3L9NA

Crystal structure of pkab3 (pka triple mutant v123a, l173m, q181k) with compound 27
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
332
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Azole-based inhibitors of AKT/PKB for the treatment of cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 332
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l9nA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l9nA02
4EH2A 4GJ3A 3NPCA 4G9RA 2RGPA 5EHLA 4FZ6A 3AC1A 3R73A 2QOBA 3EQGA 3KK9A 3FMHA 3RP9A 2PTKA 1DI8A 2XB7A 2X7FA 3EOCA 4M15A 4O22A 4YSMA 4O2ZA 3FE3A 4F0FA 3NUPA 4QMUA 4I6QA 2GCDA 3ROYA 5CTPA 3E63A 4BDIA 3DB8A 2JLDA 2F9GA 3SQQA 5F95A 4F4PA 4YJQA 3I79A 4QPSA 4XV9A 1OIRA 4BKYA 2A2AA 2XM9A 3IGOA 4DLJA 2FH9A 3CPBA 4PV0A 4IXPA 3UG2A 3RM7A 3ZZEA 4D55A 4GUEA 3EIDA 3NYXA 3MH1A 5CVGA 1Z9XA 4X2GA 4EOLA 2EB3A 1E9HA 5DBXA 4DTKA 4J71A 5AR3A 4C3FA 5I9XA 4KIKA 4E93A 4C2WA 3D4QA 4RWKA 5E92A 4RIXA 5FXRA 1SMHA 1H01A 3CC6A 1UWHA 3EN7A 4F6SA 4C38A 4OUCA 4BR3A 3KRJA 2OK1A 4I94A 4B0GA 3OD6X 5HQ0A 2B52A 3ZOSA 4Z9LA 4G3GA 4MXOA 3CQWA 4OTIA 5CEMA 4FIGA 1CKIA 3OUNB 5CVFA 1OIQA 4DBXA 1JLUE 2V5QA 2EU9A 4GVJA 4X3FC 5EW3A 4FTNA 2FB8A 2VWWA 4WBOA 4DN5A 1X8BA 2AUHA 3I81A 3QA8A 4RIWA 3GU8A 3D7TB 4X6RA 3HGKA 3PLSA 4FV4A 2JEDA 2GMXA 3GCVA 3KEXA 1P14A 4QD6A 3U9CA 5CI6A 3A2CA 1FVRA 4FKGA 4IB3A 2X2LA 1VYWA 2XK8A 3W2RA 5E7RA 1DS5A 5HNGA 5L8KA 3EZVA 4HVSA 5C1QB 2PZRA 3DFAA 2WKMA 3LCTA 4FUXA 4AGDA 3EFJA 1SZMA 2VD5A 4O6EA 2CCIA 4LM5A 4C02A 4MXYA 1XJDA 4AW0A 4EORA 2OJIA 2CNVA 2JITA 2XNGA 4I6HA 3R9OA 3UO5A 4BI0A 1UU9A 4FTIA 2X2MA 5IQIA 4NW5A 4J53A 3PRFA 4U3ZA 3BEGA 2BRMA 4OTGA 3W32A 3GNIB 5T68A 4AA5A 4NJDA 4AQCA 3MA3A 4R7HA 5BVKA 3LLAA 4A7CA 1FINA 2VWYA 3FMJA 3HKOA 3FMEA 3OMVA 4QO9A 4YTHA 2C6MA 2ITXA 4OT5A 1H28A 1Q4LA 1R3CA 1AGWA 4PQNA 3LHJA 3PJ2A 1E1XA 3QAME 4HZRA 1OECA 3EB0A 3ZRLA 4D5KA 5D11A 3UVQA 4BDKA 4L67A 4YMJA 2WMSA 5F9EA 3ELJA 4QMLA 5BUEA 4FZDB 2ZV7A 4FEQA 5CAVA 5CU0A 4JG6A 3F3VA 1B39A 3VIDA 1ZY5A 3ZEWA 2HELA 3U6HA 1MUOA 2WELA 2QOCA 5AP1A 5DOSA 3FMLA 4BZOA 3BCEA 4FZFB 4HYSA 4I23A 1R1WA 4KS7A 4ASZA 1OPJA 2RF9A 4JQ8A 3E62A 4QYHA 3WILA 2IN6A 5B2KA 4BTFA 3VS1A 4ZTMA 2DWBA 3QQUA 5HE1A 4U9AA 4CVAA 3EN4A 3FSKA 2Q0NA 2Y7JA 4U3YA 1KE9A 4YJVA 2CNUA 2WAJA 3NNXA 5I3RA 1LEZA 4C57A 4DHFA 3WARA 4GYIA 3SVVA 1RJBA 4QMSA 3HRFA 2H9VA 4F99A 2GPHA 1M7NA 2XEYA 3PJ3A 2WMWA 2V7AA 3O8PA 3UPXA 1YKRA 3EH9A 4R6VA 2QO2A 5DHJA 4B9DA 4ZTRA 5DRDA 3VS2A 4DCEA 4D2TA 2HZNA 4EBVA 4BDGA 2ZV9A 3PZEA 3QALE 2FO0A 3OXTA 3PSBA 4IMYA 1ZMWA 4FTJA 4F0GA 3C5UA 4LUEA 3UOJA 3NW5A 3V04A 1TKIA 4Z7HA 4CLJA 5I9VA 3ZUTA 4IWQA 3ZXZA 3S3IA 4X3FB 1JNKA 4RBLA 4OTQA 3PE1A 3KRWA 2XYNA 4O0UA 1W7HA 4WOVA 4IFGA 1PMEA 3U8WA 3KRXA 1RDQE 2C6OA 5M4IA 4MQ2A 5AWMA 5BVWA 5EYCA 4J52A 3VS6A 2F7XE 4FC0A 2XNBA 3UIUA 2C47A 3IECA 4RIYA 4G17A 4PNIA 5L8LA 3IDPA 5AR2A 3R63A 4LOOA 3CGFA 2XP2A 4M14A 1Y8YA 2DS1A 3CD8A 2BAKA 3CP9A 3FYKX 2PMOX 4FT9A 3I7CA 5D1JA 4F9CA 3TTIA 3FLNC 5A4CA 5HO7A 2P4IA 2VO0A 1BL7A 4IANA 3UQGA 4ZSLA 4GW8A 1FMKA 5HNBA 3P23A 5CXZA 3GUBA 1KE5A 3KMUA 2RFNA 3VJOA 3FAAA 4C37A 1IAHA 4CT1A 3D83A 4C4JA 1YQJA 4A9TA 3VRYA 5E1SA 4IAKA 4EOPA 3RHKA 3TV7A 2YM6A 3C4XA 2R3NA 2PSQA 2R0UA 4AA4A 5CSPA 3KQ7A 4LI5A 3EFKA 3TJDA 2WNTA 4YU2A 3G2FA 4HYUA 4PPBA 1O6YA 4PMPA 3COHA 1OMWA 1NXKA 3KN5A 3OOGA 4MXAA 3ZEPA 4BL1A 4HVDA 4RX5A 4RX9A 4GK3A 2WQMA 4KWPA 4U97A 1ZMUA 1LUFA 5F20A 2W5AA 4FOBA 4CMUA 5JGBA 4ZS0A 3HAMA 5KCVA 2J0LA 2UZNA 2HZ4A 5J8IA 2OSCA 5HCXA 5I9ZA 3QTWA 4RQVA 1PXJA 3BLHA 4PUZA 5A46A 1YXXA 3OWJA 4FSTA 4XH6A 5B0XA 2P2HA 5AIRA 4BBMA 4EJ7A 3EMGA 4QNAA 3SXRA 5F4NA 3TNPC 4EQMA 3R83A 1OIYA 3SV0A 2GNHA 2H8HA 2BALA 3DK7A 4U80A 3I0QA 4R3PA 5E8UA 2QKWB 4EH3A 4QP9A 2X7OA 3PXQA 1FMOE 3C50A 2GU8A 3OWKA 1PYXA 4MVFA 5A4LA 3O2MA 5EDPA 3BV3A 3F5PA 2HENA 5J7BA 3THBA 4DCAA 3UVRA 3G9LX 3VS5A 4HCUA 4ANMA 3DGKA 4JAIA 5IISA 2Q0BA 3DJ5A 3OF0A 2FSTX 5FBOA 1ZY4A 5L2IA 4YTFA 1SVEA 4HPUE 1OL5A 1Q8UA 4CCBA 4CV8A 3FI8A 4YP8A 5LMBA 4LOQA 3L8PA 5AM7A 5T6KA 1H27A 2W99B 3DB6A 1VZOA 2QODA 2Y4PA 1WVYA 3KU2A 4U0IA 1JAMA 3ZO1A 3DK3A 3BBTB 1ZYJA 1VEBA 3A61A 4BI1A 3IDCA 3E7OA 5GZ9A 4O7WA 4E6CA 4ZY4A 4LFIA 2CLQA 2W5BA 3GU6A 4GV1A 5HO6A 4EC8A 4D4VA 2GHMA 3D7ZA 3DTCA 5A4QA 2PULA 4O27B 2OKRA 3QFVA 3RVGA 4WG5A 4WSYA 2QCSA 4PL5A 4GSBA 2BILB 5HU3A 4O0VA 3UDBA 4TN6A 1M2PA 4ANBA 3D94A 5IDPA 5L2TA 4FKIA 3BU6A 2AC5A 3PWYA 3P79A 3RK7A 4OGRA 3SRVA 2JDTA 1RW8A 4R5SA 1W8CA 3Q3BA 4ACGA 2J0IA 1WVWA 3QZIA 4LMNA 5KZ0A 3ZCLA 3ACKA 4II5A 4R1VA 2C5VA 3LKMA 3GU5A 5A9UA 4BGGA 4IBMA 3UC4A 4F9YA 3LMHA 4J95A 3WYYA 5M07A 5LMKC 2ITOA 4FNXA 4YJNA 2P3GX 5EFQA 5K3YA 3PIYA 4AN3A 1DAWA 4L00A 5HIBA 4EC9A 5AP0A 3S00A 3LVPA 2DUVA 3HDMA 4ZZMA 2C6EA 3WIKA 2R3OA 2VN9A 2VO7A 2YIWA 4ZXTA 1YWRA 2JFLA 3RAHA 3SDJA 4ACHA 3U54A 4AE9A 1LPUA 5M08A 4Q2AA 3D0EA 4Y83A 2W9ZB 2X0GA 4YZNA 4CMOA 2UUEA 1MRUA 1ZZLA 2EWAA 3K3JA 3QD4A 4LRJA 4XX9A 4BDEA 4Z55A 3QA0A 4EK4A 3ET7A 2ZM4A 5AV3A 4KS8A 4X7QA 2YWVA 3ETAA 5ACKA 3W2OA 3QU0A 1CM8A 3DS6A 4XRJA 4F9WA 5DI1A 4RA5A 1REJA 3DT1A 2G9XA 2VV9A 2ZMCA 