4DFZE

Crystal structure of myristoylated k7c catalytic subunit of camp-dependent protein kinase in complex with sp20
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
350
structure length
347
Chain Sequence
GNAAAACKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Role of N-terminal myristylation in the structure and regulation of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
total genus 112
structure length 347
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfzE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfzE02
4C34A 3LCSA 3RI1A 2FVDA 4NM0A 3BYVA 3VW6A 4DGGA 3O50A 4IZAA 5DR6A 5C03A 3P79A 5L6PA 2ZM4A 4UMQA 4I5CA 5AP6A 4RX9A 5AWMA 4ZY4A 3IW4A 2BRNA 4NSTA 4QPAA 1KE6A 2BTSA 4HGEA 4BKYA 4Z7GA 5CASA 3FWQA 5JGDA 3DNDA 4FKTA 2JC6A 3ZUVA 3HAMA 2PWLA 1YXSA 2C1AA 2HZ4A 5AA9A 4PDPA 4BWXA 5J9ZA 3F3UA 3V04A 1Q3DA 4R3CA 5HVJA 1H1QA 4IDVA 5KMJA 2ZYBA 4J98A 3MJ1A 3MB6A 2ITVA 5FBNC 3FSFA 2VV9A 3B2TA 3L9MA 5H8EA 5IQIA 4YSJA 2HXLA 3UP7A 3CKXA 4FEUA 5FDPA 5HO8A 3Q9ZA 3I4BA 1IASA 2UUEA 5HIDA 3CJGA 3RWPA 3JVSA 4EWQA 4AN9A 3BI6A 4ZS0A 2XF0A 4QYYA 3WF7A 2C47A 4UX9A 4ZIMA 2WTKC 3F3WA 4I0TA 4NM5A 3R73A 4KB8A 4UEUA 3ZZEA 4J95A 2WQNA 2WAJA 4R3RA 3U6IA 4EKKA 3BV3A 5CU3A 3TEIA 1WVWA 4ASDA 1UU8A 1ZXEA 2QG7A 2YCQA 2ITYA 3CGFA 3QQFA 5KBQA 5EHYA 5CI6A 1I44A 4ANLA 4Q5EA 2W4OA 4GK2A 4I1ZA 2QURA 1U5QA 4EBVA 1RE8A 3WARA 1VZOA 4IDTA 2QU5A 2SRCA 5J7HA 3G15A 3TM0A 4HPTE 3KXZA 1J1CA 4I4EA 5BVFA 4DT8A 4BTFA 3F3VA 4BTMA 3ZLSA 2OF4A 1J3HA 3NUUA 4NJDA 4RIOA 3D5XA 2FO0A 3KCKA 4IZ7A 2W96B 2R0IA 3QC9A 4E3CA 4QMOA 3FKOA 4EZ3A 4ZZOA 4IE9A 4GFOA 4BCHA 4GJ3A 3D14A 4YUQA 1HCKA 4MEDA 3HV5A 2O8YA 3HNGA 3MJ2A 1ND4A 3ZM4A 3ORNA 5CQWA 4H39A 4I5PA 1M14A 4IVDA 3W32A 1JQHA 4ZZNA 3H9RA 2ESMA 2C3KA 4ZTSA 3BV2A 1KE9A 3NDMA 4FK6A 4FL3A 4HCVA 4EH3A 3EIDA 3N4VA 4O7ZA 1YOJA 3CQEA 4CFMA 5EOBA 1KE5A 4OTQA 4PMTA 1UV5A 4YZNA 3TNWA 2OH4A 2GTMA 1XQZA 2GNHA 3BQRA 3FSKA 4JBPA 4L7FA 4C0TA 4I0RA 1J1BA 3PY3A 4O0XA 3DT1A 3F5UA 2HW7A 1K9AA 3MSSA 3PIXA 2DYLA 3TIYA 5LWMA 4JLCA 1GZNA 3B8QA 4MD7E 3EH9A 2XP2A 4FV7A 3FZOA 2IVTA 4MXXA 5IMEA 1WZYA 4U41A 2V7OA 5HCXA 4QNAA 5DOSA 3PZHA 5IU2A 1TQIA 4FV6A 2RF9A 4XBRA 3DBDA 5M4CA 1YXVA 2WIHA 3QZHA 3FKLA 5T6KA 4BTJA 3BZ3A 2F2UA 3VVHA 5LVPA 2A27A 4GW8A 2YM7A 3G9NA 3ET7A 3OF0A 3UG2A 4EC8A 5DVRA 2QO2A 2R3JA 5AV1A 1V0BA 5J1VA 2EUFB 3OROA 3ZSIA 2JBPA 2VU3A 4CTCA 4F9BA 1KSWA 4EQUA 4KSQA 4BBEA 4C4HA 3BWJA 1VYZA 3CGOA 2JIVA 2YN8A 3NUXA 4H36A 3HA6A 4E1ZA 4BTKA 2EXMA 3QZFA 4LG4A 4BGGA 5A4EA 3F66A 1LR4A 1H01A 3DA6A 2X2LA 1OKWA 3CBLA 5EHLA 2QR8A 2P2HA 5I5ZA 1YW2A 5DPVA 2XUUA 5CI7A 2Z8CA 5IQBA 4LOQA 4IEBA 3HA8A 3TXOA 3CSVA 3W8QA 4F7SA 1RDQE 3PIZA 4YURA 5BUJA 3UZRA 3BGQA 3AD6A 4XV2A 2ERZE 3JR1A 2JDSA 3LOKA 1QPEA 1WBNA 4J52A 2RFDA 4PTGA 2RFSA 4O96A 5I3OA 2J4ZA 4RJ5A 4BDKA 4G3EA 3OHTA 3DQWA 4FTNA 1YDSE 5IDNA 3R22A 3EB0A 3TNIA 1H08A 3Q04A 4Y95A 4FT7A 3OCGA 2FGIA 4M7IA 3TNQB 4MNEA 2C68A 4PRJA 4ZXTA 5HICA 4DLJA 1ZARA 2OXDA 3KRJA 3VF8A 4I6QA 5FM2A 4YJSA 3G5DA 4G6NA 1R0EA 5E8XA 4F0FA 4AE6A 5CENA 5CANA 5C8NA 3QRUA 4A9TA 5ANGA 4LUEA 4JXFA 1FBNA 5GIPE 1QCFA 3E87A 4HW7A 2E2BA 1PHKA 4C7TA 5J5SA 4BWKA 5EKNA 3G6HA 4ID7A 4V0GA 4Q2AA 1FGKA 3DBQA 2R9SA 2OIQA 5GIOE 4U79A 3CJFA 5ACKA 3R8ZA 2IVVA 3BGZA 4QMPA 1PMUA 1LEZA 2FSTX 2OU7A 2XBAA 3DKOA 4JG8A 3FC2A 4TYJA 5CNOA 4EUTA 3I7BA 4W4XA 1Q99A 2UZBA 3IW6A 3NVKI 4FL1A 4BDJA 2R64A 2AYPA 3PXFA 4I21A 3V5TA 1UU7A 4K0YA 4DGNA 4TYIA 3S95A 4EKLA 4FODA 4Y72A 4AGWA 2CPKE 4YJVA 2OF2A 4TW9A 5LQFA 4RLLA 3OFMA 3F2AA 4WG3A 1Q97A 3EQFA 4QQ5A 4QP4A 4HGSA 5I9WA 4DCEA 2G1TA 5J7BA 4BDCA 3O17A 3BYSA 4TWOA 4BCFA 4LQMA 1ZYJA 4AU8A 1PYEA 2W1FA 3DBCA 4PMMA 4ALVA 3TACA 5DBXA 4L44A 3QGWA 4EH6A 5GNKA 4CT1A 4MWHA 3V8TA 4QMLA 1PMVA 4FK3A 1M7QA 4W4YA 4YPSA 5G1XA 4IB1A 2BUJA 3UE4A 4YLKA 4BDAA 2B55A 3FZTA 3D83A 3GFWA 4G34A 2QOCA 4RIXB 2W1IA 4F6UA 2OWBA 4E4NA 4K77A 4YP8A 4G31A 5BMMA 5CT0A 3VS2A 5M09A 3POZA 3COHA 3MH0A 4A07A 4R5SA 4CYJA 4Y83A 1KV2A 1BI8A 3E92A 5LXMA 4O2ZA 5JSMA 4RVLA 3PXZA 5CU6A 3PP1A 3FLNC 2IJMA 3V51A 4C37A 3P23A 3I1AA 2CLXA 4IAYA 5E8VA 2ETMA 2J5EA 5JFVA 3KEXA 3EN7A 3UBDA 4BDIA 4A9UA 1IA9A 1ZOGA 5LCJA 2Y6OA 2IVSA 3R63A 2QO7A 3JXWA 4MYGA 3ZC6A 4FSMA 4AZTA 2DQ7X 4DBNA 3WYYA 3QBNA 2BFXA 3FI4A 2W4KA 3OP5A 3JY9A 1FOTA 4W4VA 3TKHA 4F9CA 5I9ZA 1OUKA 2W5HA 5IH4A 3DKFA 2XS0A 1J7LA 4G2FA 4M66A 3QHRA 3SRVB 4FTIA 4WSQA 5M44A 3OMVA 4CKJA 4PNIA 4ZJJA 3TN8A 3HMPA 3MFSA 4D4VA 3QKLA 3D2IA 3QC4A 4BN1A 4O7LA 4OAVB 4FGRA 3NCGA 2R3NA 1YHVA 2YCFA 3IGOA 1V0OA 3FMKA 1B6CB 3OOMA 4IB5A 4IM2A 4KWPA 4OGRA 4XCUA 4BCMA 4DEHA 5E4HA 1TQPA 5D41A 2PVRA 4IANA 4E8AA 4Y8DA 4CXAA 4CZUA 4FZDB 4XP0A 2CN5A 4CRLA 2CDZA 2I0VA 4FKWA 4F9YA 3QD0A 2B54A 5ICPA 1IRKA 2YZAA 4OLIA 4MNEB 2WTVA 3KQ7A 3BGPA 3ZFXA 4D2RA 4KBCA 1M52A 2RIOA 1M2QA 3C50A 1YWVA 4LOOA 4I24A 4XLVA 1KUTA 2QOHA 3KC3A 3DAEA 1CSNA 1GIJA 4ZEGA 4HVDA 2R3MA 3GFEA 4AWIA 3FJQE 4GUBA 3R0TA 4AGUA 2F7EE 2F4JA 2JLDA 3P0MA 2PVMA 3PRFA 4TKSA 2WTJA 4V0GB 4YMJA 4RJ3A 3LQ8A 4CV9A 3FXXA 4HGLA 1XBBA 2H34A 3IDPA 3PLSA 4JDHA 4DAWA 2PZRA 4N57A 2J7TA 