4DFZE

Crystal structure of myristoylated k7c catalytic subunit of camp-dependent protein kinase in complex with sp20
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
350
structure length
347
Chain Sequence
GNAAAACKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Role of N-terminal myristylation in the structure and regulation of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 347
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfzE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfzE02
3KREA 2ZMDA 5HBHA 2OG8A 5G6VA 5GINE 4DCAA 4JG6A 1U4DA 2OXDA 3R8LA 3E64A 3FC2A 4ITHA 5GZ8A 4U42A 3OBGA 1YWVA 3ZUTA 3BEGA 3OWPA 2GS2A 4NK9A 5T3QA 3KF4A 4WG5A 2VX1A 5F9EA 2X4ZA 2XCKA 4LYNA 3KRWA 4RPVA 1JKSA 4V0GB 4ANOA 3UPZA 4DEEA 2Y4IC 1GAGA 4Q9SA 1W98A 3F66A 4FX3A 5J9LA 4FKUA 4PMMA 3MTFA 5GJFA 3DV3A 4XX9A 4G3DA 4GT4A 5D41A 2C5OA 2WMWA 4I5HA 5L2QA 2DUVA 3DBFA 3BU5A 1O6LA 4QYFA 5CTPA 4AT4A 4QQCA 1YOMA 3E7OA 3Q9WA 4UV0A 4AGUA 3P7CA 4CG9A 3MFTA 4QQTA 4WT6A 3V5LA 1YHWA 5HE3A 1MP8A 3A7JA 2XM9A 2WU6A 3FYKX 4JG7A 3EFLA 3V01A 3HGKA 3ZFXA 3O7LD 3QA0A 2ZV8A 4EZ3A 3KN5A 4N6YA 5I9ZA 4YLLA 2C6EA 4X3FC 2Y6MA 3RPYA 1H08A 5GZAA 4NL0A 3MS9A 4QP4A 5CQWA 2XK8A 1KSWA 2H34A 3NW6A 5FP6A 3R7EA 4D1XA 5AV1A 3OEFX 2CDZA 2F57A 2R3JA 4C3FA 3DCVA 2EB2A 5TOZA 3GI3A 2Y7JA 4W4WA 4P5QA 5EQYA 4CFNA 2FSTX 3ORZA 4FT5A 5EYMA 1B6CB 3GENA 4EOIA 3BU6A 4FV5A 1H8FA 1ZYCA 2ERZE 3W1FA 4E73A 2GFCA 4Y72A 3AC3A 3SOAA 4JQ7A 1IAJA 4ZS4A 1Y8YA 1JSUA 4DGGA 4FR4A 2BZKB 3P23A 4FKSA 1URWA 2ZV2A 3NDMA 2FSLX 1U5QA 1XJDA 2J90A 2OU7A 4AT3A 5M07A 3OT8A 3DB6A 3U9CA 3GCVA 3Q6WA 3PP1A 3BWFA 5TO8A 3UJGA 4S30A 2RFSA 4I1ZA 3R1SA 5AV3A 4ZJIA 2XUUA 3H10A 1B39A 2J0KA 2P2IA 4BY9E 1VYZA 3BIZA 4RJ6A 4BCNA 1MRYA 2VTOA 2IPXA 1V1KA 3LFFA 4I4EA 1H1QA 5HCXA 4N6ZA 2WELA 3QTIA 4R1YA 4JBPA 4BDIA 4BICA 3D5WA 3WZJA 3OMVA 3A8XA 1KE5A 3A99A 3I60A 1FVTA 5D7VA 3REPA 4A07A 4DEAA 1WVYA 4LOOA 1ZYDA 2R3NA 4MXZA 2YCRA 1PRYA 1UU8A 5A9UA 3AD6A 5LWMA 4FL2A 3QHRA 4QPMA 3SLSA 1JPAA 1URCA 3P86A 4FNXA 4XV1A 2UW9A 4P2KA 2J4ZA 3LJ0A 5HESA 2P55A 1XBAA 3EQRA 4JQ8A 4EORA 3TKHA 2B1PA 4L53A 3W33A 3AQVA 1UU9A 4U80A 5CAUA 3VQHA 3BI6A 4JLCA 1SZMA 3W55A 1ZY4A 3DKFA 4IACA 2FSOX 2JFLA 3D14A 4NTTA 3SX9A 1J91A 1V0PA 4YURA 4EOJA 1QPDA 4RFYA 4FV3A 4RT7A 4DGMA 4LL0A 4O1OA 5FXQA 3W2PA 4EH4A 3VO3A 3SGCA 3HRFA 4FV2A 2ESMA 4J97A 1DM2A 4RC2A 4CKIA 2R7BA 3DK7A 2WTKB 2PPQA 2YJSA 4MQ1A 2E9UA 4QTBA 4B0GA 4UWYA 2ITTA 2UZVA 3RVGA 3VS1A 1W7HA 4CZYB 2JIIA 2OZAB 3LLTA 4D2WA 3DXPA 3VS7A 3AOXA 3QRTA 2PUIA 4R3RA 3QCYA 4GG7A 3FMJA 4GKIA 3D5VA 2BHHA 2VV9A 3C9WA 3S4QA 1LPUA 3EQDA 2OIBA 4XNEA 4XV2A 4CXAA 2PE0A 5DMZA 2NNWB 2WIHA 3IDPA 4B8MA 4ARKA 3NR9A 4FKGA 3PYYA 4G17A 2CGVA 4R3CA 4YC3A 2PVJA 2BUJA 3FKNA 3VW6A 2XKDA 3BLQA 4WOVA 4D58A 5AR3A 1YXTA 2QR8A 2QC6A 4ITJA 4AWIA 4IIRA 3TJCA 3R2YA 3BYSA 3FL4A 3OP5A 1E1VA 3BHTA 4GJ2A 1NVQA 2OI4X 4AUAA 2QODA 4MXOA 3SXRA 1G8SA 1SMHA 5HBEA 4O96A 4ZIMA 3U6IA 1APME 2BKKA 3HA8A 5DRBA 2JIUA 3PJ8A 1XKKA 4ASXA 2JFMA 4WRSA 4CFFA 1H01A 1PHKA 2XVDA 1XBCA 4OT6A 4JJRA 3MPMA 2QO9A 4FMQA 5HTBA 1BLXA 4EJ7A 4X2JA 3IOKA 1B38A 3DGKA 4QYYA 4OAVB 3N9XA 1V0BA 1CKIA 3CY3A 4I6QA 1LEZA 4MF0A 4IZYA 3HMPA 4EKKA 3OW4A 4M14A 4KSQA 5C8NA 4YHFA 1MUOA 4K1BA 1YHVA 2EU9A 1CKPA 3A2CA 3B2WA 1WBOA 3C4ZA 3WF5A 4X3FA 2JKQA 2OXXA 2WMVA 4I93A 5K9IA 1MQ4A 3E63A 3RK7A 3FQHA 5IKWA 4DT9A 4Z7GA 2UZUE 3FHRA 2X39A 2B52A 2W1EA 4FV0A 5FG8A 5J5TA 2JDRA 2QOKA 3UMXA 2HOGA 2XM8A 2YJRA 3DJ6A 4L01A 3ZOSA 2P3GX 3OXIA 1KE9A 4LGDA 4DGOA 3E8CA 1M14A 4XG6A 3BRBA 5EH0A 2I6LA 3H9FA 4HCVA 5G1XA 4O83A 5BQ0A 3BGPA 4HGEA 3UVQA 2C0TA 3HYHA 3R2BA 4TNDA 3OVVA 4FUXA 2CN8A 4YJQA 1JSTA 3LQ3A 2PVMA 3WOWA 2RFDA 4BRXA 3PZEA 4RSSA 1Q99A 2PVFA 1OBGA 4W8DA 3KXZA 3PP0A 5EHOA 4QP9A 3WZKA 4CYIA 3VUMA 3SXSA 2V7AA 4TN6A 2RFNA 4RQVA 5FM3A 4O86A 3D7ZA 5BYYA 2REIA 4FK3A 3VHKA 2UW6A 4X0MA 1H25A 5HNIX 3CC6A 5DG5A 1Y6BA 1KE7A 2VTRA 4IAFA 1R39A 3KB7A 1GZ8A 3QYZA 5AIRA 1P14A 4M97A 4WKQA 2V0DA 3COMA 4D9TA 3QZGA 4OTGA 2O2UA 2PULA 3QX2A 3UNZA 3RALA 2BVAA 4AZFA 5EHLA 4DEIA 4QTEA 2PUNA 5IMEA 5KMLA 1Y6AA 2WTCA 3GFEA 3LJ1A 3PRIA 3QLFA 4G3FA 4RWKA 1WBWA 3ZUVA 4TY1A 1OKYA 3C5IA 5IQFA 2Z60A 5BMSA 3TKUA 4FIJA 4FTJA 5GIPE 2HIWA 4E4XA 4F99A 1Q8WA 2VGPA 3UP7A 4FZDB 4CVAA 5JZJA 5EM7A 4BZDA 3V04A 2X2KA 3RM6A 3F3WA 3OOGA 4BDGA 4R77A 4KD1A 5JRSA 4IJPA 4BGQA 4CCUA 1JOWB 5A4EA 4C38A 3EN6A 2WTDA 1R0PA 2V5QA 3CY2A 3CEKA 3KXMA 3ZSHA 5AUYA 4HYSA 3MYGA 5M09A 4RIYB 5CENA 3R7VA 4PDOA 2OJFE 2WZJA 3R8ZA 3NW5A 4APCA 4RJ7A 2IW6A 4FV1A 3U6JA 5IQCA 4FODA 4ZY6A 3V51A 4ZTHA 4UALA 1V0OA 5E90A 4C02A 3VHEA 2BROA 4NJ3A 4NW5A 5KX8A 4DFBA 3E8NA 3LXLA 2QO2A 4WD5A 3W8LA 3FMMA 5JFWA 4QT1A 3Q6UA 4K2RA 3UG1A 5BNJA 5L2WA 4QYEA 4NYEA 5AAFA 1YVJA 4NM3A 3DOGA 1KOAA 4FT0A 5JFVA 2SRCA 1OPLA 2BTRA 2ZB1A 1UNLA 3HV5A 1XH6A 3MSSA 4HVGA 4O7VA 4MBIA 1YXXA 3A4OX 3QWJA 2VO0A 4LM5A 4CZTA 3FY2A 4F1MA 3QQLA 4C3RA 2EB3A 4UZDA 4CYJA 3RMFA 4FIFA 1NY3A 3DNEA 4LOQA 1MQBA 2A4LA 4FVPA 4D55A 4DG2E 4I41A 3TUCA 4I0TA 3MESA 2PWLA 2W1CA 3FMEA 2JDTA 4AW0A 2XNGA 3F7WA 5IISA 4FKJA 