3L9NA

Crystal structure of pkab3 (pka triple mutant v123a, l173m, q181k) with compound 27
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
332
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Azole-based inhibitors of AKT/PKB for the treatment of cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 332
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l9nA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l9nA02
1ZMUA 3POOA 2GCDA 4PMMA 4QTEA 1VJYA 1KE6A 2BHHA 3LXLA 3VUMA 3UNZA 3HA8A 3NUPA 4LMUA 3A8WA 1Q97A 3I5NA 2VU3A 3QUEA 1DI8A 2UZDA 4W8EA 2QO2A 1ZMWA 1U5QA 2DQ7X 3E7VA 3IOKA 4NM3A 3HV5A 4IFGA 4QP7A 4RA4A 3EMGA 4WHZA 4YJTA 4ZTMA 1OITA 3DCVA 5HORA 4IVDA 1OPKA 2GS6A 4NH1A 4FKGA 2C1BA 5ANGA 1MRYA 4QMQA 5AAEA 5KBQA 3II5A 4XP0A 5IA5A 3RM6A 3O7LD 3D4QA 3ZDIA 4BDBA 4LUDA 2CNUA 3Q4ZA 5KKRB 4M8TA 1KE8A 3GFEA 4MK0A 5CASA 2YERA 3OBGA 4G34A 1SVHA 5ICPA 4NL0A 4G6LA 3UBDA 3WZDA 1PXPA 1U54B 3FMDA 3IW6A 3U54A 4OTHA 3R8LA 3W2RA 3TG1A 2JFMA 3C0GA 3D5WA 3D15A 3P78A 3QZGA 4TWCA 4DC2A 2WMRA 4TNBA 3QQKA 2BIYA 2X9FA 5HTIA 3LJ1A 1ND4A 3QD3A 4EK5A 1XH4A 3WARA 3L9LA 5A3XA 5E8UA 2YFXA 1RDQE 1OPLA 4PDPA 4PMTA 3R8PA 3Q9WA 1FVTA 3DBFA 4FSMA 4DG2E 1YHVA 2XBAA 3F5PA 4Q9ZA 3GCVA 2I7QA 5EYMA 4FTMA 4C38A 3PXFA 4G3EA 4RFZA 2X6EA 4CT1A 4CXAA 2REIA 3G0EA 4K11A 3BYVA 2I0EA 3C50A 3EN4A 3IK3A 2VWUA 3DKFA 4USDA 5ANKA 4CQGA 4MKCA 2OLCA 2ITNA 2VN9A 3BX5A 3OXTA 3BQCA 3TXOA 4IDTA 5JFVA 2XEZA 2PWLA 5LOHA 4O7TA 2B1PA 3F7ZA 3G5DA 4BL1A 5EDQA 4I0TA 4D1XA 1BI7A 2PMLX 4EH3A 2X2LA 2IVVA 2QG5A 4ITJA 3FC1X 2ITXA 2QG7A 3RPOA 4YSMA 1H1QA 5L6OA 1Q62A 2O3PA 4M3QA 4CFVA 3R6XA 2JD5A 2XJ2A 5CVFA 4KAOA 3FI3A 1GIIA 3DBCA 4W9WA 3WF6A 2JAMA 3LQ8A 5AP1A 4DFNA 5AR3A 4BCJA 4KIKB 3NLBA 3HV6A 2OZAA 1SVEA 5ANDA 3ZZWA 4DTBA 1A9UA 2QOHA 4AW1A 4GUEA 3V6RA 1JSVA 3IS5A 4M69A 4ERKA 4DEIA 1GZKA 2OH0E 3E8EA 3VRZA 2JDVA 3FXZA 4U97A 2ZB0A 3OT3A 3PJ3A 5DR6A 5EG3A 