1U59A

Crystal structure of the zap-70 kinase domain in complex with staurosporine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
282
Chain Sequence
KKLFLKRDNLLIADIELGCGNFGSVRQGVYRKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase ZAP-70
publication title The Three-dimensional Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine: IMPLICATIONS FOR THE DESIGN OF SELECTIVE INHIBITORS
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 282
sequence length 285
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u59A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u59A01
2CMWA 4OTRA 5DR6A 2JDSA 4R6VA 3GCSA 1PW2A 5FDXA 3PG3A 3HP2A 5EHYA 4XOZA 2BFXA 4JR3A 2PVMA 5M08A 5CF5A 3P4KA 3ZC5A 3PVWA 5A4EA 2J5EA 3SA0A 2HENA 2HYYA 2C6DA 2JAVA 3B2WA 3NW7A 2YHVA 4XG2A 3RNIA 3CIKA 1DI8A 3HAMA 2DYLA 3R1QA 3W32A 1GNGA 4M66A 3F61A 1OITA 4MX9A 3EQFA 4QMSA 3VF9A 3POOA 4EKKA 3G6GA 3JXWA 5EW3A 4WT6A 5FQDC 4AOTA 4HNFA 4XUFA 4DA5A 4KSPA 2WIHA 5IH4A 2VWZA 3PSBA 1SVHA 1BUHA 2CSNA 3GFWA 3QZIA 3B2TA 1M14A 4ZJJA 5GIOE 3IOPA 4X3FB 2G1TA 2BCJA 4EZ7A 2WTCA 4EK6A 4ZJVA 3OZ6A 5AFVA 5HVJA 1GZ8A 3CQUA 5G1XA 2Y4PA 4BFMA 5DGZA 3WF8A 4F65A 3DNEA 5JFVA 1DS5A 3AMBA 5K3YA 5C27A 2FSOX 5EFQA 5JQ5A 4O7YA 4YSJA 4F99A 3FI3A 2YISA 4A06A 4MXCA 5CAQA 3TJCA 4BWXA 1H27A 4HVSA 2QG7A 3B8RA 4YNEA 2PVKA 2CPKE 2JIIA 3EQIA 4NKSA 4PTEA 4QTEA 3NWWA 4L7SA 3KN6A 4FV0A 3QQJA 1XH5A 5KMIA 4Y8DA 4EZ3A 4ANSA 4LMNA 1B38A 5HO7A 2XS0A 1GJOA 4LUEA 4RGJA 3NYOA 1O6YA 4FODA 2OJFE 1GIHA 1TQPA 2UW0A 3FAAA 4UMQA 2IZUA 3C4EA 5G6VA 5HCXA 2HZ4A 4V01A 3R7IA 3ZFXA 3HMOA 3M2WA 1E1XA 4E6DA 3PDTA 1JQHA 4OTIA 3AC3A 3GQIA 4U3YA 5J5SA 1APME 4GMYA 4O0RA 3EWHA 3PPKA 3L8SA 5ETIA 3W55A 3QRTA 2UZDA 1ERKA 4YC8A 4PDOA 1JOWB 3R7OA 4O84A 3NUPA 2UZBA 4IVDA 2EXMA 4IW0A 5EYDA 3R2BA 3R2YA 1E9HA 4HCTA 3V5PA 5CT0A 3UC3A 2CDZA 3NAYA 4YJRA 4GT5A 2C6MA 3DFCB 3VS4A 3ZO2A 3TNQB 4PF4A 3UYTA 3KFAA 2GQRA 1ZMUA 3D9VA 5EDQA 4L00A 4JAJA 3LLTA 4FI1A 3ZSIA 3PXFA 3OXZA 3R01A 1Q4LA 5FEEA 3SLSA 3VUKA 4ZS4A 2CLXA 3SC1A 1SVEA 5HNBA 4C02A 2WMVA 3KRXA 4BIDA 1H08A 4YLJA 2NPQA 2XZSA 5DBXA 3ENHA 2UW5A 1JSUA 2R3FA 3QKLA 3TXOA 4X21A 3GI3A 4EORA 4YLLA 4I5CA 3EYHA 5AR3A 4OTHA 4D2VA 2P0CA 4U9AA 4C38A 2OXXA 2BVAA 3C7QA 1CKIA 3A2CA 3OW3A 4CZUA 5EM5A 4IWOA 3FMNA 4F6SA 2UZOA 4TRLA 4OBOA 2IPXA 1CTPE 3OD6X 4O0WA 2J2IB 4FSUA 4LV5A 2OIQA 4R5YA 2X2MA 5E7RA 4I92A 3VUIA 4EQCA 4ANLA 3TEIA 5AUWA 3QTIA 4ZLYA 1FVTA 2VWUA 4YHFA 5A14A 4H05A 2IW9A 3QHWA 5IA0A 4MXXA 4R77A 3NSZA 1Y8GA 4D2SA 3O50A 3HNGA 2QONA 5FLFA 3D5VA 5HBHA 4F08A 5LQFA 4W4WA 3CTQA 1PMNA 2IJMA 3PY0A 3MIYA 3H10A 2XNPA 1H07A 1QPJA 2E9OA 3SXFA 4J1RA 4NWMA 5ANJA 2FGIA 2VTIA 3HLLA 3E63A 4NJ3A 4LL5A 4KSQA 5HE0A 2ITOA 5HIEA 4QPSA 2IVSA 1ZOEA 3Q6UA 5CU2A 3R28A 2J9MA 4C35A 4CZYB 2QOFA 3DDQA 1FBNA 5HOAA 4NM0A 3BLQA 3LXNA 4BTJA 2XIYA 4APPA 5I0BA 3UG1A 3HECA 5HNGA 4XV3A 5I3OA 2QC6A 1AD5A 5BUEA 4QMXA 4J98A 2Y6OA 2UVYA 3KK8A 3LZBA 3NNVA 3NPCA 3W2PA 4EK8A 3I81A 1ZY4A 1SNUA 3BU3A 3HL7A 4RMZA 2PY3A 2QCSA 5AP3A 5A4LA 4XYFA 1ZWSA 3HV6A 4IAZA 4E93A 5GHVA 3F6XA 4FK3A 4A9SA 2F7EE 1GIJA 4C58A 5IA1A 2C4GA 4RWLA 2WOTA 2WPAA 5EQPA 1P4FA 4AS0A 4TXCA 3ZO3A 4QYHA 2WEVA 4K18A 4DGGA 1OPKA 4FMQA 4HCVA 4HGTA 4JG6A 2VUWA 2V55A 4FV5A 3LIJA 4RQVA 3Q60A 3ALOA 3DAEA 4OTPA 4RX7A 4EYMA 5AX3A 4O27B 3ANQA 2XK8A 3MDYA 4APCA 4NW6A 5AP2A 4X6QC 2LGCA 2W1FA 2X8EA 2WKMA 1NT2A 3QA0A 5IH6A 3QQHA 2QNJA 2P3GX 1DI9A 2CN8A 3MA3A 4AZVA 4CLJA 5DG5A 4TYIA 3QWKA 4XG9A 3T9TA 3MFUA 3EZVA 4EOJA 2W1ZA 4GV1A 3QRKA 5FTOA 4TYEA 3ACJA 3PIYA 3TZ8A 4DG0E 3ACKA 2F4JA 4QMUA 4RWKA 4PMTA 3PG1A 2RFSA 3O51A 3VW8A 5K5XA 1I44A 3EFJA 4ENXA 5CF4A 3QTWA 2B0QA 4PDYA 2GMXA 3FY2A 4QMYA 5E1EA 1Q61A 3DCVA 4TT7A 2BHEA 2JLDA 4I1ZA 3S95A 4FKUA 3NLBA 2RF9A 5CAOA 5CAPA 4FT5A 2X2LA 3KCFA 3E7VA 4WBBB 3ZM9A 4O0UA 4R7HA 1B39A 4W8EA 4F9YA 4EUTA 3VS1A 2C6KA 4CLIA 4LRKA 4BC6A 5L2IA 5H9BA 4GFGA 4IAKA 4BDGA 1G5SA 2VTAA 3A7FA 4TY1A 3P1AA 3WE4A 4BB4A 4BTFA 3TM0A 4V0GA 4JX3A 4GSBA 2VU3A 1Y6AA 3HMMA 5CQUA 2WELA 1U4DA 3P08A 2QURA 3PTGA 5DT0A 5E8XA 3TIYA 2XK7A 2XKCA 5D1JA 4P5ZA 2O8YA 1NA7A 1SNXA 2O65A 5AR7A 2O5KA 2ERKA 2V7AA 3ZUUA 3KREA 3OWJA 3Q5ZA 3LJ2A 4RSSA 4MBLA 4NZWB 1J7UA 3POZA 4IM0A 4RIOA 3UP7A 3GFEA 4JDIA 4XNEA 3ZLYA 4BBEA 4E4NA 5JRQA 4PX6A 3FZPA 3BRBA 5I3RA 3TNHA 3EQCA 1R39A 4M0YA 1SZMA 1SYKA 4A9UA 3ORXA 4JQ8A 4FE2A 4FEVA 3F7ZA 3QTSA 3WF6A 5BUIA 2PWLA 1U54A 4G6LA 1MP8A 4R8QA 1YXTA 3SOAA 3OT3A 3HA8A 3S0OA 1OKYA 2ETRA 2YAAA 1R0EA 3F5UA 3FC2A 3IW4A 2H9VA 3L8PA 3PP1A 3PVBA 3QU0A 4I6QA 3EFWA 4HVDA 4RG0A 4X2KA 3CBLA 3WARA 5M51A 3H3CA 2YDIA 5KZIA 3C4XA 4B7TA 5JFWA 1W7HA 1M7QA 3BKBA 5ACBC 4NW5A 4D1ZA 4B4LA 3LMHA 3I0OA 4FA2A 5ANKA 2XCKA 1KSWA 4F9AA 3F9NA 3BHTA 5HKMA 2VWYA 3OMVA 3JR1A 4ZSAA 3DT1A 1S9IA 3MJ1A 1K2PA 4R3PA 2VN9A 3KEXA 3C5UA 1BL6A 1V0BA 2AUHA 3A8WA 3M1SA 3P0MA 4DC2A 2F2UA 2P33A 3FSKA 5L2SA 2JC6A 4FGBA 4B8MA 4BDAA 2OF4A 3BIZA 5LJJA 2BAJA 5L2WA 3VRZA 3G51A 4RC4A 1CSNA 4UWYA 2RL5A 2YM7A 3QKMA 2OZAA 3MTLA 3PE1A 5K4IA 2YDJA 4RPVA 3WIKA 2HXQA 3HV4A 4RIWA 3UGCA 4HJOA 4ID7A 5AIKA 5AV0A 3P23A 3PZEA 2C0OA 