3E87A 3S95A 3VS7A 2VRXA 3K2LA 1S9IA 3UNKA 5DEYA 4BWPA 3QYWA 5E90A 2W1GA 4DFYA 5E8XA 2PU8A 3G33A 2ITYA 1M2QA 2XZSA 3C0IA 3GC7A 4I4FA 3DK6A 4JQ7A 3KF7A 4QYFA 4F9AA 3T3UA 4C4EA 3SOCA 5DEWA 2IWIA 1GAGA 2BDFA 1FVVA 2A19B 2XNOA 3OBJA 3BYSA 3R7YA 4AWIA 3UTOA 4D2VA 2A27A 3VQHA 4D1SA 3WF8A 2YCFA 2V7OA 3CE3A 4IC8A 4HOKA 4OT6A 4QQJA 4QMTA 4XBUA 2I1MA 4LYNA 3QTUA 2IZRA 3HA6A 5J87A 3OFMA 4IEBA 5L6OA 5CAOA 2YISA 3KXHA 2WMXA 4RX8A 3UOLA 2B7AA 4O82A 2J50A 2BROA 5IH5A 4I5HA 4PP7A 3IOPA 4BHZA 1FPUA 3LJ2A 5CSVA 4M0ZA 3LAUA 4L8MA 4YPSA 3CEKA 1H1SA 1ZOGA 1CDKA 3D5VA 1H25A 5M06A 4JDJA 5BVEA 1IG1A 5H9BA 1O6KA 2IZSA 3M1SA 4GU6A 2ITPA 4QMXA 3BBWA 3GEQA 2QHNA 4QMMA 2WTCA 2UW3A 4F63A 3K5VA 1U54A 1U59A 1KE8A 3V5PA 2PE2A 3R6XA 4HYIA 2YITA 3FEGA 2R3HA 2JIUA 5D12A 2PUIA 2X4ZA 3I1AA 5ICPA 3HVCA 4BGQA 3CY2A 3ENHA 2JFMA 3F3WA 4ZTQA 1ZWSA 2ZJWA 4RJ6A 2ZYBA 3GC8A 1GZ8A 5CF8A 5M4FA 3U55A 2FUMA 2QOQA 3OS3A 4KBKA 4R77A 5CEIA 3F7ZA 4BRXA 3KY2A 2CHLA 4XG9A 4EZ7A 2GFCA 1JVPP 5CZHA 1GIHA 1NVSA 5EOBA 4TYJA 4BFMA 4XV3A 5CASA 3ATSA 4MWHA 1RE8A 4R7IA 2OXDA 3MV5A 2KTYA 5JEBA 3OG7A 3R02A 3GI3A 1KOBA 5IUHA 4BVUA 4GU9A 4EK5A 4NYEA 5ANEA 4IC7A 2VTPA 1YI6A 1KV2A 3FKOA 4GT3A 4OAUC 3LFQA 3KULB 3DA6A 3FYJX 1SM2A 3EKNA 3PXKA 3R7GA 5HEZA 4F1TA 3FUPA 3C51A 2CMWA 4NZWB 2W5HA 4ZJJA 4CSVA 3MVLA 4I5MA 4LRMA 4AW2A 4C2VA 4ZK5A 3QBNA 5AV0A 3EKKA 4BDHA 3LFAA 4U6RA 5EHOA 2XNPA 5HG9A 3F61A 5AUVA 5IZFA 3QC9A 3QUEA 3MJ1A 2ONLA 4M69B 5FWKK 4UMPA 4PF4A 3AGLA 2UW9A 5GZAA 3Q9WA 3ORLA 2V62A 4FSUA 4YJPA 3L9PA 2PZPA 3BWFA 4BCMA 4AZSA 4DEAA 2W96B 4RC4A 3SXSA 3MW1A 3BYOA 4RLKA 2LAVA 3HV4A 4A9YA 3UC3A 4D1XA 3AT4A 5EYMA 4E26A 2IVSA 2XJ2A 3PUPA 4E4LA 4I21A 2Z02A 2JGZA 4DFLA 5HORA 2X39A 3E64A 1G3NA 1V0BA 5EHYA 5L2SA 4DE4A 1BKXA 2ITUA 5K0KA 5AUTA 5LJJA 4GFGA 1M2RA 4L45A 3BZ3A 3I5ZA 3EJ1A 3PP1A 3VBTA 2R0IA 2XJ1A 4IZAA 4OTDA 5KE0A 2WMBA 1XH7A 4UX9A 2HW7A 1H24A 5EDRA 4DFNA 2CN5A 2Z7SA 4A07A 4QP8A 3OT8A 5CAUA 3AC5A 3OZ6A 3VW8A 4YJUA 1LR4A 2IVVA 2O3PA 3WZKA 4FEUA 4ZLZA 5CNNA 3N4VA 3CTQA 5C26A 4B4LA 5CYIA 4A4OA 4DFZE 2W1CA 1FGKA 4PL3A 3LZBA 3BHHA 3UP2A 4AGUA 4F6UA 2WIHA 1JKSA 2HK5A 4IW0A 5EKOA 1KUTA 4PDYA 2OXYA 3UIXA 2H96A 4GH2A 5AUZA 5FD2A 3QRUA 4QMOA 4DTAA 2VTTA 4H36A 1M7QA 4IVCA 4FV2A 5FG8A 2BRGA 4O0YA 5CX9A 3ZH8A 2OIBA 4O81A 5LMAA 3EL7A 4MBLA 3I5NA 3R0TA 4MH7A 2Y9QA 3DBQA 1P4FA 3ANQA 3UOHA 3HV7A 4MF0A 3LMIA 4XUFA 3HP5A 5CU6A 5FDXA 5A6NA 4EHVA 4X2JA 2W4KA 5AUWA 4BZNA 4XEYA 5J5SA 4D2WA 5LOHA 3KC3A 4AF3A 3PFQA 4AS0A 1UNLA 2XKFA 1Q8YA 4FTUA 5DGZA 4RJ4A 4EOMA 4TT7A 4S33A 1IR3A 1UVRA 1TQIA 1IASA 2YJRA 3HDNA 4FF8A 2VZ6A 3GQIA 4G6NA 3W8QA 4MKCA 4H3BA 3W8LA 4L46A 5JRQA 5M44A 3VBQA 4FTMA 3PY3A 3PG3A 3A62A 5HX8A 5BUJA 1PXMA 5IA1A 4PP9A 3MY0A 3ZM4A 2JIVA 2OZAB 4RSSA 1WAKA 1XR1A 4YLJA 4NSTA 5CVHA 4I0RA 3LFNA 4O21A 4DEDA 2UV2A 4FTAA 3QQKA 4XG4A 5E8YA 4EH7A 2W9FB 3NIEA 5E8ZA 2ACXA 4FTOA 1WFCA 5AP2A 4XYFA 4RQKA 3SG8A 5BMSA 3A7GA 4GIHA 3TZMA 5EYDA 2QOLA 5CY3A 4GMYA 5DG5A 5HLPA 4G16A 1GJOA 2YIYA 4JT3A 2P0CA 4TWNA 5HI2A 4E5BA 3KVXA 4G3FA 4O0RA 4FKOA 1SYKA 1YXVA 2XKCA 4GK4A 4LGDA 3RK9A 4NH1A 1CKJA 4EH9A 3OBGA 3LFEA 3EN9A 4L3JA 3HAVA 2BHEA 4NM3A 1F3MC 3IQ7A 3DKOA 4IZ7A 4QOXA 3HRCA 5D7AA 1SVHA 3FI4A 4KKHA 1WBSA 2ZV2A 3U9NA 4FT7A 4MBJA 3RCDA 3UMXA 1SNUA 3ZLXA 3DAKA 3QLGA 4Q5EA 4CFNA 2R64A 4CKIA 1CKPA 2BTSA 3Q9ZA 3O7LB 2GNGA 3QRIA 4L68A 4Y8DA 5FQDC 5HLNA 5JSMA 2JKOA 3ORMA 4W4XA 3UNZA 5HLWA 4H3PA 4O0XA 3NLBA 4F08A 5KHXA 4S32A 4IAYA 1P5EA 3FC2A 1URCA 4PY1A 3E88A 5JZNA 4MNEA 5L3AA 2W17A 2QURA 2X81A 1LEWA 3GFWA 3Q32A 3UMWA 1J7IA 3MS9A 4R5YA 2CDZA 3DLZA 4HPTE 5ETAA 3VO3A 5BVNA 2XIRA 3HV6A 4E8AA 4IX6A 5AAFA 5TO8A 4KKEA 3F5GA 2VUWA 1GIIA 3QXOA 4WKQA 3JS2A 4GS6A 4NJ3A 4TTHB 1OKWA 5FRIA 1VJYA 2R3MA 2BUJA 1BUHA 2QC6A 3G15A 3C9WA 1W98A 4EHEA 4G3CA 4RFZA 1PXNA 3BU3A 2E9OA 4FKTA 3UE4A 1GOLA 4E6AA 2VX3A 2R7BA 3R21A 1YDRE 2FA2A 4XP0A 3AXWA 4FT5A 4F7JA 4LRKA 2ITZA 4YLKA 3R1YA 3BGQA 4Q9ZA 5B2LA 3U6IA 1CTPE 3EQHA 5JFWA 3FQEA 3NW6A 3HEGA 3KFAA 5IDNA 5BQ0A 3VS4A 3T3VA 2OJJA 5KO1A 3UIMA 5ANKA 4AFEA 3PE2A 4Z16A 1DAYA 3NR9A 4FG8A 5CWZA 2O0UA 5ACBC 2PE1A 3L8XA 3RBWA 5FXSA 1R78A 2J90A 2OICA 2Z2WA 2XF0A 2GNJA 4FIIA 4FOCA 1QCFA 1WBTA 2GNIA 4OTPA 4PTGA 4DBNA 3UZRA 3JYAA 3T9TA 4JBPA 2JBPA 4UY9A 3TJCA 4N0SA 4Y46A 4USFA 3POZA 4QMYA 4GT4A 4LL0A 4AAAA 4YBKA 4BCPA 4QPAA 5IQEA 3AMAA 3L9LA 1ZYSA 2R3KA 3O50A 3OP5A 4YJTA 3D5UA 3P7CA 4MXZA 2UW4A 3I7BA 5CLPA 5HO8A 4ZY5A 4C59A 3CY3A 4QQCA 2VAGA 3ORZA 3OOMA 4G31A 3PJ8A 4WBBB 4DFBA 4I5CA 4V0GB 2HAKA 3TUBA 1XH8A 4EOQA 3OXZA 3GENA 4EYMA 1H1PA 4F7NA 2F57A 3LM0A 4YTIA 4RRVA 3OEFX 3QUDA 4EONA 3RPYA 2RSVA 3TWJA 5GJGA 3QCXA 2X7GA 5AR8A 4E5WA 3OCTA 4AZWA 2QQ7A 3HRBA 4CKRA 2VTIA 3MYGA 2WZJA 3FV8A 1YHWA 4I92A 2W1FA 1OKZA 2NNWB 3HL7A 3IK3A 3MTFA 2PVFA 4D0XA 1YOLA 1H00A 3PSCA 5KNJA 2GSFA 3QXPA 3WF5A 2PVMA 4UWCA 3ANRA 4FTTA 2Z7RA 5A54A 2XK9A 4DINA 3GBZA 1H07A 2C1AA 2XK3A 4IM3A 4XRLA 5CI7A 4ALUA 4BCFA 1DI9A 3C4EA 3F9NA 5JH6A 3D15A 4ITHA 3A7FA 3MH2A 3MPTA 1F5QA 3QGWA 3WF6A 4NM5A 5JGAA 3PP0A 2C0IA 1IA8A 3QWKA 4GG7A 2ZVAA 5HVKA 