYA 1ZOHA 3PG3A 3BV3A 4FYNA 5E8ZA 4F9BA 4C37A 4DF3A 3FMMA 4IAAA 5CEIA 3QD4A 4TT7A 4PPCA 4M67A 3LXKA 4YO6A 4E5WA 4LRKA 2VX3A 4I5CA 4O21A 4PDPA 3QQUA 4GIIA 4CSVA 3Q6WA 3C50A 1I44A 3EIDA 5E91A 3CS9A 3KRLA 3C5IA 3DAEA 4FK3A 2H9VA 3RK5A 3FZRA 4JAIA 5TE0A 5FRIA 4EJNA 5M4FA 3LE6A 3SG8A 3HV5A 3WF8A 5LMBA 4TWOA 3VJOA 2X39A 3A60A 3QQHA 4PNIA 4HGTA 3K5UA 4DTBA 4OBQA 4IAFA 4O2PA 3NVKI 2WTWA 1YQJA 4FEQA 4DC2A 3NCZA 2CGXA 3MH0A 3E8NA 3Q5ZA 3MPTA 4B99A 4EI4A 1H25A 2YWVA 3SXRA 4FIGA 5M06A 3AC5A 3FMKA 2R7IA 3R8PA 4JS8A 2P3GX 4XLIA 3NLBA 4DFBA 5GINE 4ZTHA 2Y0AA 4LL0A 2UW3A 4QMYA 3EH9A 3IG7A 4FL1A 5IEVA 2R3MA 2BVAA 2C6LA 1M2QA 2QODA 3BWFA 1B38A 2RFDA 2VO6A 3MVJA 2AC5A 4IB1A 4IAYA 3ZOSA 4BB4A 4RFYA 1VEBA 2WQEA 4XLVA 3TV6A 4DH3A 2CN5A 2R5TA 2XJ0A 5IQDA 4E8AA 2OO8X 2ZV8A 2QOKA 3ROYA 2VAGA 3TZMA 2ZMDA 4FF8A 3P86A 3AT2A 4QMVA 2E9UA 3BU5A 1H8FA 4E6AA 2R2PA 1JAMA 4ZZNA 1MP8A 3EN7A 3R8VA 1UU7A 5I9VA 4RIWB 3WZDA 3Q60A 5EYCA 2C3LA 4EBVA 4XEYA 4DT8A 3ULIA 4BN1A 5M57A 4JDIA 2G01A 1CKJA 3IQ7A 4QPAA 4FIIA 4C59A 2YLFA 3QAME 4WUAA 5HU9A 3QC9A 2FSOX 2YJSA 4IE9A 3ZLXA 1SVEA 3HMIA 4IQ6A 3FZSA 3OT8A 4JDJA 4Z7HA 5J9LA 3ANRA 5DH3A 3FEGA 3QCQA 4O7SA 4USDA 4XJ0A 4AACA 4QQ5A 5I9UA 3CTQA 4BRXA 2VX0A 3ZDIA 2DS1A 2JFMA 4IM2A 4RQVA 2C6IA 2J0LA 3HGKA 3WOWA 1YXUA 3T3VA 2BKKA 4WHZA 1ZLTA 4UEUA 4O0RA 1L3RE 4KBCA 1OGUA 4PMMA 5B2KA 5EQYA 5M56A 4H3PA 2YM7A 4QNYA 4X2FA 3WZJA 4BWPA 4WRGA 2JIIA 4D5HA 3OW4A 5AX3A 1ZOGA 4TPTA 4J95A 4Z3VA 2UZVA 2Z7QA 4MNFA 3KRJA 2ITWA 2PZYA 1M2PA 3TZ7A 3OCTA 3W55A 3LFCA 4QYGA 2BRMA 3DTCA 1VYZA 3UZTA 3F61A 3F5UA 3GB2A 3FAAA 5EOLA 4AQCA 1G5SA 5EW9A 1FVRA 4RVTA 5A46A 2ZV2A 4RLLA 4RX9A 3QKMA 5J9YA 1PXMA 4M97A 3OBGA 3ZO1A 1M2RA 2PVNA 2WMUA 4FTIA 5KMMA 4XBUA 1R78A 5CU3A 2BILB 2R3HA 4P2KA 4QMWA 3C4ZA 4FV1A 1LP4A 2W1ZA 1H1RA 3PFQA 4RC3A 5LWMA 4MNEA 4HZRA 4NUSA 3VQHA 3W18A 2BRNA 1PXLA 2XZSA 3BBTB 3FI3A 3KMUA 4FNYA 4PL5A 3UIXA 3UOKA 3ZTXA 5K9IA 2I7QA 1XH6A 4L7SA 3NIEA 4XH6A 2GCDA 1SNXA 1U54B 4KNBA 3PP1A 5ANEA 3G33A 4FKQA 4YJVA 2ZDTA 4K77A 2VNWA 5E7RA 3OOMA 4PRJA 4BL1A 5AV4A 2UZLA 2JDVA 2JIUA 1JSVA 3AC4A 3AC8A 3MGYA 4YZ9A 3FXZA 3ZCLA 4F7LA 4XG8A 3RALA 3LXPA 4BDFA 1EH4A 2BIKB 2PMIA 5DMZA 1NT2A 2F4JA 1ZWSA 3OTUA 5DEYA 5LARA 4AF3A 1H4LA 4G3EA 4CGAA 3OTVA 4M69A 2JKKA 3QQLA 1ATPE 3QF9A 4OT6A 4BDCA 3W2OA 3GT8A 3R7GA 4M3QA 2CLQA 5T68A 4OTDA 3C9WA 3D7TB 3C7QA 4MBIA 1TQPA 4Q2AA 1IR3A 3MY5A 4N6ZA 2PULA 1H27A 3WZKA 4HCVA 3ZO2A 5KMJA 1WBOA 4FT3A 4FL3A 5I9WA 5IMXA 2JFLA 4PPAA 4OAVB 2QC6A 2CMWA 3NYOA 5K3YA 4D1XA 4G3GA 4TN6A 4QMZA 4FT9A 4JBOA 5E8XA 5D10A 5J1WA 4DTAA 3U6HA 2R9SA 4LV5A 3FI8A 3CXWA 2C1BA 3S2PA 4FKJA 2UZUE 4CMUA 3U9NA 