3BBTB 4CV8A 4O1OA 4BHNA 5JN2A 5J9YA 4G3CA 3V5WA 5FP6A 4RFZA 1PXMA 3Q96A 2AC3A 4TNDA 3ZLWA 4AOJA 4U80A 1APME 5EQPA 4HYSA 4KRCA 3ZTXA 3QTQA 5HU9A 4HPUE 1QPDA 3I0OA 1H1PA 1NA7A 2ETKA 3R1QA 4BYIA 2PMIA 4Z9LA 5E8TA 2PZYA 3DPKA 4PF4A 5A4QA 4K1BA 1B39A 3JPVA 3F61A 5DN3A 5EFQA 2HK5A 4YZCA 3IS5A 3IK3A 2Y4IB 2YDKA 3MFUA 3P78A 4ZTRA 1H00A 3K2LA 3G51A 3RPSA 4O21A 2XA4A 4CQEA 3PSCA 1XKKA 1WBTA 2G01A 3KREA 3BLRA 1BMKA 4IVBA 4L43A 4FKVA 1DAYA 3Q53A 3WZDA 3RBWA 5TT7A 1LEWA 2WU7A 4FZ7A 4Y5QA 2X8IA 3AQVA 3OCSA 5EYDA 4A4LA 3IW8A 2VWZA 4DFNA 5BPYA 4OTRA 4QNYA 3NW7A 3VUMA 3TUDA 4K6ZA 2JDTA 4PPAA 4YC8A 3ID6C 4D2PA 3DLSA 3R9DA 2YERA 3VS4A 2PMLX 4OBOA 4PWNA 5EM6A 5CEQA 3GB2A 2OZAA 4FTKA 4LMUA 3NUAA 3R2YA 1YVJA 4FYNA 4RA4A 3RAWA 3WF5A 5DWRA 4WSYA 3PXRA 3CY3A 5I4NA 2PVYA 4FV1A 4LM5A 3G0FA 5KBRA 3W2PA 1W8CA 4FTQA 4I5MA 3VIDA 2V5QA 1ZLTA 4WNOA 4FKOA 4L9IA 1WBWA 3S00A 2YIYA 4ASEA 4AXAA 4KS8A 3MPMA 3U9NA 3WOWA 1U46A 5IEYA 4ALWA 5A4CA 1F0QA 2OSCA 2C0IA 3FC1X 5IQHA 2R7IA 4FKQA 3IKAA 2C5OA 4OT5A 2QG5A 4IZ5A 5FD2A 5M4IA 4AZEA 3P1AA 1NVRA 1JSVA 2GFSA 3CR0A 2BCJA 3PVGA 4PPCA 5AV0A 1OI9A 2OI4X 2P4IA 2WMUA 2GQSA 5IQDA 3C0HA 4O1PA 4FEVA 5A6NA 3KXNA 4X3FB 5AAFA 4C2VA 2WO6A 4KUJA 4JS8A 4ZLYA 2YLFA 5CVFA 3V5PA 3HX4A 2WMXA 3GCUA 5CVHA 3GU5A 2QHMA 3LVPA 2OLCA 2GCDA 3K3JA 1ERKA 4BCQA 2CKQA 5CALA 2XBJA 4LYNA 4FOBA 4HGTA 4JAIA 4MXCA 4AFEA 5AFVA 4UMPA 4M14A 4RT7A 3R7EA 3WF8A 5AUVA 1TVOA 1LUFA 4R5YA 2R3LA 4O0RA 4F6SA 4QD6A 3BYMA 1M17A 3TL8A 4O7WA 4AW0A 3R7YA 3RCDA 1M2RA 4J8MA 3UO4A 2X1NA 2WZJA 3HV3A 2A4LA 3LMGA 3OEFX 5AUZA 4M68A 4XHKB 3GU7A 3UQCA 3CD8A 4F08A 5FTQA 4TN6A 2LAVA 4FT0A 4ACHA 4O6EA 1NVSA 3GP0A 1SNXA 3FL5A 1QMZA 4BWPA 4UMRA 3DJ5A 3N4UA 4L3JA 1Y8YA 5IQGA 4QMXA 1Y91A 2BMCA 2YWVA 2QHNA 4NH1A 2W1CA 4IFGA 3WBLA 3FI8A 2VTSA 4ZTMA 4M97A 4R78A 2OIDA 3P7AA 2R3GA 4UWBA 1YDRE 3UIBA 4K8AA 3EL7A 2J50A 3R8VA 3VRYA 3W1FA 5BUEA 5HX6A 1R78A 4KRDA 4XV3A 3JVRA 1H28A 3ANRA 4XS2A 5HKMA 3LIJA 4XG9A 1XH4A 3AT2A 4AE9A 3MPTA 5IA5A 4CFUA 3I5ZA 4DITA 2OW3A 3DDPA 3OOGA 5E8UA 1E9HA 4CFXA 5K5NA 3DKCA 2BZHB 3AC1A 3OD6X 5HBJA 5EI6A 3KMWA 3MYGA 5JRSA 4LL5A 4DG3E 3RWQA 1HCLA 1A48A 2YCSA 3OY1A 2HZNA 1O6YA 3EFWA 3K5UA 3ODZX 4ASZA 2ITTA 5EKOA 4A4OA 2RFEA 3R00A 4IAZA 4D1XA 3HP2A 3VWAA 2VTRA 1DS5A 3BKBA 4K2RA 2HW6A 5D7AA 5AX9A 1JNKA 4W9XA 4D1ZA 3A2CA 5DG5A 3VUHA 3RHKA 3SG8A 2F2CB 5AR2A 3FQSA 5ETCA 2VTQA 3OG7A 5EW8A 1RW8A 3KVWA 5GJDA 3O96A 4IX4A 1GZOA 3DY7A 3HRFA 3WF9A 5BVOA 4IC7A 4E20A 4RRVA 4PDSA 2R7BA 3CC6A 4S31A 4ZTLA 3QAME 2Y4IC 4TYHA 3VAPA 4XYFA 5CS6A 3GENA 2E9UA 4IB0A 4GU6A 4NTSA 3KN6A 5AUUA 4I4FA 5GHVA 5M57A 4DG2E 5LMKA 2G9XA 2KULA 2R3QA 3OVVA 5EYMA 4I5HA 5TR6A 2R0UA 3PP0A 3WILA 4F64A 1H4LA 3POOA 4AA4A 4NM3A 1XH8A 4FKGA 4QTBA 3CQUA 2O63A 2V22A 3G33A 3K54A 2CCIA 2ZV8A 4J99A 4KIQA 1Y6BA 3A7JA 3KRWA 5DE2A 2V62A 2QOIA 1H1RA 1OBDA 1Q8YA 4M13A 2HENA 4FV3A 4BRXA 4QPSA 4BGHA 3KVXA 5E7RA 2PUIA 1XR1A 5HORA 2UVYA 4B8LA 2C5YA 4E5BA 4QPMA 4QYEA 4II5A 2GS7A 4X2KA 3ZEPA 2HIWA 3MB7A 5IA3A 3ZLXA 3SXSA 3QTIA 4OBQA 5KX8A 2Y0AA 3L8VA 3HDNA 3FMDA 3ZBXA 4AT5A 4A9YA 3PRIA 4CEGA 4DGMA 3TIZA 5AAGA 3HRCA 4G9RA 4LGHA 4TT7A 1ZZLA 4G16A 1H24A 4AOIA 3UNKA 4DTBA 2RFNA 4GCJA 4F9WA 3IPHA 4QP2A 1RJBA 4FKUA 4E7WA 5EQEA 1T45A 1R39A 4J96A 5AR8A 4O86A 4BCKA 4X3FC 4R77A 3D9VA 3K3IA 1X8BA 4L42A 4PMSA 4BFMA 3FPMA 2YLEA 2BAQA 2BVAA 4PL5A 5AIRA 2PVFA 4Y85A 4GKHA 2B52A 5HIBA 4ZMFA 2VD5A 4FTJA 5AAEA 3KMMA 4IW0A 4UWYA 4X2NA 2OIBA 4MBJA 4CKRA 3LJ1A 4S30A 2A0CX 4ANQA 2YEXA 3OCTA 5AP7A 2Q83A 4FMQA 5HI2A 4RWJA 4ERKA 4HNIA 2VWXA 3CTJA 4RFMA 4RVMA 4O22A 4Z7HA 4M67A 4J97A 3DZOA 4QMMA 4R8QA 2UZLA 3SXRA 1GAGA 3QQKA 4BBFA 2ZB1A 2YM5A 3R7OA 3ZONA 3GOPA 4U40A 4LI5A 4NL0A 5AP5A 1OZ1A 5JGAA 4FKLA 4IX3A 4BDEA 4DF3A 3CD3A 4XP2A 4RIWB 4DE4A 4EORA 4V01A 5M55A 4C4GA 4ASXA 2X0GA 3I81A 5EQYA 2ITUA 2R5TA 2C3JA 1Q24A 3R7IA 3TZMA 4MBIA 4FZFB 4FTAA 4AX8A 4JG6A 2YAAA 2VTPA 4Z3VA 3TDVA 4X21A 4FT3A 1PMEA 2B9JA 1P14A 1UNLA 5HQ0A 2B53A 2ITXA 1GNGA 1IAHA 3AC2A 2W17A 2VWVA 1Q41A 4WUAA 3NGAA 3R9HA 3S4QA 2C6DA 3BE9A 5HLNA 1V0PA 2VRXA 3EJ1A 4JX3A 5CNNA 3R71A 4AT3A 2W1GA 3BHVA 3WI6A 2UW5A 3DOGA 1PXKA 3PE2A 4PY1A 2X39A 4RJ6A 1XJDA 2GMXA 4FSUA 4JJRA 4MF1A 5KMLA 3PIYA 3GCVA 3TNHA 5JFSA 5L2IA 4ACGA 4BI0A 5EDQA 4BIEA 4B9DA 3QF9A 3PJ2A 3BU3A 5IQFA 2UW0A 4ZSLA 4QTEA 5IQCA 2VWWA 3LFEA 3WYXA 3Q3BA 3KXHA 4JRNA 1JSTA 3TV6A 3KRLA 2Q0BA 5DT4A 4NYEA 5HG5A 3UQGA 3O0GA 1O6LA 2PZPA 3EZRA 3UOLA 2GQRA 1M2PA 2PSQA 2R3RA 3LPBA 1GY3A 2Z7LA 1OPKA 4M84A 5CEKA 3DXQA 2XNEA 4RG0A 4FUXA 5JQ8A 4E73A 1L8TA 2PULA 4RGJA 3NAXA 4FSYA 4LGGA 1UKIA 3R28A 5L2TA 5IMXA 1U54A 3TUCA 5M4UA 2J0JA 4TYGA 3MVLA 4F7JA 2JFMA 4RJ8A 3EYHA 2LGCA 5EW3A 2WFYA 2XK3A 3OW4A 4E6QA 4W4WA 3NMUF 3F9NA 4MK0A 2ONLC 4Q5HA 3O7LD 4EUUA 3O8PA 4U3ZA 4EOMA 3EN4A 5E8WA 3F5PA 4IWDA 4RSSA 3PWDA 5LWNA 5FQDC 2XNMA 3A4PA 3DXPA 2WQMA 2FSMX 4X6QC 3SHEA 4MWIA 1AGWA 4EK5A 1NT2A 3BX5A 3L9NA 3AXWA 3LXPA 4BY9E 4IX5A 4PP7A 1SM2A 1BX6A 3HAVA 1FVTA 3UIXA 5E8ZA 2WHBA 2YITA 1ZY4A 2Y8OA 4KINA 3HL7A 4CKIA 5BQ0A 5HE1A 4APPA 3LFNA 4I6HA 4FSQA 2QOOA 4RC2A 2YM8A 