1U59A

Crystal structure of the zap-70 kinase domain in complex with staurosporine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
282
Chain Sequence
b'KKLFLKRDNLLIADIELGCGNFGSVRQGVYRKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ZAP-70
publication title The Three-dimensional Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine: IMPLICATIONS FOR THE DESIGN OF SELECTIVE INHIBITORS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 282
sequence length 285
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u59A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u59A01
4EH3A 1WBWA 4JDHA 2ZB0A 5HG5A 1PYXA 3CS9A 4GT4A 3QKKA 2QOIA 4GSBA 2VWIA 2C0OA 1OIQA 2OFVA 2YN8A 1WBSA 5AR8A 3TDWA 5I9VA 3QZIA 4JOAA 4V05A 3FXZA 3HX4A 1GIHA 4NM7A 3R7IA 4F7JA 4G9RA 3SXSA 1U46A 3C5IA 4Q5HA 3TZ7A 2FUMA 3R8PA 2V55A 4EOKA 3PA3A 1QPJA 5BX0A 4HOKA 3G0FA 5IISA 4FSMA 2C3IB 4FTJA 4ZS4A 4AFJA 5HVKA 3MV5A 2A0CX 3WI6A 4Z55A 2VGPA 4XP0A 1U4DA 1PXNA 4PTGA 2G9XA 5AIKA 4FIGA 3LW0A 3LCOA 2VTPA 4U8ZA 5FEEA 5TT7A 3RK7A 4QPSA 3ZXZA 4R3PA 3GOPA 4NM3A 4O2PA 3QHWA 4FV3A 5KMOA 1J7UA 3BBWA 3EN5A 3DK6A 4WSYA 2OZAB 4ID7A 4IWPA 2I1MA 2R3QA 3Q04A 4AZFA 4FKRA 4BZDA 4C4HA 1YKRA 4EOIA 3RNIA 3QA8A 2VX3A 3OC1A 3DGKA 3FHRA 4BY9E 2AC3A 4GYIA 1YXXA 5IH5A 1W7HA 1OIUA 3OOMA 4RZVA 3FY0A 5B2MA 3WF9A 5LOHA 2C1BA 2RIOA 3E62A 4KRDA 5DHJA 1PXJA 4MX9A 4JX3A 4TWOA 2J5EA 3P86A 1ZYCA 2CGVA 3NDMA 4RMZA 2XYNA 5K5XA 3V04A 5AR5A 3LMIA 4UZHA 5HTBA 2A19B 3KCFA 4GJ2A 3HGKA 4ALUA 3MFTA 3FSKA 4GG5A 4U3ZA 5JRSA 1KE7A 3ZS5A 3S1HA 3NVKI 4OLIA 5EG3A 4F7SA 2E9NA 3PJCA 3BGQA 3BPRA 5CI6A 1V0PA 5EYKA 3RWQA 4BBMA 3Q9ZA 3FSFA 3KXZA 2ZM4A 1U5RA 3O96A 3O0GA 3OP5A 5CU0A 4I24A 5IF1A 2H34A 5EM5A 5IH4A 3JYAA 2JAMA 3VS4A 1MRUA 4J71A 2NRYA 2BTSA 5FQDC 3EQFA 3MBLA 2GTMA 3PLSA 3FLSA 3GVUA 4OAVB 2GSFA 2OWBA 4DCEA 5HU3A 5HNIX 2XBJA 3NIZA 5J9LA 2WMVA 3R71A 4USEA 4UN0C 4RWIA 4AX8A 3WBLA 5AR2A 4ANOA 4WIHA 3Q9XA 4IVCA 4YO4A 3RGFA 4C58A 3ANQA 1ZWSA 2O64A 2A2AA 2CKPA 3KXMA 4O96A 3ZFMA 2ZB1A 5A6NA 3KMWA 2X7OA 3EIDA 3MFUA 4EBVA 3ZMMA 3VRYA 3HVCA 4M97A 4X3FC 3PXKA 4HJOA 4FZFB 4WHZA 3OWPA 3A7GA 2QO7A 1BX6A 1W84A 3K3IA 5KX8A 4Z9LA 1VZOA 2EXCX 3BU5A 3IECA 3JUHA 2WTKB 4NL0A 4YO6A 3NPCA 4PNKA 3M42A 1PMNA 4RIWB 4BN1A 1XWSA 1ZAOA 5L6WL 3I79A 2VTRA 4EK8A 5AM7A 3VULA 5M08A 3U8WA 4WG3A 4TNDA 1PW2A 2P2IA 2BR1A 4WNMA 3E3PA 1TKIA 3ODYX 3POOA 3VJNA 3HEGA 3BYUA 3QD4A 4FTCA 4DFNA 1M2QA 3VC4A 3OBGA 4BTMA 4AE9A 4JVGA 4FT0A 2C69A 3PG3A 4MTAA 4MYGA 5DR6A 5FBOA 4BVUA 4JQEA 4C4GA 4CFFA 4HW7A 4EUUA 5JH6A 3D7ZA 3HUCA 1UWHA 1BL7A 3BHVA 2BMCA 5FM2A 3TT0A 3CC6A 4YJUA 4CFUA 3ZBFA 2JDOA 4DT9A 1NT2A 1ZYDA 3IK3A 3IW7A 2W4JA 1KWPA 3BYSA 3C0IA 4D2SA 5AP5A 4FNWA 4ARKA 5ACBC 5J1WA 2BIYA 4IW0A 4XG9A 2V62A 3MJ1A 2JC6A 3C4FA 4D1SA 4JG8A 3BGZA 5T6KA 4O0TA 4HVGA 1DAWA 2YIWA 3R2YA 4MHAA 3WF7A 3ZFYA 3AC4A 3O8PA 2W5HA 5AV4A 5ITAA 4WOVA 1OL7A 2CJMA 3GUBA 3G5DA 3FL4A 4EKKA 3TI1A 3ZXTA 4I5PA 5FP5A 2H6DA 3C4WA 1PKDA 3LFCA 3ORPA 2HENA 3O71A 5HKMA 2VTQA 3KF7A 5M51A 2JDSA 2QOCA 2YCFA 3WZDA 4L7SA 4AFEA 4CFWA 4AOTA 3DB8A 4M14A 2XA4A 3SG9A 4CFVA 3F7WA 2JFMA 3FMEA 3KXXA 3HECA 5ETFA 1GAGA 5F4NA 4A4XA 2Z7QA 3WARA 2C0TA 4BC6A 4Z7GA 3H9FA 4UYAA 5D41A 1IRKA 3GU6A 4FG9A 4PWNA 4NIFB 3VUHA 3QTWA 5CS6A 4O21A 4C62A 5LMBA 5LVLA 2WB8A 3AT2A 5HI2A 3F2AA 3UQCA 3HMPA 5TKDA 2VTAA 4G16A 4ZK5A 1P14A 5CLPA 4AOJA 2X8IA 3R0TA 3VHEA 2OJIA 5J7BA 3GFEA 3MVJA 5IH6A 4FV9A 4YP8A 3QQLA 3ID6C 2CNQA 2BHEA 2F2UA 5C9CA 4CV9A 2OIQA 1FVTA 3EFWA 2PMIA 3CQUA 4RX7A 2CDZA 4J52A 4UEUA 2UW8A 5HNBA 1YW2A 4L53A 3ZLWA 4A9SA 3MFSA 3RHXA 4BFMA 3E7OA 3SD0A 1E1XA 1PKGA 2WD1A 3E8EA 2R3FA 4H3BA 4JDJA 4FNZA 1UNHA 2CHLA 5K3YA 5C8MA 3ZUUA 5I9XA 3OTUA 4GEOA 1YWNA 3CBLA 4EBWA 3DJ5A 2F4JA 3OFMA 1HOWA 1W8CA 3II5A 4W8DA 3DY7A 3R1QA 2C1AA 5AP7A 4DC2A 4WNKA 2LGCA 3O7LB 4RRVA 5CVGA 5DE2A 3WZJA 4V04A 4XG2A 4U7ZA 3FKLA 4HZSA 3GU8A 3ERKA 2VWBA 3F82A 2XCKA 3QTUA 4ITJA 2XK8A 3G0EA 4J8MA 4M0YA 4DFXE 3SLSA 4EZ3A 5IUHA 2PVYA 3QTXA 4DE4A 4I1ZA 4KA3A 4QYFA 2UW5A 2ERZE 3LFAA 4WG4A 1XJDA 3PYYA 3QX2A 3TL8A 3PY3A 2YABA 2OLCA 4JDIA 1Q5KA 2QCSA 4FTLA 3AMAA 3Q53A 5H8GA 3D83A 5JFXA 1Z5MA 3RALA 1ZY5A 4I5MA 2CKQA 3FZTA 3RVGA 4AGWA 3VF9A 2ZDTA 5CU3A 5EQYA 1CDKA 2UW3A 4QQ5A 4N6YA 4NK9A 2B53A 3CGOA 2R7IA 3G9NA 3KMUA 4BTKA 2NO3A 2XIXA 5HICA 3BGPA 3UNJA 4G3GA 2QLUA 4CNHA 5AV1A 2WMRA 4GW8A 5HZNA 2PMNX 1Q62A 3LQ8A 3PZEA 2V22A 4IAZA 2P2HA 4CTBA 3FMJA 4YJNA 4ACMA 2IG7A 3P78A 2VD5A 5I9ZA 4FE2A 4CGAA 1FMKA 3I6WA 3OY3A 4YTIA 4AOIA 2O2UA 2OXDA 4A7CA 4BCIA 4AZEA 3P1AA 4JQ7A 4QTAA 3BU6A 4KB8A 5IU2A 1U5QA 4I6BA 2G2HA 2VWZA 3G15A 2OG8A 1LR4A 3TWJA 4A4LA 3I60A 4IFGA 2C0IA 4LOQA 4DEHA 5D12A 2GQSA 4KKEA 4YPSA 4UV0A 4AT5A 1H26A 3EHAA 4RVTA 1FGKA 4RT7A 4J1RA 4NT4A 3FJQE 5DYJA 4CMTA 4BYJA 4UX9A 3TDVA 4H1MA 4FUYA 5CAVA 3SW7A 3BQRA 1UU9A 5E4HA 2Z2WA 1IA9A 4ENXA 3SV0A 2YM4A 3DQWA 4QP1A 4ZY6A 5DT3A 1Q3DA 2OFUA 1FVVA 5D7AA 3NW6A 3LCDA 3R1SA 2Y4IC 4BDAA 4IM0A 3EL7A 4BI1A 4GRBA 4F7NA 4ZZOA 3DZQA 2OXXA 5HBHA 5DWRA 4RWJA 5D11A 3UTOA 5HO6A 3W55A 3TUDA 3GOKA 3FC1X 5CF4A 5M57A 2EXEA 5EOLA 4R1VA 3E87A 