4XOZA 2J4ZA 4JBOA 4DGNA 4ORKA 3QWJA 1FGIA 4RWKA 5AUTA 3UPZA 5T6KA 3QZHA 4S34A 3TUBA 2PZRA 3HAVA 5CEOA 1I44A 2YAAA 4I5CA 4R8QA 4RSSA 5AV1A 2W1FA 3DQXA 3O8TA 1PMUA 4K77A 3VJNA 4FKUA 5BVNA 2W5AA 1JSTA 5K5XA 1PKDA 4Y5HA 3TV4A 4V04A 3B2TA 4NFNA 4D2VA 4CFMA 4E93A 2QKWB 2OGVA 1BI8A 2FSLX 4QTBA 3W10A 2ZAZA 2BRBA 1MRUA 3EN6A 2JDRA 1TKIA 2FSOX 2CNVA 5D7VA 4JI9A 3BLQA 4QYEA 4TT7A 3ODZX 5HIBA 4PTCA 1S9IA 4F1TA 5HO8A 3REPA 3TZMA 3CBLA 4RC4A 3ZLYA 5A4EA 1IA9A 2XS0A 4KNBA 2QHMA 4BDCA 1Q61A 3L9MA 5L6PA 2JIIA 5L2SA 3QYWA 3DZQA 4NM5A 2UZWE 2B7AA 4LGDA 5CENA 3FQHA 4C02A 4OTFA 3HMOA 4QMZA 4F63A 1R3CA 1XKKA 5I3RA 1Y6AA 4R5YA 2Y8OA 4IZ5A 3UIUA 1JAMA 3OS3A 4R5SA 3PA3A 2QOQA 5L8JA 1OL1A 3ZDUA 3UYSA 5AAGA 1V0PA 3QRTA 5KHXA 4G31A 4MXZA 4CG9A 3A7GA 3B8QA 5HKMA 3VVHA 3ZCLA 4XCUA 3FZSA 3TM0A 2XNPA 3PXRA 3RBWA 3TJCA 3RGFA 4AZVA 5ITAA 3IW8A 3MFTA 4QP1A 3BU3A 2VTNA 3RZBA 4CFXA 5TR6A 3MESA 2GHLA 2XCKA 2XB7A 5IF1A 4J1RA 4JS8A 2O64A 1A48A 4GCJA 3PG3A 5DYJA 4GYGA 3VNTA 5DA3A 3FI8A 1J3HA 3UJGA 3ZM4A 3P4KA 3MYGA 2RG6A 3WOWA 5ANJA 4QQJA 3Q2JA 1NVQA 4JQEA 4C4EA 3FY2A 5LQFA 5AUUA 4II5A 4L52A 3NS9A 3TN8A 4QRCA 2NP8A 4FGBA 2J0LA 4WSQA 1Y57A 3QF9A 3R2BA 5FTQA 3TZ8A 3H9FA 5FDPA 3UO5A 1PRYA 2ERKA 3PSBA 2BZJA 4WKQA 3OEFX 3HRCA 2QHNA 2P33A 4LOQA 3TWJA 1YQJA 3LFQA 5E8YA 5HZNA 3DTWA 3FLWA 3UG1A 5HD7A 1NY3A 4KINA 4GUBA 5E8XA 2VWBA 2C6OA 3LHJA 3QQJA 3LE6A 5TF9A 2QVSE 2Z7RA 3KXGA 2OF2A 5AWMA 4TY1A 5LJJA 3P5KA 5JFWA 3BV2A 1WBVA 2VV9A 3LFBA 2IZSA 4W4WA 1Q41A 3FWQA 4BDKA 1JKTA 1QCFA 4KKEA 3DJ5A 3QLGA 3I1AA 3L1SA 5CSWA 1GNGA 2RFEA 1ZYDA 3Q2MA 4RQVA 2ZMDA 4ZMFA 4RPVA 3JXWA 4ASZA 2UVZA 2ZMCA 4LV8A 3HRBA 5KMOA 3C4WA 4E8AA 4UWCA 4RFYA 1Q3WA 3GGFA 1R1WA 4RIXB 3KN5A 4FIHA 1WVXA 4I4EA 4L01A 5CSVA 5T68A 5CF5A 4DHFA 5C1QB 2XP2A 2WTKC 4WRSA 5C8NA 5E1SA 4AN2A 3HMMA 3NYVA 4HNIA 4RZWA 4EL9A 3FQSA 3FV8A 4KUJA 2OW3A 2XRUA 5IQEA 2PZPA 3QA0A 5IUHA 3P79A 3F66A 2YCFA 4EBWA 