2Y6OA 1ZMVA 2R9SA 3BYMA 5D7AA 3A7GA 4E6QA 2YZAA 3TG1A 3FZ1A 3ZMMA 3TZ9A 3TV7A 1OZ1A 3NNUA 4PDSA 4R7BA 4EI4A 4LG4A 4GW8A 4RQKA 3FXXA 4BI2A 2VTTA 4ORKA 4CTCA 1GOLA 1QPEA 3GOPA 3QD0A 2XF0A 4YJSA 4YGAA 5E8YA 5E1SA 3DJ7A 2XS0A 5HVJA 4YUQA 3V8WA 3SOCA 2FO0A 4ACHA 4F9YA 5CU4A 2C6KA 5ETCA 5KMOA 3AG9A 3R9HA 5B7VA 3F2RA 4QNAA 2XRWA 2PMNX 3FZRA 3RP9A 3WILA 4MQ2A 5CXZA 4BCQA 2C68A 5IH4A 3NVKI 4IVCA 3W8QA 3A7IA 5JGDA 3GU6A 4A4OA 5JSMA 4BKJA 5LMKA 3A7HA 3LVPA 4BGGA 3WF6A 4HVDA 4KS8A 3SD0A 4R3PA 4EZ5A 4IJ9A 4IZ7A 5DR6A 5HKMA 5CZHA 1S9JA 2R0UA 4HNFA 3U6HA 5TR6A 3PXFA 5FTQA 4G31A 4X3JA 4F7NA 2RF9A 3FI3A 3P1AA 5EKNA 2OF4A 4WBBB 2OZOA 3E8EA 5AP4A 4AF3A 3I5ZA 1BL7A 4I6BA 4PNKA 2EXEA 3MVHA 4XBUA 3TNWA 4CSVA 5I3RA 3NWWA 4ZTNA 5LWNA 3RBWA 3BZ3A 4OLIA 1SNUA 2BFYA 3HDNA 2WTIA 3LFSA 1PXLA 2OH0E 2XKFA 4KB8A 4N0SA 4QMNA 2WOTA 3EMGA 4EONA 1SVGA 2XIKA 3KL8A 2BIYA 2JKKA 4O6LA 3DS6A 2PMIA 4FSQA 2ZVAA 4JDIA 4P90A 2UZEA 3FSKA 5LVMA 3GQLA 3HV6A 3SC1A 2B9IA 2F7EE 4BTFA 2OLCA 3RAKA 3A60A 3G33A 1QPCA 1K9AA 5DNRA 1O6YA 2ITVA 4FTRA 1A48A 1R1WA 3MFRA 4KUJA 1BI7A 2DYLA 3EQIA 3FUPA 5CSXA 2C5VA 3C51A 5HE0A 5KMMA 3RINA 1CM8A 3NNWA 2CN5A 4M13A 3L9LA 5CSVA 4BWKA 4O0XA 2YIXA 4J8MA 1IAHA 1BI8A 5AA8A 3FKOA 4KNBA 4RX7A 4XH6A 3KXGA 2W1ZA 5JN2A 4Y5QA 2XEZA 5CASA 2CNQA 5HG7A 5CAOA 2ITUA 3NYXA 4L42A 4F09A 2B53A 3SHEA 1PXPA 5I3OA 2E9OA 2O5KA 5AP3A 3NLBA 1WBVA 3QTXA 4ZZMA 3FPQA 3VUKA 1ND4A 3DK3A 3UPXA 5FRIA 1ZWSA 3FV8A 3KU2A 3UP2A 3MY1A 4G9RA 4EOLA 1PXKA 4UEUA 2UV2A 2UVYA 5DOSA 1H0VA 4TXCA 3RM7A 3OTUA 4R5SA 2AC5A 1NA7A 3G51A 4GKHA 3MVLA 3PUPA 4GK4A 4PL5A 3HLLA 3Q5IA 4II5A 5FBNC 3P5KA 2ZOQA 3HZTA 2CCHA 4QP2A 5E1EA 4DA5A 4Z55A 4MBJA 5EW9A 4Y85A 3PXKA 1CSNA 4U41A 5KKRC 2CLQA 3Q60A 3HMMA 5BVEA 4B9DA 3HUBA 4O0YA 5IH5A 4CGAA 5CEOA 3G5DA 4E5WA 2PK9A 3FLQA 3D2IA 3BE2A 1SVHA 4I94A 3PG3A 3R6XA 2W06A 3IO7A 4GK3A 4GYGA 4JL9A 1TKIA 3PA3A 4OTWA 3R0TA 2VTAA 5FTOA 4OTPA 1U59A 5J9ZA 3UNJA 2R3RA 3EH9A 4ZS0A 3QZIA 3VC4A 1SVEA 5M53A 4TYEA 4CNHA 5BUIA 3QRUA 2VNYA 1ZRZA 2WMBA 3IPHA 3KGAA 3QRKA 3PPKA 4HYHA 3ULIA 5JK3A 3QQUA 5A4CA 1IEPA 4IBMA 2ITZA 4BL1A 2PY3A 4EH8A 1OI9A 5LJJA 3OWLA 3GU7A 4DBXA 4M69B 2WMSA 3LFDA 3OFMA 5C01A 4RJ5A 4V05A 3DLSA 4C4EA 2G2HA 2Z7LA 4NSTA 2ZM4A 5DI1A 5CQUA 2XKCA 2UW7A 3LFQA 3DKGA 4F6UA 5HU3A 2ONLC 4GCJA 2QKWB 2XK7A 3EN9A 5AP5A 2VRXA 4I24A 4JBQA 5CZIA 4CD0A 3WZEA 4XUFA 5C27A 4CLJA 5M51A 4L6QA 5IA4A 3PIZA 3RJCA 4A06A 4UMRA 3Q4CA 4EH5A 3CSVA 3AC8A 3LMIA 4WHZA 2JKOA 5ANDA 3QAME 3RAHA 4QMWA 2NRUA 3K5UA 4YZ9A 4IHPA 3JVSA 4EUTA 3FI2A 3W10A 4O38A 1IR3A 3EL8A 4O7NA 2UW0A 3M1SA 4L7SA 5EI8A 3OY3A 4BCIA 2RIOA 3VW8A 4RX5A 2J0IA 2C3IB 1WFCA 2HXLA 4MAOA 4NFNA 3ULZA 4DGLC 2C0IA 1KOBA 2HY0A 3MJ1A 3IW7A 5E8WA 4TYHB 5K5NA 5LVLA 4AG8A 3OUNB 2VWVA 2GS6A 3PXRA 2OBJA 5HU9A 1REJA 3NCGA 3QL8A 3QQFA 3R1YA 1FGKA 2W99B 2W9FB 3M2WA 4IDVA 4RVKA 5IZFA 2O3PA 4YPSA 2A27A 5K4IA 4D5KA 4LMNA 4HOKA 5ICPA 2WEVA 4YO4A 5HO7A 4FEXA 4IFCA 2B9HA 2W5BA 2YAKA 4IX6A 4YJRA 5C8KA 1R78A 2VWBA 3ZCLA 3LAUA 4D4YA 5DEYA 2RFEA 3AT3A 2BIKB 5CALA 1K2PA 4QP1A 3R83A 3OC1A 4C35A 5BMMA 3UYSA 4IWDA 2R5TA 3BHUA 4XP0A 4XYFA 4YLJA 4QTAA 3EL7A 4BZNA 3HAMA 2IVTA 4G3CA 5BYZA 5EM5A 3ZYAA 4K18A 2W4OA 4AOJA 3PWDA 1TQIA 4LI5A 4EJNA 4L3LA 2R64A 1YRPA 3G0FA 3LJ2A 4JAJA 4BC6A 3IW5A 5ETFA 3FZPA 4L68A 5AUUA 3R8PA 5HTCA 1J7LA 1QCFA 4K6ZA 1JKTA 1WAKA 3SQQA 4CG8A 2WD1A 3ZRLA 4IAZA 3UODA 4LRJA 2UW5A 4O7RA 1YOJA 3R7OA 4FSRA 4BCOA 3ACKA 2G01A 4NT4A 4FOBA 3KMUA 3MA6A 3PE1A 5M4UA 3QQGA 1RQQA 3QD2B 2X9EA 1BX6A 1G5SA 1UU3A 3DY7A 2ZMCA 3HV7A 4HPTE 4BI0A 3LMHA 4F4PA 3FLSA 3I0QA 4M66A 4C34A 1J1CA 2X8EA 4YJVA 3U4UA 1JQHA 1Q3WA 4HCUA 3RGFA 2PMOX 3UQCA 1OB3A 2BALA 2XZSA 4DINA 4I5PA 3F3ZA 4C61A 1VR2A 3BU3A 2QO7A 3ALOA 4W4VA 4EZ7A 4YJUA 3V5WA 1NXKA 3ALNA 4S33A 3E88A 2VTHA 4YSMA 1OBDA 4GS6A 4MNFA 4FOCA 3SRVA 3VNTA 5LXMA 1Y91A 2VWZA 2JDSA 4KSPA 1GY3A 4K77A 4CT1A 1GJOA 1OM1A 4Z9LA 5C9CA 4RIXA 4YC8A 3R63A 4CTBA 5I9WA 3D4QA 3ET7A 5K4JA 3KXHA 4ZSEA 4BCJA 3F2NA 3GFWA 2ITNA 3DLZA 5DLSA 3MVJA 5M55A 1LUFA 4LGHA 4QMYA 5TT7A 3UIUA 4FGBA 3ACJA 4RWIA 4TWPA 1REKA 2VTNA 2QKRA 4FSZA 5ACKA 2R3MA 4PPAA 3F3VA 3ZM4A 2B7AA 1PY5A 3I4BA 1AQ1A 4BIEA 4RMZA 4UY9A 4RGJA 1OL1A 2WEIA 4GJ3A 3B2TA 1Q61A 3TCPA 4GEOA 4YZNA 4EEVA 1OIUA 3ORLA 4IAIA 3HA6A 4JXFA 3MJ2A 4FV8A 4A9SA 5JGAA 3MA3A 3I6UA 4G9CA 3OY1A 3O51A 4IC8A 1TQMA 5CSHA 4KIQA 3TN8A 4CRLA 5J8IA 5DT4A 5HNBA 4JOAA 2XBAA 5CI6A 1ZOHA 5AR8A 3K3IA 3LHJA 4RLLA 4DF3A 4FTIA 1PXJA 4I3ZA 3VN9A 4FG7A 2XK9A 4CFUA 2XB7A 4BWPA 4FV7A 5BPYA 4FKOA 4RLKA 5IEXA 3K2LA 2A0CX 4FNWA 4JNWA 3R7YA 3CPBA 3E5AA 3R28A 4KBKA 4H3QA 3WYXA 2WMXA 4AW1A 4FK6A 3ORMA 5H8EA 4WRGA 2KULA 2YIWA 4FEWA 3I7CA 4D0XA 4R78A 3GU5A 3NZ0A 4C4GA 2ITPA 3BE9A 3NIEA 4YMJA 5CEKA 3HKOA 3D5XA 3HNGA 2W1IA 2ACXA 3V5QA 2CHLA 2WQOA 3I0OA 4GL9A 5CEIA 4ZP5A 4N70A 3KULA 2ZYBA 2Q0NA 1KV2A 3ODYX 4UZHA 1UWHA 2X2MA 1VEBA 2VTMA 5I4NA 3EZRA 5HOAA 1U46A 3I81A 3FLZA 4ONAA 4R1VA 1P5EA 3EN5A 3FDNA 1I44A 3PWYA 5TF9A 3LKMA 3QRJA 1OGUA 2ETMA 4JS8A 2YZLA 5IEVA 5B2LA 5CVGA 3LFEA 3GC8A 4FSYA 3ZSIA 1J3HA 2Y8OA 3TJDA 5HX6A 