1E1VA 5HO8A 4DEGA 1V0BA 5FM3A 1PMUA 2GPHA 2YM5A 3MPTA 4RX8A 4EH8A 2ZMCA 4L3LA 3TKUA 3UOHA 2IWIA 2WEIA 3GU5A 4FKWA 5KMJA 3AC5A 3OXIA 2WIHA 3VJOA 3W10A 4BCHA 3T8OA 3SXFA 1JAMA 4DH8A 5J8IA 5L6OA 1L8TA 2Y8OA 2VTNA 3C50A 3OCBA 4ASZA 3NNUA 5AFVA 2W99B 5GZ9A 4PP9A 4BCFA 3V8WA 2CGUA 3O50A 2PMLX 3LFEA 4HYSA 4LM5A 3RZBA 4R7BA 3BX5A 4BCNA 1OUYA 2YERA 2WTDA 4I5HA 4QNYA 2GTNA 4RG0A 4F64A 2GNIA 3NR9A 4NEUA 2YEXA 2IZRA 4CYIA 4MKCA 2I6LA 3ORZA 4EH6A 4IXPA 1U54A 2BRNA 2UW6A 3GCQA 4MD8E 3PRFA 2VX0A 3OWKA 3RPRA 2PU8A 4U97A 3FMKA 1J1CA 2WQNA 4QMUA 1RW8A 3E63A 3EYHA 5EM8A 2W1DA 4YZ9A 3VS2A 4XYFA 4WA9A 2FSTX 4O6LA 2IPXA 4O7WA 4IIRA 1JSTA 3RPSA 4FSZA 4FEXA 4F09A 2RKUA 3EN9A 3KFAA 1XKKA 4MBJA 3CCNA 4GK3A 5GJGA 4BBEA 4RA4A 5FTQA 4AXAA 5K4JA 2P3GX 3A60A 4EOLA 2Z02A 2VO0A 4O0XA 2YAKA 4F9YA 4EI4A 3N4TA 2WMQA 4JDKA 1OI9A 5IMEA 3ZLXA 5IQDA 5C26A 4I94A 5E8TA 4MWHA 4KD1A 3C7QA 3V51A 3L8VA 3ENMA 1R39A 3FZRA 3QCQA 3OW3A 4U0IA 3CJFA 3NUPA 4CQGA 4QPAA 4ZP5A 5LMAA 3MH0A 2PY3A 3NYXA 2PE2A 3F2RA 4LQMA 4RJ6A 1T45A 1JQHA 2ITZA 2UW0A 5FLFA 3HRCA 3OHTA 3CPBA 1ZARA 3FXXA 2ONLA 2VWVA 2X8DA 5CSWA 1YHSA 4I93A 4HVHA 4Q9ZA 2RFSA 3PDTA 4FTKA 4DYMA 3GNIB 3AXWA 4K18A 4AGDA 4BDEA 1KV1A 3SRVB 1QL6A 3DDQA 4C2WA 2KTYA 5FUTA 2ZM1A 3QF9A 3ATSA 3DFCB 2IZSA 1NVRA 1MP8A 4GG7A 5IDPA 3ZEWA 3PA5A 4TTHB 3ZO4A 3EL8A 2WPAA 3JY0A 4IC8A 3CJGA 3ORIA 4IACA 3O51A 4II5A 4RIYB 2UUEA 4YLKA 3VBYA 2VTJA 5EW8A 4BIDA 3BBTB 4DEDA 3U54A 3CD8A 4IVBA 4O1OA 4IWOA 3ATTA 3H4JA 3LHJA 3R1NA 2YISA 4BTFA 2QC6A 3BWFA 1P5EA 4OBPA 5EM7A 4I23A 3LLAA 2UZNA 4E4NA 2Z7SA 1GNGA 1YDRE 3WIGA 4C57A 4L42A 5IG1A 4FNXA 3FV8A 3KXNA 3E88A 5BUEA 2VTTA 4L01A 3Q4ZA 1P4OA 3ZM9A 4IH8A 1UU7A 4WSQA 5EI8A 2EB3A 5KNJA 3BCEA 3BLQA 4MD7E 4IAKA 2ESMA 5A4EA 4O7TA 1OIYA 2WTKC 4HPUE 3RAWA 3OXZA 4MCVA 4HVDA 2WHBA 1UU3A 5I9UA 2J0IA 3OMVA 3UPXA 2IW6A 4GFMA 1BKXA 1W98A 3DBDA 2XBAA 4WRSA 4D4SA 1PJKA 2R9SA 4FKOA 3DKGA 3TNPC 3V8TA 4C4EA 5LVOA 4CZUA 4RJ7A 4X6QC 1PXOA 4FKLA 2UVXA 4EZ5A 4XEYA 2X0GA 2XIYA 3AGMA 4LL0A 3Q2JA 4DG2E 4FV1A 3AT3A 3BV3A 1URCA 4KAOA 4WO5A 3RM6A 4QP9A 4OT5A 3HZTA 3W2RA 1ZOEA 4O0RA 2PE0A 5HG7A 4BZOA 3IO7A 3D7TB 3LCSA 3QTZA 3QYWA 4GMYA 3W2PA 2SRCA 4LMNA 4KRCA 1IEPA 2RL5A 4KIPA 3W16A 3BELA 5BVNA 5D7VA 3TTJA 3UO6A 4IB5A 3UZPA 3PRIA 1Y57A 1SYKA 2ITTA 2VWYA 3A2CA 5LCKA 2QOFA 3V8SA 5KMNA 4FEUA 4QP7A 3VQUA 3W8QA 4I21A 2JKOA 3CSVA 3QLFA 4IAIA 1UWJA 1WBPA 3BKBA 4D1ZA 5FDXA 3K3JA 4FGRA 4BBFA 2FH9A 3QZFA 3ZRLA 4NTSA 4C34A 5KMIA 3HNGA 3DKOA 3LXNA 4E73A 1Q8TA 4I41A 4NCTC 5AV0A 5ANIA 1SNUA 4UWBA 2JEDA 5E90A 2OO8X 4AA4A 4F0FA 5KMMA 1ZOHA 3NGAA 3VS3A 2O3PA 4XV3A 2R0UA 5JK3A 3ACKA 5CU2A 2B55A 3IPHA 3NUNA 2J9MA 2VRXA 4Y83A 4ZSLA 3QWKA 4ZTHA 4DT8A 4JRVA 5EW9A 4H39A 3ZDIA 2WNTA 2RFEA 2JKMA 5FWKK 1Q8ZA 3LLTA 1WBVA 4CRLA 2ITWA 2RG5A 3N9XA 2OXYA 4L8MA 2OJGA 4HCVA 4D2TA 1PXKA 4EYJA 2BFYA 3ITZA 3VBVA 3GEQA 2YJRA 4MXXA 2IN6A 2PSQA 4RX5A 1V1KA 2ITPA 5LCJA 4O83A 1LP4A 3I7CA 3NUSA 4EHVA 5A54A 5BVKA 2C30A 2BKZA 4ZJIA 4EORA 4RX9A 1XBAA 1Q3WA 3ET7A 5ANDA 3QUPA 2GHMA 1Y91A 4MNEA 4Z3VA 3VAPA 1MRYA 3QXPA 2RFNA 3TCPA 5IPJA 4GL9A 4AQCA 3MYGA 3PPKA 4XV1A 1ZYLA 4CG8A 4YZBA 1H0WA 4A9RA 4B9DA 4IWDA 4IAAA 2WQEA 2ZVAA 4U79A 1LEZA 1VYZA 4P7EA 5AR4A 5FRIA 1YXTA 2HELA 3M2WA 5HCYA 3TJDA 3ZEPA 4V0GB 2B9JA 3RI1A 1RDQE 4G6OA 1Z57A 4GUEA 4PTCA 2Y6MA 2OK1A 4FK6A 2WMWA 5L8KA 2OU7A 4FTUA 4M69A 3Q2MA 2W4KA 3AT4A 5AP4A 5KZ0A 3AD6A 3NIEA 4O1PA 4YHJA 3ROYA 3FMHA 3MIYA 3MTLA 3QZGA 1VR2A 4I92A 3CQWA 4GJ3A 1XH8A 3LJ0A 5G6VA 3MH2A 5TO8A 4AT3A 5IEXA 3FMMA 1KOBA 2OJFE 5LWMA 5ANKA 3KULA 4M84A 5AUWA 3EQCA 4CRSA 4H36A 2OJ9A 3NW7A 4TYHB 3R7OA 1YI3A 1DAYA 4JQ8A 4E4LA 3TZ9A 2QO9A 4EYMA 1QPDA 4AUAA 5FXSA 5I9WA 4RJ5A 5DT0A 4J7BA 5EHLA 3RMFA 2GCDA 2AC5A 3IQ7A 4TWNA 4ASXA 4ZLZA 5CANA 4IZYA 3TZMA 5EFQA 1XH6A 2W05A 2X2LA 5J79A 5CNOA 2XNEA 3MESA 5ANEA 3KRXA 4F1MA 4HGEA 5HNGA 3VUIA 5CF5A 4O81A 4CSVA 4QMSA 3RAHA 5E8XA 2XKFA 2UZEA 3EN7A 3R73A 3SC1A 5B7VA 2V5QA 3I81A 2VX1A 3EMGA 3QTRA 5AP1A 1JNKA 2VGOA 3DBEA 3FHIA 4RGJA 4AG8A 2J50A 4FGBA 4ZOGA 2GHLA 3VUTA 3QQKA 4YNOA 3ORNA 3KVXA 4JAIA 4ZTRA 5BMMA 2GMXA 4O86A 4YZMA 2JDVA 3A8WA 3KC3A 2W1ZA 4RFYA 2XJ1A 4L68A 3POZA 4AP7A 3UC3A 3UBDA 5HE0A 4GK2A 3NX8A 4V01A 3NAXA 4RPVA 4EK3A 4FEVA 4KS7A 3G6GA 3OUNB 3EZRA 5JFSA 4O0WA 4XP3A 3DJ7A 1UU8A 4Y85A 1JSVA 3UYSA 1M14A 4EH7A 3OEZA 4L46A 5KCVA 3UZRA 4QMPA 5KHWA 4BIBA 1G3NA 4QMOA 2R3RA 5JGDA 2BIKB 2QOBA 3U9CA 1PYEA 3IOKA 2Y4IB 2R3NA 4DH5A 5CAOA 4OTRA 1YXVA 3SVVA 4BCGA 4KSPA 2OIDA 3QALE 4L44A 4PMSA 4BGQA 3K54A 5CSHA 2C6MA 2BFXA 3MH1A 4TYGA 5AMNA 3QQFA 1Y8GA 3ORLA 3DDPA 3FBVA 4NJDA 3C4CA 4MQ1A 4MXYA 2XJ0A 3HYHA 3DK3A 3BYVA 2E2BA 3PZHA 5KBQA 4IX4A 2W4OA 4FKTA 5C8NA 2W17A 1Y6AA 2HIWA 4KWPA 2GQRA 1RQQA 5LVMA 4IM3A 4WT6A 4AN9A 4YJQA 3R7EA 4EHEA 5M4IA 2R3KA 4H05A 3CP9A 3LFSA 2V0DA 5HX8A 3PP1A 3VF8A 3QRUA 4MAOA 4W9XA 2Y7JA 3KN5A 1WFCA 2WMUA 3DCVA 3MB6A 4GS6A 5DGZA 4EHZA 3GU4A 1P4FA 3C9WA 3V5JA 5BVFA 4JLCA 5H2UA 4E3CA 4BDBA 4TL0A 4YZDA 2WMXA 2XF0A 2WU6A 5IKWA 4PF4A 3F3ZA 4IVAA 4R3CA 5AAFA 5EDRA 3BYMA 5FTOA 2V7AA 3ZBXA 4Y46A 3DXNA 4EL9A 4FTRA 5E1SA 5L2QA 