3RINA 3GGFA 4FTKA 5HICA 2ZB1A 2JFMA 5CNNA 4YLKA 4I93A 3C13A 3G9NA 4ZS0A 3VQHA 3PE2A 5TT7A 3RALA 3FL5A 1XH8A 2ITXA 5AAFA 4R3CA 3AMYA 2LAVA 4W4YA 4C7TA 4CFNA 5A6OA 4GIIA 1KE6A 1XH6A 4BDIA 2EVAA 3G0EA 2REIA 3FXZA 3WZEA 1H26A 4HGEA 3UDBA 5JQ8A 1IA9A 4PNKA 4S30A 4YMJA 2XK6A 4YU2A 3G5DA 1J1CA 3KXMA 2WQOA 4LG4A 1RE8A 3QKKA 3DLSA 2JITA 4WG3A 4LOOA 5KX8A 3SG9A 3V8TA 1PKGA 3HV5A 3BLHA 3GNIB 3QZGA 5HI2A 2O63A 3UOHA 4ERWA 1DAYA 4BDHA 2ZJWA 2HZNA 1U59A 2YZLA 4U0IA 3FZSA 1IA8A 1PXMA 3NUNA 5DN3A 4YURA 5HTIA 3TWJA 3OFMA 1U54B 3EQDA 3NZ0A 3PXYA 4M3QA 3GT8A 2ESMA 5JGAA 5I9XA 3LW0A 2B9HA 2C0TA 2GS7A 3BGZA 5HCZA 4D9UA 4RRVA 1YDRE 4I3ZA 4O2PA 4NJDA 2I1MA 4AA0A 3M11A 2E9VA 3LMIA 2XNNA 4FUYA 4TTHB 4AOIA 4TPTA 3PIXA 2VTQA 4JX7A 4EI4A 5CSXA 5D9HA 5IA4A 3BYVA 2RKUA 2GS2A 3EN7A 4GRBA 4XLIA 3TIZA 3O8TA 3RJCA 3FLQA 4DEBA 2WMRA 2GHGA 4FV4A 3ZO4A 3WIGA 5J95A 4GW8A 3Q53A 3ALNA 2QKWB 3L8XA 5HVYA 5L8KA 4UXQA 2XM9A 2J5FA 2NP8A 4ITHA 3HYHA 1PXJA 4N4SA 5C8MA 2ERZE 4QTAA 3V5WA 5M57A 1TQIA 4FKIA 4DGMA 5AA8A 4E6AA 3WZDA 3KMUA 4XP0A 3F5PA 4IVAA 2WMQA 5E8WA 2R3LA 3R9HA 3KRWA 1BMKA 4WHZA 1FMKA 4F64A 3DJ5A 4BDBA 5CZHA 4E5AX 5LCKA 3VBQA 2R9SA 4E4XA 3KVWA 4XP3A 5L6WL 4V04A 1W8CA 2XH5A 3QCQA 3UE4A 4XP2A 5HEZA 4CQGA 1CKJA 3R30A 4M97A 2W1DA 1JKSA 4YTHA 5EM8A 5CANA 4EK5A 5IDPA 3U6IA 3D7ZA 1REKA 3OCSA 4BRXA 3AT2A 2R3QA 3BGQA 4UB7A 3T8OA 4FT7A 1XHAA 4O7ZA 2ONLC 3EKNA 3PLSA 4GEOA 2HWOA 3EL7A 4JDJA 3PRFA 4YPSA 3RNYA 5EYMA 2XBAA 5HG5A 2ONLA 3FYKX 3ELJA 4B99A 5AUUA 2Y8OA 1PXNA 3JS2A 2J50A 3RM6A 3DAJA 4JIAA 2CKOA 4QO9A 2XKDA 1W98A 3Q52A 5HZNA 2ACXA 4QMNA 3CEKA 3ZDIA 2BRHA 5EI2A 5HO8A 4ITIA 3OC1A 4KS8A 4DFUA 5JRSA 4DEDA 4I24A 5BVDA 4AZEA 2PULA 2PVRA 5K0XA 4U40A 2PU8A 2XCHA 1OBGA 5L8LA 3GU7A 4RVTA 2ZAZA 4Y73A 5DFPA 3V3VA 3ZRKA 2CJMA 3OS3A 3RK5A 2ZDTA 4CZTA 4F4PA 1URCA 3CXWA 4O7RA 4RLKA 3UMWA 2GCDA 1PXLA 3W8QA 3RPRA 3SVVA 4RJ4A 4G16A 5CNOA 4DFBA 1MQBA 2W5BA 1OIUA 3QQGA 5AP7A 2X1NA 2ZV9A 1BYGA 2EB3A 5KMJA 2UZTA 3OP5A 5JFXA 4F7JA 5LMKC 4XG8A 1OUKA 4ZZOA 2XKEA 3FMHA 5CEMA 4ACCA 4F6UA 1T46A 3MBLA 4P90A 1RDQE 5I9WA 3JY9A 2NRUA 4BIEA 3VJNA 2BRNA 1UA2A 2BDFA 3UO4A 3R7EA 2ZM1A 3E8NA 3FDNA 3MFRA 2G15A 3NYXA 3QGYA 3FWQA 3LFFA 4FSYA 3UODA 3TG1A 2QO7A 5GIPE 3S1HA 4EOOA 4FNXA 3BGPA 2XP2A 2OFUA 4BGGA 2Q0BA 2V22A 4U81A 4GG5A 5CWZA 2BKZA 2B54A 2VTMA 3LFCA 3UBDA 1Y91A 4BN1A 2IW6A 5F94A 5EOBA 5HD4A 3G15A 1PF8A 2W7XA 3Q4TA 1PXKA 2PYWA 4E7WA 1XH7A 2QOOA 5LOHA 2WTVA 4BL1A 3ZH8A 4TYJA 2R3PA 3TZ9A 3W2SA 5DMZA 3I5ZA 2VX0A 4GT3A 2WEIA 2ZB0A 5IG1A 3U4UA 2YIRA 5T3QA 3E5AA 4QMWA 4BCHA 1H28A 5J1WA 5FDPA 1HCLA 4OBQA 4BZNA 3FMLA 4DT9A 3L9PA 5A4QA 1O6LA 2XNBA 3R21A 3FE3A 4K8AA 1EH4A 2I0YA 4GFMA 1K9AA 3A60A 2R7IA 3RAKA 4LV8A 5LVNA 1RJBA 3BU6A 4BHNA 5JFSA 3UO5A 2GFSA 2CGUA 3CQWA 3ZU7A 4XJ0A 3N4VA 1MRYA 2QOBA 4J7BA 4M8TA 1Q41A 3WZKA 3A8XA 3IKAA 3UQCA 2HY0A 4FKGA 1BI7A 4QP2A 1F5QA 3OVVA 4I20A 3GVUA 2UZWE 3CY3A 4EQUA 3FKNA 4RC2A 2QLQA 1XR1A 4GK2A 5B7VA 3U6HA 3R0TA 3OTUA 4QYFA 5IA3A 3O0GA 4QYEA 3FLZA 4ANBA 1WBTA 4QQ5A 2FYSA 1NXKA 1XKKA 3ZLSA 3C4ZA 4XS2A 2XUUA 2VWVA 3EN9A 3KGAA 1YKRA 3UQGA 1VZOA 5IU2A 4EONA 4R1VA 3TKUA 3R8VA 3AD4A 3L9NA 2WMBA 5HG9A 4CKIA 3L9LA 1YI3A 2AC5A 3KRRA 2IW8A 4OLIA 3VS6A 3W10A 4IIRA 4L01A 5K0KA 3UPXA 2YM4A 2FO0A 2C5VA 4FVPA 4O91A 5CTPA 4C62A 3W2CA 3DTWA 4U7ZA 4FSZA 4ZTQA 3QUPA 4DE4A 3MPTA 2WU7A 3GP0A 3OEZA 3OXIA 5FM3A 4E73A 2W1HA 2YIWA 3RVGA 5BQ0A 2X8IA 2BHHA 3UIUA 5I5ZA 2JFLA 4W9XA 4CGAA 2J6MA 4EH4A 5L8JA 4Q9SA 3TNPC 4O22A 4QMOA 4CYIA 5CF8A 1PJKA 2Z7LA 4BCNA 3MY0A 2XNGA 1ZYSA 3ZZWA 1M2PA 4TNDA 2J0IA 4BDJA 3KA0A 3CGFA 4M12A 4KD1A 4KIOA 3V01A 4D28A 2YCQA 4AW2A 5JMSA 3PSDA 1GOLA 2EB2A 4L3LA 3EKKA 2CNQA 3FLYA 4FT0A 5CY3A 3DAKA 4BCMA 5KUPA 5FP6A 2B9IA 3O23A 4D1XA 1ZYJA 4DCAA 4N6ZA 1LEZA 1H0VA 4YJNA 4CVAA 2PVNA 1FVRA 3ET7A 5J7BA 4ALVA 4JL9A 4UN0C 2GNIA 5A4TA 4A07A 1OKVA 2C5OA 4RJ3A 3PWDA 3E8DA 1R78A 5EM7A 3FPQA 4AGWA 1H01A 5KMMA 3IGOA 4AE9A 4U45A 2YCFA 4G6NA 3LPBA 3TTIA 2WMXA 2ZM4A 3IK3A 4G3DA 3DGKA 4QMPA 1AGWA 2CGXA 2WD1A 1SMHA 4O6LA 2B9JA 2XK9A 5EHLA 5HIDA 1DAWA 4DH5A 2CNVA 1ZMWA 2BALA 2HCKA 2OICA 3AGMA 4GT4A 4DCEA 5AUVA 1NVSA 5IH5A 3QX4A 2IWIA 4MHAA 3SX9A 2W5HA 2UZVA 5I9VA 4TL0A 3MPAA 5JKGA 3E3BX 2HW6A 4IZAA 5AUYA 5CAVA 1PMVA 4FG9A 3NEWA 4IACA 1ZMVA 4G5JA 2VTJA 3R71A 3IW7A 3OWLA 5AADA 4XBUA 5AX9A 2QU6A 3FI4A 1JWHA 4MH7A 2EXEA 2CGWA 5B2MA 4C3RA 4BKJA 5DVRA 4GK3A 2YM3A 2E9UA 1YVJA 2VGPA 3A7GA 4I6HA 3R22A 4L43A 4Q9ZA 4BBFA 3CD3A 3PJ3A 5B0XA 5M06A 1YDSE 4D2WA 1I09A 3FC1X 1HOWA 2DWBA 2UW8A 2GNFA 2QOKA 3E88A 4WSQA 5EI6A 2YJSA 4IM3A 2VO0A 3ZXTA 5KZ0A 2FUMA 4D55A 1YXVA 2JKMA 3FMMA 4K1BA 5M55A 3R8UA 5J1VA 2YLFA 2ZVAA 4C4JA 4EC9A 5IQHA 3QRUA 1Q8UA 4F1TA 3W2QA 2UVZA 4QP6A 3IECA 3D5UA 3LJ0A 1XJDA 4IE9A 3VS3A 3DK6A 2QOQA 4FSQA 4FTQA 2QOIA 2UZEA 4G3FA 3VS0A 4DEHA 4FSMA 2W4JA 3QTRA 3NIEA 3HRFA 5AA9A 3GENA 4F1OA 4XOYA 3A62A 2GFCA 3Q3BA 4P7EA 3N4UA 4WKQA 3CJFA 4FKLA 5JK3A 3UVRA 3ZSGA 4DTKA 5HNIX 4OTWA 2YFXA 1MRVA 4F7NA 3RBWA 1UNHA 2UW6A 4E4LA 4QYGA 2ZV7A 4Z7GA 2XRUA 3BYMA 3RTPA 1YWRA 4UYAA 5HESA 4QP4A 5A46A 4JQEA 4AZFA 4RX9A 3C1XA 