4NUSA 2I1MA 1MRUA 1YXUA 5JZNA 2X7FA 3TWJA 2LGCA 4WIHA 5JGBA 4DEGA 4IVDA 4GVAA 4DEBA 5I9VA 4K9YA 3FPMA 4PMPA 2X8DA 5DT0A 3LFBA 5J95A 3QCXA 3CR0A 3KK8A 2J2IB 3BLRA 3OEZA 1OIRA 4ZJJA 4RZVA 5BYLA 1G3NA 3C7QA 4S2ZA 1G8AA 4U79A 3BWJA 5IH6A 2IG7A 2PZYA 4GK2A 5CY3A 1LEWA 4C2WA 4IQ6A 4JIAA 1KV1A 3HAVA 1UKHA 4FYNA 3CP9A 5AR2A 3RWPA 3ID6C 4U3ZA 1UVRA 3PVWA 5CWZA 5LQFA 5ANIA 3DZQA 5DH3A 3NNVA 3QC4A 4HVIA 3LQ5A 2OGVA 3R02A 3F61A 5EK7A 4J99A 2C1AA 5DR2A 5IU2A 5KMNA 3FJQE 2BCJA 3CKWA 1PF8A 3H9RA 4IX4A 4AW2A 1NVRA 2WTKC 3CKXA 3NCZA 3HX4A 4HCTA 4HYIA 2X81A 1OPKA 4BIBA 1SYKA 4AFEA 2C6OA 4DN5A 2G9XA 4F7SA 4F65A 2IN6A 4F9CA 3FQSA 1K3AA 3H3CA 4I6FA 2WTJA 4WBOA 3MIAA 4KKHA 2J51A 4BKYA 1VYWA 2PVHA 2C3LA 2HYYA 4WG3A 1WZYA 3U4WA 4QNYA 5HEZA 3ZONA 1DI8A 2RG6A 3Q5ZA 5ANOA 3DZOA 4JRVA 4QMLA 1XH8A 4RJ8A 1YOLA 2Z7QA 1P4FA 5B2MA 2PHKA 3QTZA 2QVSE 3NUXA 3OROA 2BKZA 3ELJA 3QA8A 4GIHA 1XBBA 3HP2A 4KINA 3QF9A 3IKAA 4XG7A 4CFWA 4U8ZA 2QLQA 5HE2A 5JQ5A 1RW8A 5E9EA 2C6DA 3FL5A 4MXYA 5IQIA 4ANLA 3U54A 4KS7A 5E91A 3Q4UA 3NYNA 4F64A 4JQEA 1IA9A 2BMCA 4A9RA 3BEAA 2GNIA 3F9NA 5H9BA 4EBVA 4QYHA 4C4HA 2R3OA 3QXPA 1PMNA 3Q2MA 3ZTXA 5K5XA 3O96A 2QOFA 5AP7A 3KK9A 5GIOE 2OK1A 2XJ2A 1GZKA 2B54A 5EYDA 4C8BA 4FT9A 2GQSA 2B0QA 1Z5MA 4FKQA 5EM6A 2ETKA 2X6DA 3ZZEA 3VULA 4E4MA 2YAAA 3EJ1A 4ERKA 2OXYA 3R8VA 4L7FA 2HELA 1W84A 3KC3A 4HVSA 4L46A 3E93A 3SVVA 5FD2A 4H3BA 5D12A 3A8WA 3TEIA 2IJMA 4AZSA 2YIRA 4DTKA 4ZZOA 5H2UA 1OL2A 2XEYA 5CEQA 3ODZX 2YM3A 2E9NA 3O50A 4FYOA 4BDBA 3PA4A 5D1JA 5HE1A 3VS5A 4D1SA 4J96A 4O6EA 4IXPA 4JIKA 3ROYA 3BPRA 5HO8A 5I9YA 3PIXA 4O0TA 4Y73A 1BMKA 3ORKA 1H28A 4FZ6A 2Y9QA 4NKSA 4UMTA 1U54B 3UIXA 3FZOA 3FE3A 4EWHA 4BCGA 3VF8A 3R9DA 3F6XA 1UA2A 3BV2A 3LCSA 4FL1A 4IVBA 3ZH8A 2XP2A 3DA6A 4U81A 3VUIA 3NAYA 4UMQA 3SAYA 3R1NA 2GCDA 4CFMA 3BQCA 2R3KA 5FTGA 4YTIA 1GZOA 2J5FA 2JBOA 1CTPE 5CS6A 4ZOGA 5IA3A 5DA3A 2R3LA 2WU7A 3AC4A 3OCTA 5T6KA 2UZDA 3OF0A 4WA9A 2Q83A 3AXWA 1YW2A 4ZLZA 3EKNA 3AMBA 5IA1A 2XIRA 2NO3A 4KABA 3D2KA 3PLSA 2R3HA 5HBJA 4OR5A 5CAVA 5AUXA 4ZSLA 3KEXA 5KUPA 3E3BX 4JAIA 3P79A 3C5UA 2J5EA 2JAVA 4FKWA 4LRKA 1EH4A 5CT7A 1AD5A 1PXOA 3D83A 4MXAA 3NVMB 3AMAA 1QMZA 2BR1A 2VNWA 5HQ0A 4F0FA 2W17A 3FMNA 2QG5A 1XR1A 2BRHA 3IOPA 3VS6A 2QG7A 5EI2A 3UOKA 3GQIA 3ZEWA 4ZAUA 1WBSA 3JY0A 4XJ0A 2QCSA 1J7IA 4RIWB 1YDRE 2J9MA 4GFOA 3JY9A 4OTRA 5AR5A 4F0GA 3DU8A 3FKLA 4DYMA 4EOPA 3Q32A 4AN3A 1ZLTA 2GU8A 4RVTA 4EYMA 4FTTA 4WO5A 4E6CA 1OKVA 3OZ6A 5C03A 4B7TA 5KMJA 5J7BA 3GXLA 4G3EA 3R30A 3VUHA 4F08A 4O81A 1JLUE 4JT3A 4LL5A 4UMUA 3SW7A 3Q53A 2CKOA 3WIKA 4K11A 4WNOA 5AX3A 1CKJA 4TT7A 4BYIA 2E9PA 2GSFA 3EWHA 4QD6A 5CU0A 3TNIA 4C3PA 4O0RA 1FVVA 4DH7A 3QQKA 1TVOA 4L3PA 5AUVA 3L9NA 3FI4A 3VBQA 3V5PA 1H27A 3NUNA 3QKKA 3T8OA 4A9UA 5EOBA 4AACA 4O91A 4XG4A 2UW3A 4WUAA 5BUEA 3TDWA 2OZAA 1PYXA 3MB7A 2XK4A 4GUBA 4KKEA 1JBPE 4FKTA 4L67A 4OBPA 4DFNA 4IH8A 4XG9A 4FIGA 2E9VA 3KRRA 5E8VA 3SG8A 4GU6A 1Q4LA 4OTFA 4AOIA 3LOKA 3ZEPA 1IA8A 2QOBA 2RKUA 3DJ5A 3WARA 4ID7A 4K8AA 4ACCA 3PJCA 4KIKA 3VIDA 3SG9A 3G2FA 3R8UA 2OWBA 3TUBA 4AGWA 2PZIA 1PXNA 5JFSA 4ACDA 4M7IA 1OUKA 4C62A 4IZAA 1W83A 2GTMA 4QMMA 3CE3A 2YWVA 1OUYA 4FSNA 4M8TA 2XNPA 2I0HA 3ERKA 5ITAA 4LV5A 4D1ZA 3ATTA 4PDYA 3RPVA 4O27B 3RZFA 3OT3A 1A06A 3O2MA 4QMUA 2C1BA 2PZRA 4RFZA 4BCMA 2W1GA 2XIXA 4EHZA 1UNHA 4O21A 3OCSA 4PPBA 3PZHA 3U87A 5HHWA 3FMHA 2ZAZA 3AC5A 3FC1X 3N51A 4PUZA 5FEDA 4G3GA 1PW2A 4BDAA 1PMUA 4DC2A 5IF1A 3KF7A 3FMLA 5E7RA 4E20A 4PPCA 1OKZA 4PX6A 1A9UA 4G1WA 1Y8GA 3MBLA 5DGZA 1YI6A 2Q0BA 3ANRA 1Q62A 2X4FA 3Q52A 4O7SA 4FGRA 3MFUA 2F49A 3GP0A 2BTSA 4FUYA 4OTIA 3UG2A 4OTDA 4YBKA 2OH4A 4AZTA 1ATPE 5AAEA 2OJGA 3KY2A 3MN3A 5DIAA 2UZBA 4MHAA 3ENMA 3PJ3A 5AUTA 3WZDA 5LMAA 3BHYA 3R73A 1OIYA 3NUPA 1RDQE 4UWBA 3TZ7A 2YDKA 3PDTA 1T46A 1W82A 4QYGA 1J1BA 5ETAA 4IC7A 3OUKA 4U43A 3CQWA 2IW8A 4O7YA 2DS1A 2PVYA 3DQWA 4UWCA 2OSCA 1H0WA 2WO6A 2XA4A 2WAJA 4DFLA 5IUIA 4YJPA 3TT0A 4O0SA 2DQ7X 2WB8A 3BGQA 1KE8A 3HMIA 4J52A 4L9IA 2FVDA 4BKZA 3DXQA 1Q5KA 4AA0A 4AZVA 3BYOA 4D0WA 2ZDUA 5ETIA 4HGSA 1O9UA 1PKGA 3FXZA 4R7IA 3OWKA 1QL6A 3GT8A 2PL0A 5JH6A 3EQPA 3NYVA 3S00A 3WF9A 3QTQA 2IZUA 3VUGA 3E62A 1FINA 4RJ4A 1Z57A 4O0UA 4Y95A 3VS0A 3GB2A 4J1RA 4U97A 1JVPP 3LZBA 4C33A 4EQCA 2V22A 2XH5A 3EB0A 3L8XA 3TZMA 5JT2A 2YM4A 3QUEA 2QR7A 3AD4A 4FIIA 4QP6A 4PP7A 1H1WA 2CCIA 4RVMA 4IVAA 5HLNA 1ZMUA 3CD8A 1ZXEA 3UO4A 3UVRA 3WIGA 3ORTA 5C4LA 2BRGA 4TW9A 5LVPA 2FA2A 2FUMA 4ZEGA 3OW3A 4ENYA 2QHNA 2BAQA 4NEUA 3O8TA 2C30A 4QP8A 4APPA 3P7AA 1PJKA 2FYSA 3W2SA 2R3PA 3OS3A 5EHYA 5I0BA 4GFMA 5E8SA 3QZHA 2FSMX 4RVLA 4ACGA 4EOQA 4BBFA 2OFUA 4TNBA 2GMXA 4KBAA 2XMYA 3LXKA 2HW6A 4KIPA 4AQCA 3CCNA 4IAKA 5FUTA 3Q4TA 1LP4A 4RIYA 2GQGA 3LFNA 4ANNA 5IQDA 1JAMA 3FQEA 3ZC5A 5CX9A 2UZOA 1MRVA 4Q5HA 2P4IA 1JKLA 4W9XA 2HCKA 1I09A 4UN0C 3VQUA 4Y46A 5AP1A 4IWPA 3GUBA 3IW8A 4BHZA 3OBJA 4CRSA 4E6AA 3FLWA 4QQJA 4IW0A 4L43A 2F7ZE 4D4SA 3IDCA 3PJ2A 1M7QA 2HWOA 2PE1A 4ACMA 4DHFA 4BDKA 2W0JA 4TWCA 3G6HA 1UNGA 3TI1A 4ALWA 3QCQA 4MD9E 2EVAA 5ANGA 3KFAA 2G2FA 3MGYA 3L8PA 3QZFA 4RC3A 3T9TA 4MCVA 3F69A 