5CAUA 5EKOA 2O5KA 3BZ3A 1GZKA 3CE3A 3MB6A 4QD6A 2GS7A 3ZSGA 4F9WA 3O50A 5IH6A 4V0GB 2OXYA 2WGJA 1M7QA 5ANDA 1YW2A 3BYOA 2VGOA 4V01A 5BMMA 4C4EA 4AGCA 2DQ7X 4RIWA 1XBBA 5KUPA 1URCA 3AC2A 2IZTA 4X3FA 3V5QA 1R39A 2VO7A 3LMGA 2HWPA 2HZNA 2QLQA 3L8XA 4G9CA 1H0WA 4N70A 3RKBA 3LFEA 5C9CA 1Z5MA 3GI3A 2I0YA 4WG4A 2J4ZA 1U5QA 2GHMA 2IW6A 5I9YA 3VF8A 2PZ5A 3RWPA 4TXCA 3DK3A 3EHAA 1WMKA 3JY9A 4ZLOA 4FE2A 4IVAA 4EQCA 2BZJA 2G2HA 5AAEA 3O51A 3RK9A 3FQSA 1XH8A 4QMSA 1RJBA 2B9FA 2X9EA 3F7ZA 2CGWA 4J97A 4JXFA 3GFWA 3VS3A 4QMPA 4HYHA 2VWWA 3EQBA 4QMQA 3BV2A 1H1SA 4XS2A 5IMEA 3UMXA 3OT3A 3FZ1A 5AJQA 3H10A 5CS6A 4J71A 3GC9A 1YOJA 3CEKA 3FKLA 3HZTA 2YN8A 2YM6A 2A0CX 2O0UA 4LQMA 1YXVA 4HVIA 4EUUA 5BMSA 3FMEA 4A4OA 1Q3WA 1AGWA 5CSHA 4IZYA 3ZLYA 1SM2A 1PXNA 2X8IA 2Y4IC 4RIYA 3A61A 5FP6A 3TXOA 3EMGA 3VS2A 3UNJA 3COMA 4OW8A 2YCRA 4X2JA 5IZFA 2VUWA 3E87A 4ID7A 5DE2A 2YM8A 5HE1A 3RM6A 1JNKA 3QYWA 1JKLA 3D5VA 1H00A 2C0TA 3CSVA 1WCCA 5IPJA 5AV3A 4Q5HA 3I5ZA 3MY0A 3ATSA 3MH3A 3A7HA 3NUYA 4PTEA 5EW3A 4GYIA 2J0KA 4E6QA 1E9HA 3VUHA 3BHTA 4DYMA 3DJ5A 3MESA 2PVJA 1U46A 2B9HA 1O9UA 4H3QA 3TKIA 3BKBA 3ZBFA 2NRYA 5A4CA 4BDIA 5CY3A 3RCJA 1AQ1A 4GFMA 5L2IA 4KS8A 2BALA 3AD4A 3P79A 1M14A 4HW7A 3FLQA 3D5WA 4CYIA 3D2IA 5CF8A 4RWIA 3F2NA 4WNPA 3C4CA 1K2PA 2RGPA 2BRGA 3AOXA 5JFSA 1JPAA 4LGDA 4WBBB 3O2MA 1J3HA 3COIA 4FUXA 4A7CA 2CKOA 2WTCA 2ZM4A 5IUIA 3FE3A 3PRFA 3PXQA 2R3LA 4U43A 2NO3A 4ZAUA 1ZYCA 2QO9A 3KGAA 4EC9A 2C47A 4YUQA 3KREA 4FIHA 2C4GA 3PXYA 4W4VA 3CQUA 4CMOA 5I9ZA 5AP1A 3VC4A 1OBGA 4OAUC 3DY7A 3D4QA 5IKWA 1OMWA 5AM6A 4DEAA 2FO0A 3ZS5A 5HVJA 4F08A 4DGNA 3DKGA 4EH6A 2PL0A 4EK3A 1PXPA 3P08A 3FY0A 4I94A 4EKKA 3IOKA 3GBZA 4RQKA 3AC1A 4Y72A 2XP2A 2C5NA 5HI2A 4NM3A 4II5A 3GCVA 4KWPA 2PE0A 3E3PA 2OZOA 1NW1A 2HK5A 3IDCA 1OB3A 2W96B 4QYYA 3R71A 3I6WA 3TUCA 4UWCA 1YOLA 2WMVA 5AUYA 3ZH8A 1KE6A 1WFCA 1STCE 3CJGA 4FKUA 3SQQA 4KB8A 5AR3A 4L00A 3O7LB 5ANKA 4FTOA 3TTIA 3C0IA 5E9EA 4RJ7A 4DEBA 3OBJA 4K0YA 3OFMA 2HELA 4ITHA 5GZAA 1Q97A 3L9LA 1R0EA 2CJMA 1KUTA 1H1QA 4NU1A 3GU8A 5CI7A 2BPMA 4YLKA 5DNRA 4YBKA 3Q9WA 2W1IA 1W82A 2I6LA 4ZSEA 4BDBA 3QX4A 3FI2A 3TNHA 3JS2A 2E9PA 3HUBA 4X21A 3TUDA 3Q9YA 3WZEA 3E7VA 3FQEA 3LFFA 3O96A 4FVRA 3D2KA 4BGQA 4E3CA 2V7OA 2Y6OA 5I0BA 2GQRA 1XR1A 3R04A 2BUJA 2YIWA 3FZOA 5CEPA 4GJ3A 4GW8A 1ZMUA 2FB8A 4E5AX 4C2VA 2IZRA 5CF6A 5AP6A 4NJDA 4NTTA 4XOZA 1PMNA 1RQQA 1H0VA 3HRFA 3BE9A 2HAKA 5ACBC 4O2ZA 3RNYA 4QTEA 4RBLA 3FJQE 3KRXA 4ZOGA 5LJJA 2EXCX 3FHIA 3QTQA 2A4LA 2XJ2A 3E8DA 5T6KA 3LOKA 4K33A 2WMWA 5CNNA 1IEPA 1VZOA 3HDMA 4LOOA 3D0EA 2WB8A 3KXGA 3QRKA 4CZTA 3OY1A 2GDOA 2A2AA 2R3PA 3DCVA 4HPTE 2UW9A 4I23A 4BDAA 