1U59A

Crystal structure of the zap-70 kinase domain in complex with staurosporine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
282
Chain Sequence
KKLFLKRDNLLIADIELGCGNFGSVRQGVYRKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ZAP-70
publication title The Three-dimensional Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine: IMPLICATIONS FOR THE DESIGN OF SELECTIVE INHIBITORS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 282
sequence length 285
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u59A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u59A01
4YC6A 4GYGA 4ARKA 4NW5A 3HP5A 3UBDA 5IQIA 2OH0E 5EDRA 1CM8A 5CF6A 2UUEA 2PVRA 3O51A 5HVYA 4YSMA 2AUHA 3MSSA 5G1XA 3TNPC 3VUHA 2YAAA 4LMUA 4IDTA 1IEPA 3W2PA 3MPMA 3CBLA 5B0XA 4HW7A 1KE6A 4BTMA 3FDNA 1JPAA 5IQCA 4ASDA 3QLFA 4U40A 1J7UA 4MHAA 3TJCA 4USEA 3U9NA 3FLYA 3H0YA 4YTIA 2W1EA 2XNMA 3QX4A 2QOKA 3MYGA 4YJVA 3W2OA 2FUMA 4O7NA 3C4CA 3UODA 3PJ2A 3OY1A 3LM5A 4ZK5A 3OBGA 2PHKA 2XNNA 4JT3A 2C3JA 3RAHA 3VBYA 3RAWA 3GQLA 4RC3A 3UIBA 3F5GA 3KULA 2BPMA 3ORKA 1IA8A 4QYYA 1H01A 4EZ5A 3OEFX 4FSNA 4NL0A 3W33A 2J9MA 2QU6A 3KU2A 3OD6X 5CXHA 3ATTA 2BROA 2VX3A 3PFQA 2X2LA 4DEEA 5I9WA 3R8PA 3MTLA 4IZYA 4JX7A 3QTWA 4X3JA 4G5PA 1H27A 4GRBA 4ALUA 4CSVA 1OBGA 4R3RA 2UW3A 4DFXE 2UZBA 3FMMA 3PXRA 4DITA 4OTDA 3D5WA 1ZLTA 3PXFA 4FV1A 3BGZA 4JAIA 4YTCA 3FI4A 3VS7A 2JKOA 1K2PA 3REPA 3WZEA 1B38A 3CKXA 4FZDB 1I09A 1UWJA 1XHAA 5C26A 4N6YA 2PE1A 2R3MA 5AV1A 2W1ZA 2PE0A 5M4IA 1ZYSA 3H0ZA 4WHZA 2PZ5A 3UQGA 2P0CA 2W0JA 5M06A 4DFZE 3NDMA 4BCQA 5ITAA 4YPDA 5CF5A 3UMXA 4IEBA 1FVRA 2X0GA 3HV3A 3OT3A 5I9UA 2I0HA 4HGEA 5KUPA 3HAVA 1H1QA 4AOTA 2I7QA 5ANIA 3R30A 4JQ7A 2R3NA 3E8CA 3QQHA 5CNOA 4O82A 4XG9A 4BCOA 3BKBA 3O7LB 4HVSA 3QQGA 4EQUA 2CN5A 4KSQA 4O1PA 4QP7A 5D41A 4BZDA 3OOGA 4F1MA 3ZFMA 1O6KA 4QP2A 4CVAA 1L8TA 3OWPA 1PXMA 2OZAA 3ZZEA 5FEEA 4QQJA 5JSMA 3PJ8A 4E4XA 4FG9A 3PZHA 3VRZA 4HCUA 4XNEA 3EYGA 1KE9A 4DTAA 3LFAA 4O0VA 2R3FA 5AV2A 1H1PA 2FH9A 2CKEA 3MH0A 4JRVA 5CU3A 2IG7A 4F9YA 1AGWA 2UZOA 3R8LA 4MWHA 1KSWA 2NP8A 4C0TA 3A7IA 4ITIA 4M67A 3QFVA 2Y4IC 4Y72A 5KHWA 4J99A 2J90A 2BZKB 5AUYA 5DLSA 4EOIA 1UNLA 5D9HA 3POZA 3Q04A 2XKDA 4KBKA 1TQMA 4FTUA 1OPKA 4QNAA 1O6YA 3NLBA 4UEUA 4F7JA 4A9RA 1YDRE 1K9AA 2YCSA 3Q5IA 3DKFA 5CQWA 5AX9A 5M56A 1HCLA 1LEZA 4F7NA 3LOKA 3NNWA 3OT8A 5BVWA 3DAJA 2Z7LA 2YLEA 5CI6A 2IW9A 1XBAA 3CQEA 4QMPA 3LE6A 3R1SA 3ZO3A 1XBBA 1Z57A 2CGVA 2IZTA 2ZB1A 3G51A 5AR7A 2QVSE 4IHPA 4O7ZA 5KMKA 2E9PA 3U6JA 1FOTA 1H07A 3A4PA 4UBAA 3U6IA 3NNXA 4GFMA 2XYNA 4NYEA 3O0GA 3I81A 2HZ4A 5KX8A 4GFOA 4S33A 2YM7A 1XH5A 4L52A 1PMNA 3Q9XA 4QP1A 4QPAA 1YHWA 2PU8A 3QQLA 1U54B 1UWHA 3FLSA 3GU5A 3GOKA 4MBJA 4ZJVA 3OS3A 4DEIA 3C4XA 4JBPA 4IM3A 5AR3A 3UZTA 5L3AA 1ZWSA 3FSFA 3WZJA 4CZTA 1M52A 4QMXA 5FDXA 3VJNA 3IGGA 3WZKA 5BMMA 4IC7A 5C1QB 5EQPA 2I0VA 4AFJA 2WMXA 3GGFA 1YXSA 3OP5A 4II5A 1A06A 4BN1A 3O96A 1P14A 4QQTA 1VEBA 4GCJA 4UY9A 4PF4A 5BVOA 2Y4IB 5GJGA 2NRUA 2WMUA 1R39A 4H1MA 4U97A 4XV2A 3VUDA 4ZLZA 3W1FA 4N0SA 4QMTA 2BZIB 3UNKA 2CLXA 3D2KA 4ONAA 3HDMA 2C1AA 2OK1A 4ZOGA 5ANOA 1PW2A 5A4QA 4CYJA 3EL8A 2BRMA 3G6GA 4I23A 4J8MA 5AUVA 5M09A 4AAAA 3ZZWA 4IADA 5DN3A 4HVDA 4FK3A 5M51A 4NZWB 5GHVA 4AZWA 4DYMA 1R0PA 2BTSA 5CXZA 4B0GA 5AP3A 2QURA 3LW0A 3PRFA 4JXFA 2JBPA 3C4EA 4QQCA 4XCUA 4UB7A 4D4YA 2ZDUA 3JY0A 5IKWA 5EW3A 3UOHA 4R7IA 4XLVA 3SD0A 3BEAA 5EW9A 5BYZA 3Q2JA 5FM3A 2C6MA 2X4FA 3MTFA 4EUTA 4NJ3A 4W4YA 4FYNA 4HCTA 3AMBA 3V3VA 1MP8A 1T45A 1XWSA 2QLQA 2X1NA 4EHZA 1PJKA 1QPCA 2VO6A 3AD6A 2VTMA 4PV0A 5TR6A 4YJRA 3DTCA 3R8MA 3V8SA 2J4ZA 4L68A 4YTHA 2W96B 5DT0A 3AC3A 5CQUA 2YERA 3FI2A 4FL2A 3F61A 3EFWA 3CKWA 1V0BA 2F7EE 2IVSA 2C0OA 2O5KA 3DDPA 3BCEA 3DFCB 3PVBA 4WNKA 4ZSGA 3ZRLA 4XEYA 4EONA 5LMKA 2PVFA 3QAME 3KK8A 3UIMA 1YHVA 3CE3A 4U42A 2X9EA 4XP3A 5CSXA 5AIKA 2QO7A 4RWIA 4YJSA 2J2IB 5BX0A 3MVLA 3Q3BA 4NTSA 3FMHA 5IEVA 3HMMA 3IOPA 4A9TA 4G3GA 3EN5A 2PSQA 4CTBA 2WQMA 3EQBA 4XG7A 1URCA 1KWPA 3ET7A 2J6MA 1BLXA 4FX3A 4DINA 2ZB0A 3CGFA 4YNEA 4BTJA 3VC4A 5ANEA 4FODA 4XX9A 1JQHA 3KVXA 5CEMA 2JDRA 4USDA 4IB3A 4TNBA 5BYLA 3S00A 3VS2A 2X7OA 4I1ZA 3HX4A 4MAOA 5AV3A 5HO8A 4QOXA 3FZRA 1U5RA 3QXPA 4ZY4A 5HU9A 1GAGA 4BVUA 2BR1A 3E8EA 3EQPA 2ONLC 1KUTA 5GIPE 3FE3A 4UV0A 4BCMA 3VS4A 3UE4A 3ITZA 1Q24A 3KRXA 3LCTA 3UNJA 4BCJA 4FT3A 1CTPE 3DKCA 2V55A 4ZY5A 5E4HA 1UKHA 5DYJA 1H08A 4O0RA 5EYKA 4RVLA 3ENHA 3CTQA 2VTIA 4KINA 2G01A 4OBPA 2BRHA 4UXLA 3NSZA 3ZONA 2HAKA 4BWKA 3NMUF 3TKHA 2WTDA 1JKTA 5A6NA 1Q4LA 3RHKA 5FWKK 2B4SB 4N6ZA 3FWQA 4FZAB 4D2TA 4C36A 4E6AA 4IVDA 4DFBA 4L7SA 3UDBA 1VYWA 3AXWA 3FC1X 3LFSA 5HE1A 4I6HA 3PJ3A 5EQYA 3Q2MA 3QLGA 4LGGA 4QYGA 4C4IA 1ZOGA 5CF4A 4V04A 4NUSA 5EHOA 4IZ5A 1GJOA 2EVAA 2BIKB 3UC4A 3LMIA 3L9LA 3F5PA 4C3RA 1CKPA 2QOFA 2JAMA 3AMYA 2R3OA 3DNEA 5HQ0A 4QTCA 4YC8A 4EHGA 2BFYA 3I0QA 4RX8A 3EN4A 3II5A 4IX4A 4L6QA 4NU1A 5EW8A 3QX2A 3ZCLA 3GFEA 3ZO1A 4E6DA 5A4CA 5DE2A 2XH5A 3QA8A 4MBIA 4WNPA 4V0GB 3R22A 4TYEA 4YMJA 1E1XA 4M84A 2X81A 2WQBA 3FLNC 4C34A 2PMLX 3R02A 1W0XC 1CDKA 3CQWA 2YDJA 3E3BX 4RVTA 5EG3A 3HVCA 