5E8SA 4C3PA 4HGLA 5HVYA 3T9IA 4UMQA 4DH5A 2QI8A 3BU5A 3GCSA 2ITTA 2E9PA 4HZSA 3V5JA 4IX5A 4DEBA 1SNXA 3O0GA 1REKA 4EUTA 5JQ5A 2CPKE 3KRLA 2VO3A 4KRCA 2C3IB 1OGUA 3IKAA 4QYEA 2WU7A 3HYHA 5BMMA 3V6RA 2ITVA 4GK2A 4E7WA 5CF5A 1V0OA 5FLFA 4ZLYA 2VWBA 4G6OA 4MXXA 4FKRA 2CCHA 2RIOA 3FBVA 1J3HA 5IQBA 2EVAA 5AV2A 2FSMX 4FZ7A 4ZLOA 5HZNA 2VTQA 5CU2A 4G9CA 3DNEA 1R0PA 1NY3A 4D9UA 4RWIA 5DPVA 4RZWA 3NSZA 1JSUA 2CGUA 2ZB0A 3MN3A 1WBWA 5CSXA 5CAPA 1Y6AA 2Y4IC 2RFSA 3LCKA 4MTAA 3IONA 3BEAA 4BIEA 5IMXA 4RC3A 4O2PA 3L8VA 5EM5A 3VAPA 1Q8TA 4YZCA 3VQUA 4N70A 1OL1A 4KIKB 4RX7A 2VGOA 5DR9A 4JQEA 2UZLA 3VWAA 4EWQA 3V3VA 4RIXB 2B54A 4BC6A 2WU6A 2YHVA 5C03A 2R3GA 3PA4A 2I40A 3FY2A 2X6DA 3BHUA 4K18A 4DLIA 3U87A 5LVNA 2WIPA 5DR6A 4X2FA 5DLSA 4C4GA 2BIKB 4O1OA 3KREA 4FK6A 3KMWA 2PVYA 3A8XA 4W9XA 3TCPA 3VUGA 3MIYA 4DH1A 2E9VA 5HESA 4PTEA 2BZKB 4HCTA 3SAYA 1JKTA 4K1BA 4UYNA 5CEQA 4BCIA 2W1ZA 2C4GA 3F5XA 3TZ8A 3RM6A 3R8VA 3KCKA 2C3KA 4W8EA 3DXQA 4NM0A 2C6IA 2G2FA 2J5FA 2J0JA 4E73A 5EI8A 1YXSA 4WUAA 3V5WA 4RPVA 1R0EA 3Q2MA 1FQ1B 3V01A 4RT7A 1OBGA 3HA8A 2R3RA 2AYPA 4KIPA 3ITZA 2HIWA 4MAOA 4LL5A 3W2CA 3RTPA 4KRDA 3GVUA 3QQGA 4YHJA 3QC4A 4TNDA 4RC2A 3ERKA 3G9NA 4UWYA 5L2QA 3WZJA 3AD5A 5DYJA 4WG3A 4L6QA 4YTCA 4RFMA 3R7OA 3KK8A 4FG9A 3R8MA 5AP5A 5HE0A 3JR1A 4FTQA 4AGCA 2NO3A 4NWMA 2YN8A 3MSSA 3ALOA 2B4SB 1Y8GA 1Z57A 3ODZX 5EW9A 2QKRA 5JN2A 3UQCA 5IH6A 4LGGA 2E9NA 3OTVA 4JBOA 5AJQA 4WIHA 4LMUA 5ANGA 1QMZA 4EH8A 4M13A 3KL8A 4ZTHA 3QF9A 3QGYA 4GFOA 3RWPA 4XS2A 4F65A 5CU3A 4O7LA 1FGIA 5B2MA 4M84A 3QYZA 3FQHA 2EXMA 3RPVA 3LQ5A 3MDYA 4O84A 4FEVA 3UBDA 5AA8A 3TM0A 2R2PA 3ZS5A 4O91A 5I4NA 4Y85A 1OL2A 3CCNA 3DLSA 4I22A 5IUGA 3QD0A 3ORPA 4UN0C 5AP3A 2JAVA 3Q04A 3RPOA 3C1XA 3K54A 2B9HA 1BI7A 2Y4IB 2CKQA 3EN5A 4ACDA 2OXXA 3KN6A 2GQSA 3VUIA 4K0YA 5E8VA 2CGXA 3II5A 2GQGA 2BIYA 2JDSA 3B2TA 4JBVA 4XCUA 2GFSA 5EKNA 4E6DA 4M0YA 5TT7A 4O96A 2VWZA 3AT3A 5AP6A 1NA7A 3DV3A 3E8NA 1KE7A 3V5TA 4ANNA 4PNKA 1Q97A 2W06A 3MA6A 4QTEA 2C6DA 2YIRA 4BCOA 1L8TA 3AD6A 3NAYA 5KHWA 4FR4A 2WMRA 4JXFA 3DBCA 4BHNA 5IEYA 3F3ZA 4X0MA 4YNOA 4RJ3A 3ZUUA 4IWPA 1YW2A 2WTWA 3VHEA 1BMKA 4D28A 5EQPA 4CD0A 2X6EA 4LGHA 5AR4A 3ULIA 4IAZA 5KMOA 2WHBA 5ANDA 5L6WL 5AR5A 2W0JA 2IW6A 4QP2A 4G34A 1L3RE 4DEIA 2ZAZA 3AMYA 2C0OA 3EYHA 4O0SA 3R1QA 2NRUA 5IEVA 2BRNA 1XH4A 3DJ7A 4JNWA 5GNKA 4XLVA 4XMOA 3TDWA 4DC2A 4IDTA 3DBFA 4FSZA 1PRYA 4RJ8A 2W1IA 4L42A 1JWHA 2QG5A 4GVAA 4NL0A 3NYOA 1WCCA 5CZIA 4RIYB 3R9NA 5KBRA 4L43A 2JAMA 3DDPA 5KMMA 4WNMA 1H1QA 3W16A 2ZDUA 1OPKA 4MD9E 3R8ZA 3QTXA 2YM3A 1YWVA 2CGVA 2EUFB 4TYHA 4JJRA 3UJGA 3REPA 3ZXTA 3BI6A 3HECA 3QQLA 4YLLA 2Z7LA 3A8WA 4U5JA 3SG9A 2C30A 3L1SA 3EQCA 3MFSA 4KABA 2FSLX 3G0EA 4YBJA 2V22A 2WMTA 5K5NA 2UVXA 2BFYA 2GNLA 3OCBA 2QOFA 4UZDA 4XG3A 3O17A 3VS3A 3SW7A 3MVHA 4J97A 4IB0A 2C5XA 2HZIA 4JX7A 4KAOA 4QMPA 1PXOA 1Y6BA 2R9SA 3V51A 4DEEA 3R2BA 4YC3A 5KX8A 4BCKA 2XCHA 3I6WA 4Q9SA 4BDFA 1YI3A 3RZFA 3VF9A 4K8AA 4U8ZA 2XS0A 4ASDA 3UOKA 4UALA 1FOTA 3EN6A 3H9OA 1AQ1A 3Q6WA 3R30A 4AP7A 3ZYAA 2PVKA 1CMKE 3FQSA 4G1WA 4TRLA 5I9YA 3CGOA 1A9UA 4KSQA 4FIEA 4P5ZA 3GQLA 5DA3A 5EOLA 3RCJA 4EOSA 3G51A 4FSWA 4OTFA 4IZ5A 5K9IA 4BDCA 3F2NA 3FZOA 4U79A 1TQPA 4QTDA 4JL9A 4MQ1A 3MESA 3BGZA 2WMQA 1I09A 4GUBA 2JKMA 4KNBA 4F7LA 2CKPA 5D10A 3U6JA 5I3OA 2BRHA 2ETRA 3QRJA 4J96A 5FP5A 2WTDA 3GU7A 4I0SA 3LM5A 4BF2A 4CQGA 5D9HA 4HW7A 3EQBA 3RNYA 1OUYA 2XH5A 5J9ZA 4NCTA 3LFDA 2YDJA 2X8EA 2B9FA 2J7TA 4A9SA 3BE9A 4FGBA 3UO4A 4ERWA 2QLQA 3QRKA 4I1ZA 2IZTA 1G5SA 3H9RA 3NDMA 4NW6A 2IJMA 3ZSGA 4AZFA 2OWBA 2YAAA 1P4OA 4UMTA 2PZYA 5IU2A 5IQCA 4GYGA 2BZJA 2NPQA 4I93A 1VYZA 3V8WA 1QL6A 3MJ2A 3B8RA 4QP3A 3NEWA 4L3LA 3LFFA 4PDOA 5D7VA 3AC3A 5AFVA 3JY9A 3COIA 5IG1A 2WTIA 4F1OA 5JGDA 4FIFA 4MCVA 3HMIA 3E93A 4OTRA 5HIDA 1OM1A 4IVDA 4EK3A 3TG1A 3IO7A 2X2KA 5J9LA 3AC8A 1T46A 4KSPA 4FV6A 3PVGA 4BDDA 2I0HA 5LMKA 3PZHA 2C5OA 1WZYA 3KXNA 5M09A 3I6UA 4L9IA 3MBLA 3BIZA 4YC6A 5CT0A 2YM5A 2OIDA 5HHWA 5K4JA 4LV8A 3W55A 3BELA 1NW1A 4CTBA 4O7VA 3O8UA 5IA3A 4ZP5A 1JQHA 3CKXA 3TZ7A 5IA2A 2JD5A 3FDNA 3Q53A 5C8KA 2W05A 4M7IA 3VBYA 1YHVA 5EH0A 3KXZA 2PZIA 3NGAA 4YUQA 4FTKA 3PY0A 1O9UA 4XHKB 3RPSA 2ZDTA 2B0QA 5GHVA 3QWJA 3R01A 5AV1A 4O86A 2XNNA 5F94A 3PDTA 1GZOA 4QPMA 3SRVB 5JK3A 5FTGA 3ID6C 3CJGA 2EXEA 2PVHA 5L2WA 2RL5A 3G90X 2OH4A 3A7IA 4RJ7A 3MFRA 4TWOA 3D14A 2IVUA 2PWLA 5IA5A 4APCA 2O8YA 4FVPA 2WD1A 4MD7E 3GP0A 4GFMA 2HZ0A 5JFXA 1YXUA 2RKUA 5LVPA 2FVDA 2YA9A 4ALVA 2XKDA 4AXAA 4FKSA 3MGYA 5AUYA 4CZUA 2BPMA 4GEOA 1OKYA 3G5DA 4FZAB 3B8QA 3Q9YA 4H1MA 4TXCA 2NP8A 1R39A 3DQWA 4HVHA 3W1FA 1ZYLA 5G1XA 4C7TA 3R1SA 1Y57A 5I9WA 3ZFMA 2OGVA 4QP1A 3P1AA 4WNOA 4EBWA 5TF9A 3D9VA 3Q4CA 3Q4ZA 4OBOA 3R00A 2YACA 3M2WA 4N6YA 3RMFA 2XK6A 1U5RA 4IIRA 4JS8A 4EOJA 3QTRA 3KKVA 4X6QC 2ONLC 4C4HA 3HLLA 4CNHA 4FIHA 4D2RA 3JUHA 3LIJA 1NVRA 3ZO3A 3FXWA 2R3LA 2O64A 1JSTA 1DM2A 5IQGA 3PSDA 5IQAA 1OL7A 5AUXA 1PXLA 4YJRA 2X8IA 3BLRA 4TYEA 4R8QA 3R9DA 4ARKA 4D58A 3ORIA 2EXCX 2IW9A 3UVPA 4BCNA 2O2UA 3G0FA 1H08A 5H2UA 5C8MA 3ZSIA 2WPAA 4Q5HA 4ID7A 2WQOA 3ZM9A 