1R1WA 4FSWA 4AN2A 2VWIA 4MXYA 4CT2A 5TR6A 5DT0A 5ICPA 3QX2A 3OD6X 2W9ZB 1VYWA 2R3OA 5CU2A 3Q5IA 5HO8A 3E3BX 4MAOA 1T46A 1YVJA 1V0PA 3I60A 4O86A 2WZJA 3U55A 3LVPA 4QPMA 5L6PA 3WF9A 3QRUA 2XRWA 1V0OA 3DLSA 4IFCA 1UKHA 3EQPA 3VBXA 5FTGA 4FTMA 4EONA 4F65A 3II5A 4BHZA 3I1AA 3GEQA 3TV4A 4FOCA 5CEKA 3FMJA 4ZZMA 4DEEA 1FQ1B 3PYYA 3W32A 4HYIA 4BCOA 1YWNA 5J7HA 3HECA 3KRRA 1RDQE 2UZWE 2I0HA 3ZDUA 3Q2JA 3TNWA 2HZIA 2WELA 4HJOA 4S30A 5EI8A 2JDRA 2XNPA 5JRSA 3IDPA 3SOAA 3A62A 1LEZA 2VTRA 5HBEA 4GFOA 3V6SA 1OBDA 4RC4A 2F57A 2FUMA 4ZP5A 5EYDA 3RPRA 2E9NA 3N4UA 4WG3A 3VIDA 3AD6A 3OCSA 3ZONA 4DCEA 3GNIB 4TKSA 5C8NA 3EFLA 3L8PA 4ZTRA 5IH4A 1KE9A 3BPRA 2W05A 3GQIA 1Y91A 3NNVA 5AA8A 2XB7A 4BCPA 2H6DA 4O0XA 3WARA 3OCBA 3ORIA 4C3RA 5KMNA 2XK8A 2YHVA 3VQUA 4G31A 2RFSA 4EYMA 4EORA 4F7NA 5EHOA 2WU6A 4FTCA 3R1YA 4HVGA 3CY2A 4FKRA 4YJRA 2WPAA 1OPKA 5BNJA 2VD5A 4DEHA 2CDZA 4ACCA 2B52A 4MH7A 1BLXA 3JUHA 4L6QA 3QWJA 4FBXA 4UYNA 2IN6A 3WF6A 3FZTA 4EOIA 4ZJVA 2B7AA 2QG5A 4UWBA 5EG3A 5EM5A 3R9NA 4BZNA 3TUBA 4ORKA 2WMRA 3JY0A 3QC4A 4G34A 4Y83A 3OWKA 4ONAA 5HO7A 5KMLA 2R3RA 3E62A 1ZY4A 4H3BA 4NFNA 3UYTA 3PPZA 4GUEA 3F2AA 4G9RA 4U3YA 3BBWA 3MW1A 4EOPA 3RI1A 5CI6A 4NM5A 4DH5A 1BKXA 2X8EA 2YACA 4G3CA 2R3KA 2YDJA 4AX8A 4C4JA 5BYZA 3NPCA 5HNBA 3I4BA 4PY1A 3NS9A 3QUDA 3ZZWA 4C2WA 3ZUUA 3BX5A 3W2RA 4D0XA 4EH8A 4EOJA 2NNWB 4KAOA 5C4LA 3PWDA 1Q8YA 2IW8A 2R0UA 3HYHA 4U7ZA 2O64A 3IGOA 1IA8A 5FTQA 3IW6A 5KHWA 4U5JA 4IC7A 3Q4ZA 3GVUA 2W1DA 5HBHA 3EFJA 5EDPA 5IH5A 4TTHB 5CEQA 2ZM1A 4KKEA 4L68A 4L9IA 4FA2A 4GK3A 3QTZA 1K9AA 3EL8A 5JH6A 3GCQA 3CD3A 2IJMA 2YM5A 2ITZA 3F3UA 3FQHA 3OW3A 1LR4A 1ZMWA 4A9TA 3KFAA 5KMOA 2VRXA 1FMOE 4JG8A 2BHHA 2HIWA 3DBFA 3OUKA 4B7TA 3TZ8A 3LPBA 3EL7A 3PY1A 5F20A 4IAIA 4AWIA 3FL5A 4R6VA 2QR7A 4XUFA 3Q9ZA 3ZRKA 4CFUA 3KVXA 5M44A 1U5RA 5AIKA 5FLFA 1OL6A 3ZSHA 2UVZA 1ND4A 3NAXA 2Z60A 1B6CB 3JPVA 4BYIA 2Y4PA 4IZAA 1MRUA 3K5VA 3VVHA 1YXTA 3G15A 5AUXA 5DFPA 4WNMA 5C4KA 3R1QA 5G1XA 5E4HA 2YEXA 4WNKA 4GVJA 1YHVA 4N57A 2X4ZA 3Q53A 4MKCA 5DRDA 3ZM4A 5IQAA 2WXVA 4HOKA 4AS0A 4W8EA 4EZ5A 3DNEA 4F7JA 4HVSA 3RTPA 3KF4A 5AR2A 2XIYA 4UV0A 1GNGA 2PE2A 2B4SB
chains in the Genus database with same CATH superfamily
4J96A 4QMLA 3U9CA 2BRHA 3LQ3A 1K3AA 3EQIA 3LQ5A 4ACDA 5IA2A 3F82A 5BX0A 3FLNC 2SRCA 2XKEA 4CMTA 5LXMA 4FG7A 4KBKA 1NVRA 4FC0A 3U4UA 5CLPA 1YDSE 2PSQA 5DYJA 5BYYA 4NYEA 3GU5A 4W8DA 3P0MA 1ZOEA 5IDNA 4FTQA 3BHVA 1E1VA 1REKA 2G2IA 3H9RA 3B2WA 1YDTE 4M8TA 2DYLA 3E92A 4LRJA 1UV5A 4DGMA 4ZSLA 4U9AA 3QHWA 4YZCA 3EQDA 3PJ3A 4QMXA 2HOGA 5HD4A 2UW5A 5I4NA 5ANJA 1FBNA 3VUMA 5CEOA 4RMZA 4I92A 2ITYA 1V0BA 2EB3A 3WI6A 3AG9A 