4G17A 4CYIA 3GC7A 4RIXA 3QGWA 3ZLYA 4HVIA 1RJBA 4EH8A 4LOQA 5CS6A 4XG8A 4F64A 2PUUA 5EYDA 2J0KA 4U5JA 5L6OA 5LOHA 4E93A 1FVTA 3FZTA 3V04A 2WEIA 5LQFA 4QP3A 1SVGA 4BYIA 1UU9A 5ANGA 4R7BA 2VO7A 4IX5A 5EM8A 3MH2A 3C13A 5FXRA 2WNTA 2UZTA 3CEKA 1WMKA 2B52A 5CYIA 4K2RA 4A9YA 4GL9A 4JQ8A 5E8XA 2XNGA 5AR8A 2QCSA 3ZTXA 3NZ0A 2OKRA 4MNFA 1M2PA 2YDIA 4HOKA 3G2FA 5C8MA 3B8QA 2OXYA 3R7UA 3QC9A 3GEQA 4KUJA 5E8UA 3D5XA 1Q8TA 1VR2A 1KE7A 4E73A 4FIJA 3FYJX 2WTCA 4D9TA 2XK8A 4FSZA 4RJ8A 3VHKA 3ZMMA 3CSVA 4PPCA 4WNOA 1KE8A 3QRUA 4RJ4A 4X0MA 3EWHA 1LUFA 3RAKA 3OZ6A 1RDQE 2W99B 3KC3A 2VAGA 4J97A 4EWHA 4IFCA 2QOCA 3DFAA 4QPMA 4M69A 4CTCA 3HV5A 4IB5A 4EH6A 4U79A 2GCDA 4BB4A 5M4UA 3FQSA 5GJDA 4BWPA 2KULA 1PXNA 2EB3A 2O63A 2OJ9A 3KMWA 5E8SA 4UN0C 3D4QA 3PVGA 4UMPA 2BHHA 5HIEA 3R7YA 4GKHA 1PXOA 3F3ZA 4E6QA 3KB7A 2C68A 4MXYA 2HY81 2C69A 3E62A 4ASEA 4AZFA 3EFKA 3D94A 2WB8A 3GI3A 4NIFA 1J3HA 5IG1A 2C6LA 3PP1A 4NW6A 4AW1A 3COHA 5I4NA 4BTFA 1OPJA 2ETRA 4TXCA 4Y5QA 5IUGA 3JR1A 3F5UA 1I44A 1R1WA 4IACA 3QTQA 1ZXEA 2ITZA 4AFEA 3L9PA 3Q96A 3EIDA 3DB8A 3LPBA 4XV9A 5HKMA 3R8ZA 4EORA 5IQGA 2NRYA 3ORIA 2R3RA 4EH7A 4EJNA 1MUOA 4AZEA 3K54A 4HGLA 3ZRKA 4L53A 4FSTA 2FSLX 3BU5A 1ZY5A 3SHEA 4P90A 3UTOA 2XEYA 3GU6A 3NUSA 5KKRB 3DK3A 5A4EA 1P5EA 3D2IA 4TWPA 2F57A 1H0WA 4K6ZA 1Z5MA 1JVPP 3FY0A 3NS9A 3QALE 4M0ZA 1NY3A 2UW0A 2YACA 4FIHA 5HTBA 1YDSE 4YPSA 4CMOA 1YXTA 1BX6A 2QO9A 3OXZA 4ERWA 2UW4A 1NVRA 2OJIA 3QL8A 4MXCA 2CJMA 2R64A 3TNHA 3RMFA 2Z2WA 2QOLA 2G9XA 3LVPA 1O9UA 5IEYA 1ZY4A 4CXAA 1F0QA 5JFVA 5IEXA 3WYYA 3ORZA 3OUKA 3DY7A 5I5ZA 4K1BA 4OTWA 4W8DA 4YJPA 2C4GA 2LAVA 2GS7A 2VO0A 3BYVA 4AA4A 4QD6A 4ZY6A 4D2WA 5AIRA 3ZEWA 4XG2A 1PF8A 4ZZOA 2JIVA 3NAXA 4PUZA 1WCCA 4AN3A 3ENMA 2QG5A 3Q9ZA 4F6UA 1ZMWA 3CY2A 1P2AA 1K3AA 5IA5A 4FSWA 1F3MC 3AQVA 2QLUA 4OTPA 4UXQA 5FQDC 2B9IA 2JGZA 3D83A 3EYHA 3Q5ZA 4JG7A 3U8WA 2VWYA 1PY5A 4NTTA 3UO4A 2XIYA 4XS2A 3SRVB 3AOXA 4MQ1A 5IUIA 5CF8A 4DCEA 5K9IA 2CDZA 4FNYA 1YVJA 2I6LA 1AQ1A 3OW4A 3A7FA 2XF0A 2PWLA 4IBMA 3QTZA 2HXQA 3BYOA 3NVKI 4C4FA 1BUHA 3ORTA 4U80A 2RFEA 5GJFA 4EOQA 2YIXA 4I22A 2GFCA 3MV5A 3PWDA 2VTQA 4QYEA 3RINA 4V05A 4X7QA 1BL6A 5C8NA 3PP0A 3L1SA 3R0TA 5A46A 1H25A 4WOVA 2EUFB 2BKZA 4PMSA 4ZTSA 3ALOA 5FD2A 1G5SA 3KCFA 4PNKA 3I7BA 2GHLA 1Q8ZA 1Y91A 3RM7A 4RJ6A 3UQFA 4BIDA 4BYJA 3OWJA 2XBAA 3EL7A 5AUUA 5EI8A 3ZSIA 4CV9A 4K33A 3R9HA 1M2QA 2BUJA 4TT7A 3A62A 4O7SA 3VBQA 5C01A 3WZUA 2WMTA 4DH3A 2ETKA 5CU0A 2B1PA 4ZEGA 4KRDA 2C30A 2XNBA 4YZDA 5EM7A 4RC4A 4ENYA 3SVVA 4BFMA 3H9OA 4Y46A 4BDEA 2VWVA 3BV2A 3FJQE 4F7SA 1W7HA 3RVGA 4E1ZA 3UG1A 3VS1A 4Q9ZA 2P33A 3EZVA 2DYLA 2IW6A 2YZAA 4FG7A 4U6RA 5H8EA 2O3PA 5HE2A 4ZIMA 4E3CA 2XA4A 4FF8A 2IWIA 5E91A 2YCQA 5L8JA 2VUWA 4JL9A 4QTBA 3P08A 5JKGA 4N4SA 4L7FA 4MVFA 4C4HA 4CQEA 3PXYA 5FRIA 4D5KA 2OU7A 2PYWA 2WOTA 3V8WA 1UA2A 3HYHA 1M2RA 5FG8A 4H3PA 3RHXA 5BVEA 5K4IA 1PMUA 5EM5A 2J0IA 3P23A 1H1WA 3FEGA 4MWIA 2PVYA 4JX3A 5CT0A 4DAWA 1XH7A 2W4JA 5CSWA 4Y5HA 5JEBA 4WBBB 2BRGA 3BV3A 2VO3A 4MXZA 3LKMA 4I0SA 3LQ5A 4FV5A 2UVXA 4P7EA 2OICA 4Z16A 2ZV2A 4XP0A 3N4VA 2CKOA 2JDTA 3H4JA 5EOLA 1BL7A 4AQCA 4EOLA 2WZJA 3QD3A 3QWJA 4TYHB 3HAMA 4FL3A 3UP2A 3LFQA 4TWNA 4W8EA 4WUAA 4NEUA 5LXMA 4O0UA 2JBOA 1JKLA 2ITNA 4OW8A 5AUWA 4FE2A 3BLRA 1QMZA 4AOIA 5AAGA 4CT1A 2C6DA 3H3CA 3VS6A 4MEDA 4EK5A 2WMBA 4D2SA 2HENA 4X3FC 3MBLA 4YP8A 3MVJA 4RWKA 4FTTA 5JZJA 4LRMA 1SNUA 3A7JA 2J50A 1GNGA 2PE2A 2OW3A 4IX6A 3A7GA 4TZRA 4GT5A 1ZZ2A 1OIYA 1XJDA 5E1SA 5KZ0A 3PXZA 3RZFA 3OMVA 2JKMA 3THBA 2V7OA 3QRTA 3DKGA 5CU6A 5AWMA 5CWZA 1NVSA 2H8HA 4DFYA 2GQRA 3S95A 3GC0A 5B2KA 3AGMA 4ANOA 2AC3A 3RK7A 4MX9A 2ZMCA 3JYAA 5DWRA 2F7XE 3NX8A 3ROYA 4C59A 2XZSA 3LLTA 3LQ3A 4IWQA 2IW8A 4EHEA 4BC6A 4U44A 3E7OA 2BALA 4IWDA 4O0WA 4UMQA 1OL7A 2C6EA 3JVSA 3A8XA 3FL4A 5HBHA 4X3FA 5FTQA 3D7TA 1OPLA 3G90X 2R5TA 3PA4A 3KREA 4HZSA 3ZXTA 3G6HA 3K5VA 3UVQA 3CJGA 4FI1A 3P7AA 4JDKA 4RLLA 5HE0A 3ZO2A 3EQGA 3NAYA 3LAUA 1DAWA 5DGZA 1QCFA 3ZUUA 3NUAA 4M3QA 1WVYA 2QC6A 1OUKA 4YZBA 3C1XA 4J7BA 4QTDA 1LEWA 3OCSA 4IDVA 4QMWA 4APCA 1JSTA 2PVMA 3CQUA 2WMWA 3ANRA 3HL7A 1ZYDA 3JY9A 3P9JA 3UGCA 3DOGA 1TQPA 4CFNA 5L2SA 4PL4A 3TUCA 2IJMA 3IW7A 5CNNA 3LLAA 3EOCA 2V22A 3P7BA 5IPJA 4FKVA 3LCKA 2BAQA 2E9VA 4CKJA 2YEXA 5DRDA 5TO8A 3HV7A 5JGDA 3A4OX 2VWXA 5CANA 3SW4A 2UZDA 3HUBA 3C51A 4YLLA 4DH8A 5CVGA 5JGBA 3C5UA 4PX6A 1G8SA 5ACKA 4F1TA 5IQAA 4RA4A 2WEVA 2CKPA 3TV6A 2RIOA 2C3KA 4QQ5A 5AA8A 3MFSA 3EHAA 4D1SA 3KN5A 5HLPA 1QL6A 3LCSA 1OKVA 4IMYA 3DZOA 3GUBA 3E7VA 4NKSA 4GFGA 4LRJA 4AGWA 2R3HA 4BTKA 3GCQA 3ATSA 5J9YA 3O23A 4DTKA 2VNYA 2GS6A 3EB0A 3FHIA 3GU8A 4F4PA 3QKMA 4EOKA 4C4EA 3R1NA 3WARA 3CY3A 4D0XA 4LMNA 2Z7RA 3BWJA 4KB8A 5CSVA 2ITPA 3ZBFA 2R3LA 2B53A 3HEGA 4BICA 4E7WA 4FK6A 4G9RA 5HG9A 3LCDA 2ZM1A 4F0IA 2C6IA 4L00A 4EQCA 1JOWB 3DNDA 3R2BA 4RG0A 3F3WA 3IDBA 3DTWA 3BBWA 4ITJA 1YWVA 3R21A 2GNIA 1WVWA 2BZJA 4BDCA 4FV3A 4YBKA 3LXKA 2VV9A 2OIDA 2X8DA 3ZUTA 4AN2A 4AGCA 4ASZA 4FTQA 2WMVA 4O6LA 5IA1A 4Q2AA 4ZZNA 4EL9A 5F20A 2PVHA 2WQOA 2CGWA 5I0BA 3T9TA 3UVPA 5J8IA 1A9UA 3RAIA 2QHNA 4ZTQA 1M7QA 2I1MA 3RI1A 3WOWA 