3MIAA 3UOKA 4FKWA 4QPAA 5M4UA 4U80A 4RZVA 4WNKA 4O0VA 1YOLA 1KE8A 3CTHA 4ARKA 1Y8YA 2VGOA 4KABA 4FEQA 4Y95A 2HWPA 3I6WA 2OJGA 4D2TA 4TWCA 3CTJA 3BZ3A 3CC6A 1J91A 4I21A 3W16A 3E3PA 5AJQA 3SRVB 1YHVA 3WILA 4RX5A 2E2BA 2R3IA 3QYWA 4O1OA 4FK6A 2XNMA 4E1ZA 4WNOA 2H34A 4EHZA 3HUCA 5CVHA 2I7QA 3U9CA 3H9FA 3S4QA 1PHKA 3DZQA 4FZ6A 4K33A 5DE2A 3UIBA 4MVFA 5DHJA 2PE2A 5I4NA 3BEGA 4M13A 2OH0E 4IZ5A 5GZ8A 3ODZX 4L8MA 5KMOA 5CEQA 3UG2A 4BCFA 2HW7A 4Z16A 1OVEA 4MNFA 3TL8A 3R9RA 4N70A 3V5JA 5HLWA 4IZ7A 5IQGA 1JKLA 4IFGA 5CS6A 4C33A 2X2KA 3F3UA 4BCKA 3EFLA 4N6YA 4FL3A 4CFVA 4G1WA 5CXHA 2R0UA 3BV3A 2RG5A 2X8DA 3P7BA 2YLEA 3EN5A 4AW5A 2YABA 4QNYA 4EWQA 1FQ1B 3BLRA 3LVPA 4IXPA 4FKSA 4C59A 3NYVA 1Q8ZA 3C9WA 3A7JA 4PP9A 2ITPA 4IAIA 3LFDA 3II5A 4HYIA 1M52A 2R64A 3DZOA 4FTLA 4KKEA 3OHTA 1IEPA 4MBIA 4M84A 4ONAA 3V5TA 5C1QB 5HTCA 5ETAA 1W82A 3FXWA 5C4KA 4MKCA 2JDVA 4YZ9A 4HYHA 4AFJA 4PL4A 1CKPA 2YDKA 3QXOA 4EZ5A 1H1WA 4Q5EA 2IZSA 5FWKK 2BILB 2XJ1A 4EKLA 3LAUA 4FBXA 4WG4A 5FXSA 5CASA 2FSTX 3EJ1A 5JEBA 3PXZA 4B0GA 5BX0A 3U8WA 4E5WA 4AN9A 3AMAA 3R7GA 4MD7E 5AP5A 2VTSA 4CCBA 3QHRA 5HQ0A 2H8HA 1FINA 4XX9A 4YBKA 5HBEA 2PVFA 2C69A 2ZDUA 4JLCA 1CMKE 2Y9QA 4JJRA 5AV4A 3GOKA 2WU6A 3Q9YA 2YAKA 3E62A 2A4LA 1JNKA 3VUHA 4BCQA 4EH6A 4UBAA 4WRSA 5FBNC 1OUYA 4F0GA 2PUUA 3MVHA 4KRCA 4HNIA 4K6ZA 5EYCA 2BTSA 4I23A 3LQ3A 2W5AA 3F3VA 3A4OX 4W9WA 1YXXA 4PMPA 2PZRA 5LVOA 4O0YA 3PPJA 4TZRA 4YC3A 4EK3A 4BDCA 3W33A 5DH3A 2VO6A 2PZYA 5ANIA 3ROCA 4BI0A 3R9DA 5EKOA 5IUGA 5J8IA 1OL6A 4FVRA 3RZFA 2ZYBA 4AW1A 3C4FA 4MBJA 4XH6A 4CFFA 2OLCA 3KMMA 4YZBA 5KE0A 4JI9A 3ZEWA 3MA6A 4CG9A 3VRYA 3VBWA 4BCGA 4H3BA 4FKPA 4RVKA 1ZAOA 4GH2A 4RA4A 1OBDA 3P7AA 4QPMA 4LL0A 4IHPA 4R7BA 4GJ3A 4IX5A 1PXOA 3G33A 4LMUA 3AG9A 3TCPA 1QMZA 3VUTA 4PDPA 3RZBA 4WBOA 3OCTA 5HE1A 2VWXA 3WF7A 2CKPA 4RIYA 4TN6A 3RPOA 1CM8A 5A6NA 4FV7A 4ZSEA 2OI4X 3O8PA 3DY7A 1FVVA 1KUTA 2J4ZA 5F9EA 3N9XA 5ANDA 4EQMA 3MY5A 4RFYA 1YW2A 4HVGA 3NVMB 1KE7A 2Y0AA 5CVGA 3C4WA 4EHVA 2FA2A 4FZAB 4DGNA 2DUVA 2F49A 3FI2A 4I41A 3UO6A 3WYYA 4D0WA 4XLVA 1X8BA 4JBPA 1WBSA 4PTGA 3KXHA 4BCIA 5BUJA 2F9GA 4PPCA 2CGVA 2XKFA 3EN4A 3QZHA 4KKGA 4Y83A 3DLZA 4H3QA 2YIQA 3ZMMA 5IZFA 1JBPE 3SXRA 2CLQA 4ZTNA 4D2RA 4DLIA 4ANNA 4RJ8A 4JT3A 3ZEPA 5FEDA 3QBNA 4R78A 3CKWA 4F0IA 3MVJA 4FYNA 5EYKA 3CPCA 5DEYA 4HGSA 4P2KA 4PNIA 2YM5A 4CFXA 4OUCA 3SD0A 1Q5KA 3BYOA 1Z5MA 4AOJA 4IX4A 1M7NA 5IDNA 2IG7A 3EL8A 3EN6A 5A9UA 2PMOX 3LCSA 4O6EA 4CRLA 5DT3A 4DEAA 2VO3A 5GZ9A 3MN3A 5AUTA 4ZEGA 5ANGA 3RM7A 4CMOA 4U41A 4C57A 5BPYA 3OY3A 2PZPA 2UW7A 4P4CA 4RFZA 2XYUA 2J0MB 4O1PA 3WZJA 2P55A 2W1GA 3R1SA 3PA4A 2DQ7X 2Z7RA 4IEBA 4L44A 4U5JA 3HRCA 4F70A 3HV7A 4OR5A 5KKRB 3Q9WA 2V0DA 5IQAA 2G2FA 4IB3A 5EW8A 3QX2A 2W9FB 4BDDA 3R1NA 3LKMA 1KE5A 4JNWA 2R7BA 5LWMA 4CMUA 1URWA 2VO7A 3O17A 5L3AA 2CN5A 3GB2A 4MYGA 3SXSA 4EOKA 3REPA 1VEBA 2WXVA 2JDRA 2VWIA 4MCVA 4R5SA 4QMTA 3QZFA 2BFYA 2GU8A 3PWYA 4E3CA 3R9NA 4RJ6A 3AD5A 4MXAA 3VC4A 5HX8A 4EBVA 3O7LD 2C5XA 2EUFB 3DKGA 3QD4A 2QR7A 4AQCA 3F66A 4JRNA 2XB7A 3TI1A 5IUIA 1T45A 2QD9A 4X0MA 3FLWA 4A9TA 4XHKB 2GNLA 3BE2A 3P86A 4BWPA 1UNLA 2QI8A 3I0QA 5CSWA 3GCPA 3DOGA 3U4WA 3VBVA 4WRGA 2NO3A 1QPDA 2PVHA 3HMPA 3TNIA 5EQEA 1JVPP 4RIYB 2FH9A 5E90A 2W9ZB 1QL6A 2WMTA 3ZM4A 4AWIA 3UQFA 5BVFA 4FT3A 1E1VA 3HV3A 2Q83A 5CU3A 1GAGA 5AR5A 4FTMA 4IDVA 5BYZA 5JSMA 2UW3A 3EFKA 4FNWA 4AA5A 2W96B 5I9YA 1R0PA 4CSVA 2VNWA 3ORLA 4BCPA 3LXKA 1QPEA 3QD3A 4AN3A 3ORMA 3NAXA 3IDBA 3EYGA 1UU3A 4DTBA 3FJQE 4NKAA 2Z7QA 1ZLTA 2VX3A 3CLYA 3N4TA 2PTKA 4FEUA 3ZBXA 4E20A 2I0HA 3F3ZA 4QMLA 3VAPA 3KXGA 1BLXA 4RJ7A 2RG6A 2VD5A 3QTUA 3A4PA 2R0IA 4H1MA 3BBWA 3KB7A 1UU9A 1U5RA 3MYGA 1ZOHA 2JGZA 4FKQA 3MSSA 5AP1A 4DBNA 5HLNA 3DXPA 4QD6A 1Y57A 3CE3A 4D5HA 4MNEA 3R9OA 2JKQA 4ALWA 3P7CA 3VO3A 1LR4A 2QQ7A 1YDTE 2H6DA 2E9NA 3RK7A 3I7BA 3UZTA 4KUJA 2C3JA 4J71A 4V0GB 2OH4A 4IANA 2P2IA 2ITUA 4RLLA 4AAAA 3WF5A 4E6QA 3PA3A 4FTAA 2X6EA 5GJDA 5CSHA 4Z7HA 2B52A 4DH3A 4F0FA 4LRMA 4DG3E 5A54A 4UMPA 3NCZA 3PXKA 5ANEA 4EYJA 3LXLA 3NMUF 2OJJA 2WQEA 2OIDA 1P14A 1RW8A 4HW7A 1HCKA 2BIKB 3SV0A 4ZY5A 3RAWA 2BKKA 2WMAA 4JBOA 4L52A 3VS2A 3Q4CA 3LCKA 4AF3A 1YI4A 4QMZA 3U87A 4BI1A 4QMQA 3QC9A 3FHIA 2GNGA 4F9WA 4KBAA 4BVUA 1ZY5A 4IAYA 1OPLA 3UNZA 5T6KA 2W4OA 4XCUA 1OL2A 5DRBA 2NNWB 1PYEA 1OMWA 4Q5HA 4YZMA 3PPZA 4PY1A 2YJRA 2ITZA 4C8BA 3OROA 4TW9A 5AV1A 1LP4A 2Z60A 4K2RA 4OT6A 5IQFA 3JVSA 2ITQA 3D5XA 4MEDA 4O81A 5HE2A 1LUFA 2YEXA 3KL8A 3QYZA 1M2QA 5FUTA 2R2PA 4AGDA 4UMRA 5E8TA 4J96A 2C6OA 3OBGA 2BDWA 3FQEA 4NU1A 4X7QA 4FG8A 4G34A 1L8TA 5TR6A 3FXXA 2OKRA 5FGKA 1U5QA 5KHWA 4I0SA 2BZHB 2JDOA 3DS6A 5H8BA 4EH2A 4IJ9A 4BR3A 2VTRA 3CCNA 2PUNA 4FICA 4L7FA 4DEIA 2W1EA 2YIXA 5D11A 4OAVB 1TKIA 5BMMA 1NW1A 1MUOA 2VWWA 2WTWA 3MH1A 3NGAA 4G17A 4M0ZA 3QRJA 3RCDA 3ZLWA 4E5BA 2J90A 4G9RA 4D9TA 2J0KA 5GJGA 1KE9A 2PPQA 1H8FA 2IVUA 4EHGA 2GQGA 5KO1A 3JPVA 5DIAA 4ZIMA 5JGBA 3RP9A 2PSQA 2B9FA 1G3NA 4ASXA 2C6EA 4X6RA 1UU8A 2OZAB 1XH4A 4MNEB 4RIWB 5HVKA 3V04A 3UJGA 4ENYA 1WVYA 3OXTA 5E8SA 3OWKA 3TDVA 3QCYA 3D0EA 4BF2A 3QQUA 4FV6A 3F2RA 4IQ6A 4UY9A 5DI1A 2VTTA 3CPBA 