3VONA 4O0TA 1OKZA 5FGKA 2LAVA 2C5XA 2CPKE 1U59A 4I1ZA 4JG7A 1XBCA 3ZEWA 2C6MA 4EBWA 5A4LA 3THBA 3JR1A 3HMPA 4FX3A 5M51A 1CTPE 3UP7A 3DBCA 1Q41A 2VV9A 3E8CA 5EW8A 4DA5A 4DT9A 3I7BA 3NUAA 4UZDA 1I09A 3GXLA 2J9MA 3BHHA 4IC8A 2JKQA 5D9HA 4ZY4A 3EFWA 5IA3A 5ETIA 4GV1A 1B39A 4YTFA 3POOA 1V1KA 3ZYAA 4M68A 2OJJA 2ZOQA 3DBQA 4QP2A 5JGDA 4FODA 4RJ4A 2OXXA 3RHKA 3AXWA 4BCGA 5CAPA 2G1TA 3DV3A 4FV4A 4O0WA 5JZNA 4BBEA 2B9IA 4W9WA 4EHVA 3L9NA 2GS6A 4RVMA 2EUFB 3UYSA 2GS2A 2CN8A 2WTKC 4X7QA 4AZEA 3WYXA 3W0MA 3UBDA 2J0JA 3FXWA 1Q8WA 2P0CA 3D83A 3PXRA 4FT5A 4LRMA 4RWJA 4XHKB 4AGDA 5IQGA 4ZTQA 4D0WA 3C1XA 4MUQA 4IX6A 3DZOA 5CZIA 4IIRA 2HCKA 1LEWA 4IZ5A 2R64A 3QUEA 2GSFA 3C4XA 3E8EA 1XBAA 5EFQA 4R1YA 3FLYA 3IS5A 1WAKA 1GY3A 4NKSA 3OWLA 4EQUA 3TWJA 2P2IA 3S0OA 3H0ZA 3SX9A 2OZAA 4RC2A 3G51A 5AV0A 1P4FA 3NDMA 3ZEPA 3KXXA 2X8DA 4GU9A 3EOCA 4FG9A 3AGMA 3AMAA 2QD9A 4HGLA 4I41A 2XCKA 2XAOA 4RZVA 3G9NA 1H07A 5GNKA 1SVHA 4MNEB 3UQFA 4QRCA 2YIXA 3HMOA 4IAZA 4G1WA 1FVVA 2NP8A 3TN8A 5HLWA 2XEYA 4P90A 5CU4A 4AFEA 5AADA 3NRMA 2VTLA 2WTIA 1ST0A 2BRBA 3QKLA 4EZ3A 1J7IA 4O7ZA 5ANGA 3A4PA 5JFVA 3BQRA 5HE3A 3ZUTA 2OJGA 3QZGA 3B2TA 4F6UA 4RX8A 4ZTMA 4LV8A 2RG5A 4JX3A 4R7HA 2OSCA 3FMHA 5AUWA 3R2BA 4W9XA 4R8QA 3GFEA 5FXQA 4B8LA 2W0JA 3DAJA 3BGZA 4TRLA 3RNIA 3Q4CA 3UC4A 5J5SA 2WIPA 3VW6A 4UX9A 2QU5A 1G8SA 3VS5A 4M69B 4IMYA 4JOAA 5BVDA 2C3JA 2V22A 3EQGA 4JRNA 3ULZA 4LMUA 4FGRA 4DDGA 2FYSA 4LL5A 4Y5QA 1WBNA 3I7CA 4HCTA 4RJ3A 3MBLA 1VR2A 4FEXA 3BHUA 4M14A 3KEXA 3QQFA 3ORXA 3ZC6A 4XRJA 5BVEA 4WBOA 3SC1A 2PZPA 4E20A 4RIXA 4AOJA 4EL9A 5LVMA 1YXSA 4G2FA 2ZJWA 1UU3A 2HY0A 2PUUA 1CMKE 2XVDA 3ALNA 4O96A 4KD1A 4X2NA 3ORTA 2OJFE 4QEBA 1PYXA 5K5XA 4ANMA 5L2SA 3ZC5A 5J9ZA 4O1OA 4ASZA 4YJQA 1QCFA 1MQ4A 2WTJA 2VWXA 4BCIA 3ZO4A 3MA3A 4B6LA 3PVBA 4I4EA 4UALA 3T3UA 4C57A 4CT1A 2Y9QA 5GIOE 2OJ9A 1J1CA 1MQBA 2F2CB 4YSJA 5F9EA 2RKUA 3R8LA 2VZ6A 3RAHA 4FIFA 5FEEA 2WIHA 2G15A 2VO3A 3E93A 4FOBA 4E6DA 4AT5A 3EQRA 1ZZ2A 3VWAA 2P55A 2X0QA 4AXAA 5KKRC 2OF2A 4FV8A 4X3FB 1YKRA 4EJ7A 3DKOA 4YPSA 4FV9A 3SHEA 3HA8A 2QQ7A 2WQBA 2VTPA 3FY2A 4B8MA 4C3FA 5IG1A 2O8YA 3QRIA 3I0OA 3VUTA 2ZDUA 3CTJA 3PZEA 1PF8A 3RM7A 5GHVA 4PWNA 5ETFA 5FD2A 5ETAA 4PDYA 4E4NA 1H24A 4D2VA 4ASDA 2R0IA 3RZBA 2OFUA 2C69A 3V8TA 4F09A 5BUJA 3R8ZA 1LUFA 5HE0A 2QHNA 4C36A 4Z9LA 5CF4A 2Y8OA 4CXAA 1W83A 3NNXA 3PXKA 4N6YA 4RA5A 2RIOA 3KRWA 4JIAA 2R7BA 3OEZA 5AWMA 3KXNA 3C51A 3P9JA 4CLIA 1XH4A 3F3WA 2W1CA 3F9NA 3KVWA 5B2LA 4WOVA 4JMQA 5LVOA 4S33A 4R5YA 2JKOA 4B9DA 4AA5A 4LGHA 2W06A 4I0RA 3EKNA 3KL8A 3TNQB 3UNZA 4IB0A 4TWNA 4JAJA 1XHAA 4RIYB 3O8PA 4G3DA 4ANSA 4B0GA 4FJVA 5JK3A 3W8LA 3DK7A 3NWWA 