4USEA 2C3IB 5GJGA 4FKOA 4A9TA 4AZWA 2ONLC 3CP9A 3N51A 3QTRA 4C35A 4RIWB 2HAKA 2RKUA 4FF8A 4G1WA 5CAOA 5FTGA 3BHYA 4ZS0A 3AD4A 3D83A 1IAHA 3V5QA 1H1WA 2A19B 5FM3A 2XIKA 2R0UA 5HBEA 3NIEA 5IQDA 3IDCA 4A4LA 2H34A 2E9OA 2QOKA 4IW0A 4E6QA 3GBZA 2WOUA 2YDIA 5HE2A 3ODYX 5DN3A 1MRVA 5L4QA 2VAGA 4YTCA 4M67A 1IRKA 4Q5EA 4WT6A 4AA4A 3R9OA 5IA3A 1XJDA 3NR9A 4LGGA 2IJMA 3NW7A 3W2PA 5L2WA 4IM0A 4QYYA 3RI1A 2F9GA 4JX7A 3T9IA 4O6EA 2CKEA 5F4NA 2C6TA 2CCIA 3LMGA 5EM5A 3GC8A 4AOJA 4FV8A 1H4LA 4KSPA 4YO4A 2G1TA 4IMYA 1JKLA 3RINA 2ONLA 2F2CB 4YTHA 2YLEA 4DFLA 1Q99A 2H9VA 3JS2A 1UU3A 4G6NA 4G9CA 4RIYA 4BI2A 4HVIA 5LXMA 3CPBA 3CY2A 4Y8DA 1CKPA 4I0RA 3RJCA 3M2WA 2AUHA 2WTWA 4BN1A 2W4OA 3WF8A 2CN8A 4F7JA 3LM5A 2OH4A 3L9PA 1Z9XA 3A2CA 4F9YA 3MVHA 2VO0A 4CKIA 4P2KA 3WF5A 4APPA 3NCZA 4NT4A 1FVVA 2YABA 3F5GA 4PNIA 3HKOA 3TNQB 3IDPA 1M2RA 5E4HA 4AZTA 3MTFA 4NIFA 1L3RE 5D11A 3HYHA 2ITWA 5I9XA 5EOLA 5CZIA 3U9NA 5J79A 3VS3A 3IPHA 5FP5A 4X6QC 3I4BA 5H8EA 2G2IA 5DWRA 2HXLA 4DBNA 2HELA 2XNNA 2PMIA 3DQWA 2GS7A 3FKNA 5EK7A 3RP9A 2X4FA 4CTBA 3PXYA 4DLIA 4EQMA 4Q2AA 4XLIA 2C6EA 4F4PA 2Q0BA 2BKZA 5M56A 4ANSA 4F7LA 5CEKA 4UB7A 1J7UA 3NEWA 3VF8A 5IDPA 4ITIA 2I0YA 3OWJA 1P4FA 3DK6A 4LL0A 1ZYJA 3CQUA 3ZYAA 5LCJA 4ZTSA 4ZTRA 3LFAA 4YO6A 4HW7A 3ORIA 4BDJA 5ETAA 2G9XA 5EYCA 3WYXA 3EQPA 2BHEA 3MN3A 3I0OA 2WHBA 2A27A 4OTDA 4NM0A 3ORNA 5JT2A 2C5OA 1XBBA 3TZ7A 4BYJA 3PIXA 5M4FA 2XJ0A 2IWIA 2P3GX 3MPAA 3TTIA 3KREA 3PLAE 5CEPA 2W1GA 4YZ9A 4JDKA 2XK7A 5KZ0A 5HICA 1OKYA 2O2UA 3P9JA 2E9UA 2OIBA 3ROYA 3T3UA 4EZ3A 2C5XA 4IVAA 3LFSA 4BIBA 3UC4A 2PVRA 3DK7A 2V7OA 3I81A 4QMTA 4YHFA 4AE9A 3RAIA 4J7BA 5BUIA 5J7BA 3EQGA 4C36A 4CFFA 2IO6A 4E7WA 5K5NA 1VR2A 2GU8A 1ZAOA 3R7UA 5KX8A 3UNKA 3K3IA 4TXCA 2GNHA 3IGOA 4F6UA 3TKIA 3VBWA 4CEGA 5DR9A 4JR3A 1K9AA 2X7OA 4CTCA 5K9IA 3OCGA 4MBIA 2GNIA 4HYSA 4NJ3A 4PTEA 1JPAA 5LVLA 4IB1A 3G6HA 3TCPA 3IW7A 5FLFA 1YOLA 2ZV7A 5BVDA 