4U44A 5E8TA 3TIYA 1XH9A 4XG2A 2R3JA 4IDVA 4RFYA 5J95A 1KOAA 4OBPA 2Y6MA 5EI6A 3WIGA 4EWHA 4GT5A 4DGGA 3DAJA 4S34A 2B9JA 4UBAA 2YCRA 3QD2B 3M11A 4YJOA 5CENA 3NVKI 1V1KA 5CEKA 3QHWA 3POOA 4CFXA 3NVMB 1H4LA 4RZVA 3W33A 4F1MA 2PVRA 4MYGA 3B2WA 3OCGA 4PWNA 2JBOA 2UW5A 3MFTA 4M66A 3QL8A 2PZ5A 4GKHA 2HYYA 1UNHA 4L53A 4CFMA 2VWIA 1JSVA 5FEEA 4Z3VA 5CANA 5BUIA 3LJ0A 3V6SA 5BPYA 3FLSA 3DAEA 1U54B 4ZSEA 4FV3A 4O7TA 3VUDA 3HV5A 4D9TA 3VC4A 4N4SA 2CSNA 3G6GA 4LV5A 3VVHA 2OW3A 2IVTA 3E3BX 3FXZA 2HW6A 3DU8A 4KD1A 2WEVA 4FEXA 4GKIA 3C4CA 4FG7A 3WF9A 3A4PA 3Q96A 4YURA 1WBOA 3QZFA 2R3FA 2UVZA 1WVXA 2BAQA 4FSYA 1J91A 5KZIA 3ZBXA 2C5NA 3U4WA 2PVNA 4IFCA 4AW5A 1UV5A 1K3AA 2O5KA 4FBXA 1SVGA 2C3JA 3OHTA 3PXFA 3R9HA 2ESMA 5J1VA 4MEDA 5CU4A 1JKKA 4CV9A 4ASEA 3R8PA 2OZOA 4Y95A 4E4MA 5KMKA 1FBNA 4DG2E 3GT8A 4G5JA 3ZFXA 2WQNA 3QTQA 3SHEA 4AZEA 5GINE 4J8MA 4E20A 4DG3E 2V0DA 2QR8A 3R7IA 1K9AA 2GHLA 2OBJA 5DNRA 3WF7A 4C0TA 3FMNA 3FLQA 3LLTA 3W2QA 4BBEA 3DNDA 3NNWA 4OW8A 3QRTA 4KIQA 2XK4A 4BTJA 3VUMA 4CT2A 1PMUA 4RVMA 1XQZA 3F2RA 3OC1A 2XM8A 4P4CA 4G5PA 2XRWA 4DGOA 3SA0A 5EG3A 2JKQA 5DT0A 3C4FA 3VBWA 3ZHPC 2XBAA 3D2KA 2X4FA 4ZOGA 5HG8A 3LFCA 1Q3WA 3LCDA 4TY1A 3FLWA 3NUYA 4G6LA 2ETMA 3P78A 2OO8X 3QZHA 1ZYDA 4AT3A 4DFXE 2X9FA 2RFEA 4FL3A 3GOKA 4I24A 4ONAA 3DXPA 5CF4A 4BDAA 5CXHA 5CQUA 4F70A 3MVJA 3P4KA 3QLFA 4PX6A 5HX6A 3FKNA 2UZDA 3QX4A 5IF1A 5KKRC 4NTTA 2VTNA 4U42A 4CFWA 4IJ9A 4O83A 3FPQA 3HP2A 2BMCA 5HBHA 3PTGA 3AT2A 4UWBA 1IA9A 4NIFA 2BFXA 3MY1A 2PUNA 4W8DA 3NAXA 5EW8A 3KCFA 1HCKA 2WFYA 3QHRA 2XKEA 3HNGA 3LFSA 3ORKA 4FT0A 4FEWA 2VWUA 2VWXA 3LW0A 5A3XA 5GJDA 4YHTA 3I4BA 1UU8A 2GTNA 4O7ZA 3K5UA 4Y5HA 5IQFA 5H8GA 3NS9A 3LQ3A 4X21A 3CSVA 4JR7A 2IW8A 2CKEA 4DH7A 4EHGA 1OPLA 4ALWA 4C62A 4WNKA 3UYTA 2HY0A 4UMUA 4K33A 2YERA 3V8TA 2G15A 1Q24A 2CGWA 4XOZA 1WBVA 2UW8A 3BGPA 4EH4A 1OBDA 1YOMA 5A6OA 5HNIX 4OLIA 1BL6A 3ZRMA 2SRCA 5T3QA 3VRZA 4GRBA 4IX3A 4NTSA 2R5TA 4LOPA 3CXWA 3BWJA 4FMQA 1J1CA 2G2HA 3KRRA 3R2YA 4YO4A 1FVTA 2E9UA 2QOIA 4RA4A 4DT9A 3DZQA 3IGGA 4W4YA 4U41A 3RJCA 4CYJA 4NU1A 2XEZA 4V04A 4JDHA 4JR3A 2JIIA 5CAQA 4OAVB 2YZAA 1QPDA 2BTRA 3R28A 5LWNA 1G8AA 1WMKA 2YDIA 4RVTA 2C6KA 4IADA 3O71A 1GIJA 5A4TA 4M3QA 4I41A 4FV0A 3ZUVA 3MH0A 3OWPA 4H58A 5I9UA 1PXKA 1A06A 2JKKA 4FKJA 3WOWA 3G6HA 4PTCA 5EYKA 2OLCA 3GGFA 4XBRA 4K11A 3JY0A 4MBIA 3C4ZA 1A48A 3PXZA 1IAJA 4HGTA 4EH5A 4XG8A 4FKPA 4P5QA 4AN9A 3F88A 1S9JA 3N4TA 3LXKA 2W7XA 4CG8A 3OT3A 4H39A 4PMMA 4R3CA 1GNGA 3PXYA 4RLLA 1ZXEA 3FL4A 1YWNA 3D5WA 5FEQA 3TZ9A 4F7SA 3TUCA 3GFEA 4DA5A 3DQXA 4MD8E 5HD4A 2W4OA 3MB7A 2ERKA 3FWQA 3ZO4A 4EKKA 3D7TA 3LE6A 4S30A 2Z60A 3QX2A 4KIOA 5ANJA 2J6MA 2PK9A 5ITAA 4A4XA 3GCQA 4O1PA 5CSWA 5C4LA 2HWOA 3MH3A 1I44A 3Q9XA 5FP6A 4BIBA 2ETKA 4DEHA 4F6WA 5IA0A 5AA9A 3EYGA 4FKUA 4JVGA 2OI4X 5E8WA 4IVBA 3K3IA 3CIKA 3IG7A 1XBBA 3VNTA 5AMNA 3TI1A 3OCSA 5BYYA 4QNYA 4BDBA 4IZYA 4BYJA 5CS6A 2UZVA 1T45A 3BPRA 3QQJA 5AP4A 3R7EA 3NMUF 2OJFE 1H0VA 4PMTA 3IW8A 4YSJA 1H1WA 1RQQA 4FKVA 2XRUA 3N51A 4NEUA 4HYHA 4DF3A 4CFUA 3WZEA 5KKRB 3TKIA 4B7TA 5EM6A 2BAJA 3AC4A 4C36A 5LCJA 2G01A 2VTMA 4PDSA 4QRCA 1PW2A 4ZY6A 2J5EA 2VX1A 2UZBA 4ZTNA 4ZMFA 3A4OX 1M14A 2J2IB 4RVLA 2VU3A 5ETCA 3RINA 4AW1A 4D1ZA 4ENYA 2C6LA 4XP3A 2XIKA 2F7EE 3LPBA 3GC0A 1CSNA 4TYIA 4X2KA 4ZSGA 4ZTSA 4B8MA 4C58A 4D4YA 4MNEB 3IDBA 4XJ0A 3NCGA 5GZ8A 3UPZA 3HUBA 4FV8A 4C33A 3UZTA 3DCVA 2ZM1A 4KUJA 1QPCA 3GC9A 4WHZA 3RHXA 3RI1A 3IS5A 3ALNA 4E4NA 4D2SA 2JDOA 2ZV8A 2R3PA 5EQEA 3UNJA 4FSRA 3NNUA 5HIEA 2GS6A 2Z7QA 3H0ZA 4BCHA 2OH0E 4DT8A 2WB8A 4FV9A 2KULA 4J99A 3AGMA 5D41A 3L9NA 4JBQA 4QT1A 4CTCA 2OG8A 4IWDA 2PUPA 5LCKA 4ASXA 3PVUA 4TW9A 3JPVA 4DH8A 3NYVA 4DTBA 3CTJA 4GIIA 3NUSA 4JDKA 3RWQA 3HMNA 2Y0AA 4QTAA 2IO6A 2I7QA 2VWVA 3GXLA 1QPJA 4H1JA 5C9CA 5TR6A 3BHYA 3VUHA 4IHPA 2IZUA 1ZOHA 4PPAA 4QMWA 2B55A 4E3CA 4UXQA 3DDQA 4V01A 3RALA 4APPA 4I4EA 4WD5A 4ERKA 1STCE 4O0WA 3O7LD 4FYOA 4HVGA 1W83A 4EZ5A 1Q41A 2LGCA 4XV1A 1PYEA 4M8TA 3TEIA 2FYSA 3TACA 3CQUA 4H3QA 2GHGA 5CEPA 4BICA 4EOIA 4BN1A 1H26A 2GNFA 3DKFA 3P9JA 2F2UA 4C35A 3DJ6A 3FHIA 4JX3A 3R7UA 2WEIA 3E92A 5HE2A 3WI6A 4EZ3A 3QUPA 3O23A 3FZPA 5J79A 2Y8OA 3A99A 4IAFA 4JG7A 4X3FA 2VTOA 5EDQA 3BV2A 3L9MA 4AFJA 4I6FA 5HBJA 5LVMA 2XIYA 3EZRA 1PXIA 3NX8A 2ZB1A 5M56A 4R3RA 4G2FA 4ZMEA 1WBNA 1PMVA 2YM7A 5IUIA 3P7AA 5HTBA 2BDWA 4D2PA 2VTAA 1YDSE 4IM0A 3V5QA 5K4IA 4Y72A 4UB7A 4GJ2A 1PJKA 3C0HA 4FICA 5DR2A 3UYSA 5M51A 2VTLA 2VNYA 4D4RA 2GS2A 3OW3A 3HZTA 1ERKA 1PHKA 4RGJA 5LVLA 3RZBA 4D0WA 4EYJA 3QTSA 2YFXA 3FHRA 4BTMA 4U45A 1V0PA 2B1PA 3RNIA 4CRSA 1Q99A 1Q5KA 4U40A 2XIXA 4P90A 1KV1A 1ZARA 3ACJA 2YJSA 3FSFA 4RIWB 3ZLWA 3F69A 4IQ6A 5HVJA 3RPRA 4QMQA 4JIKA 4WNPA 5CALA 3TXOA 3DBEA 2P2IA 1Y91A 3UQFA 3BQRA 3FMKA 4FV1A 4WSQA 3RGFA 2PL0A 4XG7A 4C4FA 1B38A 2UZUE 5CF6A 2FSOX 3AG9A 4TWPA 1KE6A 3LJ1A 4TNBA 4YZ9A 2WTKC 2UW7A 4TZRA 2H34A 4WUNA 5CEOA 1MQBA 3GB2A 1KWPA 1JBPE 3HMOA 5M57A 5IQDA 2PMNX 4XLIA 2QD9A 2UZTA 3R71A 4NFNA 4A4LA 3HV3A 4IJPA 2QU6A 5A4EA 2VTSA 2CNQA 3UZPA 4XNEA 2UZEA 5I0BA 3PWDA 3E8DA 3LXLA 4RG0A 