4DG0E 5HD7A 4J98A 4X6RA 3FI3A 4ZIMA 5IQHA 4U43A 4YHTA 3KK9A 3MN3A 4L7FA 4USFA 4U42A 3QGWA 3UZTA 5L2IA 5H8BA 4NYEA 2R5TA 2ITUA 2Z60A 3DTWA 3LQ3A 2C6DA 1NXKA 3QQJA 3U51A 1H1RA 4NW6A 1Z9XA 4DTBA 4HVIA 1PY5A 2X2KA 5C4KA 2WO6A 3I5NA 2C68A 3DLSA 4N0SA 3CY3A 4PTEA 1CKIA 2HZ0A 4LOOA 3DNEA 5CT7A 3FC2A 3RKBA 5AUXA 5A46A 3RAKA 3UPZA 2RSVA 3HA6A 4C38A 3F3WA 5GJDA 3RCDA 3LJ2A 2NP8A 2PVMA 4DTKA 4ALVA 1F3MC 2HYYA 5JSMA 4FOCA 3S95A 2QKWB 4USDA 2ITVA 4W9WA 3GT8A 3UODA 5CTPA 3FQSA 2CPKE 3RK5A 3KF4A 4HCUA 5TOZA 4DBXA 1FVRA 3BE9A 3KY2A 1YHVA 5J7HA 2CGXA 3DQXA 4A9UA 3FI2A 5CAQA 1SMHA 5LVNA 2UZWE 3A4PA 4ACDA 3ZZEA 4QMNA 2ZV9A 3Q6UA 4YPDA 2WQBA 3DAKA 4CEGA 5KMKA 1CM8A 2J0LA 1OB3A 3QCXA 2VNWA 3QUEA 2UZLA 4YSJA 2OGVA 5LARA 5CAUA 2JBOA 2YLEA 3ZU7A 4LRMA 5IDNA 2XVDA 3A8XA 3PXQA 3OD6X 4IX5A 5AUVA 4OW8A 3LFNA 4WG5A 4O0YA 3KB7A 4PDPA 4UMTA 4S31A 1Q99A 4D4VA 5IQCA 2WTJA 4BDFA 5JGBA 1MQBA 1J91A 5JQ5A 3F69A 5A4LA 2W1IA 4QMMA 4HVSA 3KKVA 2WTWA 4I6QA 1GZOA 4ZEGA 5CEPA 5FBNC 1OMWA 4OR5A 5M44A 3ZO2A 4LV8A 3P79A 2ZV8A 3GQIA 4RVKA 4AZTA 3LFDA 5IEYA 2QNJA 4BTJA 5A4TA 1R0PA 3R9DA 3FLQA 3HV3A 4O2ZA 3COMA 3BIZA 3PSCA 3V5LA 3NS9A 3HV6A 3R83A 4NJ3A 3QD0A 3MJ2A 5EQPA 3A4OX 5HQ0A 5I4NA 3E8DA 5HLWA 4MF0A 5T68A 1JPAA 4RZWA 2GNLA 3H3CA 4FV2A 1H0VA 4FV4A 4ZY5A 5JKGA 3JS2A 3FLNC 1H1WA 2BDFA 2X4FA 3QQHA 4LFIA 1ZXEA 3FI8A 5DRDA 3UDBA 1A06A 3FQHA 3EQPA 3FMNA 1NA7A 1GZ8A 2FYSA 3ZUTA 4GYGA 5AUUA 4JL9A 2HY81 3OCTA 1ZRZA 2PUUA 3KEXA 4YLJA 4NM0A 1KOAA 5G1XA 3Q4CA 4YC6A 3ZC6A 5CXZA 3NRMA 1OKZA 4P5ZA 4GV1A 4IJ9A 4EKLA 4PPCA 2XK9A 4JIAA 5DEYA 4AACA 4YTCA 3UP7A 2BROA 4FIIA 1WMKA 2ITQA 4BL1A 4C2VA 4O7YA 5IQIA 4DFBA 4S30A 2WQOA 1H4LA 2HAKA 4RVLA 2BTRA 4NKSA 5AM6A 3VUDA 4YMJA 4E26A 2QOQA 4FT9A 4BWPA 3ZO3A 4C37A 1I44A 2A1AB 2ITYA 4KIKA 4FVRA 3DTCA 3FKOA 5J95A 4EOQA 3KA0A 4XLVA 1OPLA 2PYWA 4K9YA 3N51A 4M8TA 3UQGA 4TYJA 4F0GA 4RVMA 3HUBA 3UIBA 1K3AA 4FOBA 5BYLA 2W7XA 3GCPA 4FKIA 4JRNA 3NAYA 2R3GA 4CD0A 4FV0A 5M4UA 4BRXA 4D28A 2PVRA 4UXLA 3V5PA 3CXWA 5CSVA 2XM9A 2VTMA 2EWAA 5JFWA 3A62A 2PZYA 3W32A 3PP0A 2CNUA 3OT3A 2JKKA 3FI4A 3LJ1A 4NU1A 3SDJA 5DEWA 4D2WA 3OEFX 2VTHA 4TPTA 5BPYA 2GS6A 5CYIA 5K0KA 1OKVA 4IADA 1OZ1A 1Q61A 4PMTA 2VZ6A 5CT0A 4RBLA 3VRZA 2ONLC 2W1CA 4WKQA 1IG1A 4DF3A 2JLDA 2ZOQA 3GC8A 2WELA 2YIQA 4G3FA 4GIHA 3CPCA 3R02A 4QO9A 5M4CA 2GFCA 3WF5A 2UZBA 2IW8A 4BDDA 3VBWA 3NVMB 3R01A 4BGGA 1NY3A 3U87A 4C4IA 3BZ3A 4DG3E 1XR1A 3VIDA 5BYYA 5F95A 4AWIA 4R7IA 4U41A 1G5SA 3DA6A 3AC8A 1ZZLA 3NYOA 4PNIA 3S3IA 5HIEA 3SXRA 1OKWA 4O27B 3OG7A 3CEKA 4H3QA 4HNFA 1J1BA 4OTHA 1KV2A 4LRJA 4G5PA 3SOCA 1PXMA 1H1PA 1I09A 4PL4A 4QMLA 3VHKA 5CXHA 4GFGA 4C3FA 5LJJA 5HLPA 4FKSA 4WD5A 4I4EA 4AF3A 4B99A 4D1XA 4C3RA 2O65A 5HIBA 3ALOA 3F66A 2GFSA 4UMRA 4B4LA 4FKQA 4P2KA 3QA0A 1MUOA 2H9VA 2WTIA 3ZRMA 4GH2A 4YSMA 1EH4A 5HG8A 5DT4A 5KKRB 4IB3A 3TXOA 4DAWA 4JR7A 3KMMA 4EOMA 2B7AA 4I6HA 2Q0BA 1LEWA 3DPKA 5HEZA 3TJCA 3F5GA 4BHNA 4N70A 5E1EA 3DXPA 1WVYA 2W1EA 3B2TA 1SZMA 2C3KA 3CTQA 1OBDA 5M09A 4FIHA 4KUJA 3EQHA 4ERWA 4NH1A 4YR8A 5CAPA 2C47A 5AEPA 3F5UA 4BZNA 4F9CA 3R04A 5L2TA 3HLLA 1O6LA 3EB0A 3JY9A 4G2FA 4FKJA 2YA9A 2GNGA 1LUFA 2BPMA 4ZS0A 3EYGA 4A9YA 4FX3A 2BKKA 5EDPA 2CLXA 4RIXA 3V5WA 4K2RA 4C3PA 5GIOE 4C0TA 1B38A 4NM5A 2I40A 4FL3A 4U5JA 5AUZA 2WAJA 3MSSA 3HAMA 3DV3A 5EQEA 4ZSAA 2HK5A 4QYHA 1CTPE 1YVJA 3BEGA 3S0OA 4MXZA 5IUGA 4LUDA 4DEBA 4XJ0A 5EH0A 1YRPA 1G8AA 4BCMA 3Q60A 3BHTA 5KO1A 3WF8A 3U9NA 4AW0A 3OS3A 4FSRA 4S33A 3ENHA 1ZMWA 4XV2A 2PVNA 2FSOX 3F5XA 3TNQB 4ZSEA 3UIXA 3LMHA 5BNJA 2P55A 3SKCA 4G17A 3BRBA 2WTCA 4PL5A 5EK7A 3PXRA 4UWCA 5IA3A 3IS5A 2HOGA 4YC8A 4X3FA 5CASA 3CTJA 5J5SA 1IAJA 5IQAA 2F7EE 3AC1A 2YIYA 3I4BA 4O7NA 4PRJA 4F1OA 1PRYA 1JBPE 1XBCA 4AE6A 4D2PA 4LGGA 5JQ8A 1YXSA 2QLQA 1RE8A 1YDTE 3R1YA 2YM3A 4R1YA 5D1JA 4W4YA 3T3UA 2H8HA 5CF6A 4MD9E 3M1SA 5CY3A 1A9UA 5C8KA 2XIKA 4C02A 1ZY4A 2C6TA 4X7QA 1S9IA 4F9BA 4D0XA 4E5AX 3R7VA 4FT3A 4RC4A 3G9LX 2OW3A 3KK8A 4G3CA 1ZMVA 4D9UA 2PL0A 4BCQA 3OCGA 4TW9A 4CMUA 4FYNA 4HGSA 4JBOA 1J7LA 4G3EA 1WBOA 4CCUA 3RPYA 4CT1A 5JEBA 4IEBA 4UXQA 4BDHA 3L9LA 5CU6A 2YZLA 2J2IB 4IX3A 3C4ZA 2VO3A 5EI6A 2BILB 4KBAA 4GFOA 4UY9A 3E5AA 4ZZNA 5AJQA 3NCGA 3LM5A 3U6HA 4MEDA 4BGHA 4FTQA 1V0OA 5L4QA 3RWPA 3H9RA 4FMQA 4HYUA 4IVDA 1G8SA 1LPUA 4UBAA 2WMTA 4O0UA 2BAQA 4BDJA 4G5JA 4ALWA 4ANNA 4DN5A 3WILA 4CKRA 3BWJA 5DFPA 5K0XA 1S9JA 2XRUA 4JG7A 2OH0E 3P7AA 5A9UA 4IZAA 3L9MA 1XBBA 4G3DA 3U4WA 2F7XE 2IZTA 3IOPA 4S32A 3VBQA 5EW3A 5HX6A 3U6JA 3D0EA 3FWQA 2HXQA 2RGPA 3NNVA 4HZRA 2BRHA 3OT8A 2XNNA 4U44A 3PA4A 1DI9A 2VUWA 4GT5A 4O0VA 3VBTA 4I6FA 3VW6A 5HVJA 4AZWA 2EU9A 1ZMUA 4R7HA 3D14A 3MA6A 1BYGA 4DA5A 3COHA 3KN6A 5ANJA 3B8QA 3Q4UA 4RQKA 3ZCLA 4AN2A 4JNWA 1YI4A 5IZFA 3FAAA 3MDYA 2A27A 1BI8A 4YURA 2PVLA 3F2NA 4ANMA 5AAGA 3OUKA 3OTVA 4Y73A 1ZZ2A 1UVRA 5HIDA 2R3IA 3G90X 3QKLA 2QOKA 4PPAA 4DLJA 4KBCA 3KCKA 3QTIA 3O17A 5CALA 2XK4A 3F7ZA 3DBFA 2CCHA 2HZ4A 2WTVA 3EQRA 3R6XA 4N4SA 4YJVA 3H0ZA 3RPOA 5E8UA 2VWWA 4QP4A 5EI2A 2BZIB 2E9VA 1AD5A 4RJ3A 3QHRA 2XM8A 4D4YA 2PUNA 3NUAA 2I7QA 5E92A 2ACXA 4R77A 2JIIA 5ETAA 3RHKA 2OSCA 