3KXGA 4YJNA 4DH3A 2W1HA 4EK8A 3QRTA 4E26A 5HG8A 3VBTA 3G9LX 4I92A 4FNWA 4KKHA 1ZYSA 3OTVA 3E3BX 3E8CA 3KXMA 3EFLA 3EQHA 4FIEA 3VS0A 5IH5A 5E91A 5M07A 2R3KA 4NM7A 4ENXA 3I6UA 3EZVA 3TUBA 2IW6A 3FPQA 2PVJA 5BNJA 3PFQA 4HCUA 5DRBA 1FPUA 2FH9A 4PV0A 3CXWA 5JMSA 2WQBA 1JBPE 2X6DA 4DFXE 5J5TA 2UZVA 2XIXA 4TWCA 2PU8A 2JKMA 3W2QA 4ZMEA 3PXQA 5JK3A 2CGXA 5K9IA 3ODYX 4PDOA 3VS1A 4AA0A 5IQEA 3OUKA 5FTGA 5HNGA 3LE6A 4L3LA 3FL4A 3Q60A 4NFMA 4BZNA 5IA4A 5FXSA 3R30A 3HKOA 1W7HA 4XG7A 5FGKA 4C61A 3PDTA 1GJOA 5LVLA 2QI8A 1SMHA 3LQ5A 2I1MA 4IAIA 2JITA 1ZOHA 3U8WA 4V04A 3FUPA 2Z60A 4GFGA 3D15A 3ZLYA 2VUWA 2WU6A 3BE2A 4OBPA 4WBBB 2VTOA 3NUYA 4JG7A 3UODA 4O0WA 3TTIA 2X6EA 5HTBA 2QQ7A 4FGBA 4DEIA 2WELA 5A54A 1CKJA 2C6EA 5KCVA 3QLGA 5IF1A 2P2IA 1DI9A 4K9YA 3TTJA 3JS2A 5CAQA 2PE2A 3MBLA 5IEXA 1ZWSA 3P08A 3AC8A 4ONAA 3F2RA 5T68A 5BYLA 1TKIA 4FF8A 1YHSA 2PMNX 3IECA 4O7RA 5DT3A 2W99B 1SVEA 3CE3A 1AD5A 4PQNA 2EU9A 4NW5A 2H6DA 4WIHA 4WNKA 3FYJX 1Q8TA 2OK1A 4L6QA 3D0EA 4DN5A 5ITAA 4QMUA 4XV1A 4E4LA 4JIAA 4ANNA 2O5KA 3DDQA 2FA2A 2JBOA 3QTRA 4C3FA 3LFAA 4KKEA 1YI4A 4F1OA 2IW9A 4GIIA 2WEVA 3O71A 1MRVA 3S1HA 4G3FA 4XNEA 1UWHA 4CMOA 4GIHA 2C5NA 3GT8A 4MVFA 1WAKA 2W1DA 3DTCA 3PSDA 1PW2A 5LJJA 1BL7A 3DXNA 4QMTA 4DC2A 3L9LA 4JIKA 1BL6A 4UZDA 1VJYA 3I60A 5L6OA 2WMQA 1G8AA 3FMNA 4EH7A 4AW5A 2WMRA 5HBHA 5KE0A 4MCVA 5A6OA 5FDXA 2W0JA 5CZHA 1JLUE 4L7SA 4YZDA 3SAYA 1S9JA 3W16A 4CQGA 3U54A 3QQJA 4UMTA 4F9AA 2UV2A 4AFJA 2FUMA 5F20A 5C8MA 3ALNA 4KS7A 1WVYA 4HYHA 5D1JA 3QZGA 4X2GA 3TZ7A 4OUCA 3SQQA 3TV4A 3SG9A 2GNJA 4CG9A 5H8BA 2Z7SA 1YI6A 4FIGA 4KD1A 4N70A 2CMWA 2EWAA 2GFCA 1UVRA 5AP3A 2A2AA 2VO0A 5D7VA 2I0EA 2JEDA 1OITA 5L2QA 2ZDUA 4JAJA 4EHEA 4X2FA 5KNJA 5HGIA 4DFYA 3P7CA 4JQ8A 3C7QA 4J7BA 3CKWA 4K11A 4X0MA 2C6OA 4USEA 1STCE 2PYWA 2CNUA 2NPQA 5KUPA 2BRGA 1BYGA 4C3PA 4E93A 4FG8A 5A14A 5CSHA 4OTPA 4FX3A 2WMTA 4C57A 2JKOA 3PY1A 3F82A 2JKQA 5B2KA 4KKGA 5BVEA 3EQRA 5DGZA 3T9IA 3WIGA 1XBCA 3R02A 5IDPA 1IR3A 2I6LA 4G5PA 5F4NA 3PYYA 3RPVA 1JVPP 4LFIA 3V01A 2PHKA 4WBOA 5IEVA 2GNLA 4BCJA 1WCCA 4GG7A 5DFPA 4WRGA 5BVKA 3V5JA 4DH5A 4TXCA 4D0WA 2PY3A 3MY5A 4ZZMA 2EXCX 2HAKA 3DGKA 5CYIA 5JZNA 4FV9A 5HOAA 4EYMA 2X7FA 4ZLOA 2CKOA 1WBPA 3L1SA 4DG0E 4HZSA 1T46A 2J90A 2XCHA 3H10A 4GUEA 4EK3A 5HVKA 3BRBA 4UV0A 5EYKA 3R7UA 3HV7A 2B9IA 3RNYA 3DFAA 4ZJIA 3RPRA 3U4UA 3PG3A 5AR7A 3G6GA 1P4FA 4FIHA 2WQOA 3AMAA 3Q5ZA 1MUOA 4LUDA 4HVGA 5FLFA 2RL5A 4C35A 2GHMA 1P4OA 4L8MA 2R3FA 4ARKA 4PDYA 4FV5A 3CIKA 3LMHA 1CDKA 4RMZA 2O2UA 2I0YA 1F5QA 2VNYA 4AN3A 1KV1A 3V8SA 3ZCLA 3MY1A 4GH2A 5HIEA 2A19B 4FZ6A 4MD9E 5JH6A 1OL2A 3HLLA 4UYAA 3R9OA 5HNIX 5HESA 3QCQA 4FG7A 3IOPA 1CKPA 3H0ZA 2J2IB 1UU3A 3EFJA 3D7ZA 3TJCA 3SW4A 5BUIA 4DEBA 1JPAA 3W8LA 3NW5A 2BDWA 3GQIA 4IACA 1BKXA 3GCPA 5IA0A 4H1MA 4JT3A 4QMWA 2WTCA 4NIFA 2Z7RA 2OFUA 1YXTA 3ZS5A 1H07A 3VJNA 3MIYA 3NNWA 4XG4A 4AN2A 2VTHA 3R7GA 5J79A 2JAVA 3LJ0A 4WOVA 2RGPA 4RPVA 4D1SA 5E90A 3FMEA 3M1SA 3COKA 4GYGA 4D9TA 2GPHA 2YM6A 4I41A 4BGQA 2V55A 3UOHA 4EC9A 5M51A 4NK9A 4QP9A 2Y4PA 3EN9A 3MY0A 4QP7A 4P5ZA 5HZNA 2YACA 3IG7A 3T8OA 4CFNA 4EOLA 3HV4A 2VWBA 5M06A 3QFVA 4I0SA 4ITJA 4F70A 2PVKA 3TWJA 2BRMA 2Z02A 4YLLA 2VX0A 2JAMA 4FSRA 2UZWE 2XKDA 2ZMDA 3VBXA 4W8DA 1J7IA 1UNGA 1G5SA 2JDVA 4AW1A 2O64A 1NXKA 4BYJA 3BELA 4J53A 1BI7A 4YHFA 3QTZA 2B9FA 4Q9ZA 4O38A 3HGKA 2HXQA 4QMYA 4F99A 4PNKA 3PWYA 2OKRA 3SD0A 1WBVA 3THBA 4BDFA 4FSZA 4WG4A 2X7GA 1ZMVA 3LHJA 4EQMA 5HE0A 4U97A 3HRBA 4GMYA 5TF9A 3SOCA 3BBWA 1JAMA 3FY0A 4U45A 5AIKA 4BDGA 4BR3A 3SDJA 2R3PA 4GS6A 3BLHA 3IO7A 3MH2A 4IAFA 2W7XA 3BIZA 3OWLA 4N0SA 3PJ1A 4NTTA 5GJFA 1OIUA 3C13A 4YO6A 3VUKA 5HTCA 5I0BA 3SGCA 3WZUA 1OBGA 4I6FA 4TYEA 3OW3A 2WIPA 4DEDA 3SLSA 3F3TA 4MXAA 4FKPA 4FR4A 3FZPA 5D9HA 4XRJA 2OBJA 4IADA 5BYYA 2OXXA 2E9PA 5LMBA 1JKKA 2HELA 3AD5A 1GZ8A 1SZMA 3RP9A 4HVHA 3SA0A 5DNRA 4BCGA 5AP2A 2EVAA 2UW3A 5C27A 3FLQA 3EQDA 2VZ6A 3LFSA 5KMNA 1H27A 3KFAA 3ELJA 2GS6A 2WMAA 1ZRZA 3RAKA 5ANJA 2WXVA 2XKEA 4H1JA 5EI8A 3AGLA 1PXLA 3A8XA 1G8SA 4EH2A 3FXWA 4H3PA 2G15A 4G5JA 4KA3A 4NWMA 5D11A 5AV4A 1H8FA 1H1SA 4FNYA 2IWIA 3LCDA 2ITNA 5IUHA 2PPQA 2PUPA 2Z7QA 1FMOE 1ZZ2A 4DTAA 4R6VA 2VWYA 4KAOA 4RC3A 3TT0A 4BF2A 4C33A 5DRDA 5EYCA 3UO5A 2OG8A 3DAKA 4EQCA 3EMGA 1WFCA 5BVNA 3S3IA 1YOMA 4DYMA 3PXYA 2B0QA 4YHTA 5AP0A 4GSBA 3Q4CA 1PRYA 5DHJA 4YHJA 3UVQA 2XIRA 5HLPA 5B7VA 5JQ5A 4MF0A 4TZRA 2NNWB 5JGBA 1S9IA 2QO9A 3F69A 1E1XA 5J1WA 3UZTA 2E9NA 2Y6MA 1Q8WA 3LKMA 2OICA 2C4GA 4JBOA 3R8UA 1PYXA 2VTAA 3KRRA 3GU8A 4UN0C 4NIFB 2PZ5A 2WMBA 2HCKA 3LXNA 4V05A 4E6CA 5K5XA 2VTIA 4F6WA 3ROCA 2ZVAA 2H8HA 3H9OA 3OC1A 4EOQA 1YRPA 4NW6A 5ETIA 4C8BA 3F88A 4DEGA 2ZV7A 1JOWB 3UVRA 2VWUA 4GKIA 2RG5A 4L45A 3MDYA 4YZMA 3OY3A 1XH9A 5L8JA 3TKUA 4GU9A 3GCSA 3ZM9A 4C2WA 1OKVA 2XKFA 2HZIA 5ANIA 3EQIA 4O0YA 5CZIA 2G2FA 3AGMA 3OBGA 2F49A 1NVQA 2VGOA 3TJDA 4OTGA 1R3CA 2WTWA 5F1ZA 4FKJA 2UZOA 1VR2A 4EWHA 4CSVA 2QNJA 5J87A 4CG8A 2FSOX 4O84A 3FHRA 1DAWA 2EXEA 1KOBA 2ZV9A 3FE3A 4IAKA 3FI2A 3RINA 4F4PA 3IW7A 4IWOA 4D2WA 3KU2A 4AUAA 2XIKA 3QTSA 4HNFA 4MD8E 2J9MA 2B4SB 3B2WA 4OAUC 