1DAWA 3E5AA 1WBPA 1O6KA 2QOLA 4GH2A 4GG7A 3GU4A 3W2CA 3ZU7A 3DLZA 3RVGA 4JIKA 4BCJA 3UE4A 2E2BA 5BUEA 3ZMMA 3UVQA 5IEYA 2QOIA 2JDTA 3AKLA 4C3PA 4ZTNA 5JKGA 2J2IB 3MTFA 2C0OA 4QP4A 5DGZA 4E7WA 3OXTA 3RJCA 3HA6A 1UWHA 3PVUA 4CKJA 2UZEA 3QXPA 2XMYA 5HOAA 1DS5A 2BZKB 2WMTA 3VW8A 3R02A 4OGRA 4ACGA 1YI6A 2P2HA 2QOCA 4BIDA 3ORKA 5GZ8A 4Y46A 2A19B 4BWXA 4TW9A 5BVFA 5DRBA 2BZIB 3SV0A 1UA2A 2EVAA 2UVXA 2XK4A 4G6LA 4J1RA 3CKXA 2R4BA 4J53A 1CM8A 4O22A 1VJYA 4QT1A 4D5KA 3PWYA 4TYIA 4RVLA 5CWZA 5FEDA 4R78A 5AA9A 2GNGA 3ODZX 1PKDA 4IX3A 3D94A 3QLFA 2XM8A 3QQKA 3BLRA 4MD7E 4YJUA 4O7YA 5HX6A 5DT4A 3VS7A 4MQ2A 5HU3A 4JDKA 4IADA 4X2KA 3UZPA 3ORNA 3HLLA 3IONA 4U6RA 3NR9A 4IZ7A 1R0PA 3NSZA 2VX1A 4ANNA 1KV2A 3HV7A 2YM3A 1ZZLA 1YWVA 3GGFA 5FQDC 4ZSJA 1APME 1L8TA 2CGUA 4EK4A 4P5QA 5DLSA 3E7OA 5KO1A 3IOPA 4FKIA 3Q9XA 2G2FA 4FSTA 4MD9E 5L2TA 4MXCA 1UKIA 4NTSA 3R7VA 3P23A 4PMPA 5IQEA 4QMOA 3SLSA 5KBQA 4ERWA 4QQCA 3SW4A 4S32A 3UIUA 4D4SA 4YC3A 3H0YA 5F95A 4EQMA 3KMMA 3NW7A 4BJJB 3R6XA 4I5MA 4M12A 4FKGA 2OF4A 3A8XA 4FK6A 3SD0A 4O81A 2GHGA 2VTOA 1YOMA 4FSZA 4NFMA 4QTCA 2UZOA 4S31A 1Z9XA 2IZUA 2RF9A 3GCSA 3H3CA 3H9OA 4IM3A 4TYHA 1OL5A 5IUGA 4YJPA 2QURA 5LOHA 5CTPA 5DA3A 3RAIA 5IA0A 4BGHA 1NY3A 2X2KA 5EM7A 4O84A 1H1PA 4DH7A 3E64A 5AP5A 4DH8A 4UMUA 2W1EA 5JGAA 2XA4A 3DXQA 4QQJA 3PA4A 4G5JA 4OTQA 5ANIA 3TTJA 3VS4A 2CKEA 2IEWA 5L2WA 1A9UA 4PMTA 3DDPA 5HTBA 4GKHA 3LXLA 1PMUA 4RLKA 5A3XA 5HE2A 2BHEA 2OI4X 1ZAOA 4E4LA 3FMNA 4MYGA 4ZSAA 5JFWA 3K3IA 2WEVA 3IGGA 5AP7A 3BL9A 4DBXA 4KKGA 2W5HA 4LG4A 4NIFA 3MV5A 4WA9A 3MTLA 4ZIMA 5FP5A 4XOYA 4U97A 2OH4A 3NEWA 1W98A 5A4EA 4FSQA 3UPZA 3LCKA 3VN9A 2W1GA 3C4WA 3I0QA 4YMJA 4AN3A 4YJSA 4AUAA 2ERZE 2Q0BA 5CF5A 2XIKA 3BIZA 3VAPA 4FSRA 5D7AA 3HEGA 4QP9A 1P2AA 1WZYA 2C6EA 5DR9A 4CKRA 4L01A 2R3IA 2XNEA 3BYUA 4BDEA 2BTRA 4O82A 4L7FA 4A06A 2YIYA 1E1XA 2UV2A 2W4JA 4IHPA 3VNTA 1CKIA 3HV3A 2JLDA 4JL9A 2YISA 1OM1A 1S9JA 1KE8A 2YCFA 3JVRA 1H08A 3LHJA 4AN9A 5AFVA 2V62A 2YM4A 3B8QA 3UIBA 4FTAA 4JI9A 3DA6A 1IRKA 4A4XA 2V55A 4UB7A 1TKIA 4AXEA 1HCLA 4GRBA 4U80A 1DM2A 3LIJA 4OTWA 3A7JA 5DG5A 2ZFYA 4NM7A 2OICA 2X0PA 4RGJA 3AC3A 4OBPA 1UU8A 5FBNC 3RGFA 2UZNA 3HDNA 4FNXA 3PE1A 4QO9A 4PNKA 3R9HA 1Q99A 4CVAA 2C5VA 4JVGA 3LW0A 3ZHPC 1WBSA 5A4TA 4GT5A 4WSQA 3W0QA 2X2LA 2OJIA 5E8VA 3AT3A 4GL9A 5A14A 2YDIA 2YDKA 2ETMA 3MH1A 4J8MA 3OP5A 5M4CA 5IF1A 3B8RA 4JQ8A 3NCGA 4ITJA 4LYNA 2QOBA 3LQ8A 4HPUE 3NVMB 3TCPA 4AU8A 1WVXA 3DU8A 3UO6A 2WHBA 1OIRA 2B55A 4PDOA 3IW7A 5M09A 2GNFA 4FTLA 2EWAA 2YJRA 4EK8A 3DNDA 4U79A 3GENA 2FSTX 4YJOA 4G3FA 5AR5A 4BHNA 2YZAA 5DT3A 5J87A 3HV4A 2XS0A 5AP0A 4C7TA 4FTKA 4DG2E 2F9GA 4O7RA 