4U80A 1DAWA 5KMLA 3N4UA 3V8WA 3OCSA 5I3OA 4P5QA 3R00A 5IKWA 4IJPA 5HQ0A 4RFMA 3VN9A 4IIRA 4EHEA 2W05A 2W4JA 2AYPA 2FB8A 2R7BA 3LFCA 4BKYA 3K5UA 3OTUA 3ZMMA 3QA8A 3F2NA 3ZUVA 4L44A 2R5TA 4EK6A 4X2NA 1Q4LA 2C30A 2WMTA 3LFDA 3OW4A 2GFCA 5AUYA 3BGZA 2B9JA 5BVEA 3C7QA 5IQGA 1WCCA 2YZLA 4AW5A 1NW1A 4XH6A 5IUGA 5CSHA 4RJ7A 1M14A 2F7ZE 1VYWA 2C6LA 3F9NA 3O50A 4XEYA 4O83A 1UU7A 3PLSA 4HCVA 4BDIA 4MBJA 3NW6A 4TYIA 1GOLA 2BFXA 3D0EA 3BU5A 3DKCA 3QKKA 4FOBA 5CXHA 4IX5A 3MBLA 4EOLA 3I7BA 4UMQA 2WTCA 3F2RA 2AC5A 2C0IA 4MQ2A 5LVOA 2SRCA 4R7BA 4DF3A 4CZTA 3FMJA 4GS6A 4YLJA 2PMNX 5BYZA 3V01A 2X7GA 3LCOA 5GNKA 2WIPA 3ZLWA 3C5IA 3EN9A 3OHTA 3S0OA 4HYIA 3B2WA 4PF4A 1UKHA 4YLKA 3DXQA 4ZMEA 2ITYA 1OIUA 1XR1A 4BCQA 4RT7A 5DLSA 5CAQA 2VX3A 4H1MA 1BLXA 2YIYA 5DNRA 3NUYA 5IH5A 4BHZA 5HE3A 4RMZA 5E7RA 4MEDA 4GK4A 3VUKA 3NX8A 4MXAA 1RE8A 3OWPA 3Q5ZA 2GNJA 2O5KA 2W99B 2FGIA 3GOPA 3QBNA 4ZSJA 2PYWA 3TL8A 4F9CA 4AA0A 3PRFA 3R30A 3PDTA 3Q4UA 5L2IA 4RIOA 3LXPA 5GINE 3ULIA 1WFCA 4DH1A 5H2UA 3D5XA 2EU9A 3NNXA 2YAKA 4LUEA 4ASXA 1XH7A 5F95A 1BL7A 4UMUA 5A4CA 4HVDA 3DKOA 4FKVA 4RX5A 3MWUA 4KIOA 4S31A 5DT0A 2QQ7A 5BQ0A 1VYZA 4XHKB 2XNOA 4NW5A 3QQLA 1O6YA 4PPAA 5LWMA 1RQQA 2BRHA 3GC7A 4XBRA 2CKOA 3Q9YA 4GT3A 5D1JA 3FMMA 1KOAA 2X81A 2Z2WA 2WEVA 5EQYA 3FC2A 3ZO2A 3PJ1A 3NVMB 5KKRC 2W17A 4IFCA 3OFMA 2VTPA 5HIDA 3ZEWA 5HTBA 1WBWA 4Z3VA 1EH4A 5E92A 3UTOA 5AR2A 3QCXA 4A7CA 3G0FA 3E87A 4GU9A 4RWJA 4RLKA 4XG7A 4NCTC 5CLPA 3TIZA 3GCQA 1OZ1A 1XH6A 3SC1A 5HNGA 4DTKA 3PXKA 4I3ZA 1O6LA 4KKGA 3CLYA 5HNBA 3I60A 4JNWA 2VWVA 5FD2A 3VS5A 4RX8A 4AX8A 3TDVA 3ATSA 5AEPA 5M44A 3GQLA 4C8BA 3TDWA 3ANRA 3QYZA 2XYNA 4ALVA 3KXHA 3NIZA 3MPTA 2PVMA 3EFKA 1UU8A 3PVUA 4C3FA 4DITA 3O8UA 3DKGA 2UW7A 2XZSA 2HZIA 2YCRA 2XK9A 5AIKA 5CALA 3NRMA 1WBOA 3SW7A 1H27A 2CGVA 2DWBA 2YIWA 3Q52A 5DBXA 4ZTLA 5HO6A 4FV7A 4BY9E 3OROA 2GHGA 2WD1A 2EB3A 2RIOA 3Q6WA 4G2FA 4DT9A 2GNLA 3LXNA 