4FV4A 3D94A 3FMMA 4XG6A 4ITHA 2YIWA 4JX7A 4MXZA 3NCZA 3QQUA 4EONA 3EQPA 4QP3A 3TZ9A 4ZSJA 2C3LA 4TTHB 3MFRA 3PUPA 2X9FA 3ACJA 1ZY5A 3LCTA 4XOYA 2RG6A 4ZTQA 3OWJA 5M4FA 3LQ3A 4BC6A 3LXLA 4UXQA 3T3VA 4BL1A 4CFVA 4D4SA 4F0GA 3R6XA 3SW7A 3RALA 3E93A 3KL8A 3BYUA 3QHWA 4MBLA 3QA8A 2DUVA 4JBVA 2AUHA 3DZQA 5LCKA 3R8MA 4ANMA 4CNHA 2PL0A 1OIRA 3UNZA 3ANQA 4IBMA 2QC6A 1PJKA 2X8EA 2IZUA 4IJPA 3A8WA 3DKGA 2ZM1A 3QL8A 1U5RA 2QOFA 3HV6A 3FKNA 2Y7JA 3M42A 4IZYA 4NU1A 4BZDA 4QQTA 2QKWB 4KIPA 4GK4A 5I9UA 5HX8A 3UQFA 2UW8A 3W10A 4EOSA 4AAAA 2QODA 3KF7A 4O0UA 5AM6A 4RWIA 1LPUA 4FTUA 2IPXA 1YXUA 3A60A 2F7XE 3A62A 2IN6A 2VNWA 5KZIA 5EM7A 3COMA 3GC9A 4O7YA 3R9RA 4UZHA 1ZMUA 3VHEA 2J0LA 2PK9A 2PMOX 3FHIA 3PA5A 4XH6A 4FE2A 5C4KA 3ORIA 3U4WA 3GUBA 3DJ6A 3QA0A 2PUNA 2VTTA 1W98A 3DB8A 1CM8A 5EK7A 4O83A 3QX4A 2OZAB 3RM6A 4JOAA 1M7NA 1JKSA 2XNBA 2WGJA 3OCBA 2X2MA 4F7LA 4OTDA 3BEAA 3NX8A 3KN5A 1OKZA 3ZOSA 2G2IA 2VGPA 2VX3A 3F7WA 3ULIA 5D10A 4BIDA 4D5HA 5L4QA 3QCYA 2VAGA 3Q4UA 3A7FA 3UC4A 1Q8ZA 3A99A 4C62A 4EOOA 4EJNA 5FXRA 2BDFA 2UW4A 4JR3A 4ZP5A 4GT3A 2WTDA 2QONA 4GL9A 5L2SA 4MH7A 4EZ7A 3C0GA 4FTLA 4M69A 2QOLA 5J9LA 5KMKA 4HVIA 2WQEA 4KBAA 5K3YA 3QD4A 5BX0A 4BICA 4QYFA 3VS7A 4ZY5A 3C5UA 4EZ5A 4IH8A 4C59A 2VX1A 3OEZA 3VBQA 3EL8A 4YZBA 1OL7A 2P55A 4YJQA 3HMIA 5FRIA 2XEZA 3IQ7A 4YPDA 3FYKX 3UG1A 5AP4A 3U9CA 5C26A 3RGFA 4OTHA 3NRMA 3OWKA 2OZOA 2X4ZA 5CLPA 1UWJA 2CLQA 4O0SA 4YGAA 3DB6A 1GIIA 3KULA 4YTHA 2C6TA 3VHKA 4YBKA 4RJ7A 4FL2A 3GBZA 4FUYA 3V5LA 2WD1A 3L8PA 3O8TA 4R3PA 4GVJA 4WO5A 1OKYA 4FOCA 4JNWA 5FG8A 4DH1A 4MKCA 2XKCA 1SVHA 3EOCA 3QGYA 4GVAA 4U44A 3TDWA 4GV1A 3PPJA 4WA9A 4ALUA 3ZC5A 4XG8A 1IG1A 5I9VA 2BFYA 2GS2A 4TY1A 4X6RA 3G2FA 2PVHA 4AOTA 3ZEWA 1P5EA 4B8MA 2I7QA 2JFLA 4GYIA 2C5XA 5EOLA 5HCZA 4F1MA 3KF4A 3R1SA 4MTAA 4L68A 1Z9XA 4QTAA 3FV8A 2BDJA 5DT0A 5TO8A 3VUIA 2XCKA 4DTKA 4E6AA 3JYAA 2WMWA 3NYNA 2ZAZA 2QD9A 4M3QA 1ZYDA 5KMMA 2YAKA 4QT1A 1J91A 5ANEA 5CAOA 4NUSA 5I3RA 3CPBA 2HWOA 2ZB0A 2ZDTA 5BMSA 5CXHA 4LRMA 4PL3A 4L67A 3ORXA 1O9UA 4EH5A 5EW9A 4CLIA 3DTWA 3D5VA 4BVUA 3ZO4A 3A7GA 4D9UA 3ZSHA 2XK9A 1W82A 3QYZA 1Z5MA 5BVWA 5FEEA 3MH1A 3EQBA 2PZIA 4FC0A 4S2ZA 4YJOA 3ZDIA 4FSTA 5A4TA 4PUZA 3TNPC 5CAPA 3QCSA 3QU0A 5CU4A 4DH8A 3MVHA 4O81A 4FEWA 4OTWA 4EOPA 5AADA 1JKTA 4MHAA 3SXFA 4L46A 1OB3A 3QQGA 2Z2WA 4IC8A 1A9UA 3FMLA 5CAVA 3DS6A 4DCAA 4RQKA 2VWIA 3L8SA 3EN6A 2W9FB 4WKQA 4ACDA 5HVYA 5KHXA 4XLIA 4P2KA 3QQHA 3AG9A 3FQEA 3CTQA 5EH0A 4AZVA 5CEMA 1O6KA 4I3ZA 2XNOA 5FTOA 4ANSA 4GK3A 3NUPA 1FQ1B 5K0KA 5HNBA 4CZYB 1UNHA 5FXQA 5LOHA 5CXZA 3FZRA 1IA8A 4TYHB 5FUTA 5ANDA 5HO7A 4UB7A 3P9JA 4N4SA 4DT9A 4RX7A 5GZAA 2XIZA 2HY81 3LFDA 4EYJA 2YIQA 1YI3A 3D7TA 4IAAA 3R1NA 3ORKA 3ROYA 4IM0A 5CVGA 2XJ1A 4L53A 3DAJA 4QQJA 1FVVA 1E1VA 1H1WA 2CSNA 3FMJA 3H9FA 3EQGA 3R2BA 4N6YA 4KSPA 3IONA 4NT4A 1QPCA 3VNTA 4O7SA 5AP1A 4FVPA 4R1YA 1I09A 2BZIB 2UW9A 3W55A 2CGWA 3I79A 2VTMA 4ORKA 1AQ1A 3A4OX 5DYJA 5DEWA 4I93A 3RJCA 5A46A 4A9SA 4XX9A 2V0DA 4P7EA 4RIYA 3UOKA 4QMVA 4NCTA 4F7NA 4USDA 3RAIA 2YDJA 1OGUA 3ETAA 4RLKA 3NYXA 5DA3A 4CFFA 5CSVA 4UBAA 1SNUA 2ITZA 4AQCA 5FP5A 4WG5A 1OIQA 2ZM3A 2F57A 3QKMA 4EH9A 4GT5A 3KGAA 3KKVA 3PJ3A 3V5QA 3QRKA 4P90A 3KULB 3QTUA 3UOJA 3LAUA 2AC5A 2FB8A 2JGZA 3NNUA 4FKSA 4U7ZA 4W9WA 4AA5A 4E4XA 5KMIA 3PSBA 3BLQA 4YU2A 3C4CA 3HZTA 2E9VA 3ULZA 2WEIA 4BCPA 3PVBA 3VN9A 3O23A 4JRVA 2OH0E 4FICA 1KE8A 4RC4A 3RVGA 3V8WA 3AMBA 2XYUA 3HVCA 3OS3A 2ZJWA 1K3AA 3VS5A 5AEPA 5KMOA 4WUNA 2YZLA 2XJ2A 4DEAA 2UZUE 4O7VA 2IG7A 4R7IA 4ZTHA 1Y8GA 4OT6A 3ZHPC 3GVUA 1YKRA 4K33A 5AR5A 3VUDA 5M56A 2BTRA 2R4BA 4D4YA 4OTIA 3ZFYA 2IVUA 4HOKA 2HWPA 3ENHA 3RTPA 3CP9A 3TI1A 2HOGA 3MA6A 4M12A 2UZDA 5HLWA 4FTCA 4EOKA 4Y46A 2XK7A 3VBYA 5LVOA 5CEPA 4HYUA 3C4XA 4AP7A 4DHFA 4S32A 3CLYA 3CPCA 4B0GA 4EK4A 4NKSA 4WNMA 4BDDA 4DFUA 3UIUA 5HTIA 3E64A 3R9NA 3E88A 4CVAA 2GTNA 2VTNA 3WZKA 1WMKA 2WMSA 3MPAA 3NR9A 3WF6A 2OJJA 3AD4A 3DBEA 4JQ7A 4U5JA 4EOIA 3Q2JA 2J0KA 4BDBA 1XH6A 2I40A 4YBJA 3OTUA 1JSUA 5K0XA 4IVAA 4XRLA 4FSNA 3PPKA 3FAAA 2PVNA 2BZKB 4CZTA 2O0UA 3VBVA 2C6MA 3QKKA 5BYZA 1KWPA 4U6RA 5HEZA 3DK6A 3UMXA 1PXIA 5JRQA 3QLFA 3MW1A 4YTCA 4JDIA 3RK5A 3RK9A 3ZXZA 4F09A 3QRIA 4MXYA 5DEYA 3ZO1A 4QYGA 4DH7A 4EH4A 1F3MC 3QCXA 4S33A 4LMNA 5C01A 4U81A 2A1AB 2QR7A 3A7IA 4I23A 3LXKA 3RZBA 4CCBA 3L8XA 4ACMA 3E7VA 3MI9A 3NNVA 3NWWA 2OFVA 2ZV2A 4E4MA 2NO3A 1OL6A 4BI1A 4YC3A 1CKIA 2OO8X 3D7TB 3MIAA 3H4JA 3N4TA 2UZEA 2BKZA 1QPJA 2J51A 3Q32A 3LFCA 3ITZA 1REKA 2W1EA 2YIRA 4MQ2A 4YZ9A 4AF3A 4RWKA 5K4IA 5IKWA 4O7NA 4RWLA 4APCA 4YC6A 3FLZA 2I0HA 5GZ8A 4WRSA 3ALOA 2EB3A 4TPTA 3IDBA 2BILB 2IO6A 4FTMA 4FNZA 3EYGA 4PX6A 5ACBC 5CF6A 4NKAA 3DBFA 2CCHA 3W2SA 4AACA 2BPMA 4BI2A 3CY2A 4RIYB 1Q8UA 2QOQA 4ZSGA 3SVVA 5AMNA 4ZK5A 4RIXA 3ZBFA 1W83A 4F0IA 4JQEA 1Z57A 4AG8A 4U9AA 3UGCA 3NUSA 1GOLA 4D2VA 3CEKA 3ERKA 5LMKC 3F5GA 3BPRA 2X81A 2UZNA 3WIKA 3OXIA 1YWNA 1U54B 3HUBA 4GEOA 4L3PA 4U0IA 3U6JA 1KE7A 4M0YA 4LOPA 2NRYA 1DI8A 2JIUA 5AV2A 5GJGA 1Q61A 3GEQA 3ZUTA 3KB7A 3R8PA 5KO1A 4G1WA 4FIJA 3E8NA 2OJGA 5ETFA 5HO6A 5EHOA 5EDRA 1R1WA 