4EHGA 2J7TA 4FT7A 2UVZA 4EEVA 3HP2A 2IW9A 4R3RA 1VEBA 2Z7LA 4CFNA 3G2FA 1M52A 1RJBA 4XOYA 5L8LA 2ZDUA 4FODA 2X9FA 3AQVA 3F3VA 4DFUA 4RC2A 4YTFA 3RAIA 2VWUA 4NFNA 4G34A 4B6LA 4XG4A 4WNOA 3KREA 4I22A 5LVPA 2XJ2A 3HAVA 1UNLA 4S34A 3V5TA 5L2SA 2HY0A 4Y95A 3HKOA 5C4LA 5A4QA 5AP0A 5IA5A 1WCCA 1OKYA 3Q5IA 4FICA 4ACGA 4BI2A 1F0QA 3R2BA 3NYVA 1OL5A 1NVSA 1WVXA 4TKSA 4EH4A 3QRTA 2FA2A 4MVFA 4F6UA 5HORA 2GDOA 4PL3A 3RZFA 3P7BA 3EFLA 2DUVA 3K5VA 3KQ7A 3QD3A 3CTHA 4R5SA 2YCSA 2QHNA 3KRJA 4B8MA 3PJ3A 5CU4A 4EUTA 4E20A 2R64A 3EKNA 1FMOE 4TWCA 3HMNA 2W5AA 5HGIA 5M55A 3ROCA 4D9TA 3FXWA 1AGWA 4ZSJA 3RINA 2PZ5A 5A14A 5IQGA 4MXCA 2QOHA 3T9TA 4A06A 4RJ8A 1B39A 3WYXA 3R9OA 4UB7A 3T3VA 3N4UA 1U54B 4CCBA 5HOAA 4IE9A 4JS8A 5CF8A 1UKIA 2PULA 2XNBA 4FF8A 3THBA 5LQFA 5E8ZA 3D2IA 1OGUA 1WZYA 1O6YA 4I3ZA 1HCKA 4W4WA 4AW2A 3I6UA 2QKRA 4IFCA 2W9FB 2VTOA 3NNWA 3PVBA 2P33A 3JVRA 4FTMA 1PXLA 3MFRA 4FG7A 4O7RA 5JT2A 2ZYBA 2B9HA 4ZTQA 4I0SA 1JOWB 4CLIA 3TV7A 4ZLYA 1M7NA 2ETKA 3CKWA 3PJ2A 5KHXA 2OBJA 4XH6A 2C3JA 5LXMA 1R1WA 3CKXA 4OBQA 5ANOA 4OT6A 5DOSA 4CFMA 4JXFA 4OTGA 4WNPA 2YWPA 4YBKA 4ANBA 4QTCA 3TNIA 3QQUA 1GZNA 3D5WA 3GB2A 3KRWA 2CGWA 4I0TA 2VNYA 3W1FA 5GZAA 4K1BA 1GIIA 4JBVA 4FYOA 5ICPA 3KVWA 4RLLA 4JG6A 3W2SA 4UMUA 5IEVA 4XLIA 3EQBA 4HYHA 2ZM3A 4WRGA 1QPCA 3L8SA 4O6EA 4YJSA 4CXAA 4F4PA 4OUCA 2XMYA 1BUHA 5IQEA 3UVQA 4XCUA 4O82A 3S2PA 3HV5A 4BCOA 1PMEA 4YUQA 2NPQA 4WBBB 1TQIA 4CKIA 4OAUC 3ZLSA 2NNWB 2F49A 2IO6A 2JFLA 2ZV7A 4UMQA 4FKVA 2CN8A 4QPMA 4DFLA 4X2JA 1OIRA 2X6DA 4ZJJA 1XQZA 3R21A 4KS8A 2PTKA 4LI5A 4Y5HA 4KBKA 1H27A 2R4BA 2HZIA 2YM6A 3W33A 5IA1A 4FIFA 3IW5A 2R7BA 5CQUA 1APME 5LMKA 3DT1A 4MWIA 5CZHA 2Y9QA 1K2PA 4JBQA 2C5YA 5CEOA 3FYKX 4L67A 1STCE 4I0RA 3E92A 3VUMA 5CZIA 3VWAA 5GIPE 3PY0A 5ETIA 3F3TA 5BUIA 3DU8A 5AIRA 2HZNA 4L6QA 2AYPA 3R8MA 3BLRA 4Q5EA 5EKOA 1OPKA 1YQJA 2OZAA 4E5BA 2HWPA 3LOKA 5KKRC 2PUIA 1CMKE 3W2QA 4P4CA 2XP2A 2XB7A 2C4GA 2R0IA 5DVRA 4NFMA 4IZ5A 3O8TA 4F70A 5F1ZA 3P23A 4LV5A 4FEWA 4J8NA 2OIBA 5HLNA 3EQGA 3P0MA 4IANA 4F0IA 1BLXA 3TIZA 3UVPA 4EOOA 2PWLA 1FBNA 1PXPA 3MGYA 1OL2A 4MK0A 3QCYA 2BUJA 2C6OA 5FXRA 4E6DA 5A6OA 1H08A 3FQEA 2ETMA 4GIIA 4XG6A 3DKCA 3T9IA 3FLYA 3VQHA 4Z7HA 5CEKA 3GC0A 3OW4A 3R9NA 4EWQA 2YJSA 2QQ7A 4AW5A 4U81A 3VS0A 1GZKA 3QRIA 4KSQA 3DS6A 2IVSA 3IG7A 5EYCA 3MA3A 5GNKA 4ANQA 4F08A 5CEIA 4B7TA 3UIUA 5J1VA 4O7SA 2JDRA 3IGGA 3HV7A 5HCZA 2YDIA 4E6AA 4E5WA 5KMLA 5H3QA 4F6SA 3CR0A 3NCZA 3UYTA 3HP5A 3UOKA 1XH9A 2BRGA 4CZTA 2XZSA 3D2KA 4AT4A 2BAJA 3VS1A 3W18A 5K4IA 2CNVA 3AMYA 4FTIA 1PF8A 4HPTE 4K33A 4Y5QA 5HG9A 3UJGA 4D55A 3QAME 4BDKA 2XKEA 3GI3A 4O38A 5HCXA 3FPQA 1AQ1A 1TVOA 2JD5A 3BQCA 3OWJA 4AS0A 4YBJA 2ITOA 3DBQA 3KXHA 5DNRA 3RM7A 3ZTXA 3ZZWA 3G6HA 4X2NA 2XKCA 3HRFA 3F5PA 3VNTA 4QP8A 4RIWA 4BCKA 2R3HA 5B2KA 4QRCA 2A4LA 3COIA 5T3QA 3SOAA 2VTIA 3QFVA 4MNEB 3FMLA 5E8WA 3LFBA 4EONA 2XNMA 4F9AA 1X8BA 4TYEA 4YU2A 4ZTMA 5I0BA 4B8LA 2VN9A 4BKZA 4FL2A 3UE4A 2PVHA 4L3JA 3CD3A 3UOJA 2EUFB 2JAVA 3NUUA 4KNBA 4W4XA 4PUZA 1DI8A 5EHYA 5JZJA 4ASDA 4I4FA 5DR2A 4HGTA 3ACJA 4XG3A 5DBXA 4X2KA 3ZLYA 3TZ8A 2J0KA 4ASEA 4C35A 3L8XA 2QU6A 4M69B 2XIZA 3FYJX 3F3UA 5DH3A 5E8SA 2YDJA 3PXYA 4QP2A 4J95A 4ZY4A 4XV9A 3VBXA 2WMAA 1YOLA 1QMZA 3BI6A 5F20A 2PVJA 3LMGA 2QU5A 2C3LA 3BV2A 3OZ6A 3RP9A 4H58A 4MBLA 4NCTA 4K6ZA 4UWYA 2HXLA 1YI6A 3EZVA 5FP6A 3KULB 1W82A 2FVDA 4BDCA 5AA9A 3IONA 5AA8A 1REJA 2WMBA 3CQEA 3ORTA 4XRLA 1IR3A 4ZZMA 4BB4A 3FUPA 4TWPA 2DWBA 4FTNA 5FG8A 4XRJA 3UIMA 4EJNA 3H9OA 3JXWA 5EYDA 2X9EA 3OVVA 4L3PA 1H01A 4EH2A 4O84A 3NUYA 2FO0A 3R22A 4FV5A 2R3LA 4JX7A 4L00A 3TN8A 4GU6A 5GJFA 3WYYA 1Y8YA 3ZC5A 4PY1A 3P4KA 3JPVA 4TNBA 5B0XA 1U59A 1O9UA 2VAGA 3Q9YA 2I0YA 4LGHA 4YGAA 3ETAA 3R8ZA 4NIFA 3GCVA 2VTLA 3AOXA 4EWHA 3NSZA 3RNYA 3VS5A 4IB0A 5M53A 3ALNA 2QODA 1OBGA 4TRLA 2H96A 4FI1A 4DHFA 5AV2A 5KBRA 1ZOGA 1YWRA 4YJOA 5L8JA 3Q52A 4FKUA 4IBMA 4QMYA 3QYZA 1OECA 5IMXA 3QD2B 5DR9A 2FSMX 2ERKA 1Y6BA 4QYYA 4ANSA 5HHWA 2QOOA 4FZDB 4FBXA 2W1FA 2Z7RA 3HL7A 3PE1A 5FD2A 4LRKA 2Y6OA 3MY0A 5A3XA 2WOTA 5AADA 3JR1A 1YDSE 2ETRA 3OWLA 4EC8A 3LXPA 4MBIA 2O63A 4APPA 5JFVA 4ACHA 2VV9A 3ORXA 4C61A 3B8RA 4FKGA 3SG8A 5TF9A 1JKKA 4FSQA 3FZ1A 4QQJA 4XBUA 1FINA 2GS7A 2ZV2A 3MW1A 3BHYA 2R3JA 4J96A 3EKKA 4TT7A 5AP2A 3TACA 4ITHA 1BL6A 2X4ZA 3QUDA 4K77A 2YITA 3IDBA 3TUCA 2PE1A 4R78A 5AP6A 1KE6A 4XP2A 2X7FA 3BU3A 2CN5A 2P0CA 3WOWA 4EK6A 2QO2A 2PPQA 1GOLA 4IJPA 1OVEA 2CSNA 2J4ZA 2BDWA 3MY5A 1H07A 3L9PA 4RWLA 1FGIA 4AZVA 3CLYA 1E9HA 5L3AA 5M56A 4ZAUA 1SNXA 3UNKA 4TYIA 2REIA 5FXQA 4FC0A 4IC7A 3PPJA 4AU8A 4XNEA 4IB1A 1JKLA 3C0GA 4M13A 1R3CA 4I5CA 4J99A 5CVHA 2X2MA 5D10A 3DKFA 3GENA 2PVFA 2IZUA 4FSWA 3PWDA 2IVTA 3R63A 2OZOA 3AGLA 3EQIA 3LXLA 4AGCA 4FZAB 2YIRA 4YZNA 4G31A 1JVPP 4LMUA 2W5BA 2UZVA 4YZCA 3EN6A 1MRVA 4OGRA 3ODZX 5B2LA 2E9PA 2XCHA 4H1JA 4EC9A 3FE3A 3UQFA 2CKEA 3ELJA 3K5UA 1TQMA 4OTPA 4R6VA 2JDTA 5J87A 2VO6A 4F7LA 2HWOA 3LZBA 2LAVA 3PVWA 2XS0A 5BYZA 2UZOA 3FLZA 1JKSA 3R7GA 5CQWA 3WF6A 4A07A 4QTEA 5BVOA 3PE2A 3LCKA 4HNIA 4QMVA 1VYWA 2UW4A 4YTHA 4DGLC 3F61A 3H0YA 3ZOSA 3DZOA 4AGUA 5AV3A 