3CP9A 1SMHA 4FTKA 4ZTMA 2V7AA 4FVRA 4X2JA 2SRCA 1REKA 4OT5A 5TF9A 5L2TA 4FNXA 5ANJA 3VWAA 4XOYA 4EBWA 3R01A 4A07A 5KMMA 4BBFA 3CC6A 2CNVA 2HZ0A 3WE8A 3VF9A 3JUHA 2XNEA 3PG3A 3R7VA 2EXMA 5T6KA 2QOHA 1WVXA 3BHVA 3GCUA 3OF0A 4JR7A 2QONA 4KSPA 4YZCA 5FM2A 2W9ZB 2C0IA 3Q9YA 2XMYA 2A0CX 1UNGA 2B55A 3P86A 3GP0A 3T3UA 1KV2A 3UVRA 4ACGA 5CVHA 3NYOA 4YO6A 4D28A 2J0JA 3ZSHA 2Y8OA 5BUIA 3MW1A 1WFCA 2WTJA 4RBLA 2GNGA 3ZEPA 2BFXA 3TKIA 4HVGA 2WMAA 5ETIA 4YU2A 2B9JA 5B2LA 5EDPA 2PVLA 3DU8A 4U9AA 1Q3WA 4X2NA 4HYIA 2UW9A 4YJNA 3V51A 3UYTA 3FC2A 4BDBA 4U41A 4D1XA 5JGAA 3OCGA 3F6XA 2XS0A 3TACA 3O50A 4AGUA 2YWVA 1DS5A 3HA8A 3SV0A 2B9HA 4RRVA 2BDJA 3MIYA 3GC9A 4A4LA 4QP4A 4BIBA 4ZAUA 4HGSA 3BIZA 3MPTA 5J95A 4H36A 4IWOA 3NVMB 3QXOA 3R1YA 3W32A 4ACDA 3F3VA 4YHJA 3FZSA 1BKXA 3ZDUA 1Q3DA 4CQGA 4DGLC 4XRJA 3BHTA 1PKDA 1JKKA 3AC5A 3MVMA 3PPZA 1U54A 2BZHB 2JEDA 3BQRA 3E88A 4R5YA 4NT4A 3OC1A 4PTCA 4BCKA 4EOOA 3PG1A 4MNEB 3DXNA 3RGFA 4AT5A 3PE2A 2F2CB 2W1CA 5AJQA 4F0GA 3KXZA 4TL0A 4QMYA 3C4ZA 5IQFA 3W2RA 3KRJA 4D9UA 2YFXA 1J7IA 4YURA 3PY3A 4EC8A 2OSCA 3NUPA 4FVQA 3RPOA 3UIUA 3QBNA 5KBQA 1WBOA 3R9OA 5DRBA 1YXUA 4BDHA 3PYYA 1PXPA 2A4LA 5A3XA 3F2NA 4C4GA 3FMDA 2YIYA 5HGIA 4BRXA 2W5AA 2O0UA 3LXPA 4DLJA 4G3EA 5M4CA 3I6WA 4O91A 4OAUC 3MPAA 2PK9A 3AC8A 4FTAA 3TIZA 2EXCX 1MQ4A 4X21A 3F3UA 5IDPA 3ODYX 4IIRA 1PKGA 2BMCA 3DQXA 3Q32A 3U54A 3F7ZA 2IVTA 2WAJA 3OHTA 4JDHA 5IDNA 4DN5A 3BU6A 5CASA 3WIKA 2OJFE 3FY2A 2QR7A 3PRIA 4RA5A 4K77A 1GOLA 3ANQA 3BGPA 5J7HA 3A8WA 4ERKA 4DEBA 5HICA 3UPZA 1ZMVA 1H1RA 4EH9A 2YISA 3DDQA 4IVAA 3RP9A 4DEHA 4CCUA 2UVYA 3IPHA 5TKDA 5M53A 1G3NA 3GB2A 4I4FA 5LARA 3A2CA 4I6BA 2R3PA 4GT4A 5DR9A 4ZTRA 4F08A 3SOCA 1E9HA 4B4LA 4I93A 4FEQA 5EKOA 4PP7A 3VBWA 5CEQA 4RVKA 4AX8A 4CKRA 4BDAA 3PIZA 4DT8A 5FBOA 2GNJA 4JDJA 4C2VA 2WGJA 3BELA 4FYOA 3TV4A 2Y4PA 3FMKA 4ZS0A 2W1FA 4I5MA 5HI2A 2W17A 2RF9A 1MRUA 3HMPA 2ERZE 2WPAA 3IO7A 3O8TA 4OBQA 2QO2A 3QD4A 3PSDA 2PZYA 3R73A 4AZSA 3OY3A 4F70A 3Q6UA 3R6XA 3RPYA 3UZRA 4LUDA 3OTVA 3A61A 1Y8YA 1WBTA 3BZ3A 3E87A 3K5UA 4PWNA 4WRGA 4XRLA 4MBLA 1CSNA 2FYSA 5M08A 3IDCA 3MWUA 5AP2A 4HJOA 4BY9E 1OL5A 4ZTLA 5AP1A 2Q83A 3CPCA 3G0EA 5FXQA 2XKEA 3QUDA 5CY3A 3E8NA 2YM5A 5IZFA 4BHZA 3U4UA 5JRQA 3GU4A 2VNWA 2YJRA 1IR3A 3HRCA 1B39A 2YA9A 5CAUA 3F2RA 1PXLA 4UMRA 3CD8A 1P4FA 2W05A 3EQRA 2EU9A 2R3JA 3DT1A 4ACMA 4DLIA 2VTSA 5A54A 5H8BA 4FTIA 5LWNA 2B9FA 5T68A 2R7BA 3ZOSA 2QD9A 2OZOA 5BVKA 4CEGA 3OUNB 1RQQA 4FZFB 2V0DA 3EQCA 5F9EA 3U6HA 3NUXA 4I24A 5LWMA 3MY5A 2GHMA 4O0SA 4TWOA 1RE8A 3O71A 3N4UA 3MFRA 3CIKA 3IQ7A 4BDDA 4EYJA 4QTEA 4E4NA 5DVRA 1IASA 3LJ2A 2NPQA 3NCZA 2UZVA 2ZOQA 4FKLA 5HO6A 5AM6A 3AC4A 2I40A 2PZIA 2WTVA 3ZRMA 4QMZA 3B2TA 2XIKA 5HCYA 2CHLA 4BDJA 2OLCA 4FV7A 1PXJA 1QPJA 4OTGA 2XIRA 3RWQA 4M8TA 2VWBA 4HNFA 2XRWA 4V0GA 3SG8A 4JS8A 4K9YA 2C0TA 3NUUA 4FV9A 4EOSA 5J1VA 2FGIA 4BKJA 4LGDA 2E2BA 3LMGA 3G0FA 2QI8A 4PPBA 5AUTA 4RSSA 3AT4A 1GZNA 2ONLA 2QKRA 1PHKA 4FT7A 1ND4A 2CSNA 1BI8A 3IONA 2HXLA 3LZBA 2VTAA 5KMIA 2OIQA 1VYZA 5DBXA 5FP6A 5IH6A 3BYMA 3FKOA 3NW5A 3V5WA 3BYUA 3QRJA 4HZRA 4FSYA 4RWJA 4F1OA 3R9RA 2R3IA 3BE9A 3DJ5A 5L2QA 3W8QA 2VTTA 2HYYA 4RIYA 3ZXZA 5I9XA 5IH4A 4N57A 1AD5A 4O2ZA 1M14A 1SVHA 2P2HA 3R2YA 3LCOA 4FV6A 4JOAA 4O7TA 3KXXA 4K8AA 3RTPA 2VTRA 4O96A 3TT0A 3U9CA 1J7LA 4TPTA 1SNXA 1Q61A 3R00A 2VWZA 4OBOA 4RGJA 3O2MA 2JAVA 2OGVA 2XNPA 3R28A 3CLYA 5HVJA 3LMHA 1NA7A 3KCKA 4JI9A 3F3TA 2CMWA 3QHRA 4AN9A 5GIOE 3T8OA 2X7GA 3V6SA 2RL5A 1Z9XA 3SKCA 1YDTE 4AA5A 1V1KA 2ETMA 2IZRA 5LJJA 2C5OA 3ODZX 4NCTC 2B7AA 1Y6AA 3OWLA 4LM5A 2NNWB 1ZOEA 4LOOA 2BCJA 4P4CA 3RCDA 3UNZA 5KKRC 2UW7A 4AW2A 4APPA 3LM0A 2PUPA 1MRYA 3FHRA 4PPAA 2XM8A 3FPQA 3L8PA 4WRSA 3PVUA 3H9RA 4WO5A 3FXXA 5ICPA 4O7WA 4UWBA 4F7LA 5CALA 2X6DA 3E8DA 2HZNA 2ZV9A 3NPCA 4XP2A 3FZPA 5E92A 4BCIA 2V62A 4BL1A 1Q99A 3IW8A 2JDSA 2YIWA 2C5YA 3IG7A 2O8YA 4L43A 3NCGA 1URWA 5DPVA 3ZYAA 2X39A 2XJ0A 3HDNA 4W9XA 5DHJA 4QMNA 4XG6A 3SG9A 5DR2A 2OF4A 4WD5A 4BGGA 1L3RE 4TN6A 5LVMA 1JLUE 2IVVA 2WXVA 2W06A 4LRKA 3LFCA 4PL5A 4RWLA 2YCFA 3EKKA 4KD1A 3DJ7A 5K3YA 3PPJA 2G2IA 2HW7A 4D4RA 1PYXA 4L67A 5CZIA 5BVDA 4I5CA 3UZPA 4CRLA 3LJ0A 4U43A 4ALWA 2WD1A 3S2PA 4O6EA 5AP6A 4HYSA 1OL6A 3JVRA 5EOBA 3RM6A 4ANQA 5HBJA 4CG8A 1E1VA 4C02A 4C4JA 4RIXB 3F66A 5HTIA 4BCGA 4E6CA 3KRRA 3FZ1A 3MI9A 3OWKA 4NM7A 2YM8A 1J91A 4J95A 4XV3A 5I9VA 3BU3A 2XCHA 3MB7A 1W83A 3LFBA 1WZYA 3C9WA 3OXIA 2RGPA 2KTYA 2QHMA 3I5NA 4KBAA 3TV7A 3HA6A 1YXXA 1Q97A 2XM9A 4E5WA 5F4NA 2GNHA 3FV8A 5DIAA 1HOWA 3LXLA 3E93A 2QOOA 4ZP5A 2DS1A 5IISA 5LVPA 4MF0A 3TDVA 4PL3A 4NH1A 2HIWA 2VX1A 3U87A 2CNUA 4GW8A 3PY1A 4YGAA 4BHNA 1GZKA 2G15A 3D5UA 2JC6A 2OH4A 3SRVA 2HK5A 3VULA 4XG4A 2DUVA 4BIEA 4G5JA 5CZHA 4ACCA 1ZYLA 3P5KA 4IWPA 4OGRA 4UALA 5CENA 4TNDA 2RFSA 3K3IA 4L3PA 3D14A 3GOPA 4IAIA 4DF3A 2GNFA 5FEDA 2XK3A 3L8SA 4AA0A 4HGTA 4YZNA 4DFNA 3TTIA 5KMJA 1GY3A 5T3QA 3I5ZA 2JKQA 3QZFA 3WE4A 2YITA 2OO8X 3BGQA 3KY2A 4RLKA 2JDVA 3DJ6A 1HCKA 3RKBA 3I6UA 4DC2A 4FR4A 4JJRA 3DLSA 2X9FA 2RSVA 3IOKA 4RVMA 1ZYJA 4L46A 5CAOA 4QMMA 4JQEA 5CU2A 4YO4A 2IN6A 4NIFB 3VVHA 4G2FA 