1PJKA 3LXNA 3PXZA 3QZHA 4G16A 3PIYA 2WQMA 5A4QA 5L2QA 1RW8A 3EWHA 4LUDA 4TZRA 1WBWA 4EKLA 5J8IA 2BROA 2O63A 2VGPA 5M55A 2QO7A 3DBDA 5J1VA 2WFYA 4QYFA 4X6QC 4AOTA 3EYHA 3W1FA 4KIKB 4EK6A 3Q2MA 4CYJA 3O7LD 1G3NA 2XNNA 4Z7GA 2QG7A 3FMDA 3QZIA 2XBAA 3UO4A 5CANA 4I6LA 3R63A 4XG9A 5E8YA 5KE0A 4D4VA 3KK8A 4ANBA 5EDRA 2W9FB 4XBRA 2Z7SA 4XV2A 4GUBA 4MWIA 3MS9A 3PG1A 4NSTA 2PUNA 3Q6UA 5CAQA 4YHFA 5HIDA 2PMNX 5FDPA 3AQVA 3IW5A 2PMLX 5BV3A 3V8WA 2PVYA 3V01A 5K0XA 3DB6A 1OL7A 3CIKA 3FYKX 3MY1A 5EDQA 4FVQA 4ALWA 3SGCA 4FZ7A 5HIBA 5C8KA 5L8JA 4IW0A 4DE4A 3SAYA 5DVRA 4N0SA 4NM0A 3CGOA 3QCXA 3V5JA 4DHIB 5AUZA 5AAGA 3MVHA 3QTXA 1ZY5A 5AR4A 4CV9A 4HVDA 4FV2A 2LGCA 3QU0A 1XWSA 2QU6A 1JSTA 4I0TA 3V04A 3OC1A 4S2ZA 2GQSA 2EU9A 3ELJA 1ZYSA 4L8MA 3OCGA 2YAAA 3UTOA 3DXNA 4WRSA 3MFUA 5BUIA 2BAQA 3CQEA 3NAYA 3IPHA 3C4EA 2FSLX 3IW4A 4YURA 5EQPA 4MBLA 4DG0E 5C1QB 2Z2WA 1HOWA 3AT4A 4F1OA 3LMIA 3WF5A 2X0GA 4R5SA 3UC3A 4F1TA 4RZWA 2OW3A 4L3PA 4UN0C 3M42A 2XEZA 3UP2A 2NYAA 1Y57A 2C3KA 3L8VA 2WO6A 3R28A 4U40A 4IFGA 4XP3A 3VS1A 1U4DA 3QGYA 4DEGA 2ONLC 5D11A 2IPXA 2XM9A 3EN9A 3FHRA 1RE8A 4CG8A 4KSPA 1JKKA 2ETKA 4USEA 4L45A 3OWPA 5HIEA 5GIPE 1IAHA 2QHMA 3GC7A 3WE4A 5M4UA 1ZYJA 4IVDA 3UG2A 1GOLA 2XIRA 1PMVA 2YFXA 4O6LA 4FV7A 4EWQA 5CALA 2W17A 2CNVA 4C8BA 4UMRA 5L6OA 4A07A 4S34A 3RZFA 3FBVA 4E73A 2OG8A 2W5AA 4B4LA 3UZRA 5AP2A 3V51A 4KABA 5HICA 2QKWB 5DHJA 4C35A 4MXOA 4D55A 3M11A 1ZYDA 2BKZA 2BCJA 4CFVA 3PZHA 5EKNA 3R21A 4FSMA 3MVLA 1NXKA 4PPBA 1YI4A 3FC1X 1FGIA 3R2YA 5AP3A 4GMYA 4JNWA 2UW0A 3EQHA 4F6SA 2C6TA 2Q83A 1A48A 4BIEA 5JT2A 4M13A 1DI9A 3NIZA 2EXMA 4FYOA 2X7FA 2ZV7A 3LCSA 5D1JA 1WVWA 4YZMA 2XAMA 3FUPA 3I5NA 2WTKB 4NJ3A 5A54A 3L9MA 3VRZA 3D5XA 3I79A 3P1AA 1T45A 2X6DA 3DFAA 4UYAA 4G6NA 4ZTLA 5CVHA 5FG8A 3ZFMA 3LFNA 5I3OA 1REJA 4E93A 3PSDA 4KIKA 3O17A 4HVHA 4EOLA 4IXPA 4TNDA 5AUVA 2JBPA 1BMKA 1Q8ZA 4FZ6A 3UOJA 1MUOA 1P4OA 4AA0A 5ITAA 3GQLA 5L4QA 1ZARA 4H39A 4IB3A 2FGIA 4IJ9A 4ZY5A 1GZ8A 4ZXTA 3VHKA 4MF1A 4AP7A 2C5YA 3ID6C 4DEIA 4O6EA 4BBFA 2FH9A 3LFDA 3CJFA 4MWHA 1WBTA 3OHTA 3COHA 4AT3A 2CKPA 2BZHB 1Y6AA 2F7EE 1JVPP 2R3FA 2OBJA 1KOBA 3Q52A 3OF0A 4IX5A 3PY0A 5HNGA 4LMNA 3PJCA 5FBOA 3ATTA 3SG9A 3OROA 3CGFA 3FKOA 4I24A 3OS3A 5HVYA 4EOSA 2P33A 1MRVA 1IA9A 2PHKA 4JBQA 4FL2A 2B0QA 3NGAA 4CRLA 3MSSA 4XV9A 2YIQA 5BVNA 2X9FA 3VBTA 3DTWA 3ENMA 5EQEA 1P14A 3P78A 3MFTA 4F0GA 4MXAA 2GFSA 3BQCA 4IDVA 3ROCA 1YXXA 1XJDA 3LAUA 2XK6A 2XNGA 4I6FA 5HGIA 5CENA 1M7NA 1PW2A 5KNJA 1J91A 2GNHA 2XNOA 2HXQA 4L53A 2XK7A 3UDBA 3WZUA 1OUKA 2C5OA 3DS6A 4C62A 5HTIA 2CLXA 2XCHA 1PXJA 5J5TA 4JLCA 4L3LA 4NKAA 5H8GA 4NZWB 5H2UA 4V05A 4EZ7A 4D1ZA 