4ERWA 3D94A 5GJGA 5TE0A 4FG8A 3N4VA 2R3QA 4MYGA 5HGIA 4ANMA 4FKIA 2CKEA 3ENHA 3LLAA 5CSPA 4IZ5A 2J50A 3MDYA 5L6OA 2BZIB 5FEEA 4AX8A 5BVOA 4F7LA 4RWLA 3KMMA 1XH5A 2X8IA 4PRJA 4YZMA 3WE4A 4NM5A 5AJQA 2VX3A 2JEDA 2B55A 4YTCA 4UB7A 1YQJA 2Z8CA 5FLFA 3W16A 5IDPA 3BGZA 3POOA 2P33A 4FTOA 2H8HA 3OCGA 4RWJA 3WBLA 2WQMA 2X2LA 4FBXA 5HCZA 3C4XA 5GJDA 3GC0A 5CU6A 5E8XA 4C57A 5TKDA 3GCSA 3Q9XA 3W32A 2QOOA 3RWQA 4AXAA 2UW8A 2XCHA 4ZSJA 2W5HA 3PSDA 4C37A 3A61A 5EG3A 2B9FA 5CU2A 4IB1A 3LCTA 4AW5A 2C0OA 4X2GA 1XO2B 4NM7A 4YNEA 5KMKA 4JDJA 4MK0A 3NUYA 3IECA 5DT3A 1Y57A 4X2KA 5EI6A 2GPHA 5JKGA 4PTGA 1E1XA 2C5YA 2F4JA 3OTVA 4DEHA 3QD4A 2ERKA 3CXWA 5EW8A 2B4SB 3PY0A 5IG1A 4MH7A 3Q3BA 5H8GA 3ORIA 2VWUA 4XRLA 5CVHA 4HW7A 1PMVA 4PV0A 2X6EA 4GRBA 3LFCA 5EW3A 3ZDUA 4QPSA 4HZSA 4MWHA 3ZLWA 3MWUA 3PVGA 4YJTA 3DKCA 3TKIA 3AD5A 3SRVB 5B2KA 4V01A 2QURA 2WGJA 4FTAA 2P2HA 4NJDA 2VX0A 4WSQA 3DFCB 4B6LA 2I0YA 2WHBA 3MPAA 4MXCA 2C6LA 2Z2WA 4PWNA 4PTEA 4RIXB 5DBXA 3D7TA 5A4LA 2R0IA 5KO1A 4TKSA 3RCJA 1AGWA 1YI3A 2F2UA 2HENA 2C6MA 2RGPA 4NM0A 5CSWA 2EWAA 2C69A 1ZYSA 3NYOA 3THBA 1SNXA 5LVOA 3TZ8A 4HGLA 2QOHA 1ZYLA 3ANQA 5CF4A 2FB8A 3R8MA 2PTKA 2WNTA 3B8QA 4O7LA 2QLUA 4DE4A 3QWKA 4KA3A 5M08A 5BUJA 5AUZA 3CJGA 4L3JA 3UNKA 3MH0A 3W2CA 2UZWE 3Q96A 4I0SA 4O7ZA 4M67A 4U9AA 2IO6A 3B8RA 3CJFA 2C3KA 3TNHA 1L8TA 5L6WL 4EK4A 5CF8A 4BR3A 3COHA 1T45A 1IASA 2YCQA 4CFXA 4FIHA 5A46A 2YWPA 3EQBA 4PQNA 3MFSA 2A1AB 5L2IA 2B9JA 3QUDA 4PNIA 1OL5A 2VGOA 2HZ4A 3EFWA 4CQEA 2VO3A 2JKMA 3UBDA 3WYYA 4WNPA 5JMSA 5A4QA 4A4XA 3PXQA 1CDKA 4FVQA 5JRQA 4M12A 2YABA 3L9PA 1GIIA 2YIQA 5EDQA 4LUDA 4DH3A 3DDQA 4QOXA 4ZSGA 4GG5A 4BGHA 5FQDC 2VTQA 3R9OA 4EC8A 5IQAA 3P7BA 2PMLX 2CJMA 3ZRKA 4CCBA 3ZS5A 4N57A 3FMDA 4EOMA 4I4FA 4FEUA 3RPSA 5LMBA 4EH9A 4E1ZA 5CAQA 1WBTA 4O1PA 3RK5A 4EH3A 2YCFA 4D4RA 4XRJA 2C6IA 2YISA 2F2CB 3JS2A 3FBVA 4FICA 3LCDA 1GIJA 4H1JA 4TWOA 4DG0E 2BDWA 2WKMA 4D4VA 1E9HA 4QMZA 3UGCA 3SA0A 4EOOA 1GIHA 3DQXA 4BI1A 5ANKA 4IMYA 5IA5A 2ZJWA 4RA4A 3JYAA 5CLPA 2CPKE 1F5QA 5AIKA 5FXSA 3LPBA 5F20A 2PVKA 3UTOA 4DT8A 2OFVA 5ACBC 2JAMA 4H1MA 2ZM3A 3ZO1A 3ORNA 5F94A 5HD7A 5KHWA 2YDIA 5AM6A 4JR3A 5I9XA 1LR4A 3H0YA 1UWJA 4KKGA 1NT2A 5E8UA 3PPJA 3UYTA 3VJNA 5AR4A 3H4JA 4BDJA 5L2SA 4QMXA 2UZNA 1XHAA 1M52A 4R5YA 3V8TA 1XH7A 5L8LA 4K33A 1H4LA 4XEYA 1BYGA 1HCKA 4M69A 3UDBA 4DLIA 4O2PA 3F5XA 3D9VA 4M0ZA 4C58A 2OO8X 5FEQA 3ZFMA 1WVXA 1DAWA 5M4IA 2HZNA 1P2AA 3QYWA 5AR7A 3UOJA 5CNNA 3KVXA 4E5BA 3F5PA 4QRCA 4FV6A 3QC9A 4ALVA 4NH1A 3LE6A 3RPRA 4MBLA 3A7FA 5BVWA 3QTUA 4EHEA 3UO5A 1VJYA 1OVEA 4G5JA 4USDA 1GZNA 2BZJA 5L2TA 4QTCA 4CV9A 4FKRA 4NIFA 1BL6A 2BRNA 2WMAA 3U8WA 1JWHA 3OXTA 2W1HA 4F6WA 3EYGA 2PSQA 4CMUA 1OMWA 1YI4A 3OHTA 2GNGA 3BLHA 4DTAA 3GC7A 3TNPC 3H30A 2YIYA 3CLYA 3K5VA 2ONLA 3HRBA 4UYAA 3RZBA 3OWJA 4YTHA 2GTNA 4JDHA 4E6DA 4RIOA 1IG1A 5D9HA 5IPJA 3COKA 3S95A 3UC4A 4B99A 1J7UA 4ZZNA 5F1ZA 4W8EA 4U6RA 5D11A 3VS3A 4AZWA 5KCVA 5L4QA 4TL0A 3TV6A 2XNOA 3ZO4A 4D28A 3TTJA 3A4PA 3MI9A 1M2RA 2GNJA 3GGFA 3JPVA 1S9IA 3V6RA 2AYPA 4U40A 4GFGA 3MPTA 4M3QA 5FGKA 2R3GA 4QMOA 2WFYA 3OCBA 3DAJA 3ZBFA 4XG3A 2QOIA 4BFMA 5HX8A 5A6OA 4YHJA 5AMNA 4EH6A 2R4BA 4M15A 2XIZA 4F63A 4IM0A 2HWPA 3S3IA 3UE4A 5IUGA 3C4WA 5KE0A 4C7TA 2YN8A 4XOYA 2RL5A 4NFMA 3PVUA 4BDEA 2PE2A 4E7WA 2GNFA 1WBPA 4IB0A 4XV3A 5LOHA 2QOQA 3IW6A 3R00A 3R7GA 4J8NA 4LMUA 3DAKA 3H0ZA 4S34A 5DVRA 4BYJA 2QU5A 4BDHA 4C4JA 1VZOA 3O17A 4EOKA 3KCKA 4EK8A 1H1SA 3E7VA 5HG8A 3F3UA 4IEBA 4Q5EA 1DS5A 2RG5A 3O0GA 3E87A 2VAGA 2X7OA 3VAPA 3CGFA 3VBYA 2NPQA 5AEPA 2JD5A 3V5JA 4MKCA 4NTSA 5AP6A 4F1TA 4BTMA 2Y4IB 1M2QA 2GFSA 2VWIA 3KCFA 4FSTA 4MF1A 3GOKA 4DFYA 3RAIA 5EOLA 5LVNA 5HIDA 3NW7A 3UZRA 3KVWA 1O6KA 4GIIA 5FM2A 3HP5A 4D2SA 3G6GA 4GSBA 3QTSA 4FNYA 5HZNA 4XCUA 3IONA 3R7UA 4F9WA 3QXOA 3CTJA 4KRDA 3BHHA 2KTYA 4RX8A 2WMRA 3BHVA 3C0GA 2UW4A 3K54A 5JEBA 3ROCA 2ITQA 4WG4A 2H96A 4J71A 3MTLA 1YDTE 3GCQA 3ZLXA 3I7BA 3PY3A 4OBQA 5T68A 3QTWA 4WSYA 1BUHA 2UUEA 2F9GA 4X3FB 4I6HA 4CMOA 2R3IA 3NRMA 3O8PA 4EBWA 3P4KA 2BRMA 4YZBA 2E2BA 3C1XA 5M4CA 5H3QA 4HVHA 4L45A 4IWQA 5HO6A 4BVUA 4FL3A 4Y83A 3MB6A 3PTGA 4BCKA 4MNEA 4D2PA 5C1QB 2BZHB 4QMTA 2O64A 3CBLA 3G15A 3IGGA 1OIQA 1OPJA 2W1DA 2W5AA 4EC9A 1FBNA 3R71A 5DFPA 5DWRA 3EQFA 4HPUE 5BVKA 4QMQA 4AFJA 3QD3A 2O65A 2IW9A 3FLNC 1PMEA 3FZTA 4RJ3A 3CIKA 2ZV9A 3P08A 1FMKA 1CMKE 3AGMA 3R22A 2VZ6A 3PSCA 4NZWB 1ZAOA 3HEGA 3AMYA 4LUEA 4U5JA 1UU7A 3SKCA 4QPAA 2OIDA 1Q97A 3DXNA 3F2AA 2IVSA 4P4CA 2BAKA 5J5SA 5GNKA 3VS4A 2PVNA 2VWWA 1WVWA 3QRIA 1W8CA 1BKXA 3U51A 4R7HA 4E93A 3ZUUA 3HDMA 3UQFA 2H9VA 1WBNA 4V0GA 3F5GA 5EQEA 4F9BA 3TTIA 4DFUA 1U5RA 1Q3DA 3E92A 4QQ5A 1XH4A 3BX5A 4ZLYA 4TPTA 4EK3A 4BWXA 4ASDA 1L3RE 5FDXA 5CI7A 3EIDA 2PUPA 3BQRA 4W9WA 4DCEA 5AUWA 4MXXA 5M06A 5AV4A 4MVFA 4BTJA 5DRDA 3ETAA 3R04A 3BBWA 4J7BA 3U55A 1P4OA 2XRUA 4EH2A 3VUTA 5E4HA 3D0EA 2JITA 4CKJA 5EFQA 3ZXTA 3ZDIA 3R01A 5HTIA 3F5UA 2VTPA 4X7QA 4CT2A 4XP3A 2CKQA 4FSWA 3FYJX 5DEWA 3KKVA 1TQPA 5AWMA 2OIQA 4D2VA 2WXVA 4EUUA 4O82A 5CT0A 4BIDA 3QU0A 3VF9A 3TM0A 3SDJA 3MH2A 2YM6A 4B8LA 2W1FA 