4IVBA 3VHEA 4DYMA 2GS6A 5ICPA 3GC7A 4ANOA 3HZTA 4EK4A 3ZRLA 4TNBA 3IOKA 1BX6A 2VTOA 3GCQA 4D0XA 4A7CA 4GL9A 3UPZA 4KIPA 3EQGA 5IEXA 2OSCA 4R3RA 4EUUA 3HGKA 3U6JA 4I5MA 5HCYA 3MJ2A 5AMNA 2JAMA 4A4XA 4QP7A 3P79A 4K77A 1AQ1A 2YCRA 2WNTA 2V5QA 3PY1A 4M7IA 4NFNA 4O83A 2PMNX 1DM2A 5AUZA 4C4GA 4EC8A 3FEGA 3A99A 1UNGA 1GIIA 2VNYA 1WBOA 3QUEA 4J95A 3V51A 5L6PA 2VV9A 4EJNA 5CEOA 3CSVA 4NTTA 4RWJA 3ZBFA 4TWPA 4E4MA 2HZIA 4GJ2A 3CQEA 3SDJA 3SW7A 2XBJA 2ZMCA 3C50A 4L53A 3OEFX 5LARA 4ZJIA 3AT3A 3BQCA 3V6SA 4AGCA 1Z9XA 5M4CA 5C9CA 3PJCA 3ZFYA 3BU5A 3FHRA 5D7VA 3UOLA 5HX6A 5J9YA 2B1PA 5CEKA 2GTMA 2EXCX 1OI9A 4O0TA 4C4EA 3V8SA 2Z7SA 5IEVA 2F7ZE 3QF9A 4A4OA 5K4JA 5HTBA 3DFAA 1ATPE 5DEWA 3BQRA 4FUXA 5LVMA 3KMWA 2B7AA 5CU4A 1ZZ2A 4JIKA 1YWVA 2Y4IC 3KN5A 4HZSA 3SW4A 2JKKA 4USFA 2YN8A 3R1YA 4GYIA 5EM6A 2WGJA 4EL9A 3CP9A 2PMLX 3GC9A 5HLPA 3NVKI 3FBVA 4YTFA 2C1BA 4YPDA 3SQQA 3RCJA 2WAJA 3VBYA 2G01A 4CT2A 1RQQA 4ACGA 1A9UA 3OBJA 3OT8A 4L42A 4QTDA 3EMGA 5FD2A 5AWMA 4ZXTA 1JAMA 5DOSA 3RHXA 3UZRA 3L8VA 3NRMA 2BTRA 3IGGA 4FV3A 5DLSA 2PHKA 4M15A 3WYXA 5BVOA 4DTAA 4DFLA 4NM5A 2F57A 4DG2E 3PP0A 3LCDA 4GCJA 4YJVA 2X7OA 5HD7A 5IUHA 3DNDA 4DFZE 4AACA 3GOPA 3QL8A 3QLFA 3GEQA 3ID6C 1Q62A 2BIYA 4CKJA 4FZ7A 4DEGA 4CQEA 1KV1A 2PK9A 5CEPA 1STCE 2BPMA 3PA5A 5DRDA 1OM1A 3Q32A 3ORNA 4C37A 4PP7A 4IAAA 1NY3A 4S32A 3TTJA 3EHAA 3FZOA 1XBBA 4QTBA 2UZUE 3DBQA 3DDPA 3PVUA 3LOKA 3QLGA 3VW6A 4EH3A 4ZMEA 2VWBA 3RWPA 5CAUA 5H2UA 3A61A 4Q2AA 4RA5A 4EJ7A 3M42A 5DYJA 5DT4A 2W1CA 4JBVA 4U43A 2PE1A 2W1IA 4TKSA 3MB6A 3P5KA 4KIKA 3R7VA 1A06A 4ZOGA 4LRJA 3TJDA 5AAGA 4BYJA 3U55A 4E26A 3QA8A 4D1SA 3BHYA 1UWHA 2ITNA 2CCHA 3HRBA 4YZNA 1FMOE 1Q97A 3JYAA 4PTCA 4UMTA 4IB1A 4AFEA 3QQLA 4PMMA 1UVRA 5C8NA 2I0VA 3RAHA 4D58A 3VVHA 1Q24A 3C0IA 4J97A 5K5NA 4A9YA 2QU5A 3DJ6A 3IS5A 3MW1A 3EOCA 4X2NA 3U51A 3OOGA 3DXQA 3D5WA 4XMOA 3QAME 4O2ZA 5E92A 5D12A 3CR0A 3MY1A 1IAHA 4HVIA 2YITA 3Q4ZA 3I7CA 3R8ZA 4OBPA 2HK5A 2I40A 3ORZA 3HA6A 2XEZA 2BR1A 3DK3A 4FTOA 4IX3A 1U46A 2JEDA 4FEWA 2I6LA 3K54A 4GVAA 4L9IA 4ZY6A 5CU0A 3Q96A 2V62A 2X4FA 4I0TA 4H39A 4H3PA 5AUXA 5F95A 4ZK5A 5CVFA 3A7IA 4ZSLA 4RIXA 2CNUA 2XNEA 3Q2JA 3MESA 2Y4IB 4RC3A 2QG5A 2QHMA 4FL2A 3IO7A 3OUNB 4Z55A 3SAYA 4PRJA 5BVKA 2Q0NA 3UIMA 4C4IA 2AYPA 5KMKA 3EZRA 4O7LA 4CEGA 3RMFA 4DH8A 2GPHA 3LCOA 2WB8A 4KBKA 5BVWA 4F9CA 4DGOA 5C01A 1MRUA 3ZC6A 3F3TA 4YHTA 5B2LA 3IDCA 4AN2A 3Q04A 2W99B 5L2TA 2CCIA 4AT5A 3I60A 3ZS5A 5DR2A 3IW6A 1A48A 3R6XA 5IA5A 3K2LA 3MVLA 2BRBA 4ZLZA 4JR7A 2WTJA 4X3FA 3LFEA 5HE3A 1WVWA 4RJ5A 3B8QA 2FVDA 4S31A 4DN5A 5BYLA 4NM3A 4BDKA 3ZTXA 5HBJA 3FQSA 4QTCA 2WIPA 3R8LA 4BYIA 4XG6A 3R63A 5FXRA 4A4LA 2WZJA 4CV9A 3HKOA 2IO6A 3HMNA 4WNPA 4EH7A 2ZV2A 1P5EA 5IQIA 2BZKB 4G3GA 1PMUA 2W17A 3BPRA 3FSFA 4TWOA 5EI8A 2X0GA 3PVGA 4LUDA 3BHHA 3QD2B 4JVGA 4U42A 4KIKB 4O7TA 4E6CA 5LMBA 2BZJA 1GZOA 2OW3A 2IN6A 1Y6BA 3BHUA 3PJ8A 4L3JA 3KY2A 4CXAA 3ROYA 3ZOSA 4FOCA 2FSMX 4C61A 5CF6A 5T68A 3Q2MA 3RPSA 3SGCA 4FF8A 2BAKA 2PVYA 3HMIA 4I4EA 4RVMA 3OCBA 4CYJA 2O3PA 4JBQA 3C51A 4AG8A 4DINA 3NCGA 3GQLA 4HYUA 3FKLA 4S34A 4XG7A 2OJ9A 2YERA 1OIRA 2CKEA 4XV1A 3GU4A 5M4IA 3AD6A 5CT7A 4FT9A 3UMXA 3IPHA 4PPAA 4NM7A 3UOJA 4QRCA 3KK9A 5B2KA 2VTNA 3MTFA 4YZCA 2R3KA 2WQNA 2X81A 3UZPA 4B9DA 4BBMA 1M2RA 4F63A 3FLNC 1JLUE 2C5YA 4RIXB 5AP4A 2A19B 3PZHA 4H36A 2UZNA 3C5IA 1VYZA 4YP8A 5A3XA 3NUAA 4Y5QA 1OZ1A 3ATTA 4DFYA 2WTKC 1PKDA 2F2CB 3MFSA 4U79A 3DK7A 1YXSA 4U44A 4BCJA 4FTUA 3ULZA 2XK4A 4CFWA 1ZRZA 2HELA 2GSFA 3UIXA 3JUHA 3VQUA 2JBPA 3D4QA 3H30A 4HPUE 4BKZA 2PE0A 5C4LA 4RFMA 4O7NA 5H8EA 4DHFA 4U6RA 4IB0A 3VN9A 3RPVA 1YOJA 3F5GA 3MS9A 4WOVA 2UV2A 2C3LA 3ZXZA 3KQ7A 2E9PA 2X7FA 2OO8X 2WHBA 3FUPA 3F82A 3GBZA 3OW4A 4S33A 2QR8A 4KINA 1H1SA 3E64A 2QOHA 4XEYA 3OG7A 4GKIA 1YQJA 4ZTMA 3MFTA 1Q3DA 4DF3A 3PSCA 5E8ZA 1FPUA 4NK9A 2QOLA 2ZMDA 5IQBA 1NVQA 4MAOA 4V05A 4O7SA 4FIGA 5A4CA 4MWIA 2OWBA 4UZDA 1G8AA 2Z02A 4RVLA 3FL4A 4MXYA 5EHOA 2OF2A 3HX4A 3P9JA 1WBNA 3ZZEA 2BZIB 4M68A 1SM2A 2KTYA 2XM8A 3MB7A 1YHSA 4ZZMA 3DBCA 3QQKA 1H24A 5CZIA 5FG8A 3FMEA 2PZ5A 3FV8A 3WI6A 4ZZNA 4YJTA 4C34A 3JVRA 4ZY4A 2OZOA 2VRXA 3BYUA 1GZNA 3VS7A 4EOMA 3KVXA 3COIA 4IZYA 4FL1A 4XBRA 2JIVA 2YCSA 4QT1A 3UNJA 1TVOA 2W4KA 1P2AA 3W1FA 2AC3A 1W0XC 3DXNA 4GFOA 2PMIA 4EOQA 4GK4A 4RBLA 5DPVA 3MGYA 4U97A 4F09A 1UKIA 2WQBA 5AR4A 4C4HA 2OIBA 4MXOA 4TYGA 3R8PA 4BCOA 5LWNA 3MV5A 3PXRA 3R00A 4OW8A 2A1AB 4QP8A 3GUBA 3H0YA 2P4IA 3BWFA 3MH2A 5IMEA 3RWQA 5EW9A 4HOKA 4YBJA 5F1ZA 3ZLXA 4GU6A 1W83A 4M14A 3EB0A 4ZTSA 4YJUA 3DV3A 4M69A 2XMYA 2UZLA 4BICA 2HIWA 1WZYA 3VHKA 1IAJA 3JY0A 4PUZA 4CKRA 3GCVA 4U8ZA 3AT4A 3E93A 1H0WA 4KB8A 2J51A 4O7WA 2WTKB 4YNOA 2WTIA 4QMMA 4Y5HA 4D4RA 3OCGA 3TKIA 3KXXA 1ZARA 3MH3A 3RKBA 2JDTA 2JBOA 4J99A 4F7LA 5AP6A 3OUKA 4ANQA 2RIOA 4NL0A 4MD8E 3E87A 3BE9A 5HG7A 4NCTC 4IWDA 1ND4A 1YWNA 4MD9E 3ZUVA 1Q8YA 1OKWA 4QOXA 4FTIA 2XRWA 1Q99A 3K3IA 5AIRA 2GHMA 5HO6A 4EOLA 2UW9A 3COKA 1H1PA 3TACA 4C3FA 4NCTA 1NVRA 3LHJA 3VJOA 2YM6A 4I6FA 4KNBA 2C5NA 3A7HA 3D83A 4O21A 5FTQA 1M17A 3UP2A 5KKRC 4ZLOA 3LFAA 2VZ6A 4EOSA 3KU2A 2IZTA 2VX1A 5EH0A 