4GJ2A 5DT3A 2VTRA 1U54A 2CCHA 3BELA 4D2PA 2BRGA 4L3PA 5IDNA 4DAWA 1P4OA 3H3CA 4NCTA 4HGEA 4ZXTA 4FX3A 1H07A 4CLIA 1PXMA 3KU2A 3QD0A 4OBPA 3K3JA 4H3BA 4FVQA 5E1EA 3VS4A 4CMUA 5AV2A 4O1OA 5C8MA 4ACHA 3U51A 4WNKA 4PP9A 3NNWA 3WI6A 5F9EA 4GRBA 2DS1A 3DXNA 4IJ9A 5DFPA 4MNFA 2I1MA 4QMNA 4FTJA 4U41A 3VF9A 2WTIA 4OBQA 5KNJA 5J8IA 5AP6A 3PJ8A 1QPCA 3SDJA 4BCIA 4C3PA 2WU6A 3WIGA 5EHYA 4EUTA 4AGUA 5LMBA 3QHWA 4TZRA 3ZXTA 4QYFA 3SXFA 3PXZA 4Y5QA 3HUCA 4WO5A 3M11A 4FV1A 1IAJA 3UZPA 5B0XA 4BRXA 4DEAA 2R9SA 4C4FA 3NMUF 3BYUA 3PJCA 5J87A 3UVRA 4XUFA 3R2YA 2CDZA 2YJRA 3U6JA 2UZVA 3KRWA 4M66A 3PTGA 5L8KA 2XCHA 3BBWA 2PUNA 4IDVA 3MH3A 5HESA 2ITTA 3ORPA 3VS7A 3W2OA 5EHLA 3WZJA 4E6CA 4WBBB 2FUMA 3D14A 4R3PA 4ZTQA 4ANLA 5M57A 3SW4A 2HZ4A 2BDWA 4FV3A 4KD1A 1M2PA 1O6KA 3EQBA 3LJ2A 3LMIA 1P14A 4JDJA 3R1SA 1FVRA 1REJA 2ETMA 1F5QA 3OOMA 4BCKA 5A54A 5JKGA 5A14A 5K4JA 3GNIB 3HMPA 4YLLA 5KO1A 3KXMA 3ZFYA 1LR4A 3NNVA 3MI9A 2VGOA 3A99A 4AGWA 3A4PA 4IX3A 1Q8ZA 4JR7A 3QUDA 4DA5A 1BX6A 4YBKA 4E4XA 1YXXA 5D12A 1ZZ2A 4FNWA 4R78A 3UC3A 4GKHA 2BILB 1H08A 4GG5A 4RJ3A 4TYGA 4YZDA 5CT0A 4BCOA 2CGXA 4JQ7A 4C3RA 5I0BA 5AV0A 4BR3A 3BEGA 5AP5A 4DH3A 3ORXA 4HGLA 4C37A 4FIEA 4U44A 3COHA 3R7OA 2QO9A 4GFOA 3QUPA 5EKOA 2W9ZB 3UMWA 2JKQA 2BKKA 1H0VA 4FTQA 2P4IA 3N4VA 1PW2A 1MP8A 1BUHA 2J0JA 3R8VA 1J91A 2BAQA 3ZHPC 4JG8A 2OSCA 3G51A 3QC9A 2Y4PA 4IB3A 2VNWA 5DRDA 4EJ7A 4YUQA 4FNYA 3KXXA 4JIAA 2QC6A 4BYIA 1JLUE 3LOKA 4FIIA 3OUKA 1W82A 2G2FA 4FEQA 4WBOA 2GHMA 3KCKA 3IGGA 2VO7A 4IX4A 4JDHA 5AIRA 5EM6A 1FMOE 1CKIA 3COKA 3GC0A 4ZY4A 1XH5A 1OIQA 3HLLA 3QTSA 1WBSA 5CNOA 2QURA 3CEKA 4OTWA 5FXQA 1AGWA 3KULB 5HI2A 2BZKB 5A4TA 3FLNC 4X6RA 5TOZA 2LGCA 1F0QA 2OFVA 4F64A 1FMKA 5BVOA 4TYEA 4HCUA 5ETIA 4JVGA 4EK8A 5IMXA 3H10A 5M53A 4GFMA 1Y8GA 4F6WA 2CLXA 4WNPA 2ESMA 1MUOA 3QTIA 4U0IA 2Z7QA 2OJIA 3ZM9A 2VTJA 4JAIA 1PXNA 1Y91A 3EQCA 4O0XA 4YC3A 4IZAA 1GJOA 4KRDA 4O7WA 