3Q2JA 3DK6A 3FXWA 3C0IA 3NUSA 4KIKB 3MH3A 5EKOA 5FWKK 2J0LA 5CVFA 4BHNA 2QI8A 4QMPA 2BFXA 4H58A 4EK6A 2XYNA 4USEA 2F7XE 4IB5A 3KRJA 4PDPA 4YNOA 4KAOA 4ZMEA 2VTLA 4Z3VA 3K3JA 1FMOE 1OL7A 3DTCA 3UQGA 5C8MA 2IVVA 4FC0A 3FY0A 3EN7A 2CKPA 2XYUA 2CLXA 3AT2A 4HNIA 5L6PA 3C4EA 4JI9A 2VWYA 4JR7A 5HIBA 1UV5A 2PZPA 4E4LA 4IAYA 4EKLA 3MVMA 4FG9A 2WQBA 4TZRA 4ZTRA 1GNGA 3S0OA 4FV4A 5LCKA 4YJOA 2RSVA 4PF4A 5HORA 3KA0A 4JBOA 1W0XC 4QMSA 3VJOA 3WF8A 4DH5A 1KUTA 3DKOA 3DNDA 4GT5A 5CAPA 4ZSAA 4FKLA 3C13A 5AP2A 3R1QA 3T9IA 3LFAA 3MY5A 2IZSA 1PXMA 2IVUA 3OXZA 3PXYA 1RE8A 3FHIA 4FF8A 4I20A 3AC2A 4HGTA 5HG9A 4YBJA 3RK9A 4Z16A 4BDCA 4MX9A 1R3CA 4QMVA 2H6DA 2HY81 3UIMA 4EQUA 2CMWA 3KRLA 4Q2AA 4XS2A 1QPJA 3E3PA 2Z7RA 3L8VA 3G0EA 3LCOA 1FGIA 4FZFB 1F3MC 4RX9A 4U7ZA 5LMKC 4F7JA 4RC4A 5FBOA 3NGAA 3ORPA 4XV9A 3ZO3A 4ZJVA 2W96B 2A2AA 3W2RA 4CZUA 5HLPA 4D5HA 2YLEA 3G9LX 4P7EA 3LIJA 5E8ZA 5IDNA 2I0EA 4TYJA 4DEDA 4FE2A 2HXQA 2ITWA 3KXNA 4BTKA 3HMNA 5J79A 3FI8A 3QALE 1Q41A 3JR1A 2OF2A 5AAGA 3BYUA 1OL6A 2VO6A 3EFJA 2C6TA 3OD6X 4ZLOA 4JVGA 3EN4A 2Z7SA 1IRKA 2FH9A 3M11A 4IM2A 3W2QA 3TUDA 2YFXA 3NX8A 1KWPA 2WTWA 3WE8A 4Q9ZA 2HK5A 4IFGA 3PXZA 3IQ7A 2XNBA 3FWQA 2PUUA 3OOMA 3POZA 2J7TA 3PSBA 5EDPA 5HICA 3VWAA 3L8SA 4GU9A 4LGGA 1OKWA 1FPUA 3EOCA 4AE9A 3GU4A 4DFZE 3N4UA 3PY1A 2UVXA 3ZSGA 2WMQA 5LARA 2Y0AA 3L9MA 2UZLA 3GU8A 2HZ0A 4B4LA 4JG8A 4C2VA 5CF6A 5IQHA 4BDFA 4D2TA 2QHMA 3LM5A 3D15A 4D2RA 1M7NA 3EZVA 3DBDA 3Q9YA 3JVRA 4YSJA 3QGWA 2XNMA 5CU3A 4JRNA 5M57A 4G6LA 3PRFA 5M56A 5E8TA 4AE6A 4F1OA 3QQJA 2OW3A 4QP3A 4YPDA 2X0GA 2VWXA 4NCTC 5HD4A 4BDDA 4CQGA 2UZTA 2GS7A 5IA2A 4RRVA 4FEVA 3C4FA 3ORXA 4O0WA 4RZWA 4AA4A 2HW7A 2W7XA 2ZV7A 5AV0A 4U44A 3NSZA 4O22A 4U3YA 1U54A 2J0JA 3FLYA 5E92A 5F4NA 4EHGA 4YTFA 3UMWA 2C5XA 4FT7A 4IADA 4LOPA 4MWIA 4EK5A 4DBNA 3FMKA 4AU8A 5K0XA 4DLJA 4OT5A 5J7HA 4UYNA 3NUUA 3HMOA 3BELA 5HG5A 4OAUC 5DPVA 5DN3A 3TIZA 3ZFYA 1XH9A 3Q9ZA 4GYIA 3UOLA 4GT3A 4ALUA 5FXRA 5L8KA 2GHLA 2DWBA 4LQMA 5IEYA 2XBJA 3A62A 2X7GA 5K3YA 3VRZA 1Q24A 5A54A 4FTLA 3WI6A 2XKEA 3IK3A 4C4IA 5KMIA 3SV0A 3MY0A 1HCLA 3VBWA 2VTSA 3BV3A 4FNZA 5I5ZA 3JXWA 4AAAA 2XK3A 2EUFB 5IA0A 5B0XA 2YITA 4AS0A 5L3AA 5CEPA 4TRLA 4NKAA 3F82A 3LXPA 4PMSA 3GCUA 3TNQB 2AC3A 3FSFA 5AFVA 4YZDA 4DFXE 4XG2A 3DPKA 2EXCX 3GNIB 3M42A 4HJOA 3ZLYA 2QD9A 3U9NA 4A9YA 1HOWA 3ZRMA 3HV4A 5HI2A 3R21A 4GMYA 3R7IA 2ZDTA 3CTQA 5HCYA 5M44A 5IQEA 3I6WA 1ZZ2A 3I1AA 3LQ8A 3NPCA 2V55A 4RIWA 4R8QA 3QGYA 3ZLSA 1UKIA 4I5CA 2GHGA 4UXQA 2JGZA 2YEXA 4BZOA 3O8UA 2WMUA 4KBCA 2GNHA 4PP9A 5FDPA 3UZPA 4TYGA 1YWRA 5H8BA 1JNKA 2JIVA 3CPCA 1XQZA 4XLVA 5EYKA 3TL8A 2BPMA 1YWNA 5ANJA 3CGOA 4EHVA 4ZY5A 4ITIA 2OICA 3KXXA 4FI1A 4FZ7A 4RFMA 2JDVA 3DBCA 4DITA 4C0TA 4BBEA 4BN1A 2OKRA 5BVNA 4KIOA 4QTDA 2XNNA 4W4YA 1SM2A 3EYHA 3GC9A 3RKBA 3BBTB 1F0QA 3AT4A 4FSMA 2XK6A 3HUCA 3SXFA 2ETRA 3LCKA 3QTRA 1H26A 5CYIA 3VBVA 3VS2A 4F70A 3QFVA 1KE6A 1Q8YA 4AT5A 3PPZA 4C4FA 4JDKA 4BF2A 1ZZLA 4IX5A 1H07A 3OG7A 1R0EA 4FZAB 2CNVA 2GQRA 3VUDA 2JC6A 2R7IA 4FIEA 2O8YA 3CQUA 4I5MA 4G2FA 3NNXA 4JX7A 4M68A 4RA5A 5HLWA 1H1RA 3WZUA 5KZIA 3VRYA 2YDJA 5GZ9A 2VUWA 3I79A 4NW6A 3VBXA 2HZIA 4E8AA 3P9JA 3Q04A 2BDFA 4DTBA 4FKVA 4ZY4A 2QQ7A 3CQEA 4L44A 4Y5HA 3O23A 3V5TA 4CEGA 2ZB0A 3D7TB 4XP2A 4YZCA 3T3VA 2W9ZB 3V6SA 4K0YA 4JBVA 3QQHA 1M17A 4XBRA 4AGDA 4E3CA 3UVPA 2XJ0A 3DBEA 4GV1A 3QX4A 3H9OA 2XNEA 4E4NA 2IZRA 5BX0A 4ENXA 5CANA 3IW4A 4YU2A 1RJBA 1PXIA 5CNOA 1X8BA 4FTNA 4XOZA 4GUEA 2LAVA 5J1WA 2YERA 5CXHA 4OBOA 4AN2A 1YHSA 4MTAA 1YDSE 2BHEA 3NUAA 4DG3E 5EM8A 3PA5A 5AM7A 4UXLA 3UC3A 2C47A 4EWQA 3ZO2A 4M84A 5EYCA 5HVYA 2V62A 4F6SA 1ZY5A 4WUNA 4LV8A 4XHKB 5I9UA 4BBMA 4MD7E 3IDBA 4NCTA 2X1NA 4XLIA 4CMTA 5HVKA 1JSVA 4FTUA 4CFVA 4OW8A 5AV2A 4NWMA 4L00A 3MW1A 2ITXA 3MV5A 3NAXA 3UOHA 2VTJA 2WMTA 4ZK5A 3O71A 5BVFA 4Z7HA 3ZHPC 4CLIA 5KBRA 4EL9A 4P5ZA 4FA2A 3HL7A 4ZTSA 2CGXA 4PL3A 2GHMA 5GHVA 3KRXA 4O84A 3TDVA 3PVBA 2YM8A 2HAKA 1Q8UA 3RHXA 2Z02A 3RHKA 4AP7A 5KNJA 5J87A 4I0RA 5K0KA 3RPOA 5C26A 2I0VA 1ERKA 2IWIA 5AP0A 2G15A 3FZSA 3NIZA 1FOTA 4FTMA 4GH2A 4X6QC 4AOTA 1NW1A 2I7QA 3O7LB 2CGUA 2VTIA 3PFQA 3Q4ZA 4OUCA 4YJNA 2XJ1A 1DAYA 3UZTA 3KMWA 3G9NA 4IDTA 4TTHB 2W4JA 4U45A 4ZTQA 4A7CA 5JFXA 4LRMA 2PVRA 5KBQA 2WQEA 4OGRA 3DB8A 3IG7A 5IQGA 3C4CA 4G16A 3FAAA 4ASZA 3ZU7A 4YHTA 5DR9A 2A19B 3ZXZA 2YCSA 1FQ1B 3COIA 4O2ZA 4YLKA 1WCCA 4L52A 4J95A 2J0MB 1XWSA 2NP8A 3DT1A 4FTCA 4YO6A 3DBQA 4YR8A 4FT3A 2W4KA 2CGWA 2C3JA 3WF7A 2FGIA 5F95A 3HVCA 3LM0A 4KWPA 3BYVA 3IS5A 3MIYA 4C59A 5KKRB 2YACA 3QKMA 3DTWA 4PY1A 3F7ZA 2P0CA 4X2NA 1H1PA 3PG1A 4TWNA 5KZ0A 3R9NA 2GDOA 4CV8A 4AN9A 4X6RA 5C4KA 2WOUA 5BVDA 5A14A 1H00A 4XMOA 2JDOA 4O7TA 2QOLA 3EKKA 2WPAA 4E5AX 1STCE 3F88A 5DHJA 1YXSA 3I5NA 4E26A 4DH8A 3RTPA 4J98A 1OECA 2AUHA 3GVUA 3IGOA 4ZTLA 3C50A 3CTHA 2J6MA 3RCDA 3CD3A 2YA9A 4NU1A 3N4TA 2W05A 4NIFB 4BCPA 2GNLA 4HZRA 3NS9A 2JLDA 5L8JA 3V3VA 2QNJA 2X9FA 5CEMA 3ZM9A 4ASEA 3HRCA 4F0IA 3VBTA 3ZC6A 4XG8A 3ZZWA 4H05A 4UBAA 4MD8E 3II5A 3PE2A 2CNUA 2C5NA 3L1SA 1Z9XA 4AA5A 1H24A 2IZTA 3G90X 5A3XA 3TIYA 4BB4A 3W18A 1NVSA 