1ZYSA 4GK4A 2C5NA 3L1SA 5CENA 2VTSA 3AMBA 2IVUA 3ZFXA 4QMWA 3A7IA 4PDOA 2W9ZB 3QL8A 5BUJA 4IQ6A 3EN4A 4XOZA 3Q96A 1WBTA 2GNJA 2OF2A 2YM8A 3M11A 2GNHA 4Q2AA 1BI7A 3FEGA 3TKIA 3KRRA 2VO7A 3L8PA 3OCSA 4HYIA 4DGGA 5HD4A 4QTDA 1IA8A 4EZ7A 2Q83A 3KGAA 3O7LD 3ZM4A 4BWXA 3UGCA 4MQ2A 5F94A 2WZJA 3R28A 2XEYA 1UKHA 4A9TA 4ZMFA 4FNYA 2HW6A 3R7UA 1UV5A 3HDNA 3E64A 4YLLA 4EOSA 3GC7A 2XUUA 2BCJA 3GCUA 3MIAA 4ITIA 4J97A 4W8EA 4E4MA 4GU9A 2B9FA 3PY1A 4KIQA 5AWMA 3Q32A 3Q5ZA 4ZTSA 1L3RE 3IGOA 3P9JA 1BMKA 2YCRA 2HW7A 4FR4A 4ONAA 2DQ7X 3AC2A 4FG8A 3R8LA 3ZSGA 2E9OA 4O7VA 5EM6A 3PPZA 4IM2A 4U45A 2X39A 4U80A 5EDQA 1T46A 1WBNA 3REPA 2XRWA 3A7FA 4DEIA 2RF9A 5EOBA 1UA2A 4QMQA 4JI9A 1H00A 4Y72A 3FPMA 3FMDA 5LWNA 2OI4X 3LFQA 3PJ1A 4M3QA 1PXIA 3MY1A 4DITA 3IW8A 2C5XA 3UNZA 2R3MA 3IDCA 3ZUVA 3IW4A 4APCA 3ZYAA 2GNFA 3UMWA 1XO2B 3TV6A 4QNAA 3MVLA 2W96B 2CMWA 2XNPA 3QRJA 4X3JA 1F5QA 3CIKA 5CX9A 4G6NA 1SVHA 4IZ7A 3HRBA 2WOUA 4AA0A 4BCPA 4UMPA 4AZSA 4RWKA 2OICA 2QHMA 4QMZA 3ZHPC 3G33A 4CKJA 3NLBA 1H1SA 3B2WA 4RLKA 2X1NA 2QURA 2UZTA 5K5NA 4U6RA 4KKGA 3ORKA 3QTQA 1OL1A 1HCLA 3TKHA 3LQ5A 2GHGA 4S2ZA 4GVAA 3NZ0A 5HE2A 5KZIA 3GC9A 1QCFA 2FSLX 4G1WA 5JRQA 3LIJA 4IDTA 1H8FA 5TE0A 3LPBA 3KL8A 2C6EA 3V6RA 3VO3A 4Z16A 2PVKA 2PZRA 4GT3A 5CWZA 4PX6A 3WZEA 1Q8UA 3EH9A 1W83A 1OL6A 3DFAA 4OTQA 3SRVA 4D5KA 3EFKA 4FVPA 4QQTA 5L2WA 3NMUF 5I3RA 3MWUA 3ZDUA 3GQLA 3H10A 5CVFA 3I0OA 5AR3A 3A7HA 4ZTLA 4OTDA 3GBZA 3C51A 4XMOA 3ULZA 2BRBA 2RG6A 3FZPA 3WZUA 4DINA 4MXAA 2JIVA 1PHKA 3NYNA 5H8EA 3SX9A 4RIYA 4H3PA 4QYGA 2B52A 1GJOA 4NUSA 4PV0A 4FVQA 4PPBA 3NW5A 3QQGA 1FQ1B 2F9GA 4DH3A 2QONA 2R3OA 2C5OA 4FUXA 3W8LA 3V01A 4CG9A 4LGDA 4KIKB 3CY2A 3DJ6A 1W0XC 4N57A 2WU7A 3OXTA 1ERKA 3ZH8A 3D5VA 2UZDA 2YFXA 2ITNA 3NNXA 1IASA 4OBOA 2JIUA 4FA2A 2WIPA 3EFJA 1H28A 2J0MB 2Y4PA 5IA4A 3PFQA 3UG2A 5DIAA 1Q4LA 3C1XA 4IX6A 4QMXA 3MI9A 2CKOA 1XH7A 3VW8A 3D9VA 1R78A 4CMOA 3AC3A 4ORKA 4WUAA 3RTPA 4L9IA 3HMOA 2JKQA 1OUKA 1FOTA 2W0JA 2G15A 2BRMA 2QD9A 5C01A 3U4UA 4ZMEA 4PMMA 3G51A 3NWWA 4EH9A 4LUEA 4D58A 2O8YA 1H1QA 2WKMA 3QC4A 1K9AA 4N6ZA 4U9AA 2IJMA 4YC3A 3QRKA 4BIEA 3C4EA 3DK7A 3COKA 2EXMA 2C6KA 3E3BX 4E4XA 5AR7A 2YLFA 4FZ6A 2QVSE 5HTCA 1YHWA 2X7GA 4DTAA 4IWQA 2OF4A 3GFWA 2QR7A 1IAHA 5CEMA 3LKMA 2ZAZA 3PJ8A 2G2IA 2B54A 2X8EA 3BHUA 4GUBA 4K0YA 5DMZA 4YHFA 2R3PA 4BCJA 4CQEA 3D7TA 1REKA 4WUNA 4CT2A 4G9CA 3C0HA 2WGJA 5HVYA 3MVHA 4NWMA 5I5ZA 5JGAA 2G01A 4C59A 2XNGA 2UW9A 3U6IA 2DYLA 4ZXTA 3E7VA 3R8VA 5JZNA 2VWXA 2Z8CA 5C1QB 3WE8A 5DRBA 2J51A 2XIRA 4E6QA 3I7BA 4FZ7A 4L52A 4DH7A 5L6PA 4D4RA 4E8AA 3R9RA 2F57A 5J9YA 2BAKA 4B0GA 5LMKC 4QD6A 4X0MA 5DG5A 3UC4A 3E8CA 4PDSA 3QBNA 4NZWB 4WBOA 2ZJWA 3AD5A 4XG8A 4DCAA 4CFXA 3DBCA 3GP0A 5TR6A 2J0JA 2I0VA 3DOGA 1PMVA 5FEDA 3DLZA 3TEIA 4DFZE 3KRLA 2C5VA 4F1TA 1XHAA 2BHHA 5BVWA 3QZHA 4GKHA 4QP3A 1TQPA 5E8VA 3I0QA 4MH7A 3RJCA 4FL1A 1WAKA 3TNWA 1SVGA 3IKAA 4EOJA 4EQUA 2WQMA 5E91A 3BE2A 4FIEA 3R00A 4A4OA 4FV6A 3D94A 1URWA 4DEEA 3O2MA 3E8NA 5CSPA 4JT3A 4UYNA 5CEQA 2C6LA 4U40A 3PIZA 3PXZA 4EOPA 3C4XA 3H30A 4LG4A 2BZKB 2X81A 2X6EA 4DLIA 4IMYA 4M15A 1CKJA 3PWYA 4XS2A 3S4QA 5GINE 5E7RA 5IQBA 3F6XA 3MVMA 3QC9A 4O91A 1CKPA 3SW4A 1YOJA 3QXOA 3HMIA 4NW5A 4RIXB 4L45A 5FGKA 3BYOA 2UVYA 3SHEA 4E7WA 2AUHA 4D0WA 3AG9A 3LVPA 4Q9SA 4LOPA 3OROA 5DA3A 4NSTA 4M68A 2UW7A 4Y8DA 3ZRKA 4AW1A 3PSBA 3QLGA 5FEQA 4CZYB 4V0GA 1A48A 2QG5A 1KSWA 4M12A 5A4CA 4KABA 3VUKA 2YAAA 5DN3A 1Q8YA 4HGLA 4DGOA 4DH1A 4ENYA 4EJ7A 2UZUE 3D5XA 4YJPA 4E6CA 4ANLA 1KUTA 3MPMA 4I20A 3A61A 4BDIA 3AD4A 5GHVA 3C5UA 3PVGA 4L43A 1M2PA 2F2CB 4ACCA 4C33A 4C4FA 4C7TA 1Q97A 3VN9A 4KKHA 2EVAA 4YJTA 2JITA 3MB7A 3ZONA 1Q24A 2GU8A 2OJJA 1XH5A 3GGFA 4DGNA 5IA0A 5J9ZA 2B0QA 3D5UA 4X3FB 4DGMA 1H24A 4TYHA 2WXVA 3PUPA 5JMSA 2XNOA 3O8UA 2F7ZE 5I3OA 4M67A 4RC3A 3LE6A 4BHZA 4DFYA 4F99A 4GVJA 4RA5A 3I5ZA 2ITXA 3DAEA 3P08A 4QOXA 2JBPA 1B6CB 3N4VA 2B4SB 5KE0A 2W1HA 4FTTA 3UG1A 2PUPA 2XH5A 3SQQA 5M06A 1SVEA 3ANRA 4K8AA 2PZIA 3TTIA 3Q4TA 4C8BA 2P4IA 5C03A 3RK9A 3R9HA 4CV8A 2B1PA 5IA2A 1QPEA 1KE8A 2YM7A 4GCJA 2XK6A 3QTSA 2DS1A 2J6MA 5D9HA 4D2VA 1R0EA 2R2PA 3PLAE 3HA8A 4ZSGA 3NUXA 3GU7A 3KU2A 3BHHA 3KXGA 4M0ZA 3CGFA 4RJ4A 4JJRA 4DEAA 2XK7A 5HO7A 3FDNA 1H25A 4X2FA 5J5TA 2QI8A 3PVUA 5DLSA 3A7JA 3UP2A 3S00A 4BKYA 3D4QA 5F9EA 3FL5A 1O6KA 5CI7A 3UOLA 4E93A 3EWHA 2PMOX 4R8QA 5AUTA 4P90A 5ACKA 2Q0NA 3HDMA 2BDJA 4FV8A 2G1TA 4FTOA 4C4JA 4BKJA 1VJYA 5EKNA 4TN6A 5E8YA 3RCJA 3UVRA 3QU0A 4FIJA 4M7IA 4XX9A 3RBWA 3L9NA 3ZO1A 4RSSA 5I9YA 1JLUE 3W2OA 5ANGA 4CLJA 3BLHA 4MXOA 3V6SA 4D2RA 3P5KA 3E93A 4O0SA 4QTBA 3TNHA 4BI0A 2KULA 1NW1A 2J5FA 4HCTA 4AAAA 3FLWA 4G6LA 2BZJA 4BDGA 3MH3A 4QP6A 3PTGA 3DB6A 3LFFA 3SAYA 4X21A 4XHKB 4RIOA 4JAJA 4YJRA 1MQ4A 1YXUA 2B9IA 1JSUA 4BWKA 1YWVA 3F9NA 3PSDA 4TZRA 4KINA 4IDVA 3R8UA 4P5QA 4FEQA 4W4VA 2V7OA 5BVDA 1XH4A 4J53A 4JIKA 3GXLA 2OH4A 4UALA 3BEAA 3IW6A 3QX4A 3UO4A 2J90A 3WIKA 3OY1A 4EQCA 5E9EA 1SM2A 2ZMDA 1NVQA 3NEWA 3CE3A 2YIXA 4LL5A 3PXFA 3VUGA 5CSXA 2QOLA 4R5YA 2YACA 2YCQA 5AUYA 3LCTA 5JN2A 1OITA 4M66A 4CVAA 2BALA 2YZAA 3DXQA 3VVHA 4FTAA 1DS5A 5IQFA 