4D0XA 4C3RA 3GNIB 3EWHA 5IISA 3O2MA 4H58A 2ACXA 4RQVA 3PY0A 4G17A 3TV7A 5L8LA 5CSWA 3SRVA 3PJCA 1EH4A 2PTKA 4HYIA 3C4ZA 3GU4A 4QRCA 2XNPA 4UXLA 3GC8A 4YNEA 3ZRKA 2JKKA 5CEOA 1J7UA 1MRYA 3LFBA 2PE1A 2ZOQA 4OTFA 3F5XA 4RZVA 3LW0A 3AC3A 3T3UA 2UW7A 4AW2A 4ZY6A 3K5VA 3GOKA 3MFTA 3Q4TA 3Q9YA 2C6KA 2C0OA 5AA8A 4ZOGA 2QOKA 3LLAA 4B7TA 2JD5A 2WNTA 2X8DA 3E63A 3HMNA 3QQLA 4W8EA 5IG1A 5AR4A 3RPYA 2O3PA 4U3YA 4NZWB 4JDKA 5HCYA 4C4JA 4FTOA 5B2MA 5HE2A 3FMHA 4XMOA 2GNFA 3VQUA 1OPJA 2ZMCA 4EHGA 4G6OA 4MX9A 2B7AA 4G3DA 3KCFA 4AZWA 3DCVA 5TE0A 3Q9WA 3FBVA 4YJRA 4NFNA 4EOJA 4F63A 2W4JA 4GT4A 4E5WA 3LM5A 5CSXA 4AS0A 5A4LA 3FLWA 2YCRA 4RJ4A 4AT4A 3MVJA 3PJ8A 3QD2B 3WE8A 2BIYA 2JIIA 3DV3A 1V1KA 4G9CA 5HD7A 2YWPA 3KK9A 3MV5A 2JDRA 3DJ7A 3O7LB 3D5WA 1URCA 4ANBA 3BHUA 4A9RA 2R3OA 4FKIA 4IWQA 2QVSE 3C4EA 5GINE 4HJOA 3HUCA 4KABA 4Z16A 3QUDA 4FIIA 4QMSA 1PF8A 1L3RE 4BIBA 2EB2A 5IA1A 3QZIA 2WKMA 2YM3A 4QP8A 4CRSA 4D58A 3F2NA 5E1SA 3RM7A 4UALA 3G0EA 4EHVA 3OZ6A 4WHZA 5E92A 2YJRA 2QKRA 4IHPA 3DLZA 5BVDA 3MWUA 2BZJA 3UC3A 4I94A 1HOWA 4M15A 4RFYA 4ITIA 4R1VA 4YTFA 4D2SA 2C3IB 1YXXA 5AM7A 5A3XA 5CTPA 3V3VA 3N51A 4X2JA 2VTJA 3ZDUA 3RKBA 4CYIA 4UMUA 1YWRA 5L8KA 2XIYA 3RMFA 3FEGA 3PA4A 2CKPA 4JDJA 4M0ZA 4UYNA 2OJFE 5ANOA 4C4IA 5H9BA 5B2LA 3C9WA 3NZ0A 2BAJA 5HG9A 4MXOA 5CT7A 4Z55A 3E7OA 4BDHA 5FBOA 3Q5IA 3M2WA 3UYSA 4G6LA 1G3NA 2W5AA 2XNGA 1QL6A 4FKRA 3FXZA 3R8LA 3GI3A 4CCUA 4EHZA 4XV9A 4PMPA 3NUNA 3PVUA 2FYSA 1LP4A 2X2KA 4IMYA 1XO2B 3ATSA 3ZO2A 4H3BA 2XVDA 3C51A 3HMMA 2VO6A 1KOAA 2QCSA 2H96A 3E8EA 3H30A 1MQ4A 4AZSA 2GU8A 3VO3A 3QYWA 4FA2A 3QTWA 5TOZA 1GIHA 1A06A 3QXOA 4A06A 2XK4A 2NRUA 3ENMA 1WVXA 2J0IA 4H3QA 4L00A 3BWFA 5EDPA 3VUTA 5HBEA 3NVMB 1UA2A 3WE4A 5CWZA 4ERWA 2GNIA 4DA5A 4NJ3A 1SVGA 1W84A 4QQCA 3UZPA 3ORTA 4FVRA 1PXJA 2GHGA 3FLSA 3UYTA 3ZUUA 2ETRA 4YJTA 3UP2A 1FMKA 4C36A 1R0PA 5CAUA 2BHEA 4XUFA 3WZJA 3BYOA 2YFXA 4M8TA 3TCPA 1TQMA 3MTLA 5T3QA 2ITQA 1OIYA 3QUEA 4NCTC 4TRLA 2F7ZE 2QOBA 5CF8A 4X3FA 1Q3WA 2CGUA 3E3PA 1PKGA 3UIMA 2X9EA 4O91A 3COIA 3IDCA 4BCIA 3HYHA 3R83A 2J6MA 4ANOA 3U6HA 1CTPE 5AJQA 5FEDA 3R7VA 1XHAA 1OL5A 3CTHA 4TNBA 2B1PA 1JKLA 2W06A 3OWPA 3QX2A 4I22A 4U43A 4DGLC 3F7ZA 4QOXA 5CEIA 4UY9A 3V6SA 2ITWA 1WBSA 3KMUA 2XZSA 3NLBA 3Q9XA 4OR5A 3P5KA 1YHWA 3ATTA 4WT6A 3LFQA 5AUTA 1NW1A 4YLJA 3FQHA 4FV2A 3HEGA 2W5BA 3REPA 1ATPE 1RQQA 3C1XA 3IGGA 1FVRA 1XBAA 4YNOA 2XK8A 1PXOA 1PXNA 4CGAA 1ZMWA 3OT3A 4XG2A 3RK7A 2C6IA 4F65A 3ZRMA 3V6RA 3VRZA 3VBWA 4EK6A 2P33A 3JY0A 4GFMA 4QO9A 5GZ9A 3KY2A 3RAHA 3I0QA 5KKRB 3HECA 1Q5KA 4LL0A 4FNXA 3W33A 4DFZE 2CHLA 3PTGA 3QRJA 5F95A 4ZS4A 5ETAA 4FV0A 2E9OA 3DFCB 3VULA 5CX9A 4KBKA 2XYNA 2W1ZA 3HDMA 5FM3A 3QWJA 5DIAA 4QYHA 3UO6A 4IQ6A 3OUNB 4IWPA 1URWA 5AUXA 5B0XA 4E5AX 3UTOA 2V7AA 1Y57A 2XMYA 3E5AA 3MH3A 4QP6A 1IAJA 2XEYA 1H26A 2ITOA 4EL9A 3SX9A 2GDOA 4USFA 4TL0A 3AT4A 3QALE 3F3ZA 1K2PA 3R21A 1ZOEA 5IH6A 3E8DA 4LV5A 3EKKA 3NYVA 4PTEA 3ORLA 4ZSAA 4H05A 3RPOA 4RBLA 1ZYCA 2WOUA 4ZLZA 3ZYAA 4O2PA 5FEQA 5IPJA 2UZTA 3II5A 1OUYA 2WMVA 2YA9A 2YABA 4ZSEA 3LZBA 5HE3A 4FVQA 4K18A 3GCQA 3S2PA 5JZJA 5I9XA 3FZ1A 3VF9A 3MA3A 1PY5A 2KTYA 3Q2MA 4TWPA 3OXTA 2ITPA 4O82A 3LLTA 2CN8A 3ORPA 2P3GX 4JI9A 3TG1A 4XEYA 4IFCA 1IEPA 3PA3A 2WB8A 5HU3A 2XH5A 4BCNA 3KXXA 4XBUA 5M08A 3FLYA 2OGVA 4XJ0A 2HY0A 2IW8A 4YSMA 3ZFMA 4EEVA 4ZAUA 5IZFA 4QTDA 4JL9A 2BKKA 4U8ZA 4I20A 3N9XA 4FBXA 3SV0A 4XP3A 3FI3A 3ORMA 5L6WL 5A9UA 3F6XA 4YJUA 1BUHA 3NW6A 3UNJA 3ZXTA 2X4FA 4X7QA 5I9YA 4U42A 5L2WA 2RKUA 2ERKA 2DWBA 2W9ZB 3C0IA 3GQLA 3I7CA 3ORZA 4J1RA 4KNBA 1FINA 2QLQA 5DR9A 3UJGA 4JR7A 3D4QA 4FZAB 3DK3A 2ONLA 3AMYA 4GJ2A 3AC4A 3D5UA 2FSLX 3M11A 3NYOA 3GXLA 4DEEA 3Q6UA 3PVWA 3VUGA 2C6LA 2WOTA 2VTLA 2REIA 4FEQA 4R7HA 5DLSA 4AGDA 1OPLA 2OJIA 3D2KA 4FTRA 4IIRA 4O6LA 3W2RA 4C58A 4CMTA 2J0MB 3ZO3A 1VEBA 3NAYA 4FEXA 1Q4LA 5KZ0A 4PTCA 3VW8A 3FDNA 2QU6A 4FG9A 3NEWA 1Q62A 2C69A 3Q52A 3RNIA 2VO7A 2UVZA 2XK6A 2BAKA 4C4FA 1OMWA 3EFKA 2UVXA 3P4KA 4A7CA 4EI4A 3W2CA 2F9GA 4I6BA 4ENYA 3BEGA 3C4WA 4O0VA 3PXKA 4S34A 1OECA 3ZU7A 4EH8A 5J8IA 2O65A 3B8RA 4GG5A 5H8GA 4A4XA 1XH5A 1YQJA 5DI1A 4GRBA 2R2PA 3FY2A 4QMZA 4KIKA 2Y9QA 4JBQA 4YJPA 3UDBA 3EN5A 4PL4A 3G90X 4B4LA 5CU0A 2XM8A 3SKCA 2RSVA 3ZMMA 5JFXA 4XOZA 2BROA 5AUYA 1MQBA 1Y6AA 2HZ0A 3H3CA 3PG1A 2BRHA 4FIFA 5EM5A 4ZTNA 5G6VA 3ZH8A 4NEUA 3QXPA 5JKGA 5C4LA 3C4FA 4DFBA 4FT9A 3VJOA 5CQUA 5E8SA 3GU6A 4LGDA 3PLAE 3MVMA 5DH3A 5AR3A 3AOXA 1PKDA 3QUPA 3FZSA 3HP5A 5H2UA 5C1QB 5CF4A 4CFWA 4IXPA 1WBOA 5K4JA 2YIXA 1ZYLA 4IM3A 1YDTE 5DMZA 5HD4A 4G3GA 1REJA 4Y5HA 5IQAA 3I6WA 5CU2A 5DR2A 1JWHA 4ZJVA 5M53A 5HG7A 5C8KA 3LM0A 4EJ7A 3L9PA 3TZ8A 3CCNA 1OM1A 4F1TA 3NIZA 3R01A 3T9TA 3LCKA 2WTIA 1DM2A 4IJ9A 4O7TA 4RIWA 3AC5A 3BHYA 3GGFA 3NSZA 5IUGA 5KKRC 4C38A 2B9HA 3SC1A 3RCJA 4BKZA 2H9VA 4DBXA 3MGYA 3KA0A 3BHTA 2J5FA 4BKJA 1VYWA 2JDOA 2PVLA 2GQGA 5E8YA 2UW6A 2CNVA 1U59A 2YHVA 4R7BA 2BRBA 3MS9A 3QTXA 1MP8A 5EG3A 1FGIA 4AZFA 3ZSGA 5KHWA 1PXPA 3U55A 4O0TA 1OVEA 3TKIA 3U87A 5JFWA 4D55A 3GC0A 4LRKA 4RVKA 3W2OA 4MNFA 3PZEA 3S0OA 3U51A 4RZWA 2X7OA 5JEBA 2PUUA 3UVPA 