3ZM9A 3QTIA 2J51A 5KBRA 3WE8A 4JG6A 4FKVA 2GQGA 3I81A 5BVOA 3FLZA 2OZAB 3UOLA 4F63A 5H3QA 1JWHA 2IO6A 3N4VA 4LFIA 4ASEA 5IQFA 4AW0A 2HXLA 3FKNA 3SRVA 4AZTA 4PP9A 4YLJA 4Z16A 3LKMA 2AC3A 4LUEA 2XUUA 2PVKA 4D2WA 2CGVA 1OUYA 3LFAA 2IZSA 4DLIA 3LLAA 5C01A 2A27A 2ITTA 2VTQA 3A99A 4ZS0A 3PJ1A 1IAJA 5EHLA 4BTJA 3CKWA 5KKRB 1BUHA 1XQZA 4IANA 3S4QA 3NUXA 3PLSA 3SOCA 3MWUA 4HNFA 3VBQA 2GHLA 3O8UA 4FKOA 4KRDA 5E1EA 4EH4A 3D5UA 3D14A 5EYKA 4O0UA 5CSPA 4BDJA 3MH2A 2JITA 5FM2A 2XH5A 3EJ1A 4AOIA 3KXZA 3F3ZA 4D9UA 4P7EA 3GU7A 4DFZE 1F0QA 2WTDA 3SDJA 3EB0A 4PL3A 5AIRA 3F5PA 3TIZA 5LMAA 4HCUA 4MD8E 2HW6A 3EN4A 5JEBA 2XIXA 5JN2A 5H8EA 3RHXA 4RIXB 2YITA 4NH1A 3W2PA 1FOTA 4CTCA 2EB2A 3BE2A 3HV6A 4KBAA 3G6GA 3SXSA 2IVTA 4I6HA 3NUSA 3R7YA 3UIMA 4QP6A 2I1MA 3TJCA 4AE9A 3KIOC 4XV3A 3NYXA 2ESMA 5HZNA 4WO5A 5M07A 1GIHA 1R3CA 4LV7A 5HCXA 2P4IA 5CX9A 3R9DA 3ZLWA 3DJ6A 5E1SA 3R1NA 2CCHA 3R73A 4YNOA 3KK9A 5HHWA 2DWBA 3W2QA 4BCNA 2IWIA 3D15A 1S9IA 2C6KA 5GJFA 3VHEA 4YO4A 1YI3A 3DQXA 4QP7A 4FIJA 4W4YA 4EWHA 4BDKA 4L52A 4AFJA 3VUDA 4U8ZA 4QQTA 4BWKA 4ZS4A 4LDTA 3SA0A 4AGWA 3R7IA 3UO5A 2HZ0A 2V0DA 2Y7JA 4F0FA 4Y5HA 4JX7A 1M52A 2J7TA 2I40A 5KCVA 2UUEA 3TDVA 4OT5A 3R8UA 3W0PA 1YWRA 3A2CA 3VO3A 3QCYA 5L6WL 3FXXA 4L44A 3OUNB 3QWKA 4UXQA 3KQ7A 4BI1A 2OLCA 2W1HA 1JKSA 2QR8A 3IW8A 3QUPA 4IM0A 1FPUA 3LFSA 1KV1A 4KIOA 3VBVA 5FXRA 5LQFA 5LVNA 5CXHA 3IO7A 3CLYA 2UVYA 2WMAA 3R9OA 5JQ5A 5HG9A 4PQNA 2X6EA 5M53A 2XIZA 2BAKA 4FI1A 3FL4A 1QPCA 4FT0A 4EH7A 4QYHA 2Y6MA 2C68A 4OR5A 3CTHA 5CQUA 1H26A 3UJGA 2XYNA 3KXHA 4DGOA 4TWCA 4A9YA 3CC6A 3ALOA 3NUNA 3VF9A 5IU2A 3EYGA 1DAYA 4XG3A 1PHKA 5EI2A 1OIUA 3HP2A 4O4EA 3F6XA 4IWOA 4KS7A 5H8BA 1OKVA 3RPOA 3UVRA 4O4BB 4ERKA 3R22A 5HVKA 2HENA 3CCNA 2EXEA 3OMVA 3ODYX 3RPSA 3HMNA 2J6MA 3Q3BA 3AGLA 4GFGA 3G90X 4QPSA 4R7IA 4AW5A 4BTKA 4F64A 3NW6A 3V5WA 3F3TA 5D41A 3PVWA 5AP4A 5F94A 1JLUE 4FSUA 3BLAA 3BU3A 3I6UA 4DFUA 3KA0A 4DTKA 3KN6A 3DJ7A 4FV5A 5CYIA 3GCPA 1OL1A 2ZB1A 4A9RA 1W84A 1FVTA 2B54A 2ZM3A 3P5JC 3QTUA 3BELA 2XKCA 4JRVA 4LGGA 3A4OX 5E8WA 1HCKA 2ERKA 2VTIA 3K2LA 4RJ5A 3HP5A 3PA5A 4E1ZA 4RWKA 3GC0A 1GIIA 2UW4A 1Y8GA 3NUPA 5CT0A 5CXZA 3TG1A 4IACA 4FV3A 3UVPA 2OK1A 4GJ2A 1YDRE 3ETAA 4L3JA 2XARA 4BGGA 4DG3E 2VTHA 5J95A 3ZFXA 2VTMA 2XRUA 4JT3A 5ACKA 3QQJA 2WOTA 4ASXA 4NW5A 4FVPA 3BEGA 4CRSA 3BLQA 4EH3A 4YZNA 4BTMA 2GTNA 4MTAA 2VWBA 4NT4A 5DI1A 3MFRA 4C34A 5FM3A 4D58A 3NFGB 4ZJJA 3NX8A 3VUIA 1PRYA 4D1SA 4CCBA 5EH0A 5HESA 1CKPA 3KC3A 5M4IA 4WG5A 3PJ2A 1ZXEA 5JQ8A 3C4FA 2BAJA 2FVDA 3KXMA 3ZXTA 1OL2A 4PP7A 3PRIA 4D4RA 5CAOA 1KWPA 4E6CA 5LCJA 1GZOA 4YTHA 3PVGA 4YJTA 4L46A 4BZOA 4J8NA 4R1VA 2C30A 2Y4IB 