4FSNA 4O7LA 5AAEA 3TM0A 2Y0AA 4C36A 2O5KA 4PMPA 3HMMA 4PDYA 4AN3A 3IDPA 2FB8A 5HBEA 1Q41A 3I1AA 4FV7A 5HESA 3UO5A 3U55A 5FTGA 5HU9A 2CLQA 4PP7A 4BYIA 3JVSA 5BMSA 5ETCA 5BVEA 4X2GA 2W06A 4EQMA 4MNFA 4BF2A 3RPVA 4OTIA 3SA0A 2XEZA 3QKMA 1P2AA 4D5HA 4NKAA 2GQGA 5FDPA 3LAUA 4ZTNA 2QR8A 5HE3A 4QMTA 3EQDA 2HCKA 4QT1A 5CNNA 5BQ0A 3K2LA 5AX9A 5C27A 3OBJA 3R7YA 4EH5A 1JWHA 4FSUA 2YWVA 1FPUA 2CCIA 2PK9A 2VU3A 3ZSHA 2C6IA 4F63A 1DM2A 1Q8WA 3OOGA 4OTWA 4OTFA 3TIYA 4FT5A 3P7CA 1OM1A 1WVWA 3O23A 4AA5A 3V3VA 4MF1A 5HBJA 2QG7A 2JGZA 2I0EA 2RFDA 2XKDA 4YNEA 3WZKA 5IUIA 1ZLTA 4XUFA 1ATPE 2PZPA 3R30A 4NTTA 5AP3A 4O7ZA 3HV4A 2WEVA 4XG7A 4FSTA 3SGCA 2GS2A 4RFMA 5DPVA 4IAFA 3WE4A 4CYJA 4K11A 4E1ZA 1OPJA 3EOCA 2PHKA 3UMXA 1M17A 2WMSA 2XK3A 3FZSA 1M2RA 3OF0A 2G2FA 3FKNA 3TUBA 3PIYA 5M4FA 5H9BA 3V5QA 4EK5A 3D15A 4FKPA 4U3YA 3A99A 3GCSA 4O22A 1YOMA 3ZSIA 4GKIA 2W1GA 3FZOA 5GZ8A 1J3HA 4RFZA 4LYNA 3TG1A 4ERKA 3W2CA 3LM0A 5KUPA 3EJ1A 2BVAA 4TXCA 1M7QA 3VS7A 5EYMA 1ZYJA 4BICA 3ULIA 1UNGA 2NRUA 3Q3BA 3PG1A 4F9WA 3QWJA 2BZHB 2OKRA 2E9UA 3C13A 2WFYA 4XBRA 5M07A 3QCSA 4DBNA 3ORMA 4BR3A 4RQVA 3DNDA 4JBPA 1KE9A 1ND4A 4KIOA 2UV2A 4IAYA 4JR3A 4EK4A 4QYEA 3MTFA 2O0UA 5AX3A 1J7IA 3VS6A 2YDKA 3MPAA 3TV4A 1JKTA 3PIXA 2I0HA 4F65A 4IHPA 4PQNA 5HTIA 1KE5A 4FK3A 4UZDA 3Q6WA 4QQCA 5DI1A 3DAJA 2YHVA 3QGYA 4CTCA 2FGIA 3LXKA 5HE1A 5EHOA 3Q9WA 4TY1A 1CSNA 4ZLOA 2EB2A 2XYUA 5K9IA 3F88A 4FSYA 4F6WA 2IVVA 4ZJVA 3MS9A 3FY2A 1GIJA 1GY3A
chains in the Genus database with same CATH superfamily
4EH3A 1WBWA 4JDHA 2ZB0A 5HG5A 1PYXA 3CS9A 4GT4A 3QKKA 2QOIA 4GSBA 2VWIA 2C0OA 1OIQA 2OFVA 2YN8A 1WBSA 5AR8A 3TDWA 5I9VA 3QZIA 4JOAA 4V05A 3FXZA 3HX4A 1GIHA 4NM7A 3R7IA 4F7JA 4G9RA 3SXSA 1U46A 3C5IA 4Q5HA 3TZ7A 2FUMA 3R8PA 2V55A 4EOKA 3PA3A 1QPJA 5BX0A 4HOKA 3G0FA 5IISA 4FSMA 2C3IB 4FTJA 4ZS4A 4AFJA 5HVKA 3MV5A 2A0CX 3WI6A 4Z55A 2VGPA 4XP0A 1U4DA 1PXNA 4PTGA 2G9XA 5AIKA 4FIGA 3LW0A 3LCOA 2VTPA 4U8ZA 5FEEA 5TT7A 3RK7A 4QPSA 3ZXZA 4R3PA 3GOPA 4NM3A 4O2PA 3QHWA 4FV3A 5KMOA 1J7UA 3BBWA 3EN5A 3DK6A 4WSYA 2OZAB 4ID7A 4IWPA 2I1MA 2R3QA 3Q04A 4AZFA 4FKRA 4BZDA 4C4HA 1YKRA 4EOIA 3RNIA 4BJJB 3QA8A 2VX3A 3OC1A 3DGKA 3FHRA 4BY9E 2AC3A 4GYIA 1YXXA 5IH5A 1W7HA 1OIUA 3OOMA 4RZVA 3FY0A 5B2MA 3WF9A 5LOHA 2C1BA 2RIOA 3E62A 4KRDA 5DHJA 1PXJA 4MX9A 4JX3A 4TWOA 3AKLA 2J5EA 3P86A 1ZYCA 2CGVA 3NDMA 4RMZA 2XYNA 5K5XA 3V04A 5AR5A 3LMIA 4UZHA 5HTBA 2A19B 3KCFA 4GJ2A 3HGKA 4ALUA 3MFTA 3W0PA 3FSKA 4GG5A 4U3ZA 5JRSA 1KE7A 3ZS5A 3S1HA 3NVKI 4OLIA 5EG3A 4F7SA 2E9NA 3PJCA 3BGQA 3BPRA 5CI6A 1V0PA 5EYKA 3RWQA 4BBMA 3Q9ZA 4AXEA 3FSFA 3KXZA 2ZM4A 1U5RA 3O96A 3O0GA 3OP5A 5CU0A 4I24A 5IF1A 2H34A 5EM5A 5IH4A 3JYAA 2JAMA 3VS4A 1MRUA 4J71A 2NRYA 2BTSA 5FQDC 3EQFA 3MBLA 2GTMA 3PLSA 3FLSA 3GVUA 4OAVB 2GSFA 2OWBA 4DCEA 5HU3A 5HNIX 2XBJA 3NIZA 5J9LA 2WMVA 3R71A 4USEA 4UN0C 4RWIA 4AX8A 3WBLA 5AR2A 4ANOA 4WIHA 3Q9XA 4IVCA 4YO4A 3RGFA 4C58A 3ANQA 1ZWSA 2O64A 2A2AA 2CKPA 3KXMA 4O96A 3ZFMA 2ZB1A 5A6NA 3KMWA 2X7OA 3EIDA 3MFUA 4EBVA 3ZMMA 3VRYA 3HVCA 4M97A 4X3FC 3PXKA 4HJOA 4FZFB 4WHZA 3OWPA 3A7GA 2QO7A 1BX6A 1W84A 3K3IA 5KX8A 4Z9LA 1VZOA 2EXCX 3BU5A 3IECA 3JUHA 2WTKB 4NL0A 4YO6A 3NPCA 4PNKA 3M42A 1PMNA 4RIWB 4BN1A 1XWSA 1ZAOA 5L6WL 5BV3A 3I79A 2VTRA 4EK8A 5AM7A 3VULA 5M08A 3U8WA 4WG3A 4TNDA 1PW2A 2P2IA 2BR1A 4WNMA 3E3PA 1TKIA 3ODYX 3POOA 3VJNA 3HEGA 3BYUA 3QD4A 4FTCA 4DFNA 1M2QA 3VC4A 3OBGA 4BTMA 4AE9A 4JVGA 4FT0A 2C69A 3PG3A 4MTAA 4MYGA 5DR6A 5FBOA 4BVUA 4JQEA 4C4GA 4CFFA 4HW7A 4EUUA 5JH6A 3D7ZA 3HUCA 1UWHA 1BL7A 3BHVA 2BMCA 5FM2A 3TT0A 3CC6A 4YJUA 4CFUA 3ZBFA 2JDOA 4DT9A 1NT2A 1ZYDA 3IK3A 3IW7A 2W4JA 1KWPA 3BYSA 3C0IA 4D2SA 5AP5A 4AXCA 4FNWA 4ARKA 5ACBC 5J1WA 2BIYA 4IW0A 4XG9A 2V62A 3MJ1A 2JC6A 3C4FA 4D1SA 4JG8A 3BGZA 5T6KA 4O0TA 4HVGA 1DAWA 2YIWA 3R2YA 4MHAA 3WF7A 3ZFYA 3AC4A 3O8PA 2W5HA 5AV4A 5ITAA 4WOVA 1OL7A 2CJMA 3GUBA 3G5DA 3FL4A 4EKKA 3TI1A 3ZXTA 4I5PA 5FP5A 2H6DA 3C4WA 1PKDA 3LFCA 3ORPA 2HENA 3O71A 5HKMA 2VTQA 3KF7A 5M51A 2JDSA 2QOCA 2YCFA 3WZDA 4L7SA 4AFEA 4CFWA 4AOTA 3DB8A 4M14A 2XA4A 3SG9A 4CFVA 3F7WA 2JFMA 3FMEA 3KXXA 3HECA 5ETFA 1GAGA 5F4NA 4A4XA 2Z7QA 3WARA 2C0TA 4BC6A 4Z7GA 3H9FA 4UYAA 5D41A 1IRKA 3GU6A 4FG9A 4PWNA 4NIFB 3VUHA 3QTWA 5CS6A 4O21A 4C62A 5LMBA 5LVLA 2WB8A 3AT2A 5HI2A 3F2AA 3UQCA 3HMPA 5TKDA 2VTAA 4G16A 4ZK5A 1P14A 5CLPA 4AOJA 2X8IA 3R0TA 3VHEA 2OJIA 5J7BA 3GFEA 3MVJA 5IH6A 4FV9A 4YP8A 3QQLA 3ID6C 2CNQA 2BHEA 2F2UA 5C9CA 4CV9A 2OIQA 1FVTA 3EFWA 2PMIA 3CQUA 4RX7A 2CDZA 4J52A 4UEUA 2UW8A 5HNBA 1YW2A 4L53A 3ZLWA 4A9SA 3MFSA 3RHXA 4BFMA 3E7OA 3SD0A 1E1XA 1PKGA 2WD1A 3E8EA 2R3FA 4H3BA 4JDJA 4FNZA 1UNHA 2CHLA 5K3YA 5C8MA 3ZUUA 5I9XA 3OTUA 4GEOA 1YWNA 3CBLA 4EBWA 3DJ5A 2F4JA 3OFMA 1HOWA 1W8CA 3II5A 4W8DA 3DY7A 3R1QA 2C1AA 5AP7A 4DC2A 4WNKA 2LGCA 3O7LB 4RRVA 5CVGA 5DE2A 3WZJA 4V04A 4XG2A 4U7ZA 3FKLA 4HZSA 3GU8A 3ERKA 2VWBA 3F82A 2XCKA 3QTUA 4ITJA 2XK8A 3G0EA 4J8MA 4M0YA 4DFXE 3SLSA 4EZ3A 5IUHA 2PVYA 3QTXA 4DE4A 4I1ZA 4KA3A 4QYFA 2UW5A 2ERZE 3LFAA 4WG4A 1XJDA 3PYYA 3QX2A 3TL8A 3PY3A 2YABA 2OLCA 4JDIA 1Q5KA 2QCSA 4FTLA 3AMAA 3Q53A 5H8GA 3D83A 