3UC3A 2PMNX 2ZDTA 3GCPA 3DBEA 1TQIA 1U59A 2AYPA 3ACKA 3NIZA 3UO6A 4O86A 5E8WA 4RIWA 3W2SA 4A4XA 4M97A 4ALVA 3UOLA 2ZYBA 4X2KA 4EKLA 3MVHA 3PTGA 4M0YA 1UU8A 5IQBA 3DAEA 1W98A 4F65A 5CAQA 5BYYA 4LV5A 4MKCA 4I6QA 4YZ9A 3M2WA 4JIAA 5AP7A 2BIYA 3PLSA 4YJOA 4CLJA 3TJDA 1NW1A 3QCSA 5JQ5A 1FGIA 5EI6A 2ITXA 1ZAOA 4FKSA 3TZ9A 3ZUVA 3MH3A 5CSHA 4U3ZA 3GFWA 5F1ZA 3G5DA 1OL2A 2OI4X 3FMJA 2QOBA 4GK2A 3DQWA 4AU8A 4R78A 1YQJA 4ZZMA 1XR1A 4FKTA 3LQ8A 4XV1A 2WIPA 3QQFA 4FA2A 3SLSA 2XKCA 4CT2A 4FKUA 3AD5A 1FINA 3QD0A 4GK4A 4MXAA 4ZJIA 4BDKA 1UV5A 4C57A 2GSFA 5KMLA 4GKIA 1QPEA 2VWIA 3TM0A 2W7XA 4H58A 3I0OA 4I21A 4XYFA 2ITUA 2R0IA 4A7CA 4DG2E 3WYXA 5L2IA 4G6LA 1IA9A 4ZLOA 3A7HA 2YWPA 3CR0A 2WMSA 3L9MA 4H39A 3A99A 2QG7A 3PA3A 1R0EA 3B2WA 3OG7A 4FG8A 3AD4A 4HPTE 3MA6A 2WQNA 4R7HA 4DFUA 4HPUE 5E1EA 3VUTA 4XH6A 2J7TA 2IZSA 2RG5A 4LGHA 4GH2A 4C58A 4G3CA 4FKWA 4GYIA 3KK9A 4RC2A 2CPKE 3AGLA 3POOA 5BMSA 4CZUA 5CAPA 2VWUA 4I5PA 1V0PA 4D2PA 4Z55A 5CAVA 2XIXA 4IE9A 2O64A 5AR4A 3WF6A 3ZC5A 4BDIA 3SW7A 4BKYA 1XBCA 3K2LA 5IU2A 5FDPA 4MK0A 2Y0AA 5IA4A 5IMEA 4FKJA 5DI1A 3SQQA 2F9GA 3I1AA 4G1WA 4O27B 5HTCA 2X8EA 4M12A 3P1AA 3QKLA 3QZHA 4QMQA 1OZ1A 5HD4A 3KQ7A 4KKGA 1YRPA 5I3OA 1J1CA 2P55A 3BWFA 5HIDA 4HYUA 2XK6A 3HMOA 4RPVA 5GNKA 3R63A 4BCFA 3WF9A 2WHBA 3E5AA 5HD7A 5J5TA 5L4QA 4LI5A 1VJYA 3W8LA 3KMMA 3F9NA 5JZNA 1UU3A 2UW8A 4P5ZA 5FTOA 4O7RA 4AE6A 4FZ7A 4OTIA 1BYGA 4O21A 2VTHA 4HVHA 3D15A 4FEXA 4NWMA 2PL0A 2BRNA 3DLZA 1ATPE 4PDPA 4QT1A 5L6WL 5HZNA 1P4OA 2P3GX 4G3DA 5J7BA 2YABA 4BWXA 1OIUA 4OT6A 3PWYA 4IB0A 4FEVA 3IKAA 3UMWA 4ZTNA 2X2MA 3QQKA 3E64A 5JH6A 3V5QA 1PMVA 4DGOA 2PMIA 2HCKA 4KABA 4F9BA 4MYGA 4LL0A 4P5QA 2JITA 3ZO4A 4F99A 1YI4A 3EFJA 2XK7A 3NUYA 3RPVA 4S31A 2X7FA 3Q4UA 4NK9A 4KIKB 3TIYA 2J0MB 4RJ5A 3UYSA 3R1QA 4O7LA 3QU0A 5HESA 4AUAA 3V5LA 1OM1A 3QKKA 3R7GA 3L8VA 4DHFA 2H6DA 4QYFA 4FUYA 1NVQA 3MH1A 4DGNA 3FPMA 2BKKA 1WAKA 3FXWA 4TW9A 4O38A 2HWPA 3AT2A 3NWWA 2UVZA 3BX5A 5ACBC 1W82A 4MD7E 5AM7A 5GINE 4J1RA 1JKSA 3TNQB 3EH9A 5LCJA 2Y6MA 4UWCA 3Q53A 3P4KA 2WQEA 4D1ZA 4FV4A 3ZLWA 4IZ7A 2YLFA 2UV2A 5FBNC 2YIQA 3WF8A 3DBFA 5C03A 4FKOA 2Z8CA 3PXQA 4J53A 1NT2A 3SA0A 4R5SA 4IAKA 4OUCA 3TL8A 4FSQA 3U55A 5ETCA 3ULIA 2VTJA 4BDGA 2OF2A 4USFA 1EH4A 4FIGA 4MD8E 2B0QA 4L3JA 4W4XA 5EYCA 4W9WA 4C61A 4KIQA 4F6WA 2Z7QA 2XRUA 5J79A 1LP4A 4MH7A 3CPBA 4G34A 3LFFA 4W4WA 3C50A 4JBQA 4WG4A 2VU3A 4L42A 3EN7A 3L8XA 2YIRA 4QP8A 4E8AA 5L6PA 4CCBA 5EDQA 4YTFA 5JFXA 4WIHA 5D7AA 3VF8A 4FOBA 4FGBA 3PIYA 4OTQA 3F82A 4A9SA 3Q4TA 1JSVA 4WA9A 5HCZA 4EI4A 4CFMA 4U7ZA 3KXHA 2IPXA 5HLWA 2A27A 3IGOA 1OGUA 3R04A 4NFNA 1H4LA 4RQVA 5CEKA 3FBVA 1DI9A 5BVNA 4AS0A 2ITVA 1YOLA 4IAAA 5CLPA 4D2VA 4AT4A 2BTRA 5HNBA 2WO6A 1H26A 3BRBA 5H3QA 3DCVA 2IVUA 5FGKA 4U45A 3PJCA 4E20A 3PDTA 3FMLA 2W1HA 4CV8A 2XUUA 3S3IA 2C6TA 4KIOA 2Z7SA 3RZBA 4FNZA 4LG4A 4KKEA 4FMQA 1XKKA 2ZJWA 5IUHA 2OFVA 3PLAE 2OXDA 4XUFA 3QCQA 1ZZLA 4GJ3A 4JBVA 1J1BA 3QQUA 4IJPA 1XQZA 3Q6WA 2NO3A 2WTKB 3O7LD 3W2CA 5L8LA 2Y9QA 3SXSA 4ANNA 4O22A 3AG9A 5KE0A 4FEUA 5J87A 4R3CA 5TOZA 5HVKA 4BCHA 2O65A 2A2AA 2YN8A 3F69A 4PQNA 3UP7A 3WF5A 5CSPA 5I9YA 2PPQA 3DXPA 4RIOA 3E3PA 5F94A 3ELJA 1GZ8A 4EH2A 1OB3A 4FIEA 5FP5A 3ZLSA 3DKOA 4EH3A 4Z7GA 4G3FA 3WBLA 3EN9A 3IK3A 3O8PA 2W9FB 3TZ7A 3MY1A 4S32A 4YBJA 4DFLA 3RJCA 4Z7HA 2C47A 4DA5A 3CTJA 5G6VA 4AZVA 2ZM3A 4JAJA 3BQCA 2WKMA 1FMKA 2VN9A 3CTHA 5DMZA 2HOGA 4UMUA 5KCVA 5EQEA 2UZWE 4C3PA 4OTFA 3H10A 4IAYA 5J9LA 4JBOA 4MCVA 5DA3A 3BI6A 3EFLA 5CEIA 3ZFXA 1STCE 3MIAA 4M13A 3VBTA 2C5NA 3OXTA 2OG8A 5AV4A 3SDJA 2H96A 4OTRA 2R3QA 3UIXA 2WMQA 4YC3A 3F88A 4C3FA 4D0WA 2H9VA 3IW5A 5TE0A 4BGQA 5DT3A 3VS5A 5CEOA 1YWRA 2WTWA 1YWNA 4LL5A 2J5FA 1LR4A 3PIXA 4E4MA 2JFMA 2X8IA 1Q5KA 4FT0A 4F9WA 4FKIA 4N70A 4RX7A 2I0EA 3G33A 4OTHA 5CT7A 2CLQA 3KXMA 4MNEA 4FV8A 4Q5HA 3EMGA 3FI8A 4YLJA 4P2KA 2E9NA 5DT4A 1ZRZA 3KULB 4RQKA 4C8BA 1FQ1B 2ITQA 1VZOA 2BHEA 2XBJA 2XYUA 3N51A 5FUTA 5AR5A 4W4VA 2GHGA 4IM0A 4M7IA 1SZMA 2A19B 4JG6A 4QMVA 2GU8A 4DGMA 4EUUA 5M44A 1OECA 4G6NA 4AF3A 3KL8A 4DEDA 4PDYA 4H3QA 3V8TA 4AW5A 4DEGA 4DH1A 4EOJA 4Y83A 5EM6A 4XBRA 3PUPA 1OBDA 4GT3A 4Q5EA 2W5HA 4ZLYA 5KHXA 1R78A 2RG6A 2RKUA 3ORMA 5EI2A 2ITTA 4RJ3A 3ZC6A 5A4TA 3EQHA 3OFMA 2OJGA 4FKQA 4S34A 2GPHA 5H8GA 1GZOA 4TYIA 2GQSA 3EQDA 4BBEA 1YOMA 4TYGA 2Y6OA 3NW7A 2OJJA 4FTOA 4YHFA 4BGHA 3CGOA 5FTGA 5DR6A 4IVCA 3MJ2A 1YOJA 2B54A 2CCIA 3DBCA 2F49A 4TKSA 4EEVA 4UWYA 3TUDA 4IANA 4UYNA 3OW3A 4JVGA 5IA3A 4I94A 3V5PA 2CN8A 4IFGA 1BMKA 4BI2A 4ENXA 4S30A 5HHWA 4D58A 3QZGA 4WG3A 4ANLA 4CZYB 1ZOHA 2I0YA 4E26A 3UQCA 4CD0A 1U46A 4QP6A 2GQGA 4Y95A 2OWBA 4J52A 4IQ6A 4PMTA 2QODA 5A14A 2YHVA 4BZOA 3T3VA 1W84A 1OI9A 3VW8A 4C7TA 2C5XA 4FSRA 3VBXA 2ZV7A 3FSKA 4DH5A 4DCAA 3R9NA 5ETAA 5ANDA 1OMWA 2FSOX 3ETAA 3C0IA 3MDYA 2OZAB 2YM3A 1CKIA 2VTLA 3AT3A 2R7IA 4KWPA 3ZM4A 4A06A 5AADA 3AC1A 2VWWA 3DAKA 3MB6A 4G31A 4FKPA 1X8BA 3DV3A 4FV2A 5HOAA 4AE9A 5JFWA 2YDKA 3IW6A 4AG8A 1OIRA 4JG8A 3QCYA 3UG2A 4RT7A 4EOMA 3PXKA 2VZ6A 3Q9WA 2QOIA 4WUNA 2X2KA 3W18A 2R0UA 1OUYA 3ZM9A 4LV8A 5M4FA 4H3BA 5LVLA 3W10A 3HRBA 1Y57A 4IVBA 