5KMLA 4Z3VA 4EBWA 5JN2A 3N51A 4FKOA 3MI9A 2J0JA 4Y46A 2XIRA 4N0SA 3R02A 1H4LA 5F4NA 1B6CB 3PYYA 5IQEA 2XIKA 3T3UA 4NH1A 4DFXE 4ACHA 1Q3WA 3CD8A 5KBRA 2FSLX 1IRKA 3VULA 4OTGA 2WMSA 4KA3A 3FMJA 4C2VA 4OTFA 3S3IA 4J52A 3KF7A 4WNMA 3PFQA 1WBWA 4FGRA 4IC7A 4QMVA 3HVCA 2O0UA 2IZRA 1R1WA 5JZNA 2IVVA 2OFVA 3HP5A 4EOPA 3D7TA 3QALE 3NNWA 1JPAA 4S2ZA 3EQBA 4RQKA 4O0XA 5IISA 3E8EA 1OECA 3LFQA 4FV1A 4UEUA 1WVXA 4DBXA 4AP7A 4I22A 4QQCA 3G9LX 5LCJA 1LPUA 4LGDA 2YA9A 3K3JA 3AC8A 4IDTA 4XG3A 4IMYA 3DU8A 3ZONA 4UX9A 2X9EA 4GS6A 4M69B 3S2PA 4X3JA 4ASZA 4BHZA 1OPJA 4WUAA 3W2OA 1IR3A 3FZTA 5HGIA 1JKTA 3FQHA 3IDPA 5M09A 4I6BA 3AC2A 2B4SB 2X6DA 3NW6A 4QQTA 2HZ0A 4O96A 4PL5A 3OTVA 1FGKA 2F7XE 2JIUA 5GNKA 5AV3A 5I9UA 5E8VA 3TZMA 4LFIA 2HY81 4MWHA 3LQ5A 2EU9A 5CQWA 3TV4A 3IG7A 4FIFA 5CENA 5M56A 3K5UA 4JS8A 2YWPA 4YJPA 3SG8A 3TUBA 2C6TA 3NX8A 2PVLA 3WF9A 2GNHA 4JOAA 4AXAA 3H9RA 4MK0A 4PMSA 2GHLA 4F1MA 4YJSA 4GG7A 4CD0A 1JKKA 3AXWA 4ITJA 3CGOA 4QP3A 4F6WA 2RSVA 5EK7A 1UV5A 2C1AA 3TNWA 1VYWA 1BI8A 3I1AA 2PUIA 5JH6A 1L3RE 4ACDA 1FOTA 2UVXA 3QWJA 5HHWA 4PWNA 3FLSA 1ZYCA 5LMAA 3T3VA 4CTBA 1V0PA 3KKVA 4G2FA 3NUSA 5GJFA 5TF9A 3VIDA 4AU8A 2R3RA 2YM8A 2XIZA 4FV9A 5CSVA 1H00A 2BAQA 4YTIA 2YACA 5CU6A 3DPKA 4KAOA 3D94A 4MQ2A 1XQZA 5J9ZA 5DR9A 4OT5A 2J7TA 3I6UA 3EQPA 3UC4A 2HXLA 3O71A 4ZSGA 4GU9A 1PXPA 5AR8A 4AA4A 4IB5A 2JD5A 3V5QA 5CLPA 4C2WA 3ZCLA 4I5HA 3GU6A 4GIHA 4D5KA 3AC1A 4CNHA 2XA4A 4I0RA 4KWPA 4MF0A 5BNJA 3OOMA 3NS9A 3MVMA 4XG4A 3D7TB 4YHJA 3O8UA 3ZFMA 3ZSHA 2I0EA 4H58A 1FGIA 2YIYA 3LXPA 2C6IA 4QP1A 2KULA 4BKYA 3OY1A 4I4FA 5I9ZA 3F3WA 5FM2A 3KXNA 3GCUA 4CMTA 4IWQA 3G90X 4FKVA 4GUBA 3TUDA 3FKOA 4U3ZA 4LOPA 3Q4UA 3F69A 5C8KA 3FMDA 2CHLA 2JKOA 4K9YA 2SRCA 1LEWA 1ZXEA 3TV7A 3AC4A 3IQ7A 2C47A 3QTZA 3NR9A 1SVGA 4BGQA 4ORKA 1J1BA 1Q8WA 2OJIA 2ITTA 4WG5A 4QYYA 3DBEA 3WOWA 3ZUTA 1H1QA 2ITWA 4JG8A 5CEIA 4BZOA 1V1KA 4IH8A 4LI5A 4UV0A 4FTTA 3L9MA 3DQXA 5JZJA 1UKHA 1OB3A 2BROA 4BWKA 2QODA 3RK9A 4C0TA 4HCUA 3VS5A 4JG7A 4BDFA 4L67A 4BZDA 4ZTHA 3QC4A 4IJPA 2XK3A 5EDPA 1Q8TA 3CY2A 4PV0A 4AX8A 4FEXA 5BVEA 5L2QA 4LGGA 4LM5A 3LFSA 3RAIA 2H96A 5CX9A 1ZYDA 5TKDA 2XYNA 3WBLA 4BTKA 3ANRA 3AOXA 2YWVA 4YJOA 3QTXA 4FKRA 1Z57A 3VF8A 3LQ8A 4FC0A 3R7UA 3DKOA 2C6LA 4BIBA 4JXFA 4LYNA 5IQCA 4G9CA 4YO6A 3QTQA 5TE0A 3GC0A 1REJA 5IA2A 4G3CA 3HDNA 1TQMA 3VBTA 4JDHA 4I94A 4FIEA 3TDWA 3FI8A 3MPMA 4GKHA 4NIFA 4L3PA 4UZHA 2R3GA 4FTJA 2WTDA 2QO9A 4UALA 3ULIA 3OF0A 3VUMA 3HAVA 2BRGA 1MQ4A 2YZAA 3COMA 3NIZA 4HYSA 4USEA 3QCSA 5D7AA 4ASEA 2QHNA 5ITAA 4UXLA 5AV2A 4II5A 2QO2A 3DKCA 3DQWA 2RFDA 3NW5A 4FNYA 3FYJX 3EQHA 4FTNA 3BBTB 4WIHA 1H25A 5J7HA 5LXMA 1QCFA 1KOBA 3D14A 4YO4A 1S9JA 3HEGA 2C30A 3K5VA 3NDMA 3R83A 4B6LA 3QD0A 2A27A 4QP9A 4WUNA 2ZV8A 4JAIA 4YR8A 2RFNA 5KCVA 3G6HA 5FRIA 1G8SA 1UU7A 1WMKA 2RGPA 4L46A 3UTOA 3ZRMA 4L6QA 4FIIA 4DITA 3TN8A 3UNKA 1XH9A 5E1SA 4FIJA 5H3QA 4EOIA 5HORA 4O82A 3HUBA 4O0SA 4P5QA 3CS9A 3ITZA 4HZRA 4KBCA 4OAUC 3GU8A 1XWSA 2C3IB 3L1SA 3Q5IA 4G3EA 3PXQA 2X9FA 4ERKA 4AT4A 3SHEA 5M07A 3KXZA 4GUEA 4NSTA 4KIQA 3FZ1A 3QXPA 3LM5A 4JRVA 4AZSA 5L6OA 1V0OA 3ODYX 1PRYA 2W0JA 4DT8A 3PIZA 4FYOA 1WBPA 3Q6WA 1WFCA 5IKWA 3FY0A 3VUGA 4BTMA 4EH5A 3ERKA 4ACMA 3QGWA 4DFNA 4FSNA 5BVNA 2Y6MA 3RGFA 3KRLA 3E92A 1ZZLA 3GU5A 4IWPA 3C0HA 3ZHPC 2ITYA 4C3PA 3ATSA 1K3AA 3DA6A 2P2HA 5CYIA 4AZWA 5CALA 2WMWA 3COHA 2OXDA 2R5TA 5HU9A 4DLJA 5ACKA 5AR2A 2ETKA 4GVJA 5DA3A 5K9IA 2WMUA 3FZRA 3DKFA 3BCEA 1YXUA 1W84A 4FG7A 4JDKA 3H9OA 2WO6A 4IBMA 4TWNA 3GC8A 5AM7A 2R3OA 4CV8A 3LE6A 3FMKA 4YZDA 5GINE 1IG1A 4I5PA 3O2MA 3R73A 4MQ1A 4EEVA 4NEUA 1VR2A 4QNAA 4Y85A 4NIFB 1WAKA 5CSPA 3WZUA 2ZOQA 1VJYA 3V5LA 5E8UA 5IF1A 4ANMA 1J7IA 2BRMA 4O38A 1PMEA 4MTAA 3TV6A 4R7IA 3C4CA 2R3HA 4ZAUA 4YTCA 3LCTA 4CG8A 2Y7JA 3BX5A 2XF0A 2VAGA 2WOUA 3QRIA 4J8MA 3EQRA 4W8DA 3VUDA 5TOZA 4YUQA 4WA9A 4FOBA 4PQNA 4K11A 1GZKA 4WSYA 1QPCA 2HAKA 4G31A 5J87A 5M53A 4FR4A 3BV2A 2BDJA 2QKRA 3NNUA 3AQVA 4Y72A 3BHVA 5F20A 5M4FA 3PJ1A 5IMXA 5BYYA 1IASA 3LLAA 2V7OA 1WCCA 5EQYA 3PUPA 4AW0A 4BY9E 5AM6A 4E8AA 1BKXA 1OGUA 2PZIA 3D2IA 3PY3A 3D15A 3V8WA 4EWHA 5FTGA 3PJ2A 2EWAA 2Z8CA 4CFMA 3R8MA 2OGVA 4FIHA 4B8LA 4O86A 1UWJA 3LMGA 4MF1A 4KRDA 2OXYA 3TKHA 1CDKA 4TYHA 3QQFA 3BI6A 4FNZA 4Z9LA 1OL7A 5ETFA 5KMNA 2Z2WA 5ANOA 2C0IA 2PUPA 4IM2A 1XO2B 4IVCA 3SOCA 4FZFB 5C03A 1YI6A 1YHWA 4YJQA 3G2FA 1F3MC 5FXQA 3VBXA 4AZTA 2OBJA 5LMKA 3V6RA 5IPJA 3MH0A 2XNOA 4NTSA 5J79A 4D4YA 5E4HA 4X2JA 2HOGA 4OGRA 3I79A 3TZ7A 2XEYA 2NRYA 2VTLA 2X39A 2XJ2A 4UWCA 1GY3A 3PRIA 5AP0A 3Q9ZA 3U54A 4NFMA 1JSVA 3DBDA 3KC3A 2BUJA 3MWUA 3VWAA 3O7LB 4FSRA 3NUUA 3F2NA 4KKHA 3W2RA 4J53A 3QFVA 3F88A 1H1RA 4LQMA 4XV2A 4CRSA 3I4BA 1OL5A 2DS1A 2IVTA 3NUXA 4AUAA 2O64A 4K0YA 4ZSJA 5GZAA 4NT4A 3THBA 4EH9A 4KS7A 4MXZA 2X7GA 1PYXA 2XJ0A 4LGHA 4DGLC 1XBAA 5DNRA 5KNJA 4F7SA 4AT3A 4ALUA 2WFYA 3OWPA 3C0GA 5BMSA 4XRLA 4FV8A 3TT0A 4L45A 1XBCA 5ETCA 4ZMFA 2ETMA 3KULA 3RI1A 2G2HA 2OG8A 1OIQA 3BYSA 3CKXA 3LFBA 4IAFA 4FX3A 4C36A 2UUEA 3DBFA 3S00A 1OL1A 2B53A 3E8CA 4PPBA 4RWIA 3F2AA 3ORTA 4CCUA 3BWJA 2PVJA 2RFEA 4YSMA 4IX6A 4WO5A 1PY5A 