5JFXA 1Z5MA 3RALA 1ZY5A 4I5MA 2CKQA 3FZTA 3RVGA 4AGWA 3VF9A 2ZDTA 5CU3A 5EQYA 1CDKA 2UW3A 4QQ5A 4N6YA 4NK9A 2B53A 3CGOA 2R7IA 3G9NA 3KMUA 4BTKA 2NO3A 2XIXA 5HICA 3BGPA 3UNJA 4LV7A 4G3GA 2QLUA 4CNHA 5AV1A 2WMRA 4GW8A 5HZNA 2PMNX 1Q62A 3LQ8A 3PZEA 2V22A 4IAZA 2P2HA 4CTBA 3FMJA 4YJNA 4ACMA 2IG7A 3P78A 2VD5A 5I9ZA 4FE2A 4CGAA 1FMKA 3I6WA 3OY3A 4YTIA 4AOIA 2O2UA 2OXDA 4A7CA 4BCIA 4AZEA 3P1AA 4JQ7A 4QTAA 3BU6A 4KB8A 5IU2A 1U5QA 4I6BA 2G2HA 2VWZA 3G15A 2OG8A 1LR4A 3TWJA 4A4LA 3I60A 4IFGA 2C0IA 4LOQA 4DEHA 5D12A 2GQSA 4KKEA 4YPSA 4UV0A 4AT5A 1H26A 3EHAA 4RVTA 1FGKA 4RT7A 4J1RA 4NT4A 3FJQE 5DYJA 4CMTA 4BYJA 4UX9A 3TDVA 4H1MA 4FUYA 5CAVA 3SW7A 3BQRA 1UU9A 5E4HA 2Z2WA 1IA9A 4ENXA 3SV0A 2YM4A 3DQWA 4QP1A 4ZY6A 5DT3A 1Q3DA 2OFUA 1FVVA 5D7AA 3NW6A 3LCDA 3R1SA 2Y4IC 4BDAA 4IM0A 3EL7A 4BI1A 4GRBA 4F7NA 4ZZOA 3DZQA 2OXXA 5HBHA 5DWRA 4RWJA 5D11A 3UTOA 5HO6A 3W55A 3TUDA 3GOKA 3FC1X 5CF4A 5M57A 2EXEA 5EOLA 4R1VA 3E87A 1E1VA 5HO8A 4DEGA 1V0BA 5FM3A 1PMUA 2GPHA 2YM5A 3MPTA 4RX8A 4EH8A 2ZMCA 4L3LA 3TKUA 3UOHA 2IWIA 2WEIA 3GU5A 4FKWA 5KMJA 3AC5A 3OXIA 2WIHA 3VJOA 3W10A 4BCHA 3T8OA 3SXFA 1JAMA 4DH8A 5J8IA 5L6OA 1L8TA 2Y8OA 2VTNA 3C50A 3OCBA 4ASZA 3NNUA 5AFVA 2W99B 5GZ9A 4PP9A 4BCFA 3V8WA 2CGUA 3O50A 2PMLX 3LFEA 4HYSA 4LM5A 3RZBA 4R7BA 3BX5A 4BCNA 1OUYA 2YERA 2WTDA 4I5HA 4QNYA 2GTNA 4RG0A 4F64A 2GNIA 3NR9A 4NEUA 2YEXA 2IZRA 4CYIA 4MKCA 2I6LA 3ORZA 4EH6A 4IXPA 1U54A 2BRNA 2UW6A 3GCQA 4MD8E 4O4BB 3PRFA 2VX0A 3OWKA 3RPRA 2PU8A 4U97A 3FMKA 1J1CA 2WQNA 4QMUA 1RW8A 3E63A 3EYHA 5EM8A 2W1DA 4YZ9A 3VS2A 4XYFA 4WA9A 2FSTX 4O6LA 2IPXA 4O7WA 4IIRA 1JSTA 3RPSA 4FSZA 4FEXA 4F09A 2RKUA 3EN9A 3KFAA 1XKKA 4MBJA 3CCNA 4GK3A 5GJGA 4BBEA 4RA4A 5FTQA 4AXAA 5K4JA 2P3GX 3A60A 4EOLA 2Z02A 2VO0A 4O0XA 2YAKA 4F9YA 4EI4A 3N4TA 2WMQA 4JDKA 1OI9A 5IMEA 3ZLXA 5IQDA 5C26A 4I94A 5E8TA 4MWHA 4KD1A 3C7QA 3V51A 3L8VA 3ENMA 1R39A 3FZRA 3QCQA 3OW3A 4U0IA 3CJFA 3NUPA 4CQGA 4QPAA 4ZP5A 5LMAA 3MH0A 2PY3A 3NYXA 2PE2A 3F2RA 4LQMA 4RJ6A 1T45A 1JQHA 2ITZA 2UW0A 5FLFA 3HRCA 3OHTA 3CPBA 1ZARA 3FXXA 2ONLA 2VWVA 2X8DA 5CSWA 1YHSA 4I93A 4HVHA 4Q9ZA 2RFSA 3PDTA 4FTKA 4I6LA 4DYMA 3GNIB 4DDGA 3AXWA 4K18A 4AGDA 4BDEA 1KV1A 3SRVB 1QL6A 3DDQA 4C2WA 2KTYA 5FUTA 2ZM1A 3QF9A 3ATSA 3DFCB 2IZSA 1NVRA 1MP8A 4GG7A 5IDPA 3ZEWA 3PA5A 4TTHB 3ZO4A 3EL8A 2WPAA 3JY0A 4IC8A 3CJGA 3ORIA 4IACA 3O51A 4II5A 4RIYB 2UUEA 4YLKA 3VBYA 2VTJA 5EW8A 4BIDA 3BBTB 4DEDA 3U54A 3CD8A 4IVBA 4O1OA 4IWOA 3ATTA 3H4JA 3LHJA 3R1NA 2YISA 4BTFA 2QC6A 3BWFA 1P5EA 3PLAE 4OBPA 5EM7A 4I23A 3LLAA 2UZNA 4E4NA 2Z7SA 1GNGA 1YDRE 3WIGA 4C57A 4L42A 5IG1A 4FNXA 3FV8A 3KXNA 3E88A 5BUEA 2VTTA 4L01A 3Q4ZA 1P4OA 3ZM9A 4IH8A 1UU7A 4WSQA 5EI8A 2EB3A 5KNJA 3BCEA 3BLQA 4MD7E 4IAKA 2ESMA 5A4EA 4O7TA 1OIYA 2WTKC 4HPUE 3RAWA 3OXZA 4MCVA 4HVDA 2WHBA 1UU3A 5I9UA 2J0IA 3OMVA 3UPXA 2IW6A 4GFMA 1BKXA 1W98A 3DBDA 2XBAA 4WRSA 4D4SA 1PJKA 2R9SA 4FKOA 3DKGA 3TNPC 3V8TA 4C4EA 5LVOA 4CZUA 4RJ7A 4X6QC 1PXOA 4FKLA 2UVXA 4EZ5A 4XEYA 2X0GA 2XIYA 3AGMA 4LL0A 1ST4A 3Q2JA 4DG2E 4FV1A 3AT3A 3BV3A 1URCA 4KAOA 4WO5A 3RM6A 4QP9A 4OT5A 3HZTA 3W2RA 1ZOEA 4O0RA 2PE0A 5HG7A 4BZOA 3IO7A 3D7TB 3LCSA 3QTZA 3QYWA 4GMYA 3W2PA 2SRCA 4LMNA 4KRCA 1IEPA 2RL5A 4KIPA 3W16A 3BELA 5BVNA 5D7VA 3TTJA 3UO6A 4IB5A 3UZPA 3PRIA 1Y57A 1SYKA 2ITTA 2VWYA 3A2CA 5LCKA 1ST0A 2QOFA 3V8SA 5KMNA 4FEUA 4QP7A 3VQUA 3W8QA 4I21A 2JKOA 3CSVA 3QLFA 4IAIA 1UWJA 1WBPA 3BKBA 4D1ZA 5FDXA 3K3JA 4FGRA 4BBFA 2FH9A 3QZFA 3ZRLA 4NTSA 4C34A 5KMIA 3HNGA 3DKOA 3LXNA 4E73A 1Q8TA 4I41A 4NCTC 3NFGB 5AV0A 5ANIA 1SNUA 4UWBA 2JEDA 5E90A 2OO8X 4AA4A 4F0FA 5KMMA 1ZOHA 3NGAA 3VS3A 2O3PA 4XV3A 2R0UA 5JK3A 3ACKA 5CU2A 2B55A 3IPHA 3NUNA 2J9MA 2VRXA 4Y83A 4ZSLA 3QWKA 4ZTHA 4DT8A 4JRVA 5EW9A 4H39A 3ZDIA 2WNTA 2RFEA 2JKMA 5FWKK 1Q8ZA 3LLTA 1WBVA 4CRLA 2ITWA 2RG5A 3N9XA 2OXYA 4L8MA 2OJGA 4HCVA 4D2TA 1PXKA 4EYJA 2BFYA 3ITZA 3VBVA 3GEQA 2YJRA 4MXXA 2IN6A 2PSQA 4RX5A 1V1KA 2ITPA 5LCJA 4O83A 1LP4A 3I7CA 3NUSA 4EHVA 5A54A 5BVKA 2C30A 2BKZA 4ZJIA 4EORA 4RX9A 1XBAA 1Q3WA 3ET7A 5ANDA 3QUPA 2GHMA 1Y91A 1OGYA 4MNEA 4Z3VA 3VAPA 1MRYA 3QXPA 2RFNA 3TCPA 5IPJA 4GL9A 4AQCA 3MYGA 3PPKA 4XV1A 1ZYLA 4CG8A 4YZBA 1H0WA 4A9RA 4B9DA 4IWDA 4IAAA 2WQEA 2ZVAA 4U79A 1LEZA 1VYZA 4P7EA 5AR4A 5FRIA 1YXTA 2HELA 3M2WA 5HCYA 3TJDA 3ZEPA 4V0GB 2B9JA 3NFFB 3UDTA 3RI1A 1RDQE 4G6OA 1Z57A 4GUEA 4PTCA 2Y6MA 2OK1A 4FK6A 2WMWA 5L8KA 2OU7A 4FTUA 4M69A 3Q2MA 2W4KA 3AT4A 5AP4A 5KZ0A 3AD6A 3NIEA 4O1PA 4YHJA 3ROYA 3FMHA 3MIYA 3MTLA 3QZGA 1VR2A 4I92A 3CQWA 4GJ3A 1XH8A 3LJ0A 5G6VA 3MH2A 5TO8A 4AT3A 5IEXA 2XALA 3FMMA 1KOBA 2OJFE 5LWMA 5ANKA 3KULA 4M84A 5AUWA 1G8JA 3EQCA 4CRSA 4H36A 2OJ9A 3NW7A 4TYHB 3R7OA 1YI3A 1DAYA 4JQ8A 4E4LA 3TZ9A 2QO9A 4EYMA 1QPDA 4AUAA 5FXSA 5I9WA 4RJ5A 5DT0A 4J7BA 5EHLA 3RMFA 2GCDA 2AC5A 3IQ7A 4TWNA 4ASXA 4ZLZA 5CANA 4IZYA 3TZMA 5EFQA 1XH6A 2W05A 2X2LA 5J79A 5CNOA 2XNEA 3MESA 5ANEA 3KRXA 4F1MA 4HGEA 5HNGA 3VUIA 5CF5A 4O81A 4CSVA 4QMSA 3RAHA 5E8XA 2XKFA 2UZEA 3EN7A 3R73A 3SC1A 5B7VA 2V5QA 3I81A 2VX1A 3EMGA 3QTRA 5AP1A 1JNKA 2VGOA 3DBEA 3FHIA 4RGJA 4AG8A 2J50A 4FGBA 4ZOGA 2GHLA 3VUTA 3QQKA 4YNOA 