1XH7A 2IZTA 1CMKE 1XWSA 3IOKA 3JUHA 2CJMA 4DLIA 2GHLA 2R3HA 4YR8A 1PMNA 2C5VA 4L01A 4XG3A 3VC4A 5E9EA 1H0WA 3SOAA 3BU5A 4BBMA 3LCOA 2OXYA 3GC7A 2VO3A 2BALA 3O51A 4B99A 4O27B 2WTKB 3BU6A 4D2TA 2CNQA 4C4EA 4BCOA 2BHHA 3VQHA 5F94A 4YO4A 2YISA 4UWCA 5EM8A 5AV3A 4LRJA 4E6DA 3MESA 3ACKA 4WNPA 4RVTA 2GSFA 5LMAA 2G2HA 3CQWA 3EKNA 3LJ2A 4P4CA 4P5QA 4BZOA 3C5IA 4JVGA 3DU8A 2DS1A 4D28A 4FV8A 1W0XC 5CF5A 4FSWA 1H25A 4BB4A 4LV8A 2VN9A 4HCTA 5ANKA 4KIOA 2XB7A 1H0VA 2IZSA 3R04A 1NY3A 4QP1A 3VS6A 2CKEA 5CY3A 4CMUA 4QMQA 2XRUA 2W05A 3RZFA 3RHXA 3LMIA 4DGOA 4RX5A 3BCEA 2CGVA 5LARA 3A7HA 1BLXA 4FT5A 3NPCA 3Q6WA 4EBWA 3BHHA 2YM4A 3OXZA 2NP8A 3AT3A 4QMNA 4ACCA 4J71A 4KIKB 4HVSA 2XRWA 2YDIA 4AGCA 5AUWA 4D5KA 1SYKA 4CLJA 2WPAA 4IX6A 4DINA 3I5NA 4L52A 4X3JA 5TKDA 4IVCA 4HZRA 4CTBA 3ZZWA 2C0TA 5LVNA 3MTFA 1OL1A 1P2AA 3P7BA 4YTIA 4FTTA 3W18A 2R3IA 4DFLA 1GZKA 2Q0NA 3EQCA 4TWNA 3Q4ZA 2C1BA 4WD5A 4FYOA 2YJSA 1YOLA 2BR1A 3DK7A 3ZRLA 5C9CA 4RA5A 1B38A 5E1EA 5IA2A 3BQCA 3IW5A 5D12A 3UPZA 3DNEA 3CS9A 2HYYA 4B6LA 3MN3A 3UPXA 3E62A 3OT8A 4J8NA 5IUIA 2XJ0A 3QD3A 3PE1A 4Q9SA 4PPBA 3H0YA 3P86A 1UU9A 3HMOA 3LFFA 4RX8A 2XNNA 3R1YA 5H3QA 3O8UA 5CSPA 3DQXA 5LVMA 2BIKB 2GNGA 2P0CA 3OBJA 1ZAOA 3WZEA 3QWKA 4PP9A 2C30A 4Y73A 4OW8A 3NNXA 2PE0A 4MQ1A 5FWKK 1UKHA 3UMWA 4QTCA 4MAOA 3PPZA 5AX3A 3NIEA 4BHZA 3EHAA 4CD0A 5EI2A 4CT2A 4C02A 3NS9A 3VS3A 5F9EA 3KRXA 4D4RA 4N6ZA 1MRUA 2IZRA 3KK8A 4FI1A 4M69B 4IB3A 5HHWA 5JT2A 3A61A 5J95A 1U4DA 2QLUA 2XM9A 2OJ9A 5L3AA
chains in the Genus database with same CATH superfamily
4C34A 3LCSA 3RI1A 2FVDA 4NM0A 3BYVA 3VW6A 4DGGA 3O50A 4IZAA 5DR6A 5C03A 3P79A 5L6PA 2ZM4A 4UMQA 4I5CA 5AP6A 4RX9A 5AWMA 4ZY4A 3IW4A 2BRNA 4NSTA 4QPAA 1KE6A 2BTSA 4HGEA 4BKYA 4Z7GA 5CASA 3FWQA 5JGDA 3DNDA 4FKTA 2JC6A 3ZUVA 3HAMA 2PWLA 1YXSA 2C1AA 2HZ4A 5AA9A 4PDPA 4BWXA 5J9ZA 3F3UA 3V04A 1Q3DA 4R3CA 5HVJA 1H1QA 4IDVA 5KMJA 2ZYBA 4J98A 3MJ1A 3MB6A 2ITVA 5FBNC 3FSFA 2VV9A 3B2TA 3L9MA 5H8EA 5IQIA 4YSJA 2HXLA 3UP7A 3CKXA 4FEUA 5FDPA 5HO8A 3Q9ZA 3I4BA 1IASA 2UUEA 5HIDA 3CJGA 3RWPA 3JVSA 4EWQA 4AN9A 3BI6A 4ZS0A 2XF0A 4QYYA 3WF7A 2C47A 4UX9A 4ZIMA 2WTKC 3F3WA 4I0TA 4NM5A 3R73A 4KB8A 4UEUA 3ZZEA 4J95A 2WQNA 2WAJA 4R3RA 3U6IA 4EKKA 3BV3A 5CU3A 3TEIA 1WVWA 4ASDA 1UU8A 1ZXEA 2QG7A 2YCQA 2ITYA 3CGFA 3QQFA 5KBQA 5EHYA 5CI6A 1I44A 4ANLA 4Q5EA 2W4OA 4GK2A 4O4EA 4I1ZA 2QURA 1U5QA 4EBVA 1RE8A 3WARA 1VZOA 4IDTA 2QU5A 2SRCA 5J7HA 3G15A 3TM0A 4HPTE 3KXZA 1J1CA 4I4EA 5BVFA 4DT8A 4BTFA 3F3VA 3UDSA 4BTMA 3ZLSA 2OF4A 1J3HA 3NUUA 4NJDA 4RIOA 3D5XA 2FO0A 3KCKA 4IZ7A 2W96B 2R0IA 3QC9A 4E3CA 4QMOA 3FKOA 4EZ3A 4ZZOA 4IE9A 4GFOA 4BCHA 4GJ3A 3D14A 4YUQA 1HCKA 4MEDA 3HV5A 2O8YA 3HNGA 3MJ2A 1ND4A 3ZM4A 3ORNA 5CQWA 4H39A 4I5PA 1M14A 4IVDA 3W32A 1JQHA 4ZZNA 3H9RA 2ESMA 2C3KA 4ZTSA 3BV2A 1KE9A 3NDMA 4FK6A 4FL3A 4HCVA 4EH3A 3EIDA 3N4VA 4O7ZA 1YOJA 3CQEA 4CFMA 5EOBA 1KE5A 4OTQA 4PMTA 1UV5A 4YZNA 3TNWA 2OH4A 2GTMA 1XQZA 2GNHA 3BQRA 3FSKA 4JBPA 4L7FA 4C0TA 4I0RA 1J1BA 3PY3A 4O0XA 3DT1A 3F5UA 2HW7A 1K9AA 3MSSA 3PIXA 2DYLA 3TIYA 5LWMA 4JLCA 1GZNA 3B8QA 4MD7E 3EH9A 2XP2A 4FV7A 3FZOA 2IVTA 4MXXA 5IMEA 1WZYA 4U41A 2V7OA 5HCXA 4QNAA 5DOSA 3PZHA 5IU2A 1TQIA 4FV6A 2RF9A 4XBRA 3DBDA 5M4CA 1YXVA 2WIHA 3QZHA 3FKLA 5T6KA 4BTJA 3BZ3A 2F2UA 3VVHA 5LVPA 2A27A 4GW8A 2YM7A 3G9NA 3ET7A 3OF0A 3UG2A 4EC8A 5DVRA 2QO2A 2R3JA 5AV1A 1V0BA 5J1VA 2EUFB 3OROA 3ZSIA 2JBPA 2VU3A 4CTCA 4F9BA 1KSWA 4EQUA 4QEBA 4KSQA 4BBEA 4C4HA 3BWJA 1VYZA 3CGOA 2JIVA 2YN8A 3NUXA 4H36A 3HA6A 4E1ZA 4BTKA 2EXMA 3QZFA 4LG4A 4BGGA 5A4EA 3F66A 1LR4A 1H01A 3DA6A 2X2LA 3TYKA 1OKWA 3CBLA 5EHLA 2QR8A 2P2HA 5I5ZA 1YW2A 5DPVA 2XUUA 5CI7A 2Z8CA 5IQBA 4LOQA 4IEBA 3HA8A 3TXOA 3CSVA 3W8QA 4F7SA 1RDQE 3PIZA 4YURA 5BUJA 3UZRA 3BGQA 3AD6A 4XV2A 2ERZE 3JR1A 2JDSA 3LOKA 1QPEA 1WBNA 4J52A 2RFDA 4PTGA 2RFSA 4O96A 5I3OA 2J4ZA 4RJ5A 4BDKA 4G3EA 3OHTA 3DQWA 4FTNA 1YDSE 5IDNA 3R22A 3EB0A 3TNIA 1H08A 3Q04A 4Y95A 4FT7A 3OCGA 2FGIA 4M7IA 3TNQB 4MNEA 2C68A 4PRJA 4ZXTA 5HICA 4DLJA 1ZARA 2OXDA 3KRJA 3VF8A 4I6QA 5FM2A 4YJSA 3G5DA 4G6NA 1R0EA 5E8XA 4F0FA 4AE6A 5CENA 5CANA 5C8NA 3QRUA 4A9TA 5ANGA 4LUEA 4JXFA 1FBNA 5GIPE 1QCFA 3E87A 4HW7A 2E2BA 1PHKA 4C7TA 5J5SA 4BWKA 5EKNA 3G6HA 4ID7A 4V0GA 4Q2AA 1FGKA 3DBQA 2R9SA 2OIQA 5GIOE 4U79A 3CJFA 5ACKA 3R8ZA 2IVVA 3BGZA 4QMPA 1PMUA 1LEZA 2FSTX 2OU7A 2XBAA 3DKOA 4JG8A 3FC2A 4TYJA 5CNOA 4EUTA 3I7BA 4W4XA 1Q99A 2UZBA 3IW6A 3NVKI 4FL1A 4BDJA 2R64A 2AYPA 3PXFA 4I21A 3V5TA 1UU7A 4K0YA 4DGNA 4TYIA 3S95A 4EKLA 4FODA 4Y72A 4AGWA 2CPKE 4YJVA 2OF2A 4TW9A 5LQFA 4RLLA 3OFMA 3F2AA 2A98A 4WG3A 1Q97A 3EQFA 4QQ5A 4QP4A 4HGSA 5I9WA 4DCEA 2G1TA 5J7BA 4BDCA 3O17A 3BYSA 4TWOA 4BCFA 4LQMA 1ZYJA 4AU8A 1PYEA 2W1FA 3DBCA 4PMMA 4ALVA 3TACA 5DBXA 4L44A 3QGWA 4EH6A 4AXDA 5GNKA 4CT1A 4MWHA 3V8TA 3W0NA 4QMLA 1PMVA 4FK3A 1M7QA 4W4YA 4YPSA 5G1XA 4IB1A 2BUJA 3UE4A 4YLKA 4BDAA 2B55A 3FZTA 3D83A 3GFWA 4G34A 2QOCA 4RIXB 2W1IA 4F6UA 2OWBA 4E4NA 4K77A 4YP8A 4G31A 5BMMA 5CT0A 3VS2A 5M09A 3POZA 3COHA 3MH0A 4A07A 4R5SA 4CYJA 4Y83A 1KV2A 1BI8A 3E92A 5LXMA 4O2ZA 5JSMA 4RVLA 3PXZA 5CU6A 