4ZY6A 1FGKA 2ITOA 4YU2A 1QPEA 4IEBA 2VTAA 4ACHA 4PDSA 4EH9A 3ACKA 4MHAA 3TKUA 2XNMA 3TM0A 5CSWA 2YERA 5GJDA 2RL5A 5L3AA 1OI9A 2ITUA 4TYHB 2BR1A 3DAKA 3DKFA 5EHYA 5L8KA 1VLRA 4HYUA 5TT7A 3R83A 4CQEA 3BYSA 1YHWA 2OGVA 2VWYA 4UBAA 3PTGA 3CPCA 2X1NA 4EC8A 2ITQA 4PUZA 5CU6A 3FLSA 4CG9A 2PMOX 3ZZEA 4BTFA 2A1AB 4IWPA 5E92A 2PU8A 4CCUA 1OECA 4D28A 3FMLA 4FKLA 5F4NA 4E4XA 3KY2A 5TOZA 3RAWA 5EOBA 4IX4A 4RFZA 2ZAZA 3FDNA 2AEGA 3F66A 2W1FA 2B1PA 4U42A 3SKCA 3QALE 4ARKA 4DFLA 5B7VA 2VN9A 4R3RA 5JFXA 3TDWA 4C61A 4CZYB 4GK2A 1W8CA 5DN3A 3QD3A 3U87A 3ZBXA 4CFXA 3VJNA 4MQ1A 4A9SA 3MDYA 4O7TA 2BFYA 4EH5A 3KCFA 5AUUA 4AXFA 4NIFB 3OG7A 1XMLA 3ZFYA 4GK4A 4EYJA 2UZTA 1Y8YA 4MK0A 4QMMA 4QDVA 4BF2A 2VWZA 3HMMA 4AE6A 3N51A 4AZSA 4PTGA 3L1SA 4MXXA 2ITNA 3C13A 3QA8A 1MRYA 4BKYA 3CR0A 3A7IA 3K54A 2GNJA 4FT7A 4U44A 1JQHA 2I0EA 4ZEGA 4UMQA 2QOHA 4YC6A 5CU0A 3L9PA 4HYSA 5HQ0A 5I3RA 1Q61A 3OOGA 4WIHA 3TIYA 1G8AA 5LCKA 3UPXA 3NNUA 3TYKA 4RJ8A 3HNGA 4IAKA 4R7BA 1SZMA 2J50A 3AMBA 4GVAA 2PUPA 2RFEA 2H8HA 3UDTA 3M1SA 4QMNA 4GS6A 3R01A 5C03A 4QNAA 3VRYA 1QPDA 4H1MA 4M0YA 2QKRA 5EYMA 4X0MA 3U6IA 1PY5A 3DPKA 4FGBA 5J79A 5CNOA 2R3JA 3KB7A 3DXPA 3W8QA 3KULA 4BKZA 2R3QA 2YA9A 3WBLA 4D4YA 5EI6A 4KIQA 2QNJA 1NVQA 2GU8A 3RAKA 5A6NA 4AZFA 2OIBA 3D7ZA 2RG6A 3R0TA 4OTFA 4TYJA 4FEWA 2X2MA 3UQCA 4O0SA 3HKOA 2C6OA 4DINA 5HG5A 4W4WA 2RSVA 4IH8A 2F7ZE 5FUTA 2JD5A 4OTRA 3BRBA 2WEIA 2ETRA 2IVUA 3COKA 4RA4A 4FRFA 4O4FA 3W0NA 5LVPA 2GNIA 2VWVA 2YAKA 4GT4A 2I0VA 4K6ZA 4J98A 3PIZA 3Q4UA 3MYGA 4I21A 3RWQA 3ITZA 4JR3A 2ITPA 2QO2A 3KMWA 5K5NA 4C4GA 4RVKA 2QONA 2X7GA 1TFFA 2QOOA 3PJ8A 2E9VA 3O8TA 3FWQA 4I20A 4USFA 1YHSA 4YZBA 4BKJA 4F6WA 3A7GA 3PP0A 4D2RA 4TWPA 3EN6A 4PV0A 3FPMA 4H05A 2PE1A 3VS0A 1OIQA 3QXOA 4FTRA 4FV0A 1NVSA 1GAGA 2C1AA 4EK5A 3TV7A 4CFMA 3PA3A 2HZ4A 5AV2A 3ZSIA 4NCTA 4DFYA 4IWDA 3WF7A 1PXIA 5KZIA 5GZ9A 4QMTA 3KF7A 3MJ1A 2PYWA 3W0OA 1IASA 1OIYA 2C0IA 3BYVA 1XKKA 4L67A 4RT7A 5HLNA 1XH5A 4K9YA 2UW8A 4TL0A 3S3IA 2F7XE 4DN5A 3W10A 4K1BA 1UNHA 2IF8A 2VNYA 3O0GA 4YZDA 3MN3A 4MBJA 3CQWA 5DOSA 3RBWA 3TZ9A 4M66A 5CSXA 1KSWA 4WNOA 3WIGA 3GCUA 3V5PA 4BYJA 5A9UA 1G8KA 3NZ0A 2CNQA 2OIQA 4BCHA 3QTRA 3H9FA 4WD5A 4FG8A 2AYPA 4FSYA 5D12A 3ORZA 2Z02A 4A4LA 5J7BA 4CFFA 5HD7A 3MJ2A 4I93A 2XYUA 4MCVA 4YHTA 2JIVA 5AM7A 3TL8A 4DLJA 3N9XA 5M08A 4HGEA 3ZRLA 3UQGA 1OKWA 2WD1A 2V5QA 1DI8A 4UZHA 3P7BA 4C58A 4DH1A 1AD5A 5HORA 4C4HA 4X6RA 2FSMX 4IJPA 4JBPA 1UVRA 4Y95A 3EQCA 1ZRZA 3M2WA 4FTNA 4TNBA 5HO6A 3PE2A 4BDHA 4CKIA 4XRLA 1OPLA 2WOUA 3G0EA 3Q04A 4NCTC 1O6YA 3RINA 5IQIA 3D9VA 4M0ZA 3HL7A 3QKKA 1FMKA 4ZSGA 4F9CA 4W4XA 1SMHA 1QL6A 3LCTA 5CT7A 4FNWA 2PPQA