4IWOA 3GCUA 4GVAA 2V22A 4AZFA 2UW9A 4JBPA 4EH8A 3FI2A 4FV4A 4RVKA 5AV3A 2PVFA 5IH4A 4JX3A 2QOOA 4MCVA 1MQBA 4G6OA 4N57A 3CJGA 4M97A 3VQHA 4FZDB 4BGGA 4EI4A 4DYMA 4AGCA 4XBUA 2JBPA 3OY1A 4XNEA 4PPBA 1WVYA 4AT3A 5IEVA 1WBTA 4GIHA 4U3YA 3ZRKA 3QCSA 3MS9A 2J9MA 4FTRA 5C8KA 4ZTNA 3MGYA 1QL6A 4IAZA 2UZBA 4EOPA 3HNGA 4OUCA 3FPQA 4H05A 3UVPA 1LPUA 4F6SA 4DFUA 3MH2A 1YKRA 1H1PA 3C4CA 2QOCA 4NEUA 3C51A 3F2AA 4FKSA 4FT5A 4G16A 4AAAA 3ZXZA 4L6QA 2XKCA 4YR8A 3PVWA 3WILA 2JIVA 4O7NA 4PTGA 4HVGA 1E1XA 3WZKA 1WAKA 3K5VA 5IPJA 3ENMA 4YURA 2BUJA 4FEWA 2QLQA 4WNMA 4MXCA 3FPMA 3CTJA 5IISA 3PJ2A 4DGGA 2YIQA 4JBVA 3DA6A 2IW9A 4P90A 4F9WA 5FGKA 3DBEA 3SG8A 1OL6A 4ZS4A 4BDHA 2QLUA 2W5BA 4BI1A 4ZK5A 3PYYA 5KMMA 1OKZA 2NRUA 3KXNA 4RIXA 2CGUA 4KABA 4XX9A 1OIYA 4PL3A 4AG8A 5J7HA 2CKPA 4A06A 5M08A 5I9YA 4YZCA 3U87A 3FMEA 4DTAA 4FTTA 3N9XA 2PPQA 4DINA 1XBAA 3NUSA 3ZLXA 2C6KA 4FSZA 4C4GA 3I0QA 2YEXA 3EQRA 4EH2A 4MNEA 5HEZA 5CANA 1J7IA 3O0GA 4FKJA 5AA8A 3R7EA 4UYNA 3PXQA 2A0CX 4U81A 5ANEA 3IDBA 1YWVA 4J95A 2XIXA 4ACDA 2XMYA 5CF4A 4EOOA 2HENA 3FMNA 3FZ1A 4UX9A 4O7ZA 4HPUE 3RWPA 4IAYA 4DCAA 2WMVA 4KKHA 4I22A 4PPCA 4GV1A 5KBRA 3RAHA 5DHJA 2C0TA 3PY3A 4FSYA 2EUFB 3AD6A 2XA4A 3QD2B 3LLAA 4C58A 5EOBA 1O9UA 4CKRA 3DU8A 2Q83A 4Q9SA 1R0PA 4TYHB 2CN5A 3S2PA 3QCQA 4PL4A 4NFMA 4A9SA 4EH5A 5KUPA 2WQEA 3BEAA 4QMOA 4XG2A 4OT6A 3MSSA 3VW6A 2XYUA 4WUNA 3D7ZA 4GT4A 1OMWA 5DGZA 3IW4A 3LFEA 1J1BA 2F7EE 5EDPA 1U46A 1YI4A 3KN6A 4L42A 4YJUA 4YNEA 4ZY6A 3VULA 4CV9A 4OAVB 1X8BA 3ZZEA 3NW5A 4B4LA 5FDXA 5K0KA 4YC6A 3FEGA 2RF9A 4E6DA 1PMEA 4OTGA 3KRRA 1T45A 3ZONA 4NYEA 2R3IA 2YDJA 3R73A 4XJ0A 4EK3A 3V3VA 4DBXA 3MJ2A 4QNYA 4CQEA 3ORTA 4AUAA 2WXVA 4IQ6A 4Q5HA 3RHXA 3KY2A 4C2VA 4TW9A 1F3MC 4F0GA 3HVCA 2C6MA 4O38A 4AWIA 3Q3BA 4BGHA 3RNYA 3EQHA 4GYIA 1UA2A 4B99A 2PUPA 3QLFA 4UMTA 4C34A 1TQPA 1STCE 3MDYA 4LGHA 4I6FA 4YJVA 2V62A 3DTCA 3PIYA 3FYJX 4FKRA 3PPZA 3THBA 3E62A 