5L6PA 1UKIA 3F2AA 4L44A 4E6QA 4EK8A 5TE0A 4K9YA 4QMNA 2PYWA 4FUYA 3BX5A 5KMLA 2HOGA 1XBAA 2C6TA 4KBAA 2R7IA 5HU9A 1J7LA 2Y6OA 3V5LA 4TYGA 3RAKA 2J0MB 3FZTA 4K6ZA 1OI9A 2BRBA 5FBNC 2VNWA 3BE2A 2AC3A 5BYZA 3GU4A 3WE8A 4AOIA 4AACA 5M4CA 4C3RA 1YI4A 3QCSA 1GY3A 5HE3A 3LMGA 2Q83A 2FGIA 3TUDA 3NZ0A 1U5QA 1ATPE 2WO6A 5CSHA 1KSWA 3TN8A 5IH4A 3TKHA 3C0GA 5LWMA 1VR2A 2WTJA 2XK7A 4QYGA 5CNOA 4XOYA 5IMEA 1BX6A 2HWPA 4KA3A 5LVOA 5H3QA 3HMMA 2REIA 3OWLA 1PF8A 4YGAA 3UO6A 5H8BA 3IW6A 4HJOA 5HCZA 1OZ1A 4TL0A 2X9EA 1XBCA 5C27A 1H8FA 4FVRA 4NKSA 2C3LA 3TV4A 2QU5A 3VUKA 5HG5A 3LCSA 3DBDA 3PY1A 2QOHA 5AX3A 2OFVA 3IPHA 4IX4A 4WA9A 3PYYA 4CZYB 3PJCA 1ZOEA 3KA0A 4LUDA 4NM7A 3R8UA 3QZGA 4ACCA 3HX4A 4YZBA 2E2BA 3CJFA 3UG1A 4ZSJA 4A9RA 2A0CX 4NUSA 3QTIA 4FTRA 4IACA 4NT4A 3RAIA 2F7ZE 3EQRA 4FA2A 5JKGA 4R7BA 4XG6A 3VULA 1JOWB 1H0WA 2Z8CA 4OTHA 2ITWA 2HXQA 2JC6A 3FLZA 3VHKA 3CBLA 4DAWA 5K0XA 4UV0A 2BCJA 2YAKA 2B9IA 2XNMA 2OFUA 2WTVA 4O0TA 1XO2B 4UXLA 4QQ5A 5KMJA 3RAWA 3VS0A 4FL1A 4P7EA 5IEXA 2PHKA 5FXQA 4AOJA 2UW6A 2ERZE 3WE4A 2QO7A 3OW4A 2YWPA 4PMSA 2ITNA 3LXNA 2XJ0A 1BLXA 4B99A 3P08A 3FZSA 3P0MA 4ITJA 3E8EA 4YZDA 4GL9A 5CT7A 4CYIA 3NUAA 4AN2A 4TPTA 4WG4A 5AX9A 3OUKA 3ZSHA 2YIQA 3BYVA 3ENMA 3ZBFA 3PPJA 1ZAOA 3QCYA 3ZO2A 4KBCA 1UNGA 5JRSA 4DG0E 5BNJA 4ZTLA 3IW4A 3VUTA 4JDIA 3ZONA 1YXTA 2WMAA 5I5ZA 2WTKB 3OY1A 4AGWA 4FNZA 4BZDA 4FNWA 3SXFA 3SD0A 1H1RA 2WQBA 4CRLA 2I0YA 4BCJA 3F7WA 3NW7A 5E4HA 1YDTE 5FDPA 3GOPA 4I0TA 5JQ8A 5LXMA 5ANIA 5ETIA 2YLEA 3UGCA 2G1TA 4OR5A 5FEDA 2RG5A 4H05A 4IVAA 3R22A 2YDKA 1Z5MA 1Q61A 4YPDA 4C8BA 2J9MA 4NFMA 4AX8A 1J7UA 2OIQA 3Q2JA 4MNFA 3VN9A 4HNFA 3CS9A 4AG8A 5FUTA 1E1VA 2CJMA 3D5XA 4EUUA 2GS7A 1AD5A 1GZKA 3MVMA 3QKMA 4O7SA 4FIJA 4NCTC 1OL6A 3ULZA 3PA5A 4ZSAA 5IKWA 3CKWA 3W10A 4OTWA 2WMUA 1XHAA 3PRIA 3H9FA 3Q4UA 3FMMA 3SOAA 3PPZA 3KXXA 5HTCA 4K2RA 2WGJA 1YRPA 4EHZA 4YO6A 3MPAA 3FL5A 4EI4A 4N6ZA 4IAIA 2W4JA 1J1BA 1LP4A 2VO6A 2OU7A 2X1NA 4ANQA 2UW0A 4OBQA 4DGLC 4PL4A 3OY3A 4EQUA 3W2SA 3E5AA 2QNJA 5GIPE 4BTKA 4QQTA 3PPKA 3ZMMA 3R7VA 2F4JA 2PMLX 1UA2A 3COMA 1PMNA 3LFBA 4RMZA 4NK9A 5DN3A 2YM4A 3I60A 4QTBA 3QCQA 2BDJA 5L4QA 3R8LA 3NNVA 3IW5A 3AC2A 1UU3A 1B6CB 1MP8A 3A7JA 4D5HA 4O7NA 3UIBA 4C4IA 4CXAA 3F66A 3VBXA 3IOKA 4EK6A 4FGRA 2VTJA 1ZRZA 2YCSA 3U51A 4JI9A 4WT6A 4KINA 3WZDA 3DOGA 1OKVA 2WXVA 3ZU7A 1ZMVA 5AR7A 3W18A 2ZM3A 4BCGA 5LQFA 4BDJA 4M68A 3FLYA 2WOUA 4JG8A 2YM8A 4FV5A 4TYHB 1IRKA 4IB1A 3TTJA 4AOTA 1ZYCA 2H6DA 5BVFA 2XBJA 3CLYA 4CZTA 3UP7A 2WMVA 3DZOA 4JAJA 5IQHA 1OVEA 3VJNA 4MHAA 4S31A 2QO9A 1M52A 4N57A 3AMBA 3ORTA 4X2NA 5HD7A 1W82A 4FVQA 4EOOA 2PVLA 4UYAA 1PKDA 5AP7A 3CPCA 5EK7A 3TT0A 5AAEA 4BIDA 3SGCA 3E3PA 3HUCA 1TQMA 2CLXA 3P5KA 3QD3A 4LG4A 5EM8A 4A06A 4EL9A 3O51A 4MXCA 3FI3A 4YNEA 5M53A 1IEPA 4PDPA 2YABA 4GCJA 1OIUA 3MFUA 4BBFA 3KULA 4D4SA 1PKGA 1U46A 2JDVA 2X8DA 5FM3A 4A9UA 4ZJVA 5JFVA 4YJSA 1TVOA 2C68A 3EQFA 4QTCA 5HKMA 5J5TA 2QR7A 3RKBA 3WBLA 5DFPA 3KF4A 2OF2A 5JT2A 5E9EA 3BLQA 3BKBA 1YVJA 4R1YA 4AUAA 3S1HA 5DE2A 3O8TA 4IM2A 4FKLA 1MQ4A 4O38A 3QKKA 4AZTA 4FKQA 2BKKA 3OEZA 4WRGA 3ZRKA 4M69A 2XIZA 5FGKA 3EHAA 3DY7A 3KXGA 1U4DA 4I20A 2BHHA 1UU7A 5M55A 2NRYA 3NRMA 3O96A 4R78A 1XKKA 2GDOA 3H10A 3IW7A 4FTLA 4TKSA 4Z7GA 4CFFA 3OXIA 2C5YA 3WZUA 2C1BA 2CKOA 4U43A 5DT4A 1HCLA 4EOKA 4J7BA 3DKGA 2JDRA 3OVVA 3MIAA 4J8NA 2P55A 3BQCA 2RG6A 4BY9E 2I6LA 3AQVA 4IAAA 4L7FA 5KMIA 4CFVA 3P7BA 3FZ1A 3JVRA 5L8JA 5AUUA 2F49A 3F3UA 5HG7A 4C61A 4JRVA 3NUXA 4DEGA 4TWCA 1Q62A 4FODA 3MY5A 5CQWA 4EEVA 3LCOA 4HCVA 4K77A 2XMYA 2J4ZA 2QONA 4FNYA 4M97A 3VBVA 4BCQA 5DVRA 4USDA 4HGEA 3E8CA 3TIZA 4KKGA 4DYMA 3FI2A 2QVSE 3ROCA 5J9YA 3ZLYA 2W1DA 5TOZA 1JKLA 2EB2A 3DXNA 3PJ1A 2XUUA 3EFWA 3QQHA 3F6XA 4JLCA 4L7SA 1QPEA 4I6BA 4F0IA 3FC1X 1GZNA 4G3DA 5DT3A 4BYIA 1XH6A 5EI2A 1YOJA 5HOAA 4BKJA 4W4WA 3H3CA 4UMRA 4O7RA 2HCKA 3KMMA 3JXWA 3MI9A 4F9BA 3S2PA 5K5XA 2IG7A 2I0VA 1F0QA 2BZHB 2PPQA 1URWA 2BZIB 3DFCB 3S0OA 4DFUA 2DQ7X 4LQMA 2XCKA 3S4QA 4ZIMA 3L8SA 5AV4A 5TKDA 2PVJA 4EH6A 1OB3A 3KXMA 1NT2A 1UKHA 4RJ5A 2O63A 5ETFA 3WYXA 3FPMA 4CEGA 1WBPA 3C13A 5A14A 3NCZA 4W9WA 4X3JA 4GG5A 1W84A 4ANOA 1NVQA 4QMVA 4AT5A 3C7QA 3ZLSA 4BGHA 4U81A 1XWSA 4E5AX 4CQEA 3FKLA 4YC8A 1MRVA 1BYGA 3EL8A 3R1NA 4ORKA 3CQEA 1YHSA 4FK3A 2QOKA 4XP2A 4BKZA 4DITA 4EQCA 5GIOE 1Q8WA 4FSMA 4I5PA 1K2PA 3QKLA 3ZC6A 3H0YA 4O7YA 2BVAA 1PY5A 4W4VA 5KUPA 1APME 1BI8A 4IB5A 5HTIA 2HXLA 3Q5ZA 2DYLA 5DIAA 3BYUA 2OZAA 4L52A 4C34A 2OJ9A 1W0XC 4FL2A 5LARA 3R04A 4FYNA 5C01A 2YIXA 3TNWA 3Q60A 5HGIA 3F5UA 2QOOA 4Y5QA 1O6LA 5ANOA 4FSQA 4U7ZA 5C4KA 4USEA 2PE0A 4ENXA 3ZFYA 1HOWA 3PA3A 3GCPA 3SKCA 4XV2A 2XVDA 3FXXA 2ZOQA 4Y73A 5J7HA 3BHVA 3LOKA 5EQYA 2VGPA 3JVSA 3NIZA 4IWOA 5AEPA 4FI1A 5B7VA 3H4JA 3Q4TA 4QP6A 4ZEGA 2F2CB 4NKAA 3R9RA 3PIXA 5E91A 3Q5IA 3SC1A 1XH5A 1EH4A 3COKA 4QYYA 4ZS4A 3ODYX 5J1WA 4ZZOA 5JZJA 3ORNA 3BHTA 3A7HA 4RVKA 2WOTA 4ANSA 2YLFA 3FZRA 2WQEA 3PXRA 2PY3A 5AADA 2HY81 3HMPA 5GJFA 4ZZNA 3C5IA 5FM2A 4FV7A 3OROA 2BR1A 3EFLA 4G3EA 4L3PA 3BRBA 4WRSA 4FTCA 2QLUA 2C0TA 3TKUA 3DKCA 3ZZWA 4CCUA 3FJQE 