3PP1A 3FLNC 2IJMA 3V51A 4C37A 3P23A 3I1AA 2CLXA 4IAYA 5E8VA 2ETMA 2J5EA 5JFVA 3KEXA 3EN7A 3UBDA 4BDIA 4A9UA 1IA9A 1ZOGA 5LCJA 2Y6OA 2IVSA 3R63A 2QO7A 3JXWA 4MYGA 3ZC6A 4FSMA 4AZTA 2DQ7X 4DBNA 3WYYA 3QBNA 2BFXA 3FI4A 2W4KA 3OP5A 3JY9A 1FOTA 4W4VA 3TKHA 4F9CA 5I9ZA 1OUKA 2W5HA 5IH4A 3DKFA 2XS0A 1J7LA 4G2FA 4M66A 3QHRA 3SRVB 4FTIA 4WSQA 5M44A 3OMVA 4CKJA 4PNIA 4ZJJA 3TN8A 3HMPA 3MFSA 3PFYA 4D4VA 3QKLA 3D2IA 3QC4A 4BN1A 4O7LA 4OAVB 4FGRA 3NCGA 2R3NA 1YHVA 2YCFA 3IGOA 1V0OA 3FMKA 1B6CB 3OOMA 4IB5A 4IM2A 4KWPA 4OGRA 4XCUA 4BCMA 4DEHA 5E4HA 1TQPA 5D41A 2PVRA 4IANA 4E8AA 4Y8DA 4CXAA 4CZUA 4FZDB 4XP0A 2CN5A 4CRLA 2CDZA 2I0VA 4FKWA 4F9YA 3QD0A 2B54A 5ICPA 1IRKA 2YZAA 4OLIA 4MNEB 2WTVA 3KQ7A 3BGPA 3ZFXA 4D2RA 4KBCA 1M52A 2RIOA 1M2QA 3C50A 1YWVA 4LOOA 4I24A 4XLVA 1KUTA 2QOHA 3KC3A 3DAEA 1CSNA 1GIJA 4ZEGA 4HVDA 2R3MA 3GFEA 4AWIA 3FJQE 4GUBA 3R0TA 4AGUA 4DHJA 2F7EE 2F4JA 2JLDA 3P0MA 2PVMA 3PRFA 4TKSA 2WTJA 4V0GB 4YMJA 4RJ3A 3LQ8A 4CV9A 2X0QA 3FXXA 1XBBA 2H34A 3IDPA 3PLSA 4HGLA 4JDHA 2PZRA 4DAWA 4N57A 2J7TA 3BBTB 4O4BB 4CV8A 4O1OA 4BHNA 5JN2A 5J9YA 4G3CA 3V5WA 5FP6A 4RFZA 1PXMA 3Q96A 2AC3A 4TNDA 3ZLWA 4AOJA 4U80A 1APME 5EQPA 4HYSA 4KRCA 3ZTXA 3QTQA 5HU9A 4HPUE 1QPDA 3I0OA 1H1PA 1NA7A 2ETKA 3R1QA 4BYIA 2PMIA 4Z9LA 5E8TA 2PZYA 3DPKA 4PF4A 5A4QA 4K1BA 1B39A 3JPVA 3F61A 5DN3A 5EFQA 2HK5A 4YZCA 3IS5A 3IK3A 2Y4IB 2YDKA 3MFUA 3P78A 4ZTRA 1H00A 3K2LA 3G51A 3RPSA 4O21A 2XA4A 4CQEA 3PSCA 1XKKA 1WBTA 2G01A 3KREA 3BLRA 1BMKA 4IVBA 4L43A 4FKVA 1DAYA 3Q53A 3WZDA 3RBWA 1G8JA 5TT7A 1LEWA 2WU7A 4FZ7A 4Y5QA 2X8IA 3AQVA 3OCSA 5EYDA 4A4LA 3IW8A 2VWZA 4DFNA 5BPYA 4OTRA 1W2DA 3NW7A 4QNYA 3VUMA 3TUDA 4K6ZA 2JDTA 4PPAA 4YC8A 3ID6C 4D2PA 3DLSA 3R9DA 2YERA 3VS4A 2PMLX 4OBOA 4PWNA 5EM6A 5CEQA 3GB2A 2OZAA 4FTKA 4LMUA 3NUAA 3R2YA 1YVJA 4FYNA 4RA4A 3RAWA 3WF5A 5DWRA 4WSYA 3PXRA 3CY3A 5I4NA 2PVYA 4FV1A 4LM5A 3G0FA 5KBRA 3W2PA 1W8CA 4FTQA 4I5MA 3VIDA 2V5QA 1ZLTA 4WNOA 4FKOA 4L9IA 1WBWA 3S00A 2YIYA 4ASEA 4AXAA 4KS8A 3MPMA 3U9NA 3WOWA 1U46A 5IEYA 4ALWA 5A4CA 1F0QA 2OSCA 2C0IA 3FC1X 3W0PA 2R7IA 4FKQA 3IKAA 5IQHA 2C5OA 4OT5A 2QG5A 4IZ5A 5FD2A 5M4IA 4AZEA 3P1AA 1NVRA 1JSVA 2GFSA 3CR0A 2BCJA 3PVGA 4PPCA 5AV0A 1OI9A 2OI4X 2P4IA 2WMUA 2GQSA 5IQDA 3C0HA 4O1PA 4FEVA 5A6NA 3KXNA 4X3FB 5AAFA 4C2VA 2WO6A 4KUJA 4JS8A 4ZLYA 2YLFA 5CVFA 3V5PA 3HX4A 2WMXA 3GCUA 5CVHA 3GU5A 2QHMA 3LVPA 2OLCA 2GCDA 3K3JA 1ERKA 4BCQA 2CKQA 5CALA 1W2FA 2XBJA 3TMOA 4LYNA 4FOBA 4HGTA 4BJJA 4JAIA 4LDTA 4MXCA 4AFEA 5AFVA 4UMPA 4M14A 4RT7A 3R7EA 3WF8A 5AUVA 1TVOA 1LUFA 4R5YA 2R3LA 4O0RA 4F6SA 4QD6A 3BYMA 1M17A 3TL8A 4O7WA 4AW0A 3R7YA 3RCDA 1M2RA 4J8MA 3UO4A 2X1NA 2WZJA 3HV3A 2A4LA 3LMGA 3OEFX 5AUZA 4M68A 4XHKB 3GU7A 3UQCA 3CD8A 4F08A 5FTQA 4TN6A 2LAVA 4FT0A 4ACHA 4DHIB 4O6EA 1NVSA 3GP0A 1SNXA 3FL5A 1QMZA 4BWPA 4UMRA 3DJ5A 3N4UA 4L3JA 1Y8YA 5IQGA 4QMXA 1Y91A 2BMCA 2YWVA 2QHNA 4NH1A 2W1CA 4IFGA 3WBLA 3FI8A 2VTSA 4ZTMA 4M97A 4QDEA 4R78A 2OIDA 3P7AA 2R3GA 4UWBA 1YDRE 3UIBA 4K8AA 3EL7A 2J50A 3R8VA 3VRYA 3W1FA 5BUEA 5HX6A 1R78A 4KRDA 4XV3A 3JVRA 1H28A 3ANRA 4XS2A 5HKMA 3LIJA 4XG9A 1XH4A 3AT2A 4AE9A 3MPTA 5IA5A 4CFUA 3I5ZA 4DITA 2OW3A 3DDPA 3OOGA 5E8UA 1E9HA 4CFXA 5K5NA 3DKCA 2BZHB 3AC1A 3OD6X 5HBJA 5EI6A 3KMWA 3MYGA 5JRSA 4LL5A 4DG3E 3RWQA 1HCLA 1A48A 2YCSA 3OY1A 2HZNA 1O6YA 3EFWA 3K5UA 3ODZX 4ASZA 2ITTA 5EKOA 4A4OA 2RFEA 3R00A 4IAZA 4D1XA 3HP2A 3VWAA 2VTRA 1DS5A 3BKBA 4K2RA 2HW6A 5D7AA 5AX9A 1JNKA 4W9XA 4D1ZA 3A2CA 5DG5A 3VUHA 3RHKA 3SG8A 2F2CB 5AR2A 3FQSA 5ETCA 2VTQA 3OG7A 5EW8A 1RW8A 3KVWA 5GJDA 3O96A 4IX4A 1GZOA 3DY7A 3HRFA 3WF9A 5BVOA 4IC7A 4E20A 4RRVA 4PDSA 2R7BA 3CC6A 4S31A 4ZTLA 3QAME 2Y4IC 4TYHA 3VAPA 4XYFA 5CS6A 3GENA 2E9UA 4IB0A 4GU6A 4NTSA 3KN6A 5AUUA 4I4FA 5GHVA 5M57A 2AQXA 4DG2E 5LMKA 2G9XA 2KULA 2R3QA 3OVVA 5EYMA 4I5HA 2IEWA 2R0UA 3PP0A 5TR6A 3WILA 1H4LA 3POOA 4F64A 4AA4A 4NM3A 1XH8A 3W0RA 4FKGA 4QTBA 3CQUA 2O63A 2V22A 3G33A 3K54A 2CCIA 2ZV8A 4J99A 4KIQA 1Y6BA 3A7JA 3KRWA 5DE2A 2V62A 2QOIA 1H1RA 1OBDA 1Q8YA 4M13A 2HENA 4FV3A 4BRXA 4QPSA 4BGHA 3KVXA 5E7RA 2PUIA 1XR1A 5HORA 2UVYA 4AXEA 4B8LA 2C5YA 4E5BA 4QPMA 4QYEA 4II5A 2GS7A 4X2KA 3ZEPA 2HIWA 3MB7A 5IA3A 3ZLXA 2AEGA 3SXSA 3QTIA 4OBQA 3KIOC 5KX8A 2Y0AA 3L8VA 3HDNA 3FMDA 3ZBXA 4AT5A 4A9YA 3PRIA 4CEGA 4DGMA 3TIZA 2IF8A 5AAGA 3HRCA 4G9RA 4LGHA 4TT7A 1ZZLA 4G16A 1H24A 4AOIA 3UNKA 2NYAA 4DTBA 2RFNA 4GCJA 4F9WA 3IPHA 4QP2A 1RJBA 4FKUA 4E7WA 5EQEA 1T45A 1R39A 4J96A 5AR8A 4O86A 4BCKA 4X3FC 4R77A 4AQKA 3D9VA 3K3IA 1X8BA 4L42A 4PMSA 4BFMA 3FPMA 2YLEA 2BAQA 2BVAA 4PL5A 5AIRA 2PVFA 4Y85A 4GKHA 2B52A 5HIBA 4ZMFA 2VD5A 4FTJA 5AAEA 3KMMA 4IW0A 4UWYA 4X2NA 2OIBA 4MBJA 4CKRA 3LJ1A 4S30A 2A0CX 4ANQA 2YEXA 3OCTA 5AP7A 2Q83A 4FMQA 5HI2A 4RWJA 4ERKA 4HNIA 2VWXA 3CTJA 4RFMA 4RVMA 4O22A 4Z7HA 4M67A 4J97A 3DZOA 4QMMA 4R8QA 2UZLA 3SXRA 1GAGA 3QQKA 4BBFA 2ZB1A 2YM5A 3R7OA 3ZONA 3GOPA 4U40A 4LI5A 4NL0A 5AP5A 1OZ1A 5JGAA 4FKLA 4IX3A 4BDEA 4DF3A 3CD3A 4XP2A 4RIWB 4DE4A 4EORA 4V01A 5M55A 4C4GA 4ASXA 2X0GA 3I81A 5EQYA 2ITUA 2R5TA 4DHZA 2C3JA 1Q24A 3R7IA 3TZMA 4MBIA 4FZFB 4FTAA 4AX8A 