3AC5A 4FZ6A 5BMMA 4FTCA 4O7RA 3NAYA 1H8FA 3AC4A 2XUUA 4D2SA 3PSDA 3Q04A 2XNMA 2QOBA 4JQ8A 4NK9A 1CMKE 2X39A 3ZSIA 1KV2A 5AM7A 2YM5A 4MD9E 4FV0A 4JLCA 4YPSA 4C33A 2F4JA 1GZNA 2JBOA 3R04A 3NCGA 5I9ZA 2NO3A 3GB2A 2E2BA 1URWA 3W33A 2WKMA 3E8CA 4L68A 4MVFA 3VHEA 2PZIA 4EOSA 5AV4A 2IZTA 2IZRA 3C13A 5LMAA 2WMQA 3UO6A 2UW5A 3I6UA 3ORLA 5AP0A 5G1XA 4F9AA 1BL6A 4YNOA 5CAVA 4AA5A 5L2TA 2OI4X 4O2ZA 1UWHA 2HXQA 5IU2A 2W1ZA 4OLIA 1P5EA 5HE0A 4YMJA 3BI6A 4H3QA 5E8VA 2AC3A 4D58A 2YWVA 2OJFE 4RJ5A 3UOKA 2IW6A 5CVHA 4ZJVA 1PF8A 4Z55A 4FSNA 4W8DA 3F3VA 4N6ZA 3JY0A 3F3WA 3KRJA 2HCKA 1XO2B 4I4FA 3ZSGA 4CCUA 5J5TA 3LQ3A 5IQHA 1SNXA 1ZYLA 2HIWA 5FTOA 4AACA 5JH6A 3NNUA 4HYHA 2XIZA 4IB5A 2QI8A 2J6MA 3FBVA 2R3LA 5DPVA 1PY5A 3BGPA 4QQTA 1S9JA 1BMKA 3PP1A 1WMKA 2ITQA 2ZV8A 4APCA 4EYMA 2W5HA 5JMSA 5AFVA 2Q0NA 1YOMA 2PVJA 3WE8A 4D9TA 1G8AA 4FOCA 3ZFMA 4E4MA 5B2LA 2ITUA 2JC6A 3ACJA 3DNDA 3UPXA 3R22A 4DN5A 1QPDA 5DRBA 4EEVA 4F09A 3NAXA 4IE9A 4ID7A 4XG6A 2OIDA 2PSQA 2YLFA 1OL2A 1W0XC 2PUUA 5EYKA 1LUFA 4NKAA 4FSQA 3EYHA 4BWKA 3GFWA 5I9UA 3TIYA 2PULA 1I09A 2OBJA 5CU2A 5EI8A 2UVXA 5EM8A 2R0IA 3FXXA 5HIEA 4F0IA 4FV9A 4NM7A 4H1JA 2JLDA 4AOTA 3MVMA 4YBJA 2PL0A 3D94A 1UVRA 1RJBA 4BTMA 4FGRA 4EJNA 3B8RA 4IX6A 4L00A 3RZFA 5EHOA 3W18A 2RFDA 4FZ7A 4WG3A 3UODA 3W2SA 3LAUA 4IZ7A 2HWOA 3KVWA 4O0UA 4AE6A 3BPRA 4FODA 2V55A 4E5AX 4CD0A 3VS6A 2VX0A 3GENA 4O7YA 5TKDA 3QQFA 3EQIA 5A6NA 4N6YA 2VO6A 4FYOA 5KMJA 4FVRA 4CRSA 2PVKA 4O0YA 4K0YA 3ZU7A 4IVBA 3F5UA 3RK5A 3MVLA 4PDSA 2ITOA 4KS7A 3VC4A 2GQRA 4O81A 3F61A 1NT2A 2YM6A 2JDSA 3KC3A 3OW3A 4XV3A 3OG7A 3C9WA 1W84A 1WBNA 4UY9A 1OUKA 1PXIA 4U42A 5EI2A 5FWKK 3ZC5A 5JSMA 4QYHA 4EOMA 4BHNA 3NDMA 4CFWA 2P55A 3FI4A 1KSWA 2XKFA 2XK3A 4EYJA 2OZOA 3G9NA 1OUYA 3MJ1A 4H58A 4ASDA 3QX4A 1YXTA 2R3HA 4MH7A 2OKRA 1ZARA 2ITPA 5HU9A 4GK2A 4ZY5A 3G90X 3P23A 3QHRA 3I79A 4FIFA 4OGRA 2B9HA 4G9RA 3JPVA 4I5MA 4XRJA 5LVMA 1ZYSA 