4A9TA 5JQ8A 4JX3A 4UMPA 3QHWA 5EDRA 1PYEA 3HECA 4V04A 3RNIA 3LW0A 4FVRA 4M0YA 3TACA 4D9UA 4AZEA 4WNKA 4C36A 3S2PA 2NRYA 3D5UA 2VU3A 3EQCA 4L8MA 4DAWA 5FP5A 3KN6A 4H39A 3RNYA 1WMKA 3LMGA 4IM3A 2R3FA 4IANA 5EQPA 4FEQA 4QP7A 5HNGA 4FTKA 3UIBA 2EXMA 4ANBA 2BRBA 4W4XA 1M2PA 4BCFA 2V7OA 4Y8DA 4DGNA 4TYIA 4BCHA 3GEQA 3GBZA 4FKPA 3ITZA 2QOCA 4J53A 4PMTA 4S32A 2C4GA 3DFAA 3TXOA 3ATSA 5A4TA 3UO6A 4I22A 4FSUA 1DI9A 3KULB 4IWOA 5DYJA 2OJIA 3QKLA 1YXVA 1ZOEA 5IMXA 2WTVA 3MH1A 4IE9A 1PKDA 2WQNA 1YKRA 3AC1A 3BCEA 4IX3A 4KRCA 2VD5A 4YC6A 5AX9A 3RI1A 2I40A 2G2IA 2R2PA 3QCSA 4I92A 4H3PA 4EYJA 5A6NA 5AADA 3FEGA 4G6OA 3NMUF 2BAJA 4FTQA 2PZ5A 3F3TA 4EOSA 2YM7A 1ZOGA 4HYUA 3EHAA 5LCJA 4LFIA 4EH7A 3P78A 2YM5A 2YLFA 3TV4A 4ANSA 4CKRA 1FVRA 4I21A 2PU8A 3P0MA 4ZXTA 4AGCA 4GVJA 4O7WA 5D10A 3S1HA 1OITA 3T3UA 3W2OA 3SW4A 5IQBA 4S31A 4A4LA 4MEDA 3V8SA 2Y4PA 3E8DA 3EQHA 3EFKA 5ANEA 4OTHA 4RBLA 4YP8A 2BDJA 4QO9A 2QONA 5HIEA 5KHXA 4O0VA 4G6NA 4F9AA 4U0IA 3EQGA 2PVLA 2OJJA 3QLGA 4I23A 3JUHA 4ZMFA 2QU6A 1ZYJA 1ZARA 2YHVA 4PTCA 4R6VA 2ITYA 4WNMA 2CSNA 5DE2A 5CF5A 3PJ1A 3QBNA 4IB3A 4N4SA 3PLAE 3DDPA 5AA9A 4UX9A 2BILB 1Q8TA 5J1VA 3DAEA 2OJ9A 2ITOA 2ZM1A 4DH1A 3KQ7A 4X2FA 2VO7A 4ZTMA 2JBPA 4IAAA 2G1TA 4G5PA 3VVHA 3PIYA 5IUHA 4FV9A 3QUPA 3NEWA 4ANQA 3R9RA 3AGLA 4MNEB 4H36A 3C0HA 3ZBXA 3BKBA 3LXNA 3GCPA 1ZMWA 5M4FA 3HV3A 4RG0A 2PYWA 2XIYA 4G34A 4TYHA 4USFA 5J9YA 1Q8ZA 4EQMA 2WIPA 4PL4A 2VN9A 4X21A 3RAWA 1JKKA 2UVZA 2O63A 4OTQA 2O0UA 3CS9A
chains in the Genus database with same CATH superfamily
3KREA 2ZMDA 5HBHA 2OG8A 5G6VA 5GINE 4DCAA 4JG6A 1U4DA 2OXDA 3R8LA 3E64A 3FC2A 4ITHA 5GZ8A 4U42A 3O5AA 3OBGA 1YWVA 3ZUTA 3BEGA 3OWPA 2GS2A 4NK9A 5T3QA 3KF4A 4WG5A 2VX1A 5F9EA 2X4ZA 2XCKA 4LYNA 3KRWA 4RPVA 1JKSA 4V0GB 4ANOA 3UPZA 4DEEA 2Y4IC 1GAGA 4Q9SA 1W98A 3F66A 4FX3A 5J9LA 4FKUA 4PMMA 3MTFA 5GJFA 3DV3A 4XX9A 4G3DA 4GT4A 5D41A 2C5OA 2WMWA 4I5HA 5L2QA 2DUVA 3DBFA 3BU5A 1O6LA 4QYFA 5CTPA 4AT4A 4QQCA 1YOMA 3E7OA 3Q9WA 4UV0A 4AGUA 3P7CA 4CG9A 3MFTA 4QQTA 4WT6A 3V5LA 1YHWA 5HE3A 1MP8A 3A7JA 2XM9A 2WU6A 3FYKX 4JG7A 3EFLA 3V01A 3HGKA 3ZFXA 3O7LD 3QA0A 2ZV8A 4EZ3A 3KN5A 4N6YA 5I9ZA 4YLLA 2C6EA 2AEGA 4X3FC 2Y6MA 3RPYA 1H08A 5GZAA 4NL0A 3MS9A 4QP4A 5CQWA 2XK8A 1KSWA 2H34A 3NW6A 5FP6A 3R7EA 4D1XA 2XARA 5AV1A 3OEFX 2CDZA 2F57A 2R3JA 4C3FA 3DCVA 2EB2A 5TOZA 3GI3A 2Y7JA 4W4WA 4P5QA 5EQYA 4CFNA 2FSTX 3ORZA 4FT5A 5EYMA 1B6CB 3GENA 4EOIA 3BU6A 4FV5A 1H8FA 1ZYCA 2ERZE 3W1FA 4E73A 2GFCA 4Y72A 3AC3A 3SOAA 4JQ7A 1IAJA 4ZS4A 1Y8YA 1JSUA 4DGGA 4FR4A 2BZKB 3P23A 4FKSA 1URWA 2ZV2A 3NDMA 2FSLX 1U5QA 1XJDA 2J90A 2OU7A 4AT3A 5M07A 3OT8A 3DB6A 3U9CA 3GCVA 3Q6WA 3PP1A 3BWFA 5TO8A 3UJGA 4S30A 2RFSA 4I1ZA 3R1SA 5AV3A 4ZJIA 2XUUA 3H10A 1B39A 2J0KA 2P2IA 4BY9E 1VYZA 3BIZA 4RJ6A 4BCNA 1MRYA 2VTOA 2IPXA 1V1KA 3LFFA 4I4EA 1H1QA 5HCXA 4N6ZA 2WELA 3QTIA 4R1YA 4JBPA 4BDIA 4BICA 3D5WA 3WZJA 3OMVA 3A8XA 1KE5A 3A99A 3I60A 1FVTA 5D7VA 3REPA 4A07A 4DEAA 1WVYA 4LOOA 1ZYDA 2R3NA 4MXZA 2YCRA 1PRYA 1UU8A 5A9UA 3AD6A 5LWMA 4FL2A 3QHRA 4QPMA 3SLSA 1JPAA 1URCA 3P86A 4FNXA 4XV1A 2UW9A 4P2KA 3P5JC 4QDVA 2J4ZA 3LJ0A 2A98A 5HESA 2P55A 1XBAA 3EQRA 4JQ8A 4EORA 3TKHA 2B1PA 4L53A 3W33A 3PFYA 3AQVA 1UU9A 4U80A 5CAUA 3VQHA 3BI6A 4JLCA 1SZMA 3W55A 1ZY4A 3DKFA 4IACA 2FSOX 2JFLA 3D14A 4NTTA 3SX9A 3AKKA 1J91A 1V0PA 4YURA 4EOJA 1QPDA 4RFYA 4FV3A 4RT7A 4DGMA 4LL0A 4O1OA 5FXQA 3W2PA 4EH4A 3VO3A 3SGCA 3HRFA 4FV2A 2ESMA 4J97A 1DM2A 4RC2A 4CKIA 2R7BA 3DK7A 2WTKB 2PPQA 2YJSA 4MQ1A 2E9UA 4QTBA 4B0GA 4UWYA 2ITTA 2UZVA 3RVGA 3VS1A 1W7HA 4CZYB 2JIIA 2OZAB 3LLTA 4D2WA 3DXPA 3VS7A 3AOXA 3QRTA 2PUIA 4R3RA 3QCYA 4GG7A 3FMJA 4GKIA 3D5VA 2BHHA 2VV9A 3C9WA 3S4QA 1LPUA 3EQDA 2OIBA 4XNEA 1XMMA 4XV2A 4CXAA 2PE0A 5DMZA 2NNWB 2WIHA 3IDPA 4B8MA 4ARKA 3NR9A 4FKGA 3PYYA 4G17A 2CGVA 4R3CA 4YC3A 2PVJA 2BUJA 3FKNA 3VW6A 2XKDA 3BLQA 4WOVA 4D58A 5AR3A 1YXTA 2QR8A 2QC6A 4ITJA 4AWIA 4IIRA 3TJCA 3R2YA 3BYSA 3FL4A 3OP5A 1E1VA 3BHTA 4GJ2A 1NVQA 2OI4X 4AUAA 2QODA 4MXOA 3SXRA 1G8SA 1SMHA 5HBEA 4O96A 4ZIMA 3U6IA 1APME 2BKKA 3HA8A 5DRBA 2JIUA 3PJ8A 1XKKA 4ASXA 2JFMA 4WRSA 4CFFA 1H01A 1PHKA 2XVDA 1XBCA 4OT6A 4JJRA 3MPMA 2QO9A 4FMQA 5HTBA 1BLXA 4EJ7A 4X2JA 3IOKA 1B38A 3DGKA 4QYYA 4OAVB 3N9XA 1V0BA 1CKIA 3CY3A 4I6QA 1LEZA 4MF0A 4IZYA 3HMPA 4EKKA 3OW4A 4M14A 4KSQA 5C8NA 4YHFA 1MUOA 4K1BA 1YHVA 2EU9A 1CKPA 3A2CA 3B2WA 1WBOA 3C4ZA 3WF5A 4X3FA 2JKQA 2OXXA 2WMVA 4I93A 5K9IA 1MQ4A 3E63A 3RK7A 3FQHA 5IKWA 4DT9A 4Z7GA 2UZUE 3FHRA 2X39A 2B52A 2W1EA 4FV0A 5FG8A 5J5TA 2JDRA 2QOKA 3UMXA 2HOGA 2XM8A 2YJRA 3DJ6A 4L01A 3ZOSA 2P3GX 3OXIA 1KE9A 4LGDA 4DGOA 3E8CA 1M14A 4XG6A 3BRBA 5EH0A 2I6LA 3H9FA 4HCVA 5G1XA 4O83A 5BQ0A 3BGPA 4HGEA 3UVQA 2X0QA 2C0TA 3HYHA 3R2BA 4TNDA 3OVVA 4FUXA 2CN8A 4YJQA 1JSTA 3LQ3A 2PVMA 3WOWA 2RFDA 4BRXA 3PZEA 4RSSA 1Q99A 1G8KA 2PVFA 1OBGA 4W8DA 3KXZA 3PP0A 5EHOA 4QP9A 3WZKA 4CYIA 3VUMA 3SXSA 2V7AA 4TN6A 2RFNA 4RQVA 5FM3A 4O86A 3D7ZA 5BYYA 2REIA 4FK3A 3VHKA 2UW6A 4X0MA 4DDIA 1H25A 5HNIX 3CC6A 5DG5A 1Y6BA 1KE7A 2VTRA 4IAFA 1R39A 3KB7A 1GZ8A 3QYZA 5AIRA 1P14A 4M97A 4WKQA 