4JG6A 2YAAA 2VTPA 4Z3VA 3TDVA 4X21A 4FT3A 1PMEA 2B9JA 1P14A 1UNLA 5HQ0A 2B53A 2ITXA 1GNGA 1IAHA 3AC2A 2W17A 2VWVA 1Q41A 4WUAA 3NGAA 3R9HA 3S4QA 2C6DA 3BE9A 4O4CA 5HLNA 1V0PA 2VRXA 3EJ1A 4JX3A 5CNNA 3R71A 4AT3A 2W1GA 3BHVA 3WI6A 2UW5A 3DOGA 1PXKA 3PE2A 4PY1A 2X39A 4RJ6A 1XJDA 2GMXA 4FSUA 4JJRA 4MF1A 5KMLA 3PIYA 3GCVA 3TNHA 5JFSA 2X0OA 5L2IA 3AKLA 4ACGA 4BI0A 5EDQA 4BIEA 4B9DA 3QF9A 3PJ2A 3BU3A 5IQFA 2UW0A 4ZSLA 4QTEA 5IQCA 2VWWA 3LFEA 3WYXA 3Q3BA 3KXHA 4JRNA 1JSTA 3TV6A 3KRLA 2Q0BA 5DT4A 4NYEA 5HG5A 3UQGA 3O0GA 1O6LA 2PZPA 3EZRA 3UOLA 2GQRA 1M2PA 2PSQA 2R3RA 3LPBA 1GY3A 2Z7LA 1OPKA 4M84A 5CEKA 3DXQA 2XNEA 4RG0A 4FUXA 5JQ8A 4E73A 1L8TA 2PULA 4RGJA 3NAXA 4FSYA 4LGGA 1UKIA 3R28A 5L2TA 5IMXA 1U54A 3TUCA 5M4UA 2J0JA 4TYGA 3MVLA 4F7JA 2JFMA 4RJ8A 3EYHA 2LGCA 5EW3A 2WFYA 2XK3A 3OW4A 4E6QA 4W4WA 3NMUF 3F9NA 4MK0A 2ONLC 4Q5HA 3O7LD 4EUUA 3O8PA 4U3ZA 4EOMA 3EN4A 5E8WA 3F5PA 3AKJA 4IWDA 4RSSA 3PWDA 5LWNA 5FQDC 2XNMA 3A4PA 3DXPA 2WQMA 2FSMX 4X6QC 3SHEA 4MWIA 1AGWA 4EK5A 1NT2A 3BX5A 3L9NA 3AXWA 3LXPA 4BY9E 4IX5A 4PP7A 1SM2A 1BX6A 3HAVA 1FVTA 3UIXA 5E8ZA 2WHBA 2YITA 1ZY4A 2Y8OA 4KINA 3HL7A 4CKIA 5BQ0A 4FJVA 2XAOA 5HE1A 4APPA 3LFNA 4I6HA 4FSQA 2QOOA 4RC2A 2YM8A 3KXGA 4YJNA 4DH3A 2W1HA 4EK8A 3QRTA 4E26A 5HG8A 3VBTA 3G9LX 4I92A 4FNWA 4KKHA 1ZYSA 3OTVA 3E3BX 3E8CA 3KXMA 3EFLA 3EQHA 4FIEA 3VS0A 5IH5A 5E91A 5M07A 2R3KA 4NM7A 4ENXA 3I6UA 3EZVA 3TUBA 2IW6A 3FPQA 2PVJA 5BNJA 3PFQA 4HCUA 5DRBA 1FPUA 2FH9A 4PV0A 3CXWA 5JMSA 2WQBA 1JBPE 2X6DA 4DFXE 5J5TA 2UZVA 2XIXA 4TWCA 2PU8A 2JKMA 3W2QA 4ZMEA 3PXQA 5JK3A 2CGXA 5K9IA 3ODYX 4PDOA 3VS1A 4AA0A 5IQEA 3OUKA 5FTGA 5HNGA 3LE6A 4L3LA 3FL4A 3Q60A 3NFFB 4NFMA 4BZNA 5IA4A 5FXSA 3R30A 3HKOA 1W7HA 4XG7A 5FGKA 4C61A 3PDTA 1GJOA 5LVLA 2QI8A 1SMHA 3LQ5A 2I1MA 4IAIA 2JITA 1ZOHA 3U8WA 4V04A 3FUPA 2Z60A 4GFGA 3D15A 3ZLYA 2VUWA 2WU6A 3BE2A 4OBPA 4WBBB 2VTOA 3NUYA 4JG7A 3UODA 4O0WA 3TTIA 2X6EA 5HTBA 2QQ7A 4FGBA 4DEIA 2WELA 5A54A 1CKJA 2C6EA 5KCVA 3QLGA 5IF1A 2P2IA 1DI9A 4K9YA 3TTJA 3JS2A 5CAQA 2PE2A 3MBLA 5IEXA 1ZWSA 3P08A 3AC8A 4ONAA 3F2RA 5T68A 5BYLA 1TKIA 4FF8A 1YHSA 2PMNX 3IECA 4O7RA 5DT3A 2W99B 1SVEA 3CE3A 1AD5A 4PQNA 2EU9A 4NW5A 2H6DA 4WIHA 4WNKA 3FYJX 1Q8TA 2OK1A 4L6QA 3D0EA 4DN5A 5ITAA 4QMUA 4XV1A 4E4LA 4JIAA 4ANNA 2O5KA 3DDQA 2FA2A 2JBOA 3QTRA 4C3FA 3LFAA 4KKEA 1YI4A 4F1OA 2IW9A 4GIIA 2WEVA 3O71A 1MRVA 3S1HA 4G3FA 4XNEA 1UWHA 4CMOA 4GIHA 2C5NA 3GT8A 4MVFA 1WAKA 2W1DA 3DTCA 3PSDA 1PW2A 5LJJA 1BL7A 3DXNA 4QMTA 4DC2A 3L9LA 4JIKA 1BL6A 4UZDA 1VJYA 3I60A 5L6OA 2WMQA 1G8AA 3FMNA 4EH7A 4AW5A 2WMRA 5HBHA 5KE0A 4MCVA 5A6OA 5FDXA 2W0JA 5CZHA 1JLUE 4L7SA 4YZDA 3SAYA 1S9JA 3W16A 4CQGA 3U54A 3QQJA 4UMTA 4F9AA 2XAMA 2UV2A 4AFJA 2FUMA 5F20A 5C8MA 3ALNA 4KS7A 1WVYA 4HYHA 5D1JA 3QZGA 4X2GA 3TZ7A 4OUCA 3SQQA 3TV4A 1XMLA 2GNJA 3SG9A 4CG9A 5H8BA 2Z7SA 1YI6A 4FIGA 4KD1A 4N70A 2CMWA 2EWAA 2GFCA 1UVRA 5AP3A 2A2AA 2VO0A 5D7VA 2I0EA 2JEDA 1OITA 5L2QA 2ZDUA 4JAJA 4EHEA 4X2FA 5KNJA 5HGIA 4DFYA 3P7CA 4JQ8A 3C7QA 4J7BA 3CKWA 4K11A 4X0MA 2C6OA 4USEA 1STCE 2PYWA 2CNUA 2NPQA 5KUPA 2BRGA 1BYGA 4C3PA 4E93A 4FG8A 5A14A 5CSHA 4OTPA 4AXCA 4FX3A 2WMTA 4C57A 2JKOA 3PY1A 3F82A 2JKQA 5B2KA 4KKGA 5BVEA 3EQRA 5DGZA 3T9IA 3WIGA 1XBCA 3R02A 5IDPA 1IR3A 2I6LA 4G5PA 5F4NA 3PYYA 3RPVA 1JVPP 4LFIA 3V01A 2PHKA 4LV7A 4WBOA 5IEVA 2GNLA 4BCJA 1WCCA 4GG7A 5DFPA 4WRGA 5BVKA 3V5JA 4DH5A 4TXCA 4D0WA 2PY3A 3MY5A 4ZZMA 2EXCX 2HAKA 3DGKA 5CYIA 5JZNA 4FV9A 5HOAA 4EYMA 2X7FA 4ZLOA 2CKOA 1WBPA 3L1SA 4DG0E 4HZSA 1T46A 2J90A 2XCHA 3H10A 4GUEA 4EK3A 5HVKA 3BRBA 4UV0A 5EYKA 3R7UA 3AKKA 3HV7A 2B9IA 3RNYA 3DFAA 4ZJIA 3RPRA 3U4UA 3PG3A 5AR7A 3G6GA 1P4FA 4FIHA 2WQOA 3AMAA 3Q5ZA 1MUOA 4LUDA 4HVGA 5FLFA 2RL5A 4C35A 2GHMA 1P4OA 4L8MA 2R3FA 4ARKA 4PDYA 4FV5A 3CIKA 3LMHA 1CDKA 4RMZA 2O2UA 1TZDA 2I0YA 1F5QA 2VNYA 4AN3A 1KV1A 3V8SA 3ZCLA 3MY1A 4GH2A 5HIEA 2A19B 4FZ6A 4MD9E 5JH6A 4DDGA 1OL2A 3HLLA 4UYAA 3R9OA 5HNIX 5HESA 3QCQA 4FG7A 3IOPA 1CKPA 3H0ZA 2J2IB 1UU3A 3EFJA 3D7ZA 3TJCA 3SW4A 5BUIA 4DEBA 1JPAA 3W8LA 3NW5A 2BDWA 3GQIA 4IACA 1BKXA 3GCPA 5IA0A 4H1MA 4JT3A 4QMWA 2WTCA 4NIFA 2Z7RA 2OFUA 1YXTA 3ZS5A 1H07A 3VJNA 3MIYA 3NNWA 4XG4A 4AN2A 2VTHA 3R7GA 5J79A 2JAVA 1TFFA 3LJ0A 4WOVA 2RGPA 4RPVA 4D1SA 5E90A 3FMEA 3M1SA 3COKA 4GYGA 4D9TA 2GPHA 2YM6A 4I41A 4BGQA 2V55A 3UOHA 4EC9A 5M51A 4NK9A 4QP9A 2Y4PA 4FRFA 3EN9A 3MY0A 4QP7A 4P5ZA 5HZNA 2YACA 3IG7A 3T8OA 4CFNA 4EOLA 3HV4A 2VWBA 5M06A 3QFVA 4I0SA 4ITJA 4F70A 2PVKA 3TWJA 2BRMA 2Z02A 4YLLA 4MUQA 2VX0A 2JAMA 4FSRA 2UZWE 2XKDA 2ZMDA 3VBXA 4W8DA 1J7IA 1UNGA 1G5SA 2JDVA 4AW1A 2O64A 1NXKA 4BYJA 3BELA 4J53A 1BI7A 4YHFA 3QTZA 2B9FA 4Q9ZA 4O38A 3HGKA 2HXQA 4QMYA 4F99A 4PNKA 3PWYA 2OKRA 3SD0A 1WBVA 3THBA 4BDFA 4FSZA 4WG4A 2X7GA 1ZMVA 3LHJA 4EQMA 5HE0A 4U97A 3HRBA 4GMYA 5TF9A 3SOCA 3BBWA 1JAMA 3FY0A 4U45A 3P5JC 5AIKA 4BDGA 4BR3A 3SDJA 2R3PA 4GS6A 3BLHA 3IO7A 3MH2A 4IAFA 2W7XA 3BIZA 3OWLA 4N0SA 3PJ1A 4NTTA 5GJFA 1OIUA 3C13A 4YO6A 3VUKA 5HTCA 5I0BA 3SGCA 3WZUA 1OBGA 4I6FA 4TYEA 3OW3A 2WIPA 4DEDA 3SLSA 3F3TA 4MXAA 4FKPA 4FR4A 3FZPA 5D9HA 4XRJA 2OBJA 4IADA 5BYYA