4CRSA 2F7ZE 3FKLA 4FGRA 3VBVA 3WILA 1CKJA 1ZARA 3DB6A 4JDIA 3TDWA 3Q60A 3QGYA 5DEWA 4K0YA 3V01A 4ANMA 5J5SA 1JAMA 4TY1A 4AW0A 4DTBA 4ZS4A 4E5BA 4ZSAA 1FGKA 5AP4A 1FVVA 4QPSA 2W5BA 5AP0A 5BVFA 5I3RA 2PULA 3QRIA 4GVJA 2IO6A 4ID7A 4KS8A 5B7VA 5EYMA 1DI8A 2P4IA 4AXAA 5J1WA 1GIIA 3UOKA 2P2IA 4UYAA 3KA0A 2UZLA 5H9BA 4YUQA 4CFUA 2OXXA 3CS9A 3Q4ZA 4DEAA 2XKFA 3IS5A 2CCHA 4XBUA 1QPDA 3E63A 3QHWA 2WIHA 4J96A 5HBEA 5K0KA 3O17A 3AMAA 5M07A 1W8CA 4FICA 1UVRA 2ZMDA 2PUIA 4GU9A 4GMYA 4HCVA 4F6SA 1CMKE 2J5EA 3ORXA 4NFMA 5C4KA 3QRKA 2C5VA 3TZ8A 1GIJA 2RFNA 4I92A 3I60A 4XMOA 3RBWA 4L8MA 4JLCA 4QMOA 5E8VA 5AV0A 4EWQA 5IF1A 1APME 4FIIA 4FTJA 4PTEA 3VRYA 3BBTB 1Y6BA 2V5QA 4K18A 2R3GA 4EK3A 2FB8A 5LMBA 1B6CB 3NRMA 4HNIA 4JNWA 1OVEA 4QP9A 4YJUA 4GJ2A 4IZAA 4PDSA 4ZSEA 4BBMA 2XIZA 4CG9A 3GQIA 5KMOA 2FVDA 3QTUA 4PNIA 3RALA 3QTSA 4EK8A 5GZAA 5HORA 3I79A 2J51A 2YZLA 3MGYA 4MXXA 4NM0A 3KGAA 3SXFA 3C7QA 3MA3A 4OR5A 4I5HA 4WBOA 5JQ8A 2E9UA 1OITA 3GBZA 4IAZA 4PTGA 5IA0A 2G1TA 2PMOX 3GNIB 3ID6C 5LMKC 3QTXA 2YAKA 3H30A 4O0YA 4EZ3A 1NXKA 2Q0NA 4F9AA 2H34A 4KIPA 5M57A 3OBJA 3EQIA 1F5QA 3GCSA 4EH4A 3TCPA 5BUEA 5E9EA 3QTRA 3KEXA 3QD2B 4Y85A 3D9VA 3VUMA 3WZDA 4EC9A 4EYMA 2GS2A 2QKWB 2Z60A 3HMNA 2VTOA 2XJ1A 3Q52A 3ROCA 5EKNA 2WU7A 3U51A 3PE1A 1WBNA 4GUEA 4JRNA 3FQHA 3JPVA 3DGKA 1OKZA 5IQDA 3VHEA 3HV4A 3V5TA 5HX6A 3F2AA 3N9XA 4RZVA 1UU7A 3PY0A 4RFZA 1SM2A 4PP9A 1T46A 4KRCA 5IA2A 4NM5A 4I3ZA 4WSQA 4XLIA 1PYEA 3T9IA 2AC5A 4X2GA 1M17A 5C27A 4KAOA 4CFFA 3P7CA 4IXPA 5BNJA 2W4KA 2O2UA 4GG5A 5KMNA 5LVOA 2CGXA 4DE4A 3LXNA 2WELA 2GTMA 4C38A 5HU3A 4GUBA 1Y8GA 4G16A 4FKGA 4WT6A 4DBNA 3I7CA 4LYNA 3TWJA 3TN8A 3N4TA 2HELA 2GNLA 3U4WA 4GIIA 3ZBXA 5JFSA 4I0RA 1XO2B 1ZMUA 3DBQA 4GIHA 5GZ9A 4O81A 2WFYA 5JRSA 1BI7A 4TYJA 4JIKA 2A1AB 4NKAA 1JWHA 3C5IA 1H28A 2UZUE 3IECA 3KXNA 3OCTA 2CKQA 3S0OA 4H1JA 4IC8A 4CFWA 4FSUA 2JIIA 3KVWA 4MTAA 5K4JA 5KO1A 1IAHA 3QYWA 1IAJA 3QA0A 4FTMA 2XP2A 3GENA 1V0OA 1MRVA 4X6QC 4X2FA 3NEWA 5JMSA 3TEIA 4EK6A 4XJ0A 4FT9A 4KBCA 3FQEA 4M66A 1YW2A 2F4JA 3M42A 4AACA 4O2PA 4IW0A 5I9ZA 3VN9A 2JDOA 4G9CA 4FL1A 3TXOA 2UZNA 2JFLA 5E90A 2G2HA 2YCRA 3MY0A 3OCBA 4KS7A 4S2ZA 5C8KA 4B9DA 2JD5A 3RK9A 4PDOA 2ERKA 4CFXA 4FEWA 5AEPA 2VGPA 3R9DA 3ERKA 3K3JA 1U5QA 4L01A 3P0MA 3NW6A 4QRCA 3BHHA 5HG5A 4RFMA 2C6KA 3PZEA 3TNWA 3ZU7A 1R3CA 4DGGA 2C1BA 4FTCA 4WSYA 4BZNA 1Q8YA 3M11A 4PMMA 2XCKA 3ALNA 3SC1A 3OEZA 5J9ZA 3KMUA 1H24A 1YXVA 4I0TA 5HG7A 3KF4A 2ESMA 5HO7A 4TRLA 3H9FA 4A9UA 2Q0BA 3NNVA 4YHTA 3UPXA 3DXQA 4ANBA 2PY3A 3LFEA 4FNWA 5HCXA 4ZXTA 4F63A 3FMEA 3MFUA 4NCTA 1M7NA 3FKNA 5K5NA 1S9IA 3GCVA 4I20A 3DPKA 3L9NA 3DZQA 2JLDA 5DH3A 5AFVA 3COIA 3FYKX 1TVOA 2FSTX 2XNOA 4C37A 4ZMFA 4RJ7A 3DA6A 2PVKA 1KOBA 3FUPA 4GU6A 4RIYB 5CU4A 4E5AX 5IMXA 2ZV8A 4QMUA 4OLIA 3VS0A 4YJQA 4F9CA 3FLQA 3BHUA 3BLQA 4ZMEA 4R8QA 2JIUA 4J98A 4UMTA 4O84A 4BR3A 3VO3A 3R8UA 2ITOA 5A9UA 2FA2A 2OBJA 3HECA 3LFNA 3OVVA 2ZVAA 4NM3A 5AUXA 2G2FA 2C3LA 3IDPA 3P79A 2PVJA 2VD5A 1H00A 3O8UA 2XK9A 4FC0A 3EN6A 3D0EA 4GV1A 4QYHA 4EZ7A 5CTPA 5CI7A 3G15A 3KFAA 2YJSA 4C2WA 4Q9SA 5B2MA 4R77A 3HV6A 2J0LA 2C6OA 1O6LA 3BPRA 4Y8DA 5C9CA 4R1YA 3CD3A 3MFTA 3Q4CA 3RPSA 3PPKA 5M55A 4DG3E 3UOJA 3LFDA 4IX3A 4UX9A 1FBNA 3KKVA 1WBPA 5DG5A 4L9IA 5EK7A 3B8RA 4D55A 3QUEA 3RNYA 1XH8A 3PVWA 4CFVA 4YNOA 3CXWA 5AP5A 4CKIA 3SX9A 4GG7A 1OL1A 2HW6A 4UZDA 4YLKA 4ZSLA 4EH5A 3VQUA 3UJGA 3QWKA 4IJ9A 5HNIX 2BVAA 2PVNA 1KV1A 3W2QA 3BE2A 4QMSA 4M69B 5AMNA 5AA9A 4QTAA 2DQ7X 2XEZA 5DFPA 3R8VA 5EHYA 1ZYCA 2W1GA 3C4FA 5TT7A 3ULZA 2DWBA 1SYKA 1UNHA 2XJ2A 3KN6A 2X4ZA 4FTLA 4I6FA 2QQ7A 3KRLA 3BHYA 3QQJA 4UZHA 4LFIA 5FLFA 5H2UA 4B8LA 3ACJA 1KE5A 1PMEA 4RFYA 3TZMA 4MXOA 2WMRA 4D4VA 4H05A 4AGDA 3W55A 4XOZA 2W4OA 1S9JA 4D5HA 2UW5A 3ZSGA 4B99A 3R7OA 3FMNA 4GK3A 3D7ZA 3TKUA 3ZH8A 3COKA 4KA3A 4O7YA 4O7VA 2BRBA 2UW6A 1U4DA 3FI3A 2IZUA 3PA5A 4YZMA 3P78A 3JXWA 1YHSA 5DEYA 3GC8A 3LJ1A 2E9OA 2QU5A 1FMOE 1GIHA 1OKYA 4ZSJA 1YI3A 5KBRA 5EHLA 3V5JA 5D10A 3DS6A 3HZTA 3OOMA 3NR9A 4FBXA 4AZTA 3FAAA 3MS9A 2CGUA 2R3KA 4R6VA 4YJTA 3PSCA 2XB7A 3LHJA 4FVPA 4B6LA 3VUGA 2GFSA 2QOQA 4FV0A 1OKWA 5BUJA 2W1IA 4WNMA 5LCKA 3NNUA 4FTRA 4KNBA 3DBDA 4U8ZA 4YR8A 3C0HA 1RW8A 3FZOA 1XH4A 5HNGA 4U81A 5HEZA 4EQMA 4X6RA 5JT2A 4ITHA 1PXIA 2BAKA 4L44A 4B8MA 4D2RA 5E8YA 3PJ1A 1DM2A 4PMPA 2BAJA 4I4EA 3R83A 3NYXA 3ORNA 3MN3A 2PZPA 4CMUA 2ACXA 2FSMX 3ZHPC 2PTKA 4GEOA 2W1DA 4MF1A 1A48A 3PSBA 4BDFA 4WG5A 3SAYA 5IH5A 3GU7A 3RK5A 3G9LX 4E4LA 2YM4A 2VRXA 3S4QA 4KKHA 5E8TA 4CMTA 2GDOA 2R4BA 3NGAA 5AAFA 3S1HA 2ZM4A 3JS2A 1KOAA 4XHKB 3GXLA 4FSMA 4TYHA 3ORPA 4O0XA 3V6RA 2RFDA 2EB2A 1XH9A 3BLHA 4NJDA 4AT3A 3TI1A 4MD9E 4BCPA 5D1JA 3TUBA 3QUPA 1JNKA 3EZRA 2Y7JA 4RIWB 5LVNA 4F09A 4IAFA 3TTJA 3SOAA 3SGCA 5IQHA 3COMA 3WF7A 4QMLA 1JSUA 4IB1A 4CGAA 4L3LA 4D4SA 2F2UA 2X6EA 4HYHA 2UZEA 5IQEA 4ZJJA 2VGOA 4EBVA 2VTNA 3MJ1A 2WTIA 5BPYA 3W16A 2PUNA 2BILB 3E92A 3QF9A 5ETFA 3HRFA 3HKOA 4L45A 4KIKA 3KXGA 4ZTHA 5LMAA 2R2PA 4AP7A 3R7EA 2HZIA 1YI6A 5CVFA 1G8AA 3QCXA 1IRKA 3TG1A 2CNQA 4F0FA 2BDWA 2GMXA 4DG0E 3QZIA 4NSTA 4FUXA 4CNHA 3R7IA 3VW6A 4DBXA 3VJOA 1XH6A 