3P86A 4UEUA 3ATTA 3MWUA 3NYNA 3TV6A 4B8LA 1ZZ2A 3DTWA 1OUKA 4S2ZA 4AZVA 2W1HA 4ACMA 3SX9A 4DGMA 5DRBA 5C8NA 3QTZA 3TNIA 3N9XA 3MPMA 3Q52A 1M17A 5AIKA 3ZDIA 4QMZA 2C69A 4MWIA 4ANLA 3TDVA 4PRJA 2CN8A 2B53A 4PPCA 1UWJA 4AT4A 3NUUA 4P2KA 4V05A 4F09A 2R4BA 4O6LA 4AU8A 3C4WA 3PG1A 4BB4A 3KGAA 4CMTA 5JFSA 4WO5A 3W2PA 5FTOA 2GTMA 5H8EA 2QHMA 2OJGA 3BYMA 3H30A 3UODA 4DGNA 4UZHA 4YZMA 4HNIA 5DWRA 4EJNA 4EKLA 3MB6A 3TNHA 2GQRA 3PVWA 4J98A 3PLAE 3V8SA 2PUUA 2UVYA 2VTRA 4RWJA 3LQ8A 2R3QA 3N4UA 5IPJA 2VTHA 4B6LA 3VW6A 3E7VA 5HICA 1P2AA 1PXPA 2IPXA 4CLIA 2A1AB 4YHFA 2XNEA 4RIOA 4ITIA 2R3IA 3CTHA 3DPKA 2I0EA 4CG9A 3FY0A 4HGSA 4M67A 1G8SA 4E4XA 3AD4A 2RFDA 3EWHA 3KB7A 4IE9A 1Q3DA 3I0OA 4FSNA 4FX3A 1MRYA 3EQPA 2QG7A 3TNQB 3PIZA 5EM7A 5AAGA 4RWLA 5BVOA 2BKZA 3KVWA 3NUNA 4YR8A 2YEXA 5BYLA 4I3ZA 3SLSA 4ZJIA 3OTUA 4V0GA 2UZWE 3NWWA 1ZLTA 4KB8A 4QP7A 5F1ZA 4JOAA 2J51A 3MTLA 5DMZA 3FMDA 5AM6A 5E1EA 4MX9A 3U4UA 2VX0A 2UZOA 3ORXA 4FKWA 5KBQA 3F82A 4CKJA 2ZMDA 5G6VA 3M42A 3TL8A 2O65A 2PMIA 3ZC5A 3D2IA 3QQFA 4DH3A 5IA4A 3ZDUA 3Q6UA 3SW4A 2A4LA 2OF4A 3ZTXA 1Q8ZA 4HVIA 4BWXA 4AE6A 4BI2A 5HCYA 4JRNA 4J1RA 4L01A 2YZLA 4QP4A 2ITQA 4MK0A 1OITA 4E1ZA 5M4UA 2XA4A 2J0KA 2XYUA 4BWKA 3VF8A 5KMNA 3GCUA 3F3TA 2P33A 1JPAA 4M12A 3AOXA 5BX0A 5BVDA 4MF1A 5FTQA 4NIFB 2W1EA 3CR0A 2V55A 5HBEA 3A60A 4F64A 2YCQA 3CD3A 2G2IA 4JIAA 3EQIA 4IH8A 4ZAUA 3LXPA 3EQDA 4FE2A 4CGAA 5DH3A 3PVBA 3T8OA 3RK5A 1ND4A 5JMSA 4AA0A 4FT3A
chains in the Genus database with same CATH superfamily
4EH2A 4GJ3A 3NPCA 4G9RA 2RGPA 5EHLA 4FZ6A 3AC1A 3R73A 2QOBA 3EQGA 3KK9A 3FMHA 3RP9A 2IF8A 2PTKA 1DI8A 2XB7A 2X7FA 3EOCA 4M15A 4O22A 4YSMA 4O2ZA 3FE3A 4F0FA 3BLAA 3NUPA 4QMUA 4I6QA 2GCDA 3ROYA 5CTPA 3E63A 4BDIA 3DB8A 2JLDA 2F9GA 3SQQA 3UDTA 5F95A 4F4PA 4YJQA 3I79A 4QPSA 4XV9A 1OIRA 4BKYA 2A2AA 2XM9A 3IGOA 4DLJA 2FH9A 3CPBA 4DHIB 4PV0A 4IXPA 3UG2A 3RM7A 3ZZEA 4D55A 4GUEA 3EIDA 3NYXA 3MH1A 5CVGA 1Z9XA 4X2GA 4EOLA 2EB3A 1E9HA 5DBXA 4DTKA 4J71A 5AR3A 4C3FA 5I9XA 4KIKA 4E93A 4C2WA 3D4QA 4RWKA 5E92A 4RIXA 5FXRA 1SMHA 1H01A 3CC6A 1UWHA 3EN7A 4F6SA 4C38A 4OUCA 4BR3A 3KRJA 2OK1A 4I94A 4B0GA 3OD6X 5HQ0A 2B52A 3ZOSA 4Z9LA 4G3GA 4MXOA 3CQWA 4OTIA 5CEMA 4FIGA 1CKIA 3OUNB 5CVFA 1OIQA 4DBXA 1JLUE 2V5QA 2EU9A 4GVJA 4X3FC 5EW3A 4FTNA 2FB8A 2VWWA 4WBOA 4DN5A 1X8BA 2AUHA 3I81A 3QA8A 4RIWA 3GU8A 3D7TB 4X6RA 3HGKA 3PLSA 4FV4A 2JEDA 2GMXA 3GCVA 3KEXA 1P14A 4QD6A 3U9CA 5CI6A 3A2CA 1FVRA 4FKGA 4IB3A 2X2LA 1VYWA 2XK8A 3W2RA 5E7RA 1DS5A 5HNGA 5L8KA 3EZVA 4HVSA 5C1QB 2PZRA 3DFAA 2WKMA 3LCTA 4FUXA 4AGDA 3EFJA 1SZMA 2VD5A 4O6EA 2CCIA 4LM5A 4C02A 4MXYA 1XJDA 4AW0A 4EORA 2OJIA 2CNVA 2JITA 2XNGA 4I6HA 3R9OA 3UO5A 4BI0A 1UU9A 4FTIA 2X2MA 5IQIA 4NW5A 4J53A 3PRFA 4U3ZA 3BEGA 2BRMA 4OTGA 3W32A 3GNIB 5T68A 4AA5A 4NJDA 4AQCA 3MA3A 4R7HA 5BVKA 3LLAA 4A7CA 1FINA 2VWYA 3FMJA 3HKOA 3FMEA 3OMVA 4QO9A 4YTHA 2C6MA 2ITXA 4OT5A 1H28A 1Q4LA 1R3CA 1AGWA 4PQNA 3LHJA 3PJ2A 1E1XA 3QAME 4HZRA 1OECA 3EB0A 3ZRLA 4D5KA 5D11A 3UVQA 4BDKA 4L67A 4YMJA 2WMSA 5F9EA 4O4EA 3ELJA 4QMLA 5BUEA 4FZDB 2ZV7A 4FEQA 5CAVA 5CU0A 4JG6A 3F3VA 1B39A 3VIDA 1ZY5A 3ZEWA 2HELA 3U6HA 1MUOA 2WELA 2QOCA 5AP1A 5DOSA 3FMLA 4BZOA 3BCEA 4FZFB 4HYSA 4I23A 1R1WA 4KS7A 4ASZA 1OPJA 2RF9A 4JQ8A 3E62A 4QYHA 3WILA 2IN6A 5B2KA 4BTFA 3VS1A 4ZTMA 2DWBA 3QQUA 5HE1A 4U9AA 4CVAA 3EN4A 3FSKA 2Q0NA 2Y7JA 4U3YA 1KE9A 4YJVA 2CNUA 2WAJA 3NNXA 5I3RA 1LEZA 4C57A 4DHFA 4DDIA 3WARA 4GYIA 3SVVA 1RJBA 4QMSA 3HRFA 2H9VA 4F99A 2GPHA 1M7NA 2XEYA 3PJ3A 2WMWA 2V7AA 3O8PA 3UPXA 3AKJA 1YKRA 3EH9A 4R6VA 2QO2A 5DHJA 4B9DA 4ZTRA 5DRDA 3VS2A 4DCEA 4D2TA 2HZNA 4EBVA 4BDGA 2ZV9A 3PZEA 3QALE 2FO0A 3OXTA 3PSBA 4IMYA 1ZMWA 4FTJA 4F0GA 3C5UA 4LUEA 3UOJA 3NW5A 3V04A 1TKIA 4Z7HA 4CLJA 5I9VA 3ZUTA 4IWQA 3ZXZA 3S3IA 4X3FB 1JNKA 4RBLA 4OTQA 3PE1A 3KRWA 2XYNA 4O0UA 1W7HA 4WOVA 4IFGA 1PMEA 3U8WA 3KRXA 1RDQE 2C6OA 5M4IA 4MQ2A 5AWMA 5BVWA 5EYCA 4J52A 3VS6A 1G8JA 2F7XE 4FC0A 2XNBA 3UIUA 2C47A 3IECA 4RIYA 4G17A 4PNIA 5L8LA 3IDPA 5AR2A 3R63A 4LOOA 3CGFA 2XP2A 4M14A 1Y8YA 2DS1A 3CD8A 2BAKA 3CP9A 3FYKX 2PMOX 4FT9A 3I7CA 5D1JA 4F9CA 3TTIA 3FLNC 5A4CA 5HO7A 2P4IA 2VO0A 1BL7A 4IANA 3UQGA 4ZSLA 4GW8A 1FMKA 5HNBA 1XMLA 3P23A 5CXZA 3GUBA 1KE5A 3KMUA 2RFNA 3VJOA 3PFYA 3FAAA 4C37A 1IAHA 4AXEA 4CT1A 3D83A 4C4JA 1YQJA 4A9TA 3VRYA 5E1SA 4IAKA 4EOPA 3RHKA 3TV7A 2YM6A 3C4XA 2R3NA 2PSQA 2R0UA 4AA4A 5CSPA 3KQ7A 4LI5A 3EFKA 3TJDA 2WNTA 4YU2A 3G2FA 4HYUA 4PPBA 1O6YA 4PMPA 3COHA 1OMWA 1NXKA 3KN5A 3OOGA 4MXAA 3ZEPA 4BL1A 4HVDA 4RX5A 4RX9A 4GK3A 2WQMA 4KWPA 4U97A 1ZMUA 1LUFA 5F20A 2W5AA 4FOBA 4CMUA 5JGBA 4ZS0A 3HAMA 5KCVA 2J0LA 2UZNA 2HZ4A 5J8IA 2OSCA 5HCXA 5I9ZA 3QTWA 4RQVA 1PXJA 3BLHA 4PUZA 5A46A 1YXXA 3OWJA 4FSTA 2X0OA 4XH6A 5B0XA 2P2HA 5AIRA 4BBMA 4EJ7A 3EMGA 4QNAA 3SXRA 5F4NA 3TNPC 4EQMA 3R83A 1OIYA 3SV0A 2GNHA 2H8HA 2BALA 3DK7A 4U80A 3I0QA 4R3PA 5E8UA 2QKWB 4EH3A 4QP9A 2X7OA 3PXQA 1FMOE 3C50A 2GU8A 3OWKA 1PYXA 4MVFA 5A4LA 3O2MA 5EDPA 3BV3A 3F5PA 2HENA 5J7BA 3THBA 4DCAA 3UVRA 3G9LX 3VS5A 4HCUA 4ANMA 3DGKA 4JAIA 5IISA 2Q0BA 3DJ5A 3OF0A 2FSTX 