2V0DA 3COMA 4D9TA 3QZGA 4OTGA 4AXCA 2O2UA 2PULA 3QX2A 3UNZA 3RALA 2BVAA 4AZFA 5EHLA 4DEIA 4QTEA 2PUNA 5IMEA 5KMLA 1Y6AA 2WTCA 3GFEA 3LJ1A 3PRIA 3QLFA 4G3FA 4RWKA 3TYKA 1WBWA 3ZUVA 4TY1A 1OKYA 3C5IA 5IQFA 2Z60A 5BMSA 3TKUA 4FIJA 4FTJA 5GIPE 2HIWA 4E4XA 4F99A 1Q8WA 2VGPA 3UP7A 4FZDB 4CVAA 5JZJA 5EM7A 4BZDA 3V04A 2X2KA 3RM6A 3F3WA 3OOGA 4BDGA 4R77A 4KD1A 5JRSA 4IJPA 4BGQA 4CCUA 1JOWB 5A4EA 4C38A 3EN6A 2WTDA 1R0PA 2V5QA 3CY2A 3CEKA 3KXMA 3ZSHA 5AUYA 4HYSA 3MYGA 5M09A 4RIYB 5CENA 3R7VA 4PDOA 2OJFE 2WZJA 3R8ZA 3NW5A 4APCA 4RJ7A 2IW6A 4FV1A 3U6JA 5IQCA 4FODA 4ZY6A 3V51A 4ZTHA 4UALA 1V0OA 5E90A 4C02A 3VHEA 2BROA 4NJ3A 4NW5A 5KX8A 4DFBA 3E8NA 3LXLA 2QO2A 4WD5A 3W8LA 3FMMA 5JFWA 4QT1A 3Q6UA 4K2RA 3UG1A 5BNJA 5L2WA 4QYEA 4NYEA 5AAFA 1YVJA 4NM3A 3DOGA 1KOAA 4FT0A 5JFVA 2SRCA 1OPLA 2BTRA 2ZB1A 1UNLA 3HV5A 1XH6A 3MSSA 4HVGA 4O7VA 4MBIA 1YXXA 3A4OX 3QWJA 3NFGB 2VO0A 4LM5A 4CZTA 3FY2A 4F1MA 3QQLA 4C3RA 2EB3A 4UZDA 4CYJA 3RMFA 4FIFA 1NY3A 3DNEA 4LOQA 1MQBA 2A4LA 4FVPA 4D55A 4DG2E 4I41A 3TUCA 4I0TA 3MESA 2PWLA 2W1CA 3FMEA 2JDTA 4AW0A 2XNGA 3F7WA 5IISA 4FKJA 2Y6OA 1ZMVA 3W0OA 2R9SA 3BYMA 5D7AA 3A7GA 4E6QA 2YZAA 3TG1A 3FZ1A 3ZMMA 3TZ9A 3TV7A 1OZ1A 3NNUA 4PDSA 4R7BA 4EI4A 4LG4A 4GW8A 4RQKA 3FXXA 4BI2A 2VTTA 4ORKA 4CTCA 1GOLA 1QPEA 3GOPA 3QD0A 2XF0A 4YJSA 4YGAA 5E8YA 5E1SA 3DJ7A 2XS0A 5HVJA 4YUQA 3V8WA 1VLRA 3SOCA 2FO0A 4ACHA 4F9YA 4LDTA 5CU4A 2C6KA 5ETCA 5KMOA 3AG9A 3R9HA 5B7VA 3F2RA 4QNAA 2XRWA 2PMNX 3FZRA 3RP9A 3WILA 4MQ2A 5CXZA 4BCQA 2C68A 5IH4A 3NVKI 4IVCA 3W8QA 3A7IA 5JGDA 3GU6A 4A4OA 5JSMA 4BKJA 5LMKA 3A7HA 3LVPA 4BGGA 3WF6A 4HVDA 4KS8A 3SD0A 4R3PA 4EZ5A 4IJ9A 4IZ7A 5DR6A 5HKMA 5CZHA 1S9JA 2R0UA 4HNFA 3U6HA 5TR6A 3PXFA 5FTQA 4G31A 4X3JA 4F7NA 2RF9A 3FI3A 3P1AA 5EKNA 2OF4A 4WBBB 2OZOA 3E8EA 5AP4A 4AF3A 3I5ZA 1BL7A 4I6BA 4PNKA 2EXEA 3MVHA 4XBUA 3TNWA 4CSVA 5I3RA 3NWWA 4ZTNA 5LWNA 3RBWA 3BZ3A 4OLIA 1SNUA 2BFYA 3HDNA 2WTIA 3LFSA 1PXLA 2OH0E 2XKFA 4KB8A 4N0SA 3BLAA 4QMNA 2WOTA 3EMGA 4EONA 1SVGA 2XIKA 3KL8A 2BIYA 2JKKA 4O6LA 3DS6A 2PMIA 4FSQA 3BL7A 4BJJB 2ZVAA 4JDIA 4P90A 2UZEA 3FSKA 5LVMA 3GQLA 3HV6A 3SC1A 2B9IA 2F7EE 4BTFA 2OLCA 3RAKA 3A60A 3G33A 1QPCA 1K9AA 5DNRA 1O6YA 2ITVA 4FTRA 1A48A 1R1WA 2IF8A 3MFRA 4KUJA 1BI7A 2DYLA 3EQIA 3FUPA 5CSXA 2C5VA 3C51A 5HE0A 5KMMA 3RINA 1CM8A 3NNWA 2CN5A 4M13A 3L9LA 5CSVA 4BWKA 4O0XA 2YIXA 4J8MA 1IAHA 1BI8A 5AA8A 3FKOA 4KNBA 4RX7A 4XH6A 3KXGA 2W1ZA 5JN2A 4Y5QA 2XEZA 5CASA 2CNQA 5HG7A 5CAOA 2ITUA 3NYXA 4L42A 4F09A 2B53A 3SHEA 1PXPA 5I3OA 2E9OA 2O5KA 5AP3A 3NLBA 1WBVA 3QTXA 4ZZMA 3FPQA 3VUKA 1ND4A 3DK3A 3UPXA 5FRIA 1ZWSA 3FV8A 3KU2A 3UP2A 3MY1A 4G9RA 4EOLA 1PXKA 4UEUA 2UV2A 2UVYA 5DOSA 1H0VA 4TXCA 3RM7A 3OTUA 4R5SA 2AC5A 1NA7A 3G51A 4GKHA 3BL9A 3MVLA 3PUPA 4GK4A 4PL5A 3HLLA 3Q5IA 4II5A 5FBNC 3P5KA 2ZOQA 3HZTA 2CCHA 4QP2A 5E1EA 4DA5A 4Z55A 4MBJA 5EW9A 4Y85A 3PXKA 1CSNA 4U41A 5KKRC 2CLQA 3Q60A 1ST4A 3HMMA 5BVEA 4B9DA 3HUBA 4O0YA 5IH5A 4CGAA 5CEOA 3G5DA 4E5WA 2PK9A 3FLQA 3D2IA 3BE2A 1SVHA 4I94A 3PG3A 3R6XA 2W06A 3IO7A 4GK3A 4GYGA 4JL9A 1TKIA 3PA3A 4OTWA 3R0TA 2VTAA 5FTOA 4OTPA 1U59A 5J9ZA 3UNJA 2R3RA 3EH9A 4ZS0A 3QZIA 3VC4A 1SVEA 5M53A 4TYEA 4CNHA 5BUIA 3QRUA 2VNYA 1ZRZA 2WMBA 3IPHA 3KGAA 3QRKA 3PPKA 4HYHA 3ULIA 5JK3A 3QQUA 5A4CA 1IEPA 4IBMA 2ITZA 4BL1A 2PY3A 4EH8A 1OI9A 5LJJA 1TZDA 3OWLA 3GU7A 4DBXA 4M69B 2WMSA 3LFDA 3OFMA 5C01A 4RJ5A 4V05A 3DLSA 4C4EA 2G2HA 2Z7LA 4NSTA 2ZM4A 5DI1A 5CQUA 2XKCA 2UW7A 3LFQA 3DKGA 4O4EA 4F6UA 5HU3A 2ONLC 4GCJA 2QKWB 2XK7A 3EN9A 5AP5A 2VRXA 4I24A 4JBQA 5CZIA 4CD0A 3WZEA 4XUFA 5C27A 4CLJA 2X0PA 4L6QA 5IA4A 5M51A 1G8JA 3PIZA 3RJCA 4A06A 4UMRA 3Q4CA 4EH5A 3CSVA 3AC8A 3LMIA 4WHZA 2JKOA 5ANDA 3QAME 3RAHA 4QMWA 2NRUA 3K5UA 4YZ9A 4IHPA 3JVSA 4EUTA 3FI2A 3W10A 4O38A 1IR3A 3EL8A 4O7NA 2UW0A 3M1SA 4L7SA 5EI8A 3OY3A 4BCIA 2RIOA 3VW8A 4RX5A 2J0IA 2C3IB 1WFCA 2HXLA 4MAOA 4NFNA 3ULZA 4DGLC 2C0IA 1KOBA 2HY0A 3MJ1A 3IW7A 5E8WA 4TYHB 5K5NA 5LVLA 4AG8A 3OUNB 2VWVA 2GS6A 3PXRA 2OBJA 5HU9A 1REJA 3NCGA 3AKLA 3QL8A 3QQFA 1W2DA 3R1YA 1FGKA 2W99B 2W9FB 4O4DA 3M2WA 4IDVA 4RVKA 5IZFA 2O3PA 4YPSA 2A27A 5K4IA 4I6LA 4D5KA 4LMNA 4HOKA 5ICPA 2WEVA 4YO4A 5HO7A 4FEXA 4IFCA 2B9HA 2W5BA 2YAKA 4IX6A 4YJRA 2ZFYA 5C8KA 4FJVA 1R78A 2VWBA 3ZCLA 3LAUA 4D4YA 5DEYA 2RFEA 3AT3A 2BIKB 5CALA 1K2PA 4QP1A 3R83A 3OC1A 4C35A 5BMMA 3UYSA 4IWDA 2R5TA 3BHUA 4XP0A 4XYFA 4YLJA 4QTAA 3EL7A 4BZNA 3HAMA 3TMOA 2IVTA 4G3CA 5BYZA 5EM5A 3ZYAA 4K18A 2W4OA 4AOJA 3PWDA 1TQIA 4LI5A 4EJNA 4L3LA 2R64A 1YRPA 3G0FA 3LJ2A 4JAJA 4BC6A 3IW5A 5ETFA 3FZPA 4L68A 5AUUA 3R8PA 5HTCA 1J7LA 1QCFA 4K6ZA 1JKTA 1WAKA 3SQQA 4CG8A 2WD1A 3ZRLA 4IAZA 3UODA 4LRJA 2UW5A 4O7RA 1YOJA 3R7OA 4FSRA 4BCOA 3ACKA 2G01A 4NT4A 4FOBA 3KMUA 3MA6A 3PE1A 5M4UA 3QQGA 1RQQA 3QD2B 3VONA 2X9EA 1BX6A 1G5SA 1UU3A 3DY7A 2ZMCA 3HV7A 4HPTE 4BI0A 3LMHA 4F4PA 3FLSA 3I0QA 4M66A 4C34A 1J1CA 2X8EA 4YJVA 3U4UA 1JQHA 1Q3WA 4HCUA 3RGFA 2PMOX 3UQCA 1OB3A 2BALA 2XZSA 4DINA 4I5PA 3F3ZA 4C61A 1VR2A 3BU3A 2QO7A 3ALOA 4W4VA 4EZ7A 4YJUA 3V5WA 1NXKA 3ALNA 4S33A 3E88A 2VTHA 4YSMA 1OBDA 4GS6A 4MNFA 4FOCA 3SRVA 