5HIBA 2R4BA 3LFNA 4UYNA 4FSWA 2VTPA 3IW5A 1P4OA 2A0CX 3H0ZA 4FV2A 2G9XA 3F7WA 4FTRA 2O2UA 4FKJA 4IC8A 3UVPA 3UVQA 4EH8A 3P78A 4CTCA 4JQ7A 4EHEA 2G2IA 5FBOA 4J8NA 3KF4A 4M67A 5IEYA 4X2FA 1O9UA 4NYEA 2R3JA 5AAEA 3BEAA 3GXLA 2QVSE 3H4JA 3HDMA 4G6OA 3T9IA 4HVHA 1J3HA 1KWPA 4N57A 2ZM3A 2PL0A 4UWBA 5D41A 4OTDA 3ENMA 4TYHB 5E8YA 3VNTA 3EIDA 2GDOA 2ITVA 4RX8A 3WE8A 3QCXA 4ZP5A 4F9BA 2C68A 3DJ7A 2QOCA 4IADA 3I5NA 4NUSA 3W8LA 5JGDA 5M44A 4IFCA 1WBVA 1R3CA 3D2KA 3LJ1A 2QLUA 4GYGA 5E91A 3UYSA 5HU3A 4FKTA 5JT2A 3ETAA 3SKCA 4BDEA 5EKNA 2W05A 5LVLA 4D4VA 2GQSA 4DAWA 3LM0A 5EOLA 2FB8A 4LOQA 4BI2A 2UW4A 1KOAA 4XV9A 4AGUA 4X3FC 3R7YA 1ZYLA 2W06A 3DB6A 3DTCA 2BMCA 3QUDA 4W4XA 5EG3A 5FP5A 4PL3A 3PLAE 3FPMA 4QQJA 4A9RA 2R3NA 5FEQA 5CI6A 3RHKA 2VTHA 1F0QA 5AEPA 2GTNA 3O96A 3ORKA 3U9NA 2CKQA 5D10A 4ZTLA 5LVPA 4DH7A 2R3MA 5H8GA 3EH9A 3W18A 2WQMA 2A2AA 3ZO1A 2OU7A 4D2PA 4ZTRA 1O6KA 3KCKA 4UMUA 5J5TA 2B55A 4HPTE 5KBQA 4W4VA 1JSTA 5EDRA 3AC5A 3R04A 1J7LA 4G5PA 3DB8A 4YC6A 4DEEA 5J9LA 2C3KA 4O7VA 3Q9XA 1YRPA 3BELA 4X2GA 3NUYA 3ZYAA 1OIYA 1YOMA 2GNJA 4L68A 5DWRA 3IW8A 4OTQA 2XIXA 5TO8A 4ASDA 5CI7A 3CJGA 3E7OA 4USDA 1ZOGA 2OK1A 4XRJA 4AE6A 2X4ZA 4R1YA 5C26A 4D4SA 5E9EA 4RZWA 5KHXA 5CXZA 4CFUA 3F5XA 1OKZA 3ORPA 3ZDUA 3KRJA 3KULB 3ORIA 4FTCA 4CT1A 3NNXA 5L4QA 5HG8A 3RPYA 4RT7A 5IQDA 2J0LA 4FVQA 2XVDA 4H1JA 3IONA 4DH1A 4FSTA 4YGAA 4PDSA 4C4FA 3AGLA 1PXIA 3NYNA 4FZDB 1KV2A 3TUCA 4BGHA 1BL7A 3SRVA 4WD5A 4HGLA 3G0FA
chains in the Genus database with same CATH superfamily
2CMWA 4OTRA 5DR6A 2JDSA 4R6VA 3GCSA 1PW2A 5FDXA 3PG3A 3HP2A 5EHYA 4XOZA 2BFXA 4JR3A 2PVMA 5M08A 5CF5A 4DHZA 3P4KA 3ZC5A 3PVWA 5A4EA 2J5EA 3SA0A 2HENA 2HYYA 2C6DA 2JAVA 3B2WA 3NW7A 2YHVA 4XG2A 3RNIA 3CIKA 1DI8A 3HAMA 2DYLA 3R1QA 3W32A 1GNGA 4M66A 3AKLA 3F61A 1OITA 4MX9A 3EQFA 4QMSA 3VF9A 3POOA 4EKKA 3G6GA 3JXWA 5EW3A 4WT6A 5FQDC 4AOTA 4HNFA 4XUFA 4O4EA 4DA5A 4KSPA 2WIHA 5IH4A 2VWZA 3PSBA 5BV3A 1SVHA 1BUHA 2CSNA 3GFWA 3QZIA 3B2TA 1M14A 4ZJJA 5GIOE 3IOPA 4X3FB 2G1TA 2BCJA 4EZ7A 2WTCA 4EK6A 4ZJVA 3OZ6A 5AFVA 5HVJA 1GZ8A 3CQUA 5G1XA 2Y4PA 4BFMA 5DGZA 3WF8A 4F65A 3DNEA 5JFVA 1DS5A 3AMBA 5K3YA 5C27A 2FSOX 5EFQA 5JQ5A 4O7YA 2XAOA 4YSJA 4F99A 3FI3A 2YISA 4A06A 4MXCA 5CAQA 4AXDA 3TJCA 4BWXA 1H27A 4HVSA 2QG7A 3B8RA 4YNEA 2PVKA 2CPKE 2JIIA 3EQIA 4NKSA 4PTEA 4QTEA 3NWWA 4L7SA 3KN6A 4FV0A 3QQJA 1XH5A 5KMIA 4Y8DA 4EZ3A 4ANSA 4LMNA 3W0SA 1B38A 5HO7A 2XS0A 1GJOA 4LUEA 4RGJA 3NYOA 1O6YA 4FODA 2OJFE 1GIHA 1TQPA 2UW0A 3FAAA 4UMQA 2IZUA 3C4EA 5G6VA 5HCXA 2HZ4A 4V01A 3R7IA 3NFGB 3ZFXA 3HMOA 3M2WA 1E1XA 4E6DA 3PDTA 1JQHA 4OTIA 3AC3A 3GQIA 4U3YA 5J5SA 1APME 4GMYA 4O0RA 3EWHA 3PPKA 3L8SA 5ETIA 3W55A 3QRTA 2UZDA 1ERKA 4YC8A 4PDOA 1JOWB 3R7OA 4O84A 3NUPA 2UZBA 4IVDA 2EXMA 4IW0A 5EYDA 3R2BA 3R2YA 1E9HA 4HCTA 3V5PA 5CT0A 3UC3A 2CDZA 3NAYA 4YJRA 4GT5A 2C6MA 3DFCB 3VS4A 3ZO2A 1G8KA 3TNQB 4PF4A 3UYTA 3KFAA 2GQRA 1ZMUA 3D9VA 5EDQA 4L00A 4JAJA 3LLTA 4FI1A 3ZSIA 3PXFA 3OXZA 3R01A 1Q4LA 5FEEA 3SLSA 3VUKA 4ZS4A 2CLXA 3SC1A 1SVEA 5HNBA 4C02A 2WMVA 3KRXA 4BIDA 1H08A 4YLJA 2NPQA 2XZSA 5DBXA 3ENHA 2UW5A 1JSUA 2R3FA 3QKLA 3TXOA 4X21A 3GI3A 4EORA 4YLLA 4I5CA 3EYHA 5AR3A 4OTHA 4D2VA 2P0CA 4U9AA 4C38A 2OXXA 2BVAA 3C7QA 1CKIA 3A2CA 3OW3A 4CZUA 5EM5A 4IWOA 3FMNA 4F6SA 2UZOA 4TRLA 4OBOA 2IPXA 1CTPE 3OD6X 4O0WA 2J2IB 4FSUA 4LV5A 2OIQA 4R5YA 2X2MA 5E7RA 4I92A 3VUIA 4EQCA 4ANLA 3TEIA 5AUWA 3QTIA 4ZLYA 1FVTA 2VWUA 4YHFA 5A14A 4H05A 2IW9A 3QHWA 5IA0A 4MXXA 4R77A 3NSZA 1Y8GA 4D2SA 2ZFYA 3O50A 3HNGA 2QONA 5FLFA 3D5VA 5HBHA 4F08A 5LQFA 2AEGA 3TMOA 4F78A 4W4WA 3CTQA 1PMNA 2IJMA 3PY0A 3MIYA 3H10A 2XNPA 1H07A 1QPJA 2E9OA 3SXFA 4J1RA 4NWMA 5ANJA 2FGIA 2VTIA 3HLLA 3E63A 4NJ3A 4LL5A 4KSQA 5HE0A 2ITOA 5HIEA 4QPSA 2IVSA 1ZOEA 3Q6UA 5CU2A 3R28A 2J9MA 4C35A 4CZYB 2QOFA 3DDQA 1FBNA 5HOAA 4NM0A 3BLQA 3LXNA 4BTJA 2XIYA 4APPA 5I0BA 3UG1A 3HECA 5HNGA 4XV3A 5I3OA 2QC6A 1AD5A 5BUEA 4QMXA 4J98A 2Y6OA 2UVYA 3KK8A 3LZBA 3NNVA 3NPCA 3W2PA 4EK8A 3I81A 1ZY4A 1SNUA 3BU3A 3HL7A 4RMZA 2PY3A 2QCSA 5AP3A 5A4LA 4XYFA 1ZWSA 3HV6A 4IAZA 4E93A 5GHVA 3F6XA 4FK3A 1OGYA 4A9SA 2F7EE 1GIJA 4C58A 5IA1A 2C4GA 4RWLA 2WOTA 2WPAA 5EQPA 1P4FA 4AS0A 4TXCA 3ZO3A 4QYHA 2WEVA 4K18A 4DGGA 1OPKA 4FMQA 4HCVA 4HGTA 4JG6A 2VUWA 2V55A 4FV5A 3LIJA 4RQVA 3Q60A 3ALOA 3DAEA 4OTPA 4RX7A 4EYMA 5AX3A 4O27B 3ANQA 2XK8A 3MDYA 4APCA 4NW6A 5AP2A 4X6QC 2LGCA 2W1FA 2X8EA 2WKMA 1NT2A 3QA0A 5IH6A 3QQHA 2QNJA 2P3GX 1DI9A 2CN8A 3MA3A 4AZVA 4CLJA 5DG5A 4TYIA 4QDEA 3QWKA 4XG9A 3T9TA 3MFUA 3EZVA 4EOJA 2W1ZA 4GV1A 3QRKA 5FTOA 4TYEA 3ACJA 3PIYA 3TZ8A 4DG0E 3ACKA 2F4JA 4QMUA 4RWKA 4PMTA 3PG1A 2RFSA 3O51A 3VW8A 5K5XA 1I44A 3EFJA 4ENXA 5CF4A 3QTWA 2B0QA 4PDYA 2GMXA 3FY2A 4QMYA 5E1EA 1Q61A 3DCVA 4TT7A 2BHEA 2JLDA 4I1ZA 3S95A 4FKUA 3NLBA 2RF9A 5CAOA 5CAPA 4FT5A 2X2LA 5M09A 3KCFA 3E7VA 4WBBB 3ZM9A 4O0UA 4R7HA 1B39A 4W8EA 4F9YA 4EUTA 3VS1A 2C6KA 4CLIA 4LRKA 4BC6A 5L2IA 5H9BA 4GFGA 4IAKA 4BDGA 1G5SA 2VTAA 3A7FA 4TY1A 3P1AA 3WE4A 4BB4A 4BTFA 3TM0A 4V0GA 4JX3A 4GSBA 2VU3A 1Y6AA 3HMMA 5CQUA 2WELA 1U4DA 3P08A 2QURA 3PTGA 5DT0A 5E8XA 3TIYA 2XK7A 2XKCA 