4QMYA 2W1IA 3OVVA 4PP7A 4I20A 2YHVA 4FSUA 4UWBA 3SQQA 3P7AA 2NRYA 2YN8A 3PE1A 3R21A 5TT7A 4CLJA 4P4CA 4BKZA 4LOOA 1CSNA 2GSFA 2OIQA 5BVWA 1GY3A 3H30A 5LMKC 3AT2A 3LZBA 3QRKA 3CQWA 4LRJA 3MH1A 3EKNA 3Q60A 3TACA 4AGDA 3FAAA 3PRIA 3TV7A 2X9EA 2ZJWA 4ZSAA 3U55A 5AR5A 5JZJA 3ZRLA 3QKMA 2P2HA 1SMHA 5CF6A 4HPTE 1Q8UA 3D7TA 2VTMA 1KE9A 2WMWA 5E9EA 4EZ5A 1DI9A 3CY3A 5GZ8A 4O96A 1P2AA 5AP3A 3SKCA 3ZBXA 4LFIA 4AU8A 2EVAA 4YTFA 5IQCA 5CEIA 5M4CA 1ZY4A 4X2GA 1OB3A 1B38A 3QRJA 4ALWA 3L8SA 3RPYA 3VIDA 4DFZE 2PVLA 4WOVA 5HHWA 2CLQA 3QGYA 4TN6A 4RWIA 2XNBA 4RRVA 4UMRA 2YIRA 5C26A 4OR5A 4EHVA 5I9VA 2UZEA 4FTAA 5LMKA 4EOIA 3BWFA 2ZV2A 3TUCA 4YZNA 2A2AA 3CSVA 4G3FA 2BVAA 3QTUA 2OF4A 2EB2A 4EHZA 3PWYA 1PXLA 5B2MA 2O8YA 4BCMA 4PY1A 3UVQA 4RC2A 3WYYA 2OU7A 3C5UA 5BPYA 2P2IA 3GOKA 2BZIB 1R0EA 1VEBA 2W1HA 2JKKA 2QU5A 5D9HA 4ZJIA 3SD0A 1R78A 4F7SA 4BBFA 5L6WL 1OPJA 3IQ7A 3GUBA 4IAKA 2ITVA 4ACGA 2QOFA 5J9LA 3E92A 2ZB1A 3GU6A 1YHWA 4PRJA 4YU2A 2GS2A 3V5WA 3P7BA 4ZAUA 3MTLA 2B53A 3BBTB 3JYAA 3PY0A 3SXSA 4U9AA 4L45A 5D7AA 5IUIA 3T9TA 3ZC6A 3ZS5A 3C4EA 4RQKA 4GKIA 5M06A 1B39A 3C4FA 3F3UA 3UGCA 2J90A 4MQ1A 3RKBA 1FGKA 2UW0A 2WMUA 3EQDA 5CXZA 3HDNA 4AXAA 3GP0A 3SLSA 2G01A 4IAFA 2RFSA 3MIAA 5CEMA 1ZOGA 1HCKA 3QKLA 1YDSE 4TTHB 1IASA 5HG9A 3QAME 4J96A 5GZ9A 1W8CA 4QTCA 3A7FA 5DOSA 2O0UA 3KA0A 1HCLA 4I21A 2B4SB 2JKOA 5GIPE 5HOAA 3FZOA 5HGIA 5KZIA 5IEYA 1PXJA 5F20A 5B7VA 5IA2A 3Q6UA 3GU8A 3NYOA 3MA3A 5LWNA 4X2KA 2YITA 5A46A 3O23A 4JBQA 3HMIA 3VBTA 3SVVA 4DGOA 4HZRA 3FLYA 3R7VA 2NNWB 2R3OA 4C2WA 4WD5A 4AFEA 3TV6A 2C5NA 4M7IA 3CC6A 5T3QA 3ITZA 3KGAA 4EWHA 3HL7A 5JRSA 5IA1A 3BHVA 4KBKA 2WEIA 3NUXA 2J7TA 2PHKA 4X3FB 3MFRA 4JG7A 5HLPA 4AOIA 5E8TA 4EK4A 4F65A 2VRXA 3AOXA 3VWAA 2XKDA 3IW5A 2X4ZA 2F49A 1YI6A 4JL9A 4RX9A 4V05A 5TO8A 3VUTA 2BZHB 1Y6BA 5F1ZA 1JVPP 4I24A 5E8SA 4NTTA 5ANOA 5HCYA 5CSXA 4BWPA 1PKGA 4R77A 5IH6A 5JFXA 1JWHA 4O82A 4CYJA