3ORNA 3KVXA 4JAIA 4ZTRA 5BMMA 2GMXA 4O86A 4YZMA 2JDVA 3A8WA 3KC3A 2W1ZA 4RFYA 2XJ1A 4L68A 3POZA 4AP7A 3UC3A 3UBDA 5HE0A 4GK2A 3NX8A 4V01A 3NAXA 4RPVA 4EK3A 4FEVA 4KS7A 3G6GA 3OUNB 3EZRA 5JFSA 4O0WA 4XP3A 3DJ7A 1UU8A 4Y85A 1JSVA 3UYSA 1M14A 4EH7A 1XMLA 3OEZA 4L46A 5KCVA 3UZRA 4QMPA 5KHWA 4BIBA 1G3NA 4QMOA 2R3RA 5JGDA 2BIKB 2QOBA 3U9CA 1PYEA 3IOKA 2Y4IB 2R3NA 4DH5A 5CAOA 4OTRA 1YXVA 3SVVA 4BCGA 3AKJA 4KSPA 2OIDA 3QALE 4L44A 4PMSA 4BGQA 3K54A 5CSHA 2C6MA 2BFXA 3MH1A 4TYGA 5AMNA 3QQFA 1Y8GA 3ORLA 3DDPA 3FBVA 4NJDA 3C4CA 4MQ1A 4MXYA 2XJ0A 3HYHA 3DK3A 3BYVA 2E2BA 3PZHA 5KBQA 4IX4A 2W4OA 4FKTA 3VONA 5C8NA 2W17A 1Y6AA 2HIWA 4KWPA 2GQRA 1RQQA 5LVMA 4IM3A 4WT6A 4AN9A 4YJQA 3R7EA 4EHEA 5M4IA 2R3KA 4H05A 3CP9A 3LFSA 2V0DA 5HX8A 3PP1A 3VF8A 3QRUA 4MAOA 4W9XA 2Y7JA 3KN5A 1WFCA 2WMUA 3DCVA 3MB6A 4GS6A 5DGZA 4EHZA 1W2DA 3GU4A 1P4FA 3C9WA 3V5JA 5BVFA 4JLCA 5H2UA 4E3CA 4BDBA 4TL0A 4YZDA 2WMXA 2XF0A 2WU6A 5IKWA 4PF4A 3F3ZA 4IVAA 4R3CA 5AAFA 5EDRA 3BYMA 5FTOA 2V7AA 3ZBXA 4Y46A 3DXNA 4EL9A 4FTRA 5E1SA 5L2QA 4DG0E 5HD7A 4J98A 4X6RA 3FI3A 4ZIMA 5IQHA 4U43A 4YHTA 3KK9A 3MN3A 4L7FA 4USFA 4U42A 3QGWA 3UZTA 5L2IA 5H8BA 4NYEA 2R5TA 2ITUA 2Z60A 3DTWA 3LQ3A 2C6DA 1NXKA 3QQJA 3U51A 1H1RA 4NW6A 1Z9XA 4DTBA 4HVIA 1PY5A 2X2KA 5C4KA 2WO6A 3I5NA 2C68A 3DLSA 4N0SA 3CY3A 4PTEA 1CKIA 2HZ0A 4LOOA 3DNEA 5CT7A 3FC2A 3RKBA 5AUXA 5A46A 3RAKA 3UPZA 2RSVA 3HA6A 4C38A 3F3WA 5GJDA 3RCDA 3LJ2A 2NP8A 2PVMA 4DTKA 4ALVA 1F3MC 2HYYA 5JSMA 4FOCA 3S95A 2QKWB 4USDA 2ITVA 4W9WA 3GT8A 3UODA 5CTPA 3FQSA 4QDVA 2CPKE 3AKKA 3RK5A 3KF4A 4HCUA 5TOZA 4DBXA 1FVRA 3BE9A 3KY2A 1YHVA 5J7HA 2CGXA 3DQXA 4A9UA 3FI2A 5CAQA 1SMHA 5LVNA 2UZWE 3A4PA 4ACDA 3ZZEA 4QMNA 2XAOA 3W0QA 2ZV9A 3Q6UA 4YPDA 2WQBA 3DAKA 4CEGA 5KMKA 1CM8A 2J0LA 1OB3A 3QCXA 2VNWA 3QUEA 2UZLA 4YSJA 2OGVA 5LARA 5CAUA 2JBOA 2YLEA 3ZU7A 4LRMA 5IDNA 2XVDA 3A8XA 3PXQA 3OD6X 4IX5A 5AUVA 4OW8A 3LFNA 4WG5A 4O0YA 3KB7A 4PDPA 4UMTA 3ML1A 4S31A 1Q99A 4D4VA 5IQCA 2WTJA 4BDFA 5JGBA 1MQBA 1J91A 5JQ5A 3F69A 5A4LA 2AEGA 2W1IA 4QMMA 4HVSA 3KKVA 2WTWA 4I6QA 1GZOA 4ZEGA 5CEPA 5FBNC 1OMWA 4OR5A 2X0OA 5M44A 3ZO2A 4LV8A 3P79A 2ZV8A 3GQIA 4RVKA 4AZTA 3LFDA 5IEYA 2QNJA 4BTJA 5A4TA 1R0PA 3R9DA 3FLQA 3HV3A 4O2ZA 3COMA 3BIZA 3PSCA 3V5LA 3NS9A 3HV6A 3R83A 4NJ3A 3QD0A 3MJ2A 5EQPA 3A4OX 5HQ0A 5I4NA 3E8DA 5HLWA 4MF0A 3TMOA 5T68A 1JPAA 4RZWA 3O5AA 2GNLA 3H3CA 4FV2A 1H0VA 4FV4A 4ZY5A 5JKGA 3JS2A 3FLNC 1H1WA 2BDFA 2X4FA 3QQHA 4LFIA 1ZXEA 3FI8A 5DRDA 3UDBA 1A06A 3FQHA 3EQPA 3FMNA 1NA7A 1GZ8A 2FYSA 3ZUTA 4GYGA 5AUUA 4JL9A 2HY81 3OCTA 1ZRZA 2PUUA 3KEXA 4YLJA 4NM0A 1KOAA 5G1XA 3Q4CA 4YC6A 3ZC6A 5CXZA 3NRMA 1OKZA 4P5ZA 4GV1A 4IJ9A 4EKLA 4PPCA 2XK9A 4JIAA 5DEYA 4AACA 4YTCA 3UP7A 2BROA 4FIIA 1WMKA 2ITQA 4BL1A 4C2VA 4O7YA 5IQIA 4DFBA 4S30A 2WQOA 1H4LA 2HAKA 4RVLA 2BTRA 4NKSA 5AM6A 3VUDA 4YMJA 2XAMA 4E26A 2QOQA 4FT9A 4BWPA 3ZO3A 4C37A 1I44A 2A1AB 2ITYA 4KIKA 4FVRA 3DTCA 3FKOA 5J95A 4EOQA 3KA0A 4XLVA 1OPLA 2PYWA 4K9YA 3N51A 4M8TA 3UQGA 4TYJA 4F0GA 4RVMA 3HUBA 3UIBA 1K3AA 4FOBA 4O4DA 5BYLA 2W7XA 3GCPA 4FKIA 4JRNA 3NAYA 2R3GA 4CD0A 4FV0A 5M4UA 4BRXA 4D28A 2PVRA 4UXLA 3V5PA 3CXWA 1VLRA 5CSVA 2XM9A 2VTMA 2EWAA 5JFWA 3A62A 2PZYA 3W32A 3PP0A 2CNUA 3OT3A 2JKKA 3FI4A 3LJ1A 4NU1A 3SDJA 5DEWA 4D2WA 3OEFX 2VTHA 4TPTA 5BPYA 2GS6A 5CYIA 5K0KA 1OKVA 4IADA 1OZ1A 1Q61A 4PMTA 2VZ6A 5CT0A 4RBLA 3VRZA 2ONLC 2W1CA 4WKQA 1IG1A 4DF3A 2JLDA 2ZOQA 3GC8A 2WELA 2YIQA 4G3FA 4GIHA 3CPCA 3R02A 4QO9A 5M4CA 2GFCA 3WF5A 2UZBA 2IW8A 4BDDA 3VBWA 3NVMB 3R01A 4BGGA 1NY3A 3U87A 4C4IA 3BZ3A 4DG3E 1XR1A 3VIDA 5BYYA 5F95A 4AWIA 4R7IA 4U41A 1G5SA 3DA6A 3AC8A 1ZZLA 3NYOA 4PNIA 3S3IA 5HIEA 3SXRA 1OKWA 4O27B 3BL9A 3OG7A 3CEKA 4H3QA 4HNFA 1J1BA 4OTHA 1KV2A 4LRJA 4G5PA 3SOCA 1PXMA 1H1PA 1I09A 4PL4A 4QMLA 3VHKA 5CXHA 4GFGA 4C3FA 5LJJA 5HLPA 4FKSA 4WD5A 4I4EA 4AF3A 4B99A 4D1XA 4C3RA 2O65A 5HIBA 3ALOA 3F66A 2GFSA 4UMRA 4B4LA 2ZFYA 3W0RA 4FKQA 4P2KA 3QA0A 1MUOA 2H9VA 2WTIA 3ZRMA 4GH2A 4YSMA 1EH4A 5HG8A 5DT4A 5KKRB 4IB3A 3TXOA 4DAWA 4JR7A 3KMMA 4EOMA 2B7AA 4I6HA 2Q0BA 1LEWA 3DPKA 5HEZA 3TJCA 3F5GA 4BHNA 4N70A 5E1EA 3DXPA 1WVYA 2W1EA 3B2TA 1SZMA 2C3KA 3CTQA 1OBDA 5M09A 4FIHA 4KUJA 3EQHA 4ERWA 4NH1A 4YR8A 5CAPA 2C47A 5AEPA 3F5UA 4AQKA 4BZNA 4F9CA 3R04A 5L2TA 3HLLA 1O6LA 3EB0A 3JY9A 4G2FA 4AXFA 4FKJA 2YA9A 2GNGA 1LUFA 2BPMA 4ZS0A 3EYGA 4A9YA 4FX3A 2BKKA 1TZDA 5EDPA 2CLXA 4RIXA 3V5WA 4K2RA 4C3PA 5GIOE 4C0TA 1B38A 4NM5A 2I40A 4FL3A 4U5JA 5AUZA 2WAJA 3MSSA 3HAMA 3DV3A 5EQEA 4ZSAA 2HK5A 4QYHA 1CTPE 1YVJA 3BEGA 3S0OA 4MXZA 5IUGA 4LUDA 4DEBA 4XJ0A 5EH0A 1YRPA 1G8AA 4BCMA 3Q60A 3BHTA 5KO1A 3WF8A 3U9NA 4AW0A 3OS3A 4FSRA 4S33A 3ENHA 1ZMWA 4XV2A 2PVNA 2FSOX 3F5XA 3TNQB 4ZSEA 3UIXA 3LMHA 5BNJA 2P55A 3SKCA 4G17A 3BRBA 2WTCA 4PL5A 5EK7A 3PXRA 4UWCA 5IA3A 3IS5A 2HOGA 4YC8A 4X3FA 5CASA 3CTJA 5J5SA 1IAJA 5IQAA 2F7EE 3AC1A 2YIYA 3I4BA 4O7NA 4PRJA 4F1OA 1PRYA 1JBPE 1XBCA 4AE6A 4D2PA 4LGGA 3W0MA 5JQ8A 1YXSA 2QLQA 1RE8A 1YDTE 3R1YA 2YM3A 4R1YA 5D1JA 4W4YA 3T3UA 2H8HA 5CF6A 4MD9E 3M1SA 5CY3A 1A9UA 5C8KA 2XIKA 4C02A 1ZY4A 2C6TA 4X7QA 1S9IA 4F9BA 4D0XA 4E5AX 3BL7A