5FBOA 1ZY4A 5L2IA 4YTFA 1SVEA 4HPUE 1OL5A 1Q8UA 4CCBA 4CV8A 3AKLA 3FI8A 4YP8A 5LMBA 2NYAA 4LOQA 3L8PA 5AM7A 5T6KA 1H27A 2W99B 3DB6A 1VZOA 2QODA 2Y4PA 1WVYA 3KU2A 4U0IA 1JAMA 3ZO1A 3DK3A 3BBTB 1ZYJA 1VEBA 3A61A 4BI1A 3IDCA 3E7OA 5GZ9A 3NFGB 4O7WA 4E6CA 2IEWA 4ZY4A 4LFIA 2CLQA 2W5BA 3GU6A 4GV1A 5HO6A 4EC8A 4D4VA 2GHMA 3D7ZA 3DTCA 5A4QA 2PULA 4O27B 2OKRA 3QFVA 4O4FA 3RVGA 4WG5A 4WSYA 2QCSA 4PL5A 4GSBA 2BILB 5HU3A 4O0VA 3UDBA 4TN6A 1M2PA 4ANBA 3D94A 5IDPA 5L2TA 4FKIA 3BU6A 2AC5A 3PWYA 3P79A 3RK7A 4OGRA 3SRVA 2JDTA 1RW8A 4R5SA 1W8CA 3Q3BA 4ACGA 2J0IA 1WVWA 3QZIA 4LMNA 5KZ0A 3ZCLA 3ACKA 4II5A 4R1VA 2C5VA 3LKMA 3GU5A 5A9UA 4BGGA 4IBMA 3UC4A 4F9YA 3LMHA 4J95A 3WYYA 5M07A 5LMKC 2ITOA 4FNXA 4YJNA 2P3GX 5EFQA 5K3YA 3PIYA 4AN3A 1DAWA 4L00A 5HIBA 4EC9A 5AP0A 3S00A 3LVPA 2DUVA 3HDMA 4ZZMA 2C6EA 3WIKA 2R3OA 2VN9A 2VO7A 2YIWA 4ZXTA 1YWRA 2JFLA 3RAHA 3SDJA 4ACHA 3U54A 4AE9A 1LPUA 5M08A 4O4BB 4Q2AA 3D0EA 4Y83A 2W9ZB 2X0GA 4YZNA 4CMOA 2UUEA 1MRUA 1ZZLA 2EWAA 3K3JA 3QD4A 4LRJA 4XX9A 4BDEA 4Z55A 3QA0A 4EK4A 3ET7A 2ZM4A 5AV3A 4KS8A 4X7QA 2YWVA 3ETAA 5ACKA 3W2OA 3QU0A 1CM8A 3DS6A 4XRJA 4F9WA 5DI1A 4RA5A 1REJA 3DT1A 2G9XA 2VV9A 2ZMCA 3E87A 3S95A 3VS7A 2VRXA 3K2LA 1S9IA 3UNKA 5DEYA 4BWPA 3QYWA 5E90A 2W1GA 4DFYA 5E8XA 2PU8A 3G33A 2ITYA 1M2QA 2XZSA 3C0IA 3GC7A 4I4FA 3DK6A 4JQ7A 3KF7A 4QYFA 4F9AA 3T3UA 4C4EA 3SOCA 5DEWA 2IWIA 1GAGA 2BDFA 1FVVA 2A19B 2XNOA 3OBJA 3BYSA 3R7YA 4AWIA 3UTOA 4D2VA 2A27A 3VQHA 4D1SA 3WF8A 2YCFA 2V7OA 3CE3A 4IC8A 4HOKA 4OT6A 4QQJA 4QMTA 4XBUA 3BL7A 2I1MA 4LYNA 3QTUA 2IZRA 3HA6A 5J87A 3OFMA 4IEBA 5L6OA 5CAOA 2YISA 3KXHA 2WMXA 4RX8A 3UOLA 2B7AA 4O82A 2J50A 2BROA 5IH5A 4I5HA 4PP7A 3IOPA 4BHZA 1FPUA 3LJ2A 5CSVA 4M0ZA 3LAUA 4L8MA 4YPSA 3CEKA 1H1SA 1ZOGA 1CDKA 3D5VA 1H25A 5M06A 4JDJA 5BVEA 1IG1A 5H9BA 1O6KA 2IZSA 3M1SA 4GU6A 2ITPA 4QMXA 3BBWA 3GEQA 2QHNA 4QMMA 2WTCA 2UW3A 4F63A 3K5VA 1U54A 1U59A 1KE8A 3V5PA 2PE2A 3R6XA 4HYIA 2YITA 3FEGA 2R3HA 2JIUA 5D12A 2PUIA 2X4ZA 3I1AA 5ICPA 3HVCA 4BGQA 3CY2A 3ENHA 2JFMA 3F3WA 4ZTQA 1ZWSA 2ZJWA 4RJ6A 2ZYBA 3GC8A 1GZ8A 5CF8A 5M4FA 3U55A 2FUMA 2QOQA 3OS3A 4KBKA 4R77A 5CEIA 3F7ZA 4BRXA 3KY2A 2CHLA 4XG9A 4EZ7A 2GFCA 1JVPP 5CZHA 1GIHA 1NVSA 5EOBA 4TYJA 4BFMA 4XV3A 5CASA 3ATSA 4MWHA 3TYKA 1RE8A 4R7IA 2OXDA 3MV5A 2KTYA 5JEBA 3OG7A 3R02A 3GI3A 1KOBA 5IUHA 4BVUA 4GU9A 4EK5A 4NYEA 5ANEA 4IC7A 2VTPA 1YI6A 1KV2A 3FKOA 4GT3A 4OAUC 3LFQA 3KULB 3DA6A 3FYJX 1SM2A 3EKNA 3PXKA 3R7GA 5HEZA 4F1TA 4DDGA 3FUPA 3C51A 2CMWA 4NZWB 2W5HA 4ZJJA 4CSVA 3MVLA 4I5MA 4LRMA 4AW2A 4C2VA 4ZK5A 3QBNA 5AV0A 3EKKA 4BDHA 3LFAA 4U6RA 5EHOA 2XNPA 5HG9A 3F61A 5AUVA 5IZFA 3AKKA 3QC9A 3QUEA 3MJ1A 2ONLA 4M69B 5FWKK 4UMPA 4PF4A 3AGLA 2UW9A 5GZAA 3Q9WA 3ORLA 2V62A 4FSUA 4YJPA 3L9PA 2PZPA 3BWFA 4BCMA 4AZSA 4DEAA 2W96B 4RC4A 3SXSA 3MW1A 3BYOA 2X0QA 4RLKA 3W0OA 2LAVA 3HV4A 4A9YA 3UC3A 4D1XA 3AT4A 5EYMA 4E26A 2IVSA 2XJ2A 3PUPA 4E4LA 4I21A 2Z02A 2JGZA 4DFLA 3TMOA 5HORA 2X39A 3E64A 1G3NA 1V0BA 5EHYA 5L2SA 4DE4A 1BKXA 2ITUA 5K0KA 5AUTA 5LJJA 4GFGA 1M2RA 4L45A 3BZ3A 3I5ZA 3EJ1A 3PP1A 3VBTA 2R0IA 2XJ1A 4IZAA 4OTDA 5KE0A 4DHJA 2WMBA 1XH7A 4UX9A 2HW7A 1H24A 5EDRA 4DFNA 2CN5A 2Z7SA 4A07A 4QP8A 3OT8A 5CAUA 3AC5A 3OZ6A 3VW8A 4YJUA 1LR4A 2IVVA 2O3PA 3WZKA 4FEUA 4ZLZA 5CNNA 3N4VA 3CTQA 5C26A 4B4LA 5CYIA 4A4OA 4DFZE 2W1CA 1FGKA 4PL3A 3LZBA 3BHHA 3UP2A 4AGUA 4F6UA 2WIHA 1JKSA 2HK5A 4IW0A 5EKOA 1KUTA 4PDYA 2OXYA 3UIXA 2H96A 4GH2A 5AUZA 5FD2A 3QRUA 4QMOA 4DTAA 2VTTA 4H36A 1M7QA 4IVCA 4FV2A 5FG8A 2BRGA 4O0YA 5CX9A 3ZH8A 2OIBA 4O81A 5LMAA 3EL7A 4MBLA 3I5NA 3R0TA 4MH7A 2Y9QA 3DBQA 1P4FA 3ANQA 3UOHA 3HV7A 4O4DA 4MF0A 3LMIA 4XUFA 3HP5A 5CU6A 5FDXA 5A6NA 4EHVA 4X2JA 2W4KA 5AUWA 4BZNA 4XEYA 5J5SA 4D2WA 5LOHA 3KC3A 1W2DA 4AF3A 3PFQA 4AS0A 1UNLA 2XKFA 1Q8YA 4FTUA 5DGZA 4RJ4A 4EOMA 4TT7A 4S33A 1IR3A 1UVRA 1TQIA 1IASA 2YJRA 3HDNA 4FF8A 2VZ6A 3GQIA 4G6NA 3W8QA 4MKCA 4H3BA 3W8LA 4L46A 5JRQA 5M44A 3VBQA 4FTMA 3PY3A 3PG3A 3A62A 5HX8A 5BUJA 1PXMA 5IA1A 4PP9A 3MY0A 3ZM4A 2JIVA 2OZAB 4RSSA 1WAKA 1XR1A 4YLJA 4NSTA 5CVHA 4I0RA 3LFNA 4O21A 4DEDA 2UV2A 4FTAA 3QQKA 4XG4A 5E8YA 4EH7A 2W9FB 3W0RA 3NIEA 5E8ZA 2ACXA 4FTOA 1WFCA 5AP2A 4XYFA 4RQKA 3SG8A 5BMSA 3A7GA 4GIHA 3TZMA 5EYDA 2QOLA 5CY3A 4GMYA 4AAYA 5DG5A 5HLPA 4G16A 1GJOA 2YIYA 4JT3A 2P0CA 4TWNA 5HI2A 4E5BA 3KVXA 4G3FA 4O0RA 4FKOA 1SYKA 1YXVA 2XKCA 4GK4A 4LGDA 3RK9A 4NH1A 1CKJA 4EH9A 1ST4A 3OBGA 3LFEA 3EN9A 4L3JA 3HAVA 2BHEA 4NM3A 1F3MC 3IQ7A 3DKOA 4IZ7A 4QOXA 3HRCA 5D7AA 1SVHA 3FI4A 4KKHA 1WBSA 2ZV2A 3U9NA 4FT7A 4MBJA 4O4CA 3RCDA 1SNUA 3UMXA 3ZLXA 3DAKA 3QLGA 4Q5EA 4CFNA 2R64A 4CKIA 1CKPA 2BTSA 3Q9ZA 3O7LB 2GNGA 3QRIA 4L68A 4Y8DA 5FQDC 5HLNA 5JSMA 2JKOA 3ORMA 4W4XA 3UNZA 5HLWA 4H3PA 4O0XA 3NLBA 2XANA 4F08A 5KHXA 4S32A 4IAYA 1P5EA 3FC2A 1URCA 4PY1A 3E88A 5JZNA 4MNEA 5L3AA 2W17A 2QURA 2X81A 1LEWA 3GFWA 3Q32A 3UMWA 1J7IA 3MS9A 4R5YA 2CDZA 3DLZA 4HPTE 5ETAA 3VO3A 5BVNA 2XIRA 3HV6A 4E8AA 4IX6A 5AAFA 5TO8A 4KKEA 3F5GA 2VUWA 1GIIA 3QXOA 4WKQA 3JS2A 4GS6A 4NJ3A 4TTHB 1OKWA 5FRIA 1VJYA 2R3MA 2BUJA 1BUHA 2QC6A 3G15A 3C9WA 1W98A 4EHEA 