3VNTA 5LXMA 1Y91A 2VWZA 2JDSA 4KSPA 1GY3A 4K77A 4CT1A 1GJOA 1OM1A 4Z9LA 5C9CA 4RIXA 4YC8A 3R63A 4CTBA 5I9WA 3D4QA 3ET7A 5K4JA 3KXHA 4ZSEA 4BCJA 3F2NA 3GFWA 2ITNA 3DLZA 5DLSA 3MVJA 5M55A 1LUFA 4LGHA 4QMYA 5TT7A 3UIUA 4FGBA 3ACJA 4RWIA 4TWPA 1REKA 2VTNA 2QKRA 4FSZA 5ACKA 2R3MA 4PPAA 3F3VA 3ZM4A 2NYAA 2B7AA 1PY5A 3I4BA 1AQ1A 4BIEA 4RMZA 4UY9A 4RGJA 1OL1A 2WEIA 4GJ3A 3B2TA 1Q61A 3TCPA 2X0OA 4GEOA 4YZNA 1OIUA 3ORLA 4EEVA 4IAIA 3HA6A 4JXFA 3MJ2A 4FV8A 4A9SA 5JGAA 3MA3A 3I6UA 4G9CA 3OY1A 3O51A 4IC8A 1TQMA 5CSHA 4KIQA 3TN8A 4CRLA 5J8IA 5DT4A 5HNBA 4JOAA 2XBAA 5CI6A 1ZOHA 5AR8A 3K3IA 3LHJA 4RLLA 4DF3A 4FTIA 1PXJA 4I3ZA 3VN9A 4FG7A 2XK9A 4CFUA 2XB7A 4BWPA 4FV7A 5BPYA 4FKOA 4RLKA 5IEXA 3K2LA 2A0CX 4FNWA 4JNWA 3R7YA 3CPBA 3E5AA 3R28A 4KBKA 4H3QA 3WYXA 2WMXA 4AW1A 4FK6A 3ORMA 5H8EA 4WRGA 2KULA 2YIWA 4FEWA 3I7CA 4D0XA 4R78A 3GU5A 3NZ0A 4C4GA 2ITPA 3BE9A 3NIEA 4YMJA 5CEKA 3HKOA 3D5XA 3HNGA 2W1IA 2ACXA 3V5QA 2CHLA 2WQOA 3I0OA 4GL9A 5CEIA 4ZP5A 4N70A 3KULA 2ZYBA 2Q0NA 1KV2A 3ODYX 4UZHA 1UWHA 2X2MA 1VEBA 2VTMA 5I4NA 3EZRA 5HOAA 1U46A 3I81A 3FLZA 4ONAA 4R1VA 1P5EA 3EN5A 3FDNA 1I44A 3PWYA 5TF9A 3LKMA 3QRJA 1OGUA 4JMQA 2ETMA 4JS8A 2YZLA 5IEVA 5B2LA 5CVGA 3LFEA 3GC8A 4FSYA 3ZSIA 1J3HA 2Y8OA 3TJDA 5HX6A 4NUSA 2I1MA 1MRUA 1YXUA 5JZNA 2X7FA 3TWJA 2LGCA 4WIHA 5JGBA 4DEGA 3W0MA 4IVDA 4GVAA 4DEBA 5I9VA 4K9YA 3FPMA 4PMPA 2X8DA 5DT0A 3LFBA 5J95A 3QCXA 3CR0A 3KK8A 2J2IB 3BLRA 3OEZA 1OIRA 4ZJJA 4RZVA 5BYLA 1G3NA 3C7QA 4S2ZA 1G8AA 4U79A 3BWJA 5IH6A 2IG7A 2PZYA 4GK2A 5CY3A 1LEWA 4C2WA 4IQ6A 4JIAA 1KV1A 3HAVA 1UKHA 1XMLA 4FYNA 3CP9A 5AR2A 3RWPA 3ID6C 4U3ZA 1UVRA 3PVWA 5CWZA 5LQFA 5ANIA 3DZQA 5DH3A 3NNVA 3QC4A 4HVIA 3LQ5A 2OGVA 3R02A 3F61A 5EK7A 4J99A 2C1AA 5DR2A 5IU2A 5KMNA 3FJQE 2BCJA 3CKWA 1PF8A 3H9RA 4IX4A 4AW2A 1NVRA 2WTKC 3CKXA 3NCZA 3HX4A 4HCTA 4HYIA 2X81A 1OPKA 4BIBA 1SYKA 4AFEA 2C6OA 4DN5A 2G9XA 4F7SA 4F65A 2IN6A 4F9CA 3FQSA 1K3AA 3H3CA 4I6FA 2WTJA 4WBOA 3MIAA 4KKHA 4O4FA 2J51A 4BKYA 1VYWA 2PVHA 2C3LA 2HYYA 4WG3A 1WZYA 4QDEA 3U4WA 4QNYA 5HEZA 3ZONA 1DI8A 2RG6A 3Q5ZA 5ANOA 3DZOA 4JRVA 4QMLA 1XH8A 4RJ8A 1YOLA 2Z7QA 1P4FA 5B2MA 2PHKA 3QTZA 2QVSE 3NUXA 3OROA 2BKZA 3ELJA 3QA8A 4GIHA 1XBBA 3HP2A 4KINA 3QF9A 3IKAA 4XG7A 4CFWA 4U8ZA 2QLQA 5HE2A 5JQ5A 1RW8A 5E9EA 2C6DA 3FL5A 4MXYA 5IQIA 4ANLA 3U54A 4KS7A 5E91A 3Q4UA 3NYNA 4F64A 4JQEA 1IA9A 2BMCA 4A9RA 3BEAA 2GNIA 3F9NA 5H9BA 4EBVA 4QYHA 4C4HA 2R3OA 3QXPA 1PMNA 3Q2MA 3ZTXA 5K5XA 3O96A 2QOFA 5AP7A 3KK9A 5GIOE 2OK1A 2XJ2A 1GZKA 2B54A 5EYDA 4C8BA 4FT9A 2GQSA 2B0QA 1Z5MA 4FKQA 5EM6A 2ETKA 2X6DA 3ZZEA 3VULA 4E4MA 2YAAA 3EJ1A 4ERKA 2OXYA 3R8VA 4L7FA 2HELA 1W84A 3KC3A 4HVSA 4L46A 3E93A 3SVVA 5FD2A 4H3BA 5D12A 3A8WA 3TEIA 2IJMA 4AZSA 2YIRA 4DTKA 4ZZOA 5H2UA 1OL2A 2XEYA 5CEQA 3ODZX 2YM3A 2E9NA 3O50A 4FYOA 4BDBA 3PA4A 5D1JA 5HE1A 3VS5A 4D1SA 4J96A 4O6EA 4IXPA 4JIKA 3ROYA 3BPRA 5HO8A 5I9YA 3PIXA 4O0TA 4Y73A 1BMKA 3ORKA 1H28A 4FZ6A 2Y9QA 4NKSA 4UMTA 1U54B 3UIXA 3FZOA 3FE3A 4EWHA 4BCGA 3VF8A 3R9DA 3F6XA 1UA2A 3BV2A 3LCSA 4FL1A 4IVBA 3ZH8A 2XP2A 3DA6A 4U81A 3VUIA 3NAYA 4UMQA 3SAYA 3R1NA 2GCDA 4CFMA 3BQCA 2R3KA 5FTGA 4YTIA 1GZOA 2J5FA 2JBOA 1CTPE 5CS6A 4ZOGA 5IA3A 5DA3A 2R3LA 2WU7A 3AC4A 3OCTA 5T6KA 2UZDA 3OF0A 4WA9A 2Q83A 3AXWA 1YW2A 4ZLZA 3EKNA 3AMBA 5IA1A 2XIRA 2NO3A 4KABA 3D2KA 3PLSA 2R3HA 5HBJA 4OR5A 5CAVA 5AUXA 4ZSLA 3KEXA 5KUPA 3E3BX 4JAIA 4AXEA 3P79A 3C5UA 2J5EA 2JAVA 4FKWA 4LRKA 1EH4A 5CT7A 1AD5A 1PXOA 3D83A 4MXAA 3NVMB 3AMAA 1QMZA 2BR1A 2VNWA 5HQ0A 4F0FA 2W17A 3FMNA 2QG5A 1XR1A 2BRHA 3IOPA 3VS6A 2QG7A 5EI2A 3UOKA 3GQIA 3ZEWA 4ZAUA 1WBSA 3JY0A 4XJ0A 2QCSA 1J7IA 4RIWB 1YDRE 2J9MA 4GFOA 3JY9A 4OTRA 5AR5A 4F0GA 3DU8A 3FKLA 4DYMA 4EOPA 3Q32A 4AN3A 1ZLTA 2GU8A 4RVTA 4EYMA 4FTTA 4WO5A 4E6CA 1OKVA 3OZ6A 5C03A 4B7TA 5KMJA 5J7BA 3GXLA 4G3EA 3R30A 3VUHA 4F08A 4O81A 4F78A 1JLUE 4JT3A 4LL5A 4UMUA 3SW7A 3Q53A 2CKOA 3WIKA 4K11A 4WNOA 5AX3A 1CKJA 4TT7A 4BYIA 2E9PA 2GSFA 3EWHA 4QD6A 5CU0A 3TNIA 4C3PA 4O0RA 1FVVA 4DH7A 3QQKA 1TVOA 4L3PA 5AUVA 3L9NA 3FI4A 3VBQA 3V5PA 1H27A 3NUNA 3QKKA 3T8OA 4A9UA 5EOBA 4AACA 4O91A 4XG4A 2UW3A 4WUAA 5BUEA 2XAOA 3TDWA 2OZAA 1PYXA 3MB7A 2XK4A 4GUBA 4KKEA 1JBPE 4FKTA 4L67A 4OBPA 4DFNA 4IH8A 4XG9A 4FIGA 2E9VA 3KRRA 5E8VA 3SG8A 4GU6A 1Q4LA 4OTFA 4AOIA 3LOKA 3ZEPA 1IA8A 2QOBA 2RKUA 3DJ5A 3WARA 4ID7A 4K8AA 4ACCA 3PJCA 4KIKA 3VIDA 3SG9A 3G2FA 3R8UA 2OWBA 3TUBA 4AGWA 2PZIA 1PXNA 5JFSA 4ACDA 4M7IA 1OUKA 4C62A 4IZAA 1W83A 2GTMA 4QMMA 3CE3A 2YWVA 1OUYA 4FSNA 4M8TA 2XNPA 2I0HA 3ERKA 5ITAA 4LV5A 4D1ZA 3ATTA 4PDYA 3RPVA 4O27B 3RZFA 3OT3A 1A06A 3O2MA 4QMUA 2C1BA 2PZRA 4RFZA 4BCMA 2W1GA 2XIXA 4EHZA 1UNHA 4O21A 3OCSA 4PPBA 3PZHA 3U87A 5HHWA 3FMHA 3ML1A 2ZAZA 3AC5A 3FC1X 3N51A 4PUZA 5FEDA 4G3GA 1PW2A 4BDAA 1PMUA 4DC2A 5IF1A 3KF7A 3FMLA 5E7RA 4E20A 4PPCA 1OKZA 4PX6A 1A9UA 4G1WA 1Y8GA 3MBLA 5DGZA 1YI6A 2Q0BA 3ANRA 1Q62A 2X4FA 3Q52A 4O7SA 4FGRA 3MFUA 2F49A 3GP0A 2BTSA 4FUYA 4OTIA 3UG2A 4OTDA 4YBKA 2OH4A 4AZTA 1ATPE 5AAEA 2OJGA 3KY2A 3MN3A 5DIAA 2UZBA 4MHAA 3ENMA 3PJ3A 5AUTA 3WZDA 5LMAA 3BHYA 3R73A 1OIYA 3NUPA 1RDQE 4UWBA