3RPRA 2ZAZA 4V01A 1WBVA 3CJFA 4C62A 3ZLXA 2QR8A 4BKZA 2YM6A 3OROA 4RZWA 4A4OA 2HWOA 3ORLA 3BEGA 3GVUA 5AR2A 4EKKA 4J8NA 4ASXA 5K0XA 4FZ6A 5FXSA 3VUIA 4ORKA 3FL5A 5L2WA 1YKRA 2WOUA 3HMIA 3KF7A 5EH0A 4BI1A 4WKQA 4Z3VA 5L8KA 4PY1A 1PXKA 3QYZA 4QNYA 5FEQA 3I4BA 3RNIA 3TNIA 2GTNA 5HLNA 2BDFA 3VQHA 3MESA 1Q8WA 2PZRA 1WBWA 4R3PA 4XG3A 5DOSA 4EJ7A 3HNGA 3BYSA 4EOPA 3NIEA 3FXZA 5HX8A 3C0GA 3OTUA 3RCJA 2XK4A 1H0VA 3F7WA 1ERKA 1Q41A 5HE3A 4BI0A 4Y73A 5C4LA 2C3IB 2FO0A 3HP2A 4M14A 1H1SA 5CEPA 4FT5A 4G6OA 3DK6A 3EQFA 5F95A 4EK4A 4U3YA 4OAVB 1DAYA 4O0TA 3VAPA 4MQ2A 3WIGA 3FLWA 5GZ8A 4C33A 4IH8A 5A6OA 1PRYA 4BCNA 5HG8A 3D5VA 5KNJA 2WTKC 3R71A 3NYNA 5HIBA 1SVEA 5AX3A 4PRJA 3SXRA 3VS3A 3A60A 4EHVA 5D12A 3VNTA 5JK3A 3EJ1A 5A4LA 3EKNA 5AUZA 3G9NA 4LQMA 3ZS5A 3F5XA 4DT9A 5K5XA 4C35A 2HY0A 3GT8A 2OFUA 2XVDA 5DNRA 1FPUA 5KZIA 4RX9A 4K11A 4O83A 2REIA 3M1SA 4RMZA 5JN2A 3DK7A 4FTNA 1IG1A 1WBSA 1H8FA 4GSBA 4JR3A 3HLLA 3ZFYA 4M68A 3RWPA 3C4WA 1MQBA 3FLZA 5E8ZA 3QTIA 4I41A 5D11A 5ANKA 3VIDA 5BQ0A 4FIFA 4IM2A 4TTHB 3NYVA 2ITWA 1Q8UA 5E7RA 2VTPA 5CX9A 1LPUA 5D7VA 3KRWA 2EWAA 4B7TA 4BF2A 1UKIA 1OIQA 3NUNA 2WU6A 3LIJA 2JKKA 2ITYA 4M15A 4ANSA 2QNJA 4RX5A 2EXEA 4AWIA 4CLIA 4R1VA 3HGKA 4LUEA 3VUKA 4YSJA 3UO5A 4GS6A 3HUCA 5EFQA 1TKIA 4X3FB 1Q62A 4DH7A 3D7TB 4O1OA 1JBPE 4FOCA 2VX0A 2Z02A 4LOPA 3ZDIA 4GVAA 4TWCA 4QO9A 4U0IA 5AAEA 4Z9LA 4ACHA 3CCNA 3WI6A 4FKRA 3AC2A 2OIBA 2LGCA 2R9SA 4AOJA 3IW4A 3QC4A 4J71A 1REJA
chains in the Genus database with same CATH superfamily
4YC6A 4GYGA 4ARKA 4NW5A 3HP5A 3UBDA 5IQIA 2OH0E 5EDRA 1CM8A 5CF6A 2UUEA 2PVRA 3O51A 5HVYA 4YSMA 2AUHA 3MSSA 5G1XA 3TNPC 3VUHA 2YAAA 4LMUA 4IDTA 1IEPA 3W2PA 3MPMA 3CBLA 5B0XA 4HW7A 1KE6A 4BTMA 3FDNA 1JPAA 5IQCA 4ASDA 3QLFA 4U40A 1J7UA 4MHAA 3TJCA 4USEA 3U9NA 3FLYA 3H0YA 4YTIA 2W1EA 2XNMA 3QX4A 2QOKA 3MYGA 4YJVA 3W2OA 2FUMA 1ST0A 4O7NA 3C4CA 3UODA 1XMMA 3PJ2A 3OY1A 3LM5A 4ZK5A 3OBGA 2PHKA 2XNNA 4JT3A 2C3JA 3RAHA 3VBYA 3RAWA 3GQLA 4RC3A 3UIBA 3F5GA 3KULA 2BPMA 3ORKA 1IA8A 4QYYA 1H01A 4EZ5A 3OEFX 4FSNA 4NL0A 3W33A 2J9MA 2QU6A 3KU2A 3OD6X 5CXHA 3ATTA 2BROA 2VX3A 3PFQA 2X2LA 4DEEA 5I9WA 3R8PA 3MTLA 4IZYA 4JX7A 3QTWA 4X3JA 4G5PA 1H27A 4GRBA 4ALUA 4CSVA 1OBGA 4R3RA 2UW3A 4DFXE 2UZBA 3FMMA 3PXRA 4DITA 4OTDA 3D5WA 1ZLTA 3PXFA 4FV1A 3BGZA 4JAIA 4YTCA 3FI4A 3VS7A 2JKOA 1K2PA 3REPA 3WZEA 1B38A 3CKXA 4FZDB 4O4EA 1I09A 1UWJA 1XHAA 5C26A 4N6YA 2PE1A 2R3MA 5AV1A 2W1ZA 2PE0A 5M4IA 1ZYSA 3H0ZA 4WHZA 2PZ5A 3UQGA 2P0CA 2W0JA 5M06A 4DFZE 3NDMA 4BCQA 5ITAA 4YPDA 5CF5A 3UMXA 4IEBA 1FVRA 2X0GA 3HV3A 3OT3A 1OGYA 5I9UA 2I0HA 4HGEA 5KUPA 3HAVA 1H1QA 4AOTA 2I7QA 5ANIA 3R30A 4JQ7A 2R3NA 3E8CA 3QQHA 5CNOA 4O82A 4XG9A 4BCOA 3BKBA 3O7LB 4HVSA 3QQGA 4EQUA 2CN5A 4KSQA 4O1PA 4QP7A 5D41A 4BZDA 3OOGA 4F1MA 3ZFMA 1O6KA 4QP2A 4CVAA 1L8TA 3OWPA 1PXMA 2OZAA 3ZZEA 5FEEA 4QQJA 5JSMA 3PJ8A 4E4XA 4FG9A 3PZHA 3VRZA 4HCUA 4XNEA 3EYGA 1KE9A 4DTAA 3LFAA 4O0VA 2R3FA 5AV2A 1H1PA 2FH9A 2CKEA 3MH0A 4JRVA 5CU3A 2IG7A 2IF8A 4F9YA 1AGWA 2UZOA 3R8LA 4MWHA 1KSWA 2NP8A 4C0TA 3A7IA 4ITIA 4M67A 3QFVA 2Y4IC 4Y72A 5KHWA 4J99A 2J90A 2BZKB 5AUYA 5DLSA 4EOIA 1UNLA 5D9HA 3POZA 3Q04A 2XKDA 4KBKA 1TQMA 4FTUA 1OPKA 4QNAA 1O6YA 3NLBA 4UEUA 4F7JA 4A9RA 1YDRE 1K9AA 2YCSA 3Q5IA 3DKFA 5CQWA 5AX9A 5M56A 1HCLA 1LEZA 4F7NA 3LOKA 2IEWA 3NNWA 3OT8A 5BVWA 3DAJA 2Z7LA 2YLEA 5CI6A 2IW9A 1XBAA 3CQEA 4QMPA 3LE6A 3R1SA 3ZO3A 1XBBA 1Z57A 2CGVA 2IZTA 2ZB1A 3G51A 5AR7A 2QVSE 4IHPA 4O7ZA 5KMKA 2E9PA 3U6JA 1FOTA 1H07A 3A4PA 4UBAA 3U6IA 3NNXA 4GFMA 2XYNA 4NYEA 3O0GA 3I81A 2HZ4A 5KX8A 4GFOA 4S33A 2YM7A 1XH5A 4L52A 1PMNA 3Q9XA 4QP1A 4QPAA 1YHWA 2PU8A 3QQLA 1U54B 1UWHA 3FLSA 3GU5A 3GOKA 4MBJA 4ZJVA 3OS3A 4DEIA 3C4XA 4JBPA 4IM3A 5AR3A 3UZTA 5L3AA 1ZWSA 3FSFA 3WZJA 4CZTA 1M52A 4QMXA 5FDXA 3VJNA 3IGGA 3WZKA 5BMMA 4IC7A 5C1QB 5EQPA 2I0VA 4AFJA 2WMXA 3GGFA 1YXSA 3OP5A 4II5A 1A06A 4BN1A 3O96A 1P14A 4QQTA 1VEBA 4GCJA 4UY9A 4PF4A 5BVOA 2Y4IB 5GJGA 2NRUA 2WMUA 1R39A 4H1MA 4U97A 4XV2A 3VUDA 4ZLZA 3W1FA 4QDVA 4N0SA 4QMTA 3TYKA 2BZIB 3UNKA 2CLXA 3D2KA 4ONAA 3HDMA 2C1AA 2OK1A 4ZOGA 5ANOA 1PW2A 5A4QA 4CYJA 3EL8A 2BRMA 3G6GA 4I23A 4J8MA 5AUVA 5M09A 4AAAA 3ZZWA 4IADA 5DN3A 4HVDA 4FK3A 5M51A 4NZWB 5GHVA 4AZWA 4DYMA 1R0PA 2BTSA 3BL7A 5CXZA 4B0GA 5AP3A 2QURA 3LW0A 3PRFA 4JXFA 2JBPA 3C4EA 4QQCA 4XCUA 4UB7A 4D4YA 2ZDUA 4DHZA 3JY0A 5IKWA 5EW3A 3UOHA 4R7IA 4XLVA 3SD0A 3BEAA 5EW9A 5BYZA 3Q2JA 5FM3A 2C6MA 2X4FA 3MTFA 4EUTA 4NJ3A 4W4YA 4FYNA 4HCTA 3AMBA 3V3VA 1MP8A 1T45A 1XWSA 2QLQA 2X1NA 4EHZA 1PJKA 1QPCA 2VO6A 3AD6A 2VTMA 4O4BB 4PV0A 5TR6A 4YJRA 3DTCA 3R8MA 3V8SA 2J4ZA 4L68A 4YTHA 2W96B 5DT0A 3AC3A 5CQUA 2YERA 3FI2A 4FL2A 3F61A 3EFWA 3CKWA 1V0BA 2F7EE 2IVSA 2C0OA 2O5KA 3DDPA 3BCEA 3DFCB 3PVBA 4WNKA 4ZSGA 3ZRLA 4XEYA 4EONA 5LMKA 2PVFA 3QAME 3KK8A 3UIMA 1YHVA 3CE3A 4AXCA 4U42A 2X9EA 4XP3A 5CSXA 5AIKA 2QO7A 4RWIA 4YJSA 2J2IB 5BX0A 3MVLA 3Q3BA 4NTSA 3FMHA 5IEVA 3HMMA 3IOPA 4A9TA 4G3GA 3EN5A 2PSQA 4CTBA 2WQMA 3EQBA 4XG7A 1URCA 1KWPA 3ET7A 2J6MA 1BLXA 4FX3A 4DINA 2ZB0A 3CGFA 4YNEA 4BTJA 3VC4A 5ANEA 4FODA 4XX9A 1JQHA 3KVXA 5CEMA 2JDRA 