4G3CA 4RFZA 1PXNA 3BU3A 2E9OA 4FKTA 3UE4A 1GOLA 4E6AA 2VX3A 2R7BA 3R21A 1YDRE 2FA2A 4XP0A 3AXWA 4FT5A 4F7JA 4LRKA 2ITZA 4YLKA 3R1YA 3BGQA 4Q9ZA 5B2LA 3U6IA 1CTPE 3EQHA 5JFWA 3FQEA 3NW6A 3HEGA 3KFAA 5IDNA 5BQ0A 3VS4A 3T3VA 2OJJA 5KO1A 3UIMA 5ANKA 4AFEA 3PE2A 4Z16A 1DAYA 3NR9A 4FG8A 5CWZA 2O0UA 5ACBC 2PE1A 3L8XA 3RBWA 5FXSA 1R78A 2J90A 2OICA 2Z2WA 2XF0A 2GNJA 4FIIA 4FOCA 1QCFA 1WBTA 2GNIA 4OTPA 4PTGA 4DBNA 3UZRA 3JYAA 3T9TA 4JBPA 2JBPA 4UY9A 3TJCA 4N0SA 4Y46A 4USFA 3POZA 4QMYA 4GT4A 4LL0A 4AAAA 4YBKA 4BCPA 4QPAA 5IQEA 3AMAA 3L9LA 1ZYSA 2R3KA 3O50A 3OP5A 4YJTA 3D5UA 3P7CA 4MXZA 2UW4A 3I7BA 5CLPA 5HO8A 4ZY5A 4C59A 3CY3A 4QQCA 2VAGA 3ORZA 3OOMA 4G31A 3PJ8A 4WBBB 4DFBA 4I5CA 4V0GB 2HAKA 3TUBA 1XH8A 4EOQA 3OXZA 3GENA 4EYMA 1H1PA 4F7NA 2F57A 3LM0A 4YTIA 4RRVA 3OEFX 3QUDA 4EONA 3RPYA 2RSVA 3TWJA 5GJGA 3QCXA 2X7GA 5AR8A 4E5WA 3OCTA 4AZWA 2QQ7A 3HRBA 4CKRA 2VTIA 3MYGA 2WZJA 3FV8A 1YHWA 4I92A 2W1FA 1OKZA 2NNWB 3HL7A 3IK3A 3MTFA 2PVFA 4D0XA 1YOLA 1H00A 3PSCA 5KNJA 2GSFA 4QEBA 3QXPA 3WF5A 2PVMA 4UWCA 3ANRA 4FTTA 2Z7RA 5A54A 2XK9A 4DINA 3GBZA 1H07A 2C1AA 2XK3A 4IM3A 4XRLA 5CI7A 4ALUA 4BCFA 1DI9A 3C4EA 3F9NA 5JH6A 3D15A 4ITHA 3A7FA 3MH2A 3MPTA 1F5QA 3QGWA 3WF6A 4NM5A 5JGAA 3PP0A 2C0IA 1IA8A 3QWKA 4GG7A 2ZVAA 5HVKA 5E8SA 4C3PA 4HGLA 5HVYA 3T9IA 4UMQA 4DH5A 2QI8A 3BU5A 3GCSA 2ITTA 2E9PA 4HZSA 3V5JA 4IX5A 4DEBA 1SNXA 3O0GA 1REKA 4EUTA 5JQ5A 2CPKE 3KRLA 2VO3A 4KRCA 2C3IB 1OGUA 3IKAA 4QYEA 2WU7A 3HYHA 5BMMA 3V6RA 2ITVA 4GK2A 4E7WA 5CF5A 1V0OA 5FLFA 4ZLYA 2VWBA 4G6OA 4MXXA 4FKRA 2CCHA 2RIOA 3FBVA 1J3HA 5IQBA 2EVAA 5AV2A 2FSMX 4FZ7A 4ZLOA 5HZNA 2VTQA 5CU2A 4G9CA 3DNEA 1R0PA 1NY3A 4D9UA 4RWIA 5DPVA 4RZWA 3NSZA 1JSUA 2CGUA 2ZB0A 3MN3A 1WBWA 5CSXA 5CAPA 1Y6AA 2Y4IC 2RFSA 1OGYA 3LCKA 4MTAA 3IONA 3BEAA 4BIEA 5IMXA 4RC3A 4O2PA 3L8VA 5EM5A 3VAPA 1Q8TA 4YZCA 3VQUA 4N70A 1OL1A 4KIKB 4RX7A 2VGOA 5DR9A 4JQEA 2UZLA 3VWAA 4EWQA 3V3VA 4RIXB 2B54A 4BC6A 2WU6A 2YHVA 5C03A 2R3GA 3PA4A 2I40A 3FY2A 2X6DA 3BHUA 4K18A 4DLIA 3U87A 5LVNA 2WIPA 5DR6A 4X2FA 5DLSA 4C4GA 2BIKB 4O1OA 3KREA 4FK6A 3KMWA 2PVYA 3A8XA 4W9XA 3TCPA 3VUGA 3MIYA 4JMQA 4DH1A 2E9VA 5HESA 4PTEA 2BZKB 4HCTA 3SAYA 1JKTA 4K1BA 4UYNA 5CEQA 4BCIA 2W1ZA 2C4GA 3F5XA 3TZ8A 3RM6A 3R8VA 3KCKA 2C3KA 4W8EA 3DXQA 4NM0A 2C6IA 2G2FA 2J5FA 2J0JA 4E73A 5EI8A 1YXSA 4WUAA 3V5WA 4RPVA 1R0EA 3Q2MA 1FQ1B 3V01A 4RT7A 1OBGA 3HA8A 2R3RA 2AYPA 4KIPA 3ITZA 2HIWA 4MAOA 4LL5A 3W2CA 3RTPA 4KRDA 3GVUA 3QQGA 4YHJA 3QC4A 4TNDA 4RC2A 3ERKA 3G9NA 4F78A 4UWYA 5L2QA 3WZJA 3AD5A 5DYJA 4WG3A 4L6QA 4YTCA 4RFMA 3R7OA 2AEGA 3KK8A 4FG9A 3R8MA 5AP5A 5HE0A 3JR1A 4FTQA 4AGCA 2NO3A 4NWMA 2YN8A 3MSSA 3ALOA 2B4SB 1Y8GA 1Z57A 3ODZX 5EW9A 2QKRA 5JN2A 1TZDA 3UQCA 5IH6A 4LGGA 2E9NA 3OTVA 4JBOA 5AJQA 4WIHA 4LMUA 5ANGA 1QMZA 4EH8A 4M13A 3KL8A 4ZTHA 3QF9A 3QGYA 4GFOA 3RWPA 4XS2A 4F65A 5CU3A 4O7LA 1FGIA 5B2MA 4M84A 3QYZA 3FQHA 2EXMA 3RPVA 3LQ5A 3MDYA 4O84A 4FEVA 3UBDA 5AA8A 3TM0A 2R2PA 3ZS5A 4O91A 5I4NA 4Y85A 1OL2A 3CCNA 3DLSA 4I22A 5IUGA 3QD0A 3ORPA 4UN0C 5AP3A 2JAVA 3Q04A 3RPOA 3C1XA 3K54A 2B9HA 1BI7A 2Y4IB 2CKQA 3EN5A 4ACDA 2OXXA 3KN6A 2GQSA 3VUIA 4K0YA 5E8VA 2CGXA 3II5A 2GQGA 2BIYA 2JDSA 3B2TA 4JBVA 4XCUA 2GFSA 5EKNA 4E6DA 4M0YA 5TT7A 4O96A 2VWZA 3AT3A 5AP6A 1NA7A 3DV3A 3E8NA 1KE7A 3V5TA 4ANNA 4PNKA 1Q97A 2W06A 3MA6A 4QTEA 2C6DA 2YIRA 4BCOA 1L8TA 3AD6A 3NAYA 5KHWA 4FR4A 2WMRA 4JXFA 3DBCA 4BHNA 5IEYA 3F3ZA 4X0MA 4YNOA 4RJ3A 3ZUUA 4IWPA 1YW2A 2WTWA 3VHEA 1BMKA 4D28A 5EQPA 1VLRA 4CD0A 2X6EA 4LGHA 5AR4A 3ULIA 4IAZA 5KMOA 2WHBA 4QDEA 5ANDA 5L6WL 5AR5A 2W0JA 2IW6A 4QP2A 4G34A 1L3RE 4DEIA 2ZAZA 3AMYA 2C0OA 3EYHA 4O0SA 3R1QA 2NRUA 5IEVA 2BRNA 1XH4A 3DJ7A 4JNWA 5GNKA 4XLVA 4XMOA 3TDWA 4DC2A 4IDTA 3DBFA 4FSZA 1PRYA 4RJ8A 2W1IA 4L42A 1JWHA 2QG5A 4GVAA 4NL0A 3NYOA 1WCCA 5CZIA 4RIYB 3R9NA 5KBRA 4L43A 2JAMA 3DDPA 5KMMA 4WNMA 1H1QA 3W16A 2ZDUA 1OPKA 4MD9E 3R8ZA 3QTXA 2YM3A 1YWVA 2CGVA 2EUFB 4TYHA 4JJRA 3UJGA 3REPA 3ZXTA 3BI6A 3HECA 3QQLA 4YLLA 2Z7LA 3A8WA 4U5JA 3SG9A 2C30A 3L1SA 3EQCA 3MFSA 4KABA 2FSLX 3G0EA 4YBJA 2V22A 2WMTA 5K5NA 2UVXA 2BFYA 2GNLA 3OCBA 2QOFA 4UZDA 4XG3A 3O17A 3VS3A 3SW7A 3MVHA 4J97A 4IB0A 2C5XA 2HZIA 4JX7A 4KAOA 4QMPA 1PXOA 1Y6BA 2R9SA 3V51A 4DEEA 3R2BA 4YC3A 5KX8A 4BCKA 2XCHA 3I6WA 4Q9SA 4BDFA 1YI3A 3RZFA 3VF9A 4K8AA 4U8ZA 2XS0A 4ASDA 3UOKA 4UALA 1FOTA 3EN6A 3H9OA 1AQ1A 3Q6WA 3R30A 4AP7A 3ZYAA 2PVKA 1CMKE 3FQSA 4G1WA 4TRLA 5I9YA 3CGOA 1A9UA 4KSQA 4FIEA 4P5ZA 3GQLA 5DA3A 5EOLA 3RCJA 4EOSA 3G51A 4FSWA 4OTFA 4IZ5A 5K9IA 4BDCA 3F2NA 3FZOA 4U79A 1TQPA 4QTDA 4JL9A 4MQ1A 3MESA 3BGZA 2WMQA 1I09A 4GUBA 2JKMA 4KNBA 4F7LA 2CKPA 5D10A 3U6JA 5I3OA 2BRHA 2ETRA 3QRJA 4J96A 5FP5A 2WTDA 3GU7A 4I0SA 3LM5A 4BF2A 4CQGA 5D9HA 4HW7A 3EQBA 3RNYA 1OUYA 2XH5A 5J9ZA 4NCTA 3LFDA 2YDJA 2X8EA 2B9FA 2J7TA 4A9SA 3BE9A 4FGBA 3UO4A 4ERWA 2QLQA 3QRKA 4I1ZA 1ST0A 2IZTA 1G5SA 3H9RA 3NDMA 4NW6A 2IJMA 3ZSGA 4AZFA 2OWBA 2YAAA 1P4OA 4UMTA 2PZYA 5IU2A 5IQCA 4GYGA 2BZJA 2NPQA 4I93A 1VYZA 3V8WA 1QL6A 3MJ2A 3B8RA 4QP3A 3NEWA 4L3LA 3LFFA 4PDOA 2XAOA 5D7VA 3AC3A 5AFVA 3JY9A 3COIA