5D1JA 4P5ZA 2O8YA 1NA7A 1SNXA 2O65A 5AR7A 2O5KA 2ERKA 2V7AA 3ZUUA 3KREA 3OWJA 3Q5ZA 3LJ2A 4RSSA 4MBLA 4NZWB 1J7UA 3POZA 4IM0A 4RIOA 3UP7A 3GFEA 4JDIA 4XNEA 3ZLYA 4BBEA 4E4NA 5JRQA 3UDSA 4PX6A 3FZPA 3BRBA 5I3RA 3TNHA 3EQCA 1R39A 4M0YA 1SZMA 1SYKA 4A9UA 3ORXA 4JQ8A 4FE2A 4FEVA 3F7ZA 3QTSA 3WF6A 5BUIA 2PWLA 1U54A 4G6LA 1MP8A 4R8QA 1YXTA 3SOAA 3OT3A 3HA8A 3S0OA 1OKYA 2ETRA 2YAAA 1R0EA 3F5UA 3FC2A 3IW4A 2H9VA 3L8PA 3PP1A 3PVBA 3QU0A 4I6QA 3EFWA 4HVDA 4RG0A 4X2KA 3CBLA 3WARA 5M51A 3H3CA 2YDIA 5KZIA 3C4XA 4B7TA 5JFWA 1W7HA 1M7QA 3BKBA 5ACBC 4NW5A 4D1ZA 4B4LA 3LMHA 3I0OA 4FA2A 5ANKA 2XCKA 1KSWA 4F9AA 3F9NA 3BHTA 5HKMA 2VWYA 3OMVA 3JR1A 4ZSAA 3DT1A 1S9IA 3MJ1A 1K2PA 4R3PA 2VN9A 3KEXA 3C5UA 4I6LA 1BL6A 1V0BA 2AUHA 3A8WA 3M1SA 3P0MA 4DC2A 2F2UA 2P33A 3FSKA 5L2SA 2JC6A 4FGBA 4B8MA 4BDAA 2OF4A 3BIZA 5LJJA 2BAJA 5L2WA 3VRZA 3G51A 4RC4A 1CSNA 4UWYA 2RL5A 2YM7A 3QKMA 2OZAA 3MTLA 3PE1A 5K4IA 2YDJA 4RPVA 3WIKA 2HXQA 3HV4A 4RIWA 3UGCA 4HJOA 4ID7A 5AIKA 5AV0A 3P23A 3PZEA 2C0OA 3RINA 3GGFA 4FTKA 5HICA 4MUQA 2ZB1A 2JFMA 5CNNA 4YLKA 4I93A 3C13A 3G9NA 4ZS0A 3VQHA 3PE2A 5TT7A 3RALA 3FL5A 1XH8A 2ITXA 5AAFA 4R3CA 3AMYA 2LAVA 4W4YA 4C7TA 4CFNA 5A6OA 4GIIA 1KE6A 1XH6A 4BDIA 2EVAA 3G0EA 2REIA 3FXZA 3WZEA 1H26A 4HGEA 3UDBA 5JQ8A 1IA9A 4PNKA 4S30A 4YMJA 2XK6A 4YU2A 3G5DA 1J1CA 3KXMA 2WQOA 4LG4A 1RE8A 3QKKA 3DLSA 2JITA 4WG3A 4LOOA 5KX8A 3SG9A 3V8TA 1PKGA 3HV5A 3BLHA 3GNIB 3QZGA 5HI2A 2O63A 3UOHA 4ERWA 1DAYA 4BDHA 2ZJWA 2HZNA 1U59A 2YZLA 4U0IA 3FZSA 1IA8A 1PXMA 3NUNA 5DN3A 4YURA 5HTIA 3TWJA 3OFMA 1U54B 3EQDA 3NZ0A 3PXYA 4M3QA 3GT8A 2ESMA 5JGAA 5I9XA 3KIOC 3LW0A 2B9HA 2C0TA 2GS7A 3BGZA 5HCZA 4D9UA 4RRVA 1YDRE 4I3ZA 4O2PA 4NJDA 2I1MA 4AA0A 3M11A 2E9VA 3LMIA 2XNNA 4FUYA 4TTHB 4AOIA 4TPTA 3PIXA 2VTQA 4JX7A 4EI4A 5CSXA 5D9HA 5IA4A 3BYVA 2RKUA 2GS2A 3EN7A 4GRBA 4XLIA 3TIZA 3O8TA 3RJCA 3FLQA 4DEBA 2WMRA 2GHGA 4FV4A 3ZO4A 3WIGA 5J95A 4GW8A 3Q53A 3ALNA 2QKWB 3L8XA 5HVYA 5L8KA 4UXQA 2XM9A 2J5FA 2NP8A 4ITHA 3HYHA 1PXJA 4N4SA 5C8MA 2ERZE 4QTAA 3V5WA 5M57A 3O5AA 1TQIA 4FKIA 4DGMA 5AA8A 4E6AA 3WZDA 3KMUA 4XP0A 3F5PA 4IVAA 2WMQA 5E8WA 2R3LA 3R9HA 3KRWA 1BMKA 4WHZA 1FMKA 4F64A 3DJ5A 4BDBA 5CZHA 4E5AX 5LCKA 3VBQA 2R9SA 4E4XA 3KVWA 4XP3A 5L6WL 4V04A 1W8CA 2XH5A 3QCQA 3UE4A 4XP2A 5HEZA 4CQGA 1CKJA 3R30A 4M97A 2W1DA 1JKSA 4YTHA 5EM8A 5CANA 4EK5A 5IDPA 3U6IA 3D7ZA 1REKA 3OCSA 4BRXA 3AT2A 2R3QA 3BGQA 4UB7A 3T8OA 4FT7A 1XHAA 4O7ZA 2ONLC 3EKNA 3PLSA 4GEOA 2HWOA 3EL7A 4JDJA 3PRFA 4YPSA 3RNYA 3P5JC 5EYMA 2XBAA 5HG5A 2ONLA 3FYKX 3ELJA 4B99A 5AUUA 2Y8OA 1PXNA 3JS2A 2J50A 3RM6A 3DAJA 4JIAA 2CKOA 4QO9A 2XKDA 1W98A 3Q52A 5HZNA 2ACXA 4QMNA 3CEKA 3ZDIA 2BRHA 5EI2A 5HO8A 4ITIA 3OC1A 4KS8A 4DFUA 5JRSA 4DEDA 4I24A 5BVDA 4AZEA 2PULA 2PVRA 5K0XA 4U40A 2PU8A 2XCHA 1OBGA 5L8LA 3GU7A 4RVTA 2ZAZA 4Y73A 5DFPA 3V3VA 3ZRKA 2CJMA 3OS3A 3RK5A 2ZDTA 4CZTA 4F4PA 1URCA 3CXWA 4O7RA 4RLKA 3UMWA 2GCDA 1PXLA 3W8QA 3RPRA 3SVVA 4RJ4A 4G16A 5CNOA 4DFBA 1MQBA 2W5BA 1OIUA 3QQGA 5AP7A 2X1NA 2ZV9A 1BYGA 2EB3A 5KMJA 2UZTA 3OP5A 5JFXA 4F7JA 5LMKC 4XG8A 1OUKA 4ZZOA 2XKEA 3FMHA 5CEMA 4ACCA 4F6UA 1T46A 3MBLA 4P90A 1RDQE 5I9WA 3JY9A 2NRUA 4BIEA 3VJNA 2BRNA 1UA2A 2BDFA 3UO4A 3R7EA 2ZM1A 3E8NA 3FDNA 3MFRA 2G15A 3NYXA 3QGYA 3FWQA 3LFFA 4FSYA 3UODA 3TG1A 2QO7A 5GIPE 3S1HA 4EOOA 4FNXA 3BGPA 2XP2A 2OFUA 4BGGA 2Q0BA 2V22A 4U81A 4GG5A 5CWZA 2BKZA 2B54A 2VTMA 3LFCA 3UBDA 1Y91A 4BN1A 2IW6A 5F94A 5EOBA 5HD4A 3G15A 1PF8A 2W7XA 3Q4TA 3W0NA 1PXKA 3UDTA 2PYWA 4E7WA 1XH7A 2QOOA 5LOHA 2WTVA 4BL1A 3ZH8A 4TYJA 2R3PA 3TZ9A 3W2SA 5DMZA 3I5ZA 2VX0A 4GT3A 2WEIA 2ZB0A 5IG1A 3U4UA 2YIRA 5T3QA 3E5AA 4QMWA 4BCHA 1H28A 5J1WA 5FDPA 1HCLA 4OBQA 4BZNA 3FMLA 4DT9A 3L9PA 5A4QA 1O6LA 2XNBA 3R21A 3FE3A 4K8AA 1EH4A 2I0YA 4GFMA 1K9AA 3A60A 4JMQA 2R7IA 3RAKA 4LV8A 5LVNA 1RJBA 3BU6A 4BHNA 5JFSA 3UO5A 2GFSA 2CGUA 3CQWA 3ZU7A 4XJ0A 3N4VA 1MRYA 2QOBA 4J7BA 4M8TA 1Q41A 3WZKA 3A8XA 3IKAA 3UQCA 2HY0A 4FKGA 1BI7A 4QP2A 1F5QA 3OVVA 4I20A 3GVUA 2UZWE 3CY3A 4EQUA 3FKNA 4RC2A 2QLQA 1XR1A 4GK2A 5B7VA 3U6HA 3R0TA 3OTUA 4QYFA 5IA3A 3O0GA 4QYEA 3FLZA 4ANBA 1WBTA 4QQ5A 1VLRA 2FYSA 1NXKA 1XKKA 3ZLSA 3C4ZA 4XS2A 2XUUA 2VWVA 3EN9A 3KGAA 1YKRA 3UQGA 1VZOA 5IU2A 4EONA 4R1VA 3TKUA 3R8VA 3AD4A 3L9NA 2WMBA 5HG9A 4CKIA 3L9LA 1YI3A 2AC5A 3KRRA 2IW8A 4OLIA 3VS6A 3W10A 4IIRA 4L01A 5K0KA 3UPXA 2YM4A 2FO0A 2C5VA 4FVPA 4O91A 5CTPA 4C62A 3W2CA 4QDVA 3DTWA 4U7ZA 4FSZA 4AQKA 4ZTQA 3QUPA 4DE4A 3MPTA 2WU7A 3GP0A 3OEZA 3OXIA 5FM3A 4E73A 2W1HA 2YIWA 3RVGA 5BQ0A 2X8IA 2BHHA 3UIUA 5I5ZA 2JFLA 4W9XA 4CGAA 2J6MA 4EH4A 5L8JA 4Q9SA 3TNPC 4O22A 4QMOA 4CYIA 5CF8A 1PJKA 2Z7LA 4BCNA 3MY0A 2XNGA 1ZYSA 3ZZWA 1M2PA 4TNDA 2J0IA 4BDJA 3KA0A 3CGFA 4M12A 4KD1A 4KIOA 4O4CA 3V01A 4D28A 2YCQA 4AW2A 5JMSA 4FJVA 3PSDA 1GOLA 2EB2A 4L3LA 3EKKA 2CNQA 3FLYA 4FT0A 5CY3A 3DAKA 4BCMA 5KUPA 5FP6A 2B9IA 3O23A 4D1XA 1ZYJA 4DCAA 4N6ZA 1LEZA 1H0VA 4YJNA 4CVAA 2PVNA 1FVRA 3ET7A 5J7BA 4ALVA 4JL9A 4UN0C 2GNIA 5A4TA 4A07A 1OKVA 2C5OA 4RJ3A 3PWDA 3E8DA 1R78A 5EM7A 3FPQA 4AGWA 1H01A 5KMMA 3IGOA 4AE9A 4U45A 2YCFA 4G6NA 3LPBA 3TTIA 2WMXA 2ZM4A 3IK3A 4DDGA 4G3DA 