4USDA 4IB3A 4TNBA 5BYLA 3S00A 3VS2A 2X7OA 4I1ZA 3HX4A 4MAOA 5AV3A 5HO8A 4QOXA 3FZRA 1U5RA 3QXPA 4ZY4A 5HU9A 1GAGA 4BVUA 2BR1A 3E8EA 3EQPA 2ONLC 1KUTA 5GIPE 3FE3A 4UV0A 4BCMA 3VS4A 3UE4A 3ITZA 1Q24A 3KRXA 3LCTA 3UNJA 4BCJA 4FT3A 1CTPE 3DKCA 2V55A 4ZY5A 5E4HA 1UKHA 5DYJA 1H08A 4O0RA 5EYKA 4RVLA 3ENHA 3CTQA 2VTIA 4KINA 2G01A 4OBPA 2BRHA 4UXLA 3NSZA 3ZONA 2HAKA 4BWKA 3NMUF 3TKHA 2WTDA 1JKTA 5A6NA 1Q4LA 3RHKA 5FWKK 2B4SB 4N6ZA 3FWQA 4FZAB 4D2TA 4C36A 4E6AA 4IVDA 4DFBA 4L7SA 3UDBA 1VYWA 3AXWA 3FC1X 3LFSA 5HE1A 4I6HA 3PJ3A 5EQYA 3Q2MA 3QLGA 4LGGA 4QYGA 4C4IA 1ZOGA 5CF4A 4V04A 4NUSA 5EHOA 4IZ5A 1GJOA 2EVAA 2BIKB 3UC4A 3LMIA 3L9LA 3F5PA 4C3RA 1CKPA 2QOFA 2JAMA 3AMYA 2R3OA 3DNEA 5HQ0A 4QTCA 4YC8A 4EHGA 3W0OA 2BFYA 3I0QA 4RX8A 3EN4A 3II5A 4IX4A 4L6QA 4NU1A 5EW8A 3QX2A 3ZCLA 3GFEA 3ZO1A 4E6DA 5A4CA 5DE2A 2XH5A 3QA8A 4MBIA 4WNPA 4V0GB 3R22A 4TYEA 4YMJA 1E1XA 4M84A 2X81A 2WQBA 3FLNC 4C34A 2PMLX 3R02A 1W0XC 1CDKA 3CQWA 2YDJA 3E3BX 4RVTA 5EG3A 3HVCA 4G17A 4CYIA 3GC7A 4RIXA 3QGWA 3ZLYA 4HVIA 1RJBA 4EH8A 4LOQA 5CS6A 4XG8A 4F64A 2PUUA 5EYDA 2J0KA 4U5JA 5L6OA 5LOHA 4E93A 1FVTA 3FZTA 3V04A 3W0QA 2WEIA 5LQFA 4QP3A 1SVGA 4BYIA 1UU9A 5ANGA 4R7BA 1W2CA 2VO7A 4IX5A 5EM8A 3MH2A 3C13A 5FXRA 2WNTA 2UZTA 3CEKA 1WMKA 2B52A 5CYIA 4K2RA 4A9YA 4GL9A 4JQ8A 5E8XA 2XNGA 5AR8A 2QCSA 3ZTXA 4AXDA 3NZ0A 2OKRA 4MNFA 1M2PA 2YDIA 4HOKA 3G2FA 5C8MA 3B8QA 2OXYA 3R7UA 3QC9A 3GEQA 4KUJA 5E8UA 3D5XA 1Q8TA 1VR2A 1KE7A 4E73A 4FIJA 3FYJX 2WTCA 4D9TA 2XK8A 4FSZA 4RJ8A 3VHKA 3ZMMA 3CSVA 4PPCA 4WNOA 1KE8A 3QRUA 4RJ4A 4X0MA 3EWHA 1LUFA 3RAKA 3OZ6A 1RDQE 2W99B 3KC3A 2VAGA 4J97A 4EWHA 4IFCA 2QOCA 3DFAA 4QPMA 4M69A 4CTCA 3HV5A 4IB5A 4EH6A 4DHIB 4U79A 2GCDA 4BB4A 5M4UA 3FQSA 5GJDA 4BWPA 2KULA 1PXNA 2EB3A 2O63A 2OJ9A 3KMWA 5E8SA 4UN0C 3D4QA 3PVGA 4UMPA 2BHHA 5HIEA 3R7YA 4GKHA 1PXOA 3F3ZA 4E6QA 3KB7A 2C68A 4MXYA 2HY81 2C69A 3E62A 4ASEA 4AZFA 3EFKA 3D94A 2WB8A 3GI3A 4NIFA 1G8KA 1J3HA 5IG1A 2C6LA 3PP1A 4NW6A 4AW1A 3COHA 5I4NA 4BTFA 1OPJA 2ETRA 4TXCA 4Y5QA 5IUGA 3JR1A 3F5UA 1I44A 1R1WA 4IACA 3QTQA 1ZXEA 2ITZA 4AFEA 3L9PA 3Q96A 3EIDA 3DB8A 3LPBA 4XV9A 5HKMA 3R8ZA 4EORA 5IQGA 2NRYA 3ORIA 2R3RA 4EH7A 4EJNA 1MUOA 4LV7A 4AZEA 3K54A 4HGLA 3ZRKA 4L53A 4FSTA 2FSLX 3BU5A 1ZY5A 3SHEA 4P90A 3UTOA 2XEYA 3GU6A 3NUSA 5KKRB 3DK3A 5A4EA 1P5EA 3D2IA 4TWPA 2F57A 1H0WA 4K6ZA 1Z5MA 1JVPP 3FY0A 3NS9A 3QALE 4M0ZA 1NY3A 2UW0A 2YACA 4FIHA 5HTBA 1YDSE 4YPSA 4CMOA 1YXTA 1BX6A 2QO9A 3OXZA 4ERWA 2UW4A 1NVRA 2OJIA 3QL8A 4MXCA 2CJMA 2R64A 3TNHA 3RMFA 2Z2WA 2QOLA 2G9XA 3LVPA 1O9UA 5IEYA 3BLAA 1ZY4A 4CXAA 1F0QA 5JFVA 5IEXA 3WYYA 3ORZA 3OUKA 3DY7A 5I5ZA 4K1BA 4OTWA 4W8DA 4YJPA 2C4GA 2LAVA 2GS7A 2VO0A 3BYVA 4AA4A 4QD6A 4ZY6A 4D2WA 5AIRA 3ZEWA 3PUFC 4XG2A 1PF8A 4ZZOA 2JIVA 3NAXA 4PUZA 1WCCA 4AN3A 3ENMA 2QG5A 3W0SA 3Q9ZA 4F6UA 2XANA 1ZMWA 3CY2A 1P2AA 1K3AA 5IA5A 4FSWA 1F3MC 3AQVA 2QLUA 4OTPA 4UXQA 5FQDC 2B9IA 2JGZA 3D83A 3EYHA 3Q5ZA 4JG7A 3U8WA 2VWYA 1PY5A 4NTTA 3UO4A 2XIYA 4XS2A 3SRVB 3AOXA 4MQ1A 5IUIA 5CF8A 4DCEA 5K9IA 2CDZA 4FNYA 1YVJA 2I6LA 1AQ1A 3OW4A 3A7FA 2XF0A 2PWLA 4IBMA 3QTZA 2HXQA 3BYOA 3NVKI 4C4FA 1BUHA 3ORTA 4U80A 2RFEA 5GJFA 4EOQA 2YIXA 4I22A 2GFCA 3MV5A 3PWDA 2VTQA 4QYEA 3RINA 4V05A 4X7QA 1BL6A 5C8NA 3PP0A 3L1SA 3R0TA 5A46A 1H25A 4WOVA 2EUFB 2BKZA 4PMSA 4ZTSA 3ALOA 5FD2A 1G5SA 3KCFA 4PNKA 3I7BA 2GHLA 1Q8ZA 1Y91A 3RM7A 4RJ6A 3UQFA 4BIDA 4BYJA 3OWJA 2XBAA 3EL7A 5AUUA 5EI8A 3ZSIA 4CV9A 4K33A 3R9HA 1M2QA 2BUJA 4TT7A 3A62A 4O7SA 3VBQA 5C01A 3WZUA 2WMTA 4DH3A 2ETKA 5CU0A 2B1PA 4ZEGA 4KRDA 2C30A 2XNBA 4YZDA 5EM7A 4RC4A 4ENYA 3SVVA 4BFMA 3H9OA 4Y46A 4BDEA 2VWVA 3BV2A 3FJQE 4F7SA 1W7HA 3RVGA 4E1ZA 3UG1A 3VS1A 4Q9ZA 2P33A 3EZVA 2DYLA 2IW6A 2YZAA 4FG7A 4U6RA 5H8EA 2O3PA 5HE2A 4ZIMA 4E3CA 2XA4A 4FF8A 2IWIA 5E91A 2YCQA 5L8JA 2VUWA 4JL9A 4QTBA 3P08A 5JKGA 4N4SA 4L7FA 4MVFA 4C4HA 4CQEA 3PXYA 5FRIA 4D5KA 2OU7A 2PYWA 2WOTA 3V8WA 1UA2A 3HYHA 1M2RA 5FG8A 4H3PA 3RHXA 5BVEA 5K4IA 1PMUA 5EM5A 2J0IA 3P23A 1H1WA 3FEGA 4MWIA 2PVYA 4JX3A 5CT0A 4DAWA 1XH7A 2W4JA 5CSWA 4Y5HA 5JEBA 4WBBB 2BRGA 3BV3A 2VO3A 4MXZA 3LKMA 4I0SA 3LQ5A 4FV5A 2UVXA 4P7EA 2OICA 4Z16A 2ZV2A 4XP0A 3N4VA 2CKOA 2JDTA 3H4JA 5EOLA 1BL7A 4AQCA 4EOLA 2WZJA 3QD3A 3QWJA 4TYHB 3HAMA 4FL3A 3UP2A 3LFQA 4TWNA 4W8EA 4WUAA 4NEUA 5LXMA 4O0UA 2JBOA 1JKLA 2ITNA 4OW8A 5AUWA 4FE2A 3BLRA 1QMZA 4AOIA 5AAGA 4CT1A 2C6DA 3H3CA 3VS6A 4MEDA 4EK5A 2WMBA 4D2SA 2HENA 4X3FC 3MBLA 4YP8A 3MVJA 4RWKA 4FTTA 5JZJA 4LRMA 1SNUA 3A7JA 2J50A 1GNGA 2PE2A 2OW3A 4IX6A 3A7GA 4TZRA 4GT5A 1ZZ2A 1OIYA 1XJDA 2A98A 5E1SA 3PXZA 5KZ0A 3OMVA 2JKMA 3THBA 2V7OA 3QRTA 3DKGA 5CU6A 5AWMA 5CWZA 1NVSA 2H8HA 4DFYA 2GQRA 3S95A 3GC0A 5B2KA 3AGMA 4ANOA 2AC3A 3RK7A 4MX9A 2ZMCA 3JYAA 5DWRA 2F7XE 3NX8A 3ROYA 4C59A 2XZSA 3LLTA 3LQ3A 4IWQA 2IW8A 4EHEA 4BC6A 4U44A 3E7OA 2BALA 4IWDA 4O0WA 4UMQA 1OL7A 2C6EA 3JVSA 3A8XA 3FL4A 5HBHA 4X3FA 5FTQA 3D7TA 1OPLA 3G90X 2R5TA 4DDGA 3PA4A 3KREA 4HZSA 3ZXTA 3G6HA 3K5VA 3UVQA 3CJGA 4FI1A 3P7AA 4JDKA 4RLLA 5HE0A 3ZO2A 3EQGA 3NAYA 3LAUA 1DAWA 5DGZA 1QCFA 3ZUUA 3NUAA 4M3QA 1WVYA 2QC6A 1OUKA 4YZBA 3C1XA 4J7BA 4QTDA 1LEWA 3OCSA 4IDVA 4QMWA 4APCA 1JSTA 2PVMA 3CQUA 2WMWA 3ANRA 3HL7A 1ZYDA 3JY9A 3P9JA 3UGCA 3DOGA 1TQPA 4CFNA 5L2SA 4PL4A 3TUCA 2IJMA 3IW7A 5CNNA 3LLAA 3EOCA 2V22A 3P7BA 5IPJA 4FKVA 4MUQA 3LCKA 2BAQA 2E9VA 4CKJA 2YEXA 5DRDA 5TO8A 3HV7A 5JGDA 3A4OX 2VWXA 5CANA 3SW4A 2UZDA 3HUBA 3C51A 4YLLA 4DH8A 5CVGA 5JGBA 3C5UA 4PX6A 1G8SA 5ACKA 4F1TA 5IQAA 4RA4A 2WEVA 2CKPA 3TV6A 2RIOA 2C3KA 4QQ5A 5AA8A 3MFSA 3EHAA 4D1SA 3KN5A 5HLPA 1QL6A 3LCSA 1OKVA 4IMYA 3DZOA 3GUBA 3E7VA 4NKSA 4GFGA 4LRJA 4AGWA 2R3HA 4BTKA 3GCQA 3ATSA 5J9YA 3O23A 4DTKA 2VNYA 2GS6A 3EB0A 3FHIA 3GU8A 4F4PA 3QKMA 4EOKA 4C4EA 3R1NA 3WARA 3CY3A 4D0XA 4LMNA 2Z7RA 3BWJA 4KB8A 5CSVA 2ITPA 3ZBFA 2R3LA 2B53A 3HEGA 4BICA 4E7WA 4FK6A 4G9RA 5HG9A 3LCDA 2ZM1A 4F0IA 2C6IA 4L00A 4EQCA 1JOWB 3DNDA 3R2BA 4RG0A 3F3WA 3IDBA 3DTWA 3BBWA 4ITJA 1YWVA 3R21A 2GNIA 1WVWA 2BZJA 4BDCA 4FV3A 4YBKA 3LXKA 2VV9A 2OIDA 2X8DA 3ZUTA 4AN2A 4AGCA 4ASZA 4FTQA 2WMVA 4O6LA 5IA1A 4Q2AA 4ZZNA 4EL9A 5F20A 2PVHA 2WQOA 2CGWA 5I0BA 3T9TA 3UVPA 5J8IA 1A9UA 3RAIA 2QHNA 4ZTQA 1M7QA 2I1MA 3RI1A 3WOWA 3CP9A 1SMHA 4FTKA 4ZTMA 2V7AA 4FVRA 4X2JA 2SRCA 1REKA 4OT5A 5TF9A 5L2TA 4FNXA 5ANJA 3VWAA 4XOYA 4EBWA 3R01A 4A07A 5KMMA 4BBFA 3CC6A 2CNVA 2HZ0A 3WE8A 3VF9A 3JUHA 2XNEA 3ML1A 3PG3A 3R7VA 2EXMA 5T6KA 2QOHA 1WVXA 3BHVA 3GCUA 3OF0A 4JR7A 2QONA 4KSPA 4YZCA 5FM2A 2W9ZB 2C0IA 3Q9YA 1VLRA 2XMYA 2A0CX 1UNGA 2B55A 3P86A 3GP0A 3T3UA 1KV2A 3UVRA 4ACGA 5CVHA 3NYOA 4YO6A 4D28A 2J0JA 3ZSHA 2Y8OA 5BUIA 3MW1A 1WFCA 2WTJA 4RBLA 2GNGA 3ZEPA 2BFXA 3TKIA 4HVGA 2WMAA 5ETIA 4YU2A 2B9JA 5B2LA 5EDPA 2PVLA 3DU8A 4U9AA 1Q3WA 4X2NA 4HYIA 2UW9A 4YJNA 3V51A 3UYTA 3FC2A 4BDBA 4U41A 4D1XA 5JGAA 3OCGA 3F6XA 2XS0A 3TACA 3O50A 4AGUA 4O4FA 2YWVA 1DS5A 3HA8A 3SV0A 2B9HA 4RRVA 2BDJA 3MIYA 3GC9A 4A4LA 4QP4A 4BIBA 4ZAUA 4HGSA 3BIZA 3MPTA 5J95A 4H36A 4IWOA 3NVMB 3QXOA 3R1YA 3W32A 4ACDA 3F3VA 4YHJA 3FZSA 1BKXA 3ZDUA 1Q3DA 4CQGA 4DGLC 4XRJA 3BHTA 1PKDA 1JKKA 3AC5A 3MVMA 3PPZA 1U54A 2BZHB 2JEDA 3BQRA 3E88A 4R5YA 4NT4A 3OC1A 4PTCA 4BCKA 4EOOA 3PG1A 4MNEB 3DXNA 3RGFA 4AT5A 3PE2A 2F2CB 2W1CA 5AJQA 4F0GA 3KXZA 4TL0A 4QMYA 3C4ZA 5IQFA 3W2RA 3KRJA 4D9UA 2YFXA 1J7IA 4YURA 3PY3A 4EC8A 2OSCA 3NUPA 4FVQA 3RPOA 3UIUA 3QBNA 5KBQA 1WBOA 3R9OA 5DRBA 1YXUA 4BDHA 3PYYA 1PXPA 2A4LA 5A3XA 3F2NA 4C4GA 3FMDA 2YIYA 5HGIA 4BRXA 2W5AA 2O0UA 3LXPA 4DLJA 4G3EA 5M4CA 3I6WA 4O91A 4OAUC 3MPAA 2PK9A 3AC8A 4FTAA 3TIZA 2EXCX 3W0MA 1MQ4A 4X21A 3F3UA 5IDPA 3ODYX 4IIRA 1PKGA 2BMCA 3DQXA 3Q32A 3U54A 3F7ZA 2IVTA 2WAJA 3OHTA 4JDHA 5IDNA 4DN5A 3BU6A 4BJJB 5CASA 3WIKA 2OJFE 3FY2A 2QR7A 3PRIA 4RA5A 4K77A 1GOLA 3ANQA 3BGPA 5J7HA 3A8WA 4ERKA 4DEBA 5HICA 3UPZA 1ZMVA 1H1RA 4EH9A 2YISA 3DDQA 4IVAA 3RP9A 4DEHA 3UDZA 4CCUA 2UVYA 3IPHA 5TKDA 5M53A 1G3NA 3GB2A 4I4FA 5LARA 3A2CA 4I6BA 2R3PA 2AEGA 4GT4A 5DR9A 4ZTRA 4F08A 3SOCA 1E9HA 4B4LA 4I93A 4FEQA 5EKOA 4PP7A 3VBWA 5CEQA 4RVKA 4AX8A 4CKRA 4BDAA 3PIZA 4DT8A 5FBOA 2GNJA 4JDJA 4C2VA 2WGJA 3BELA 4FYOA 3TV4A 2Y4PA 3FMKA 4ZS0A 2W1FA 4I5MA 5HI2A 2W17A 2RF9A 1MRUA 3HMPA 2ERZE 2WPAA 3IO7A 3O8TA 4OBQA 2QO2A 3QD4A 3PSDA 2PZYA 3R73A 4AZSA 3OY3A 4F70A 3Q6UA 3R6XA 3RPYA 3UZRA 4LUDA 3OTVA 3A61A 1Y8YA 1WBTA 2X0PA 3BZ3A 3E87A 3K5UA 4PWNA 4WRGA 4XRLA 4MBLA 1CSNA 2FYSA 5M08A 3IDCA 3MWUA 5AP2A 4HJOA 4BY9E 1OL5A 4ZTLA 5AP1A 2Q83A 3CPCA 3G0EA 5FXQA 2XKEA 3QUDA 5CY3A 3E8NA 2YM5A 5IZFA 4BHZA 3U4UA 5JRQA 3GU4A 2VNWA 2YJRA 1IR3A 3HRCA 1B39A 2YA9A 5CAUA 3F2RA 1PXLA 4UMRA 3CD8A 1P4FA 2W05A 3EQRA 2EU9A 2R3JA 3DT1A 4ACMA 4DLIA 2VTSA 5A54A 5H8BA 4FTIA 5LWNA 2B9FA 5T68A 2AQXA 2R7BA 3ZOSA 2QD9A 2OZOA 5BVKA 4CEGA 3OUNB 1RQQA 4FZFB 2V0DA 3EQCA 5F9EA 3U6HA 3NUXA 4I24A 5LWMA 3MY5A 2GHMA 4O0SA 4TWOA 1RE8A 3O71A 3N4UA 3MFRA 3CIKA 3IQ7A 4BDDA 4EYJA 4QTEA 4E4NA 5DVRA 1IASA 3LJ2A 2NPQA 3NCZA 2UZVA 2ZOQA 4FKLA 5HO6A 5AM6A 3AC4A 2I40A 2PZIA 2WTVA 3ZRMA 4QMZA 3B2TA 2XIKA 5HCYA 2CHLA 4BDJA 2OLCA 4FV7A 1PXJA 1QPJA 4OTGA 2XIRA 3RWQA 4M8TA 2VWBA 4HNFA 2XRWA 4V0GA 3SG8A 4JS8A 4K9YA 4DDIA 2C0TA 3NUUA 4FV9A 4EOSA 5J1VA 2FGIA 4BKJA 4LGDA 2E2BA 3LMGA 3G0FA 2QI8A 4PPBA 5AUTA 4RSSA 3AT4A 1GZNA 2ONLA 2QKRA 1PHKA 4FT7A 1ND4A 2CSNA 1BI8A 3IONA 2HXLA 3LZBA 2VTAA 5KMIA 2OIQA 1VYZA 5DBXA 5FP6A 5IH6A 3BYMA 3FKOA 3NW5A 3V5WA 3BYUA 3QRJA 4HZRA 4FSYA 4RWJA 4F1OA 3R9RA 2R3IA 3BE9A 3DJ5A 5L2QA 3W8QA 2VTTA 2HYYA 4RIYA 3ZXZA 5I9XA 5IH4A 4N57A 1AD5A 4O2ZA 1M14A 1SVHA 2P2HA 3R2YA 3LCOA 4FV6A 4JOAA 4O7TA 3KXXA 4K8AA 3RTPA 4QEBA 2VTRA 4O96A 3TT0A 3U9CA 1J7LA 4TPTA 1SNXA 1Q61A 3R00A 2VWZA 4OBOA 4RGJA 3O2MA 2JAVA 2OGVA 2XNPA 3R28A 3CLYA 5HVJA 3LMHA 3TMOA 1NA7A 3KCKA 4JI9A 3F3TA 2CMWA 3QHRA 4AN9A 5GIOE 3T8OA 2X7GA 3V6SA 2RL5A 1Z9XA 3SKCA 1YDTE 4AA5A 1V1KA 2ETMA 2IZRA 5LJJA 2C5OA 3ODZX 4NCTC 2B7AA 1Y6AA 3OWLA 4LM5A 2NNWB 1ZOEA 4LOOA 2BCJA 4P4CA 3RCDA 3UNZA 3KIOC 5KKRC 2UW7A 4AW2A 4APPA 3LM0A 2PUPA 1MRYA 3FHRA 4PPAA 2XM8A 3FPQA 3L8PA 4WRSA 3PVUA 3H9RA 4WO5A 3FXXA 5ICPA 4I6LA 4O7WA 4UWBA 4F7LA 5CALA 2X6DA 3E8DA 2HZNA 2ZV9A 3NPCA 4XP2A 3FZPA 1W2DA 5E92A 4BCIA 2V62A 4BL1A 3W0RA 1Q99A 3IW8A 2JDSA 2YIWA 2C5YA 3IG7A 2O8YA 4L43A 3NCGA 1URWA 5DPVA 3ZYAA 2X39A 2XJ0A 3HDNA