3DGKA 4QMPA 1AGWA 2CGXA 2WD1A 1SMHA 4O6LA 2B9JA 2XK9A 5EHLA 5HIDA 1DAWA 4DH5A 2CNVA 1ZMWA 2BALA 2HCKA 2OICA 3AGMA 4GT4A 4DCEA 5AUVA 1NVSA 5IH5A 3QX4A 2IWIA 4MHAA 3SX9A 2W5HA 2UZVA 5I9VA 4TL0A 3MPAA 5JKGA 3E3BX 2HW6A 4IZAA 5AUYA 2A98A 5CAVA 1PMVA 4FG9A 3NEWA 4IACA 1ZMVA 4G5JA 2VTJA 3R71A 3IW7A 3OWLA 5AADA 4XBUA 5AX9A 2QU6A 3FI4A 1JWHA 4MH7A 2EXEA 2CGWA 5B2MA 4C3RA 4BKJA 5DVRA 4AXEA 4GK3A 2YM3A 2E9UA 1YVJA 2VGPA 3A7GA 4I6HA 3R22A 4L43A 4Q9ZA 4BBFA 3CD3A 3PJ3A 5B0XA 5M06A 1YDSE 4D2WA 1I09A 3FC1X 1HOWA 2DWBA 2UW8A 2GNFA 2QOKA 3E88A 4WSQA 5EI6A 2YJSA 4IM3A 2VO0A 3ZXTA 5KZ0A 2FUMA 4D55A 1YXVA 2JKMA 3FMMA 4K1BA 5M55A 3R8UA 5J1VA 2YLFA 2ZVAA 4C4JA 4EC9A 5IQHA 3QRUA 1Q8UA 4F1TA 3W2QA 2UVZA 4QP6A 3IECA 3D5UA 3LJ0A 1XJDA 4IE9A 3VS3A 3DK6A 2QOQA 4FSQA 4FTQA 2QOIA 2UZEA 4G3FA 3VS0A 4DEHA 4FSMA 2W4JA 3QTRA 3NIEA 3HRFA 5AA9A 3GENA 4F1OA 4XOYA 3A62A 2GFCA 3Q3BA 4P7EA 3N4UA 4WKQA 3CJFA 4FKLA 5JK3A 3UVRA 3ZSGA 4DTKA 5HNIX 4OTWA 2YFXA 1MRVA 4F7NA 3RBWA 1UNHA 2UW6A 4E4LA 4QYGA 2ZV7A 4Z7GA 2XRUA 3BYMA 3RTPA 1YWRA 4UYAA 5HESA 4QP4A 5A46A 4JQEA 4AZFA 4RX9A 3C1XA 3MIAA 3UOKA 4FKWA 4QPAA 5M4UA 4U80A 4RZVA 4WNKA 4O0VA 1YOLA 1KE8A 3CTHA 4ARKA 1Y8YA 2VGOA 4KABA 4FEQA 4Y95A 2HWPA 3I6WA 2OJGA 4D2TA 4TWCA 3CTJA 3BZ3A 3CC6A 1J91A 4I21A 3W16A 3E3PA 5AJQA 3SRVB 1YHVA 3WILA 4RX5A 2E2BA 2R3IA 3QYWA 4O1OA 4FK6A 2XNMA 4E1ZA 4WNOA 2H34A 4EHZA 3HUCA 5CVHA 2I7QA 3U9CA 3H9FA 3S4QA 1PHKA 3DZQA 4FZ6A 4K33A 5DE2A 3UIBA 4MVFA 5DHJA 2PE2A 5I4NA 3BEGA 4M13A 2OH0E 4IZ5A 5GZ8A 3ODZX 4L8MA 5KMOA 5CEQA 3UG2A 4BCFA 2HW7A 4Z16A 4BJJA 1OVEA 4MNFA 3TL8A 3R9RA 4N70A 3V5JA 5HLWA 4IZ7A 5IQGA 3AKKA 1JKLA 4IFGA 5CS6A 4C33A 2X2KA 3F3UA 4BCKA 3EFLA 4N6YA 4FL3A 4CFVA 4G1WA 5CXHA 2R0UA 3BV3A 2RG5A 2X8DA 3P7BA 2YLEA 3EN5A 4AW5A 2YABA 4QNYA 4EWQA 1FQ1B 3BLRA 3LVPA 4IXPA 4FKSA 4C59A 3NYVA 1Q8ZA 3C9WA 3A7JA 4PP9A 2ITPA 4IAIA 3LFDA 3II5A 4HYIA 1M52A 2R64A 3DZOA 4FTLA 4KKEA 3OHTA 1IEPA 4MBIA 4M84A 4ONAA 3V5TA 5C1QB 5HTCA 5ETAA 1W82A 3FXWA 5C4KA 4MKCA 2JDVA 4YZ9A 4HYHA 4AFJA 4PL4A 1CKPA 2YDKA 3QXOA 4EZ5A 1H1WA 4Q5EA 2IZSA 5FWKK 2BILB 2XJ1A 4EKLA 3LAUA 4FBXA 4WG4A 5FXSA 5CASA 2FSTX 3EJ1A 5JEBA 3PXZA 4B0GA 5BX0A 3U8WA 4E5WA 4AN9A 3AMAA 3R7GA 4MD7E 5AP5A 2VTSA 4CCBA 3QHRA 5HQ0A 2H8HA 1FINA 4XX9A 4YBKA 5HBEA 2PVFA 2C69A 2ZDUA 4JLCA 1CMKE 2Y9QA 4JJRA 5AV4A 3GOKA 2WU6A 3Q9YA 2YAKA 3E62A 2A4LA 1JNKA 3VUHA 4BCQA 4EH6A 4UBAA 4WRSA 5FBNC 1OUYA 4F0GA 2PUUA 3MVHA 4KRCA 4HNIA 4K6ZA 5EYCA 2BTSA 4I23A 3LQ3A 2W5AA 3F3VA 3A4OX 4W9WA 1YXXA 4PMPA 2PZRA 5LVOA 4O0YA 3PPJA 4TZRA 4YC3A 4EK3A 4BDCA 3W33A 3NFFB 5DH3A 2VO6A 2PZYA 5ANIA 3ROCA 4BI0A 3R9DA 5EKOA 5IUGA 5J8IA 1OL6A 4FVRA 3RZFA 2ZYBA 4AW1A 3C4FA 4MBJA 4XH6A 4CFFA 2OLCA 3KMMA 4YZBA 5KE0A 4JI9A 3ZEWA 3MA6A 4CG9A 3VRYA 3VBWA 4BCGA 4H3BA 4FKPA 4RVKA 1ZAOA 4GH2A 4RA4A 1OBDA 3P7AA 4QPMA 4LL0A 4BJJB 4IHPA 4R7BA 2XAMA 4GJ3A 4IX5A 1PXOA 3G33A 4LMUA 3AG9A 3TCPA 1QMZA 3VUTA 4PDPA 3RZBA 4WBOA 3BLAA 3OCTA 5HE1A 2VWXA 3WF7A 2CKPA 4RIYA 4TN6A 3RPOA 1CM8A 5A6NA 4FV7A 4ZSEA 2OI4X 3O8PA 3DY7A 1FVVA 1KUTA 2J4ZA 5F9EA 3N9XA 5ANDA 4EQMA 3MY5A 4RFYA 1YW2A 4HVGA 3NVMB 1KE7A 2Y0AA 5CVGA 3C4WA 4EHVA 2FA2A 4FZAB 4DGNA 2DUVA 2F49A 3FI2A 4I41A 3UO6A 3WYYA 4D0WA 4XLVA 1X8BA 4JBPA 1WBSA 4PTGA 3KXHA 4BCIA 5BUJA 2F9GA 4PPCA 2CGVA 2XKFA 3EN4A 3QZHA 4KKGA 4Y83A 3DLZA 4H3QA 2YIQA 3ZMMA 5IZFA 1JBPE 3SXRA 2CLQA 4ZTNA 4D2RA 4DLIA 4ANNA 4RJ8A 4JT3A 3ZEPA 5FEDA 3QBNA 4R78A 3CKWA 4F0IA 3MVJA 4FYNA 5EYKA 3CPCA 5DEYA 4HGSA 4P2KA 4PNIA 2YM5A 4CFXA 4OUCA 3SD0A 1Q5KA 3BYOA 1Z5MA 4AOJA 4IX4A 1M7NA 5IDNA 2IG7A 3EL8A 3EN6A 5A9UA 2PMOX 3LCSA 4O6EA 4CRLA 5DT3A 4DEAA 2VO3A 5GZ9A 3MN3A 5AUTA 4ZEGA 5ANGA 3RM7A 4CMOA 2X0PA 4U41A 4C57A 5BPYA 3OY3A 2PZPA 2UW7A 4P4CA 4RFZA 2XYUA 2J0MB 4O1PA 3WZJA 2P55A 2W1GA 3R1SA 3PA4A 2DQ7X 2Z7RA 4IEBA 4L44A 4U5JA 3HRCA 4F70A 3HV7A 4OR5A 5KKRB 3Q9WA 2V0DA 5IQAA 2G2FA 4IB3A 5EW8A 3QX2A 2W9FB 4BDDA 3R1NA 3LKMA 1KE5A 4JNWA 2R7BA 5LWMA 4CMUA 1URWA 2VO7A 3O17A 5L3AA 2CN5A 3GB2A 4MYGA 3SXSA 4EOKA 3REPA 1VEBA 2WXVA 2JDRA 2VWIA 4MCVA 4R5SA 4QMTA 3QZFA 2BFYA 2GU8A 3PWYA 4E3CA 3R9NA 4RJ6A 3AD5A 4MXAA 3VC4A 5HX8A 4EBVA 3O7LD 2C5XA 2EUFB 3DKGA 3QD4A 2QR7A 4AQCA 3F66A 4JRNA 2XB7A 3TI1A 5IUIA 1T45A 2QD9A 4X0MA 3FLWA 4A9TA 4XHKB 2GNLA 3BE2A 3P86A 4BWPA 1UNLA 2QI8A 3W0OA 3I0QA 5CSWA 3GCPA 3DOGA 3U4WA 3VBVA 4WRGA 2NO3A 1QPDA 2PVHA 3HMPA 3TNIA 5EQEA 1JVPP 4RIYB 2FH9A 5E90A 2W9ZB 1QL6A 2WMTA 3ZM4A 4AWIA 3UQFA 5BVFA 4FT3A 1E1VA 3HV3A 2Q83A 5CU3A 1GAGA 5AR5A 4FTMA 4IDVA 5BYZA 5JSMA 4DHIB 2UW3A 3EFKA 4FNWA 4AA5A 2W96B 5I9YA 2XARA 1R0PA 4CSVA 2VNWA 3ORLA 4BCPA 3LXKA 1QPEA 3QD3A 4AN3A 3ORMA 3NAXA 3IDBA 3EYGA 1UU3A 4DTBA 3FJQE 4NKAA 2Z7QA 1ZLTA 2VX3A 3CLYA 3N4TA 2PTKA 4FEUA 3ZBXA 4E20A 2I0HA 3F3ZA 4QMLA 3VAPA 3KXGA 1BLXA 4RJ7A 2RG6A 2VD5A 3QTUA 3A4PA 2R0IA 4H1MA 3BBWA 3KB7A 1UU9A 1U5RA 3MYGA 1ZOHA 2JGZA 4FKQA 3MSSA 5AP1A 4DDIA 4DBNA 5HLNA 3DXPA 3UDZA 4QD6A 1Y57A 3CE3A 4D5HA 4MNEA 3R9OA 2JKQA 4ALWA 3P7CA 3VO3A 1LR4A 2QQ7A 1YDTE 2H6DA 2E9NA 3RK7A 3I7BA 3UZTA 4KUJA 2C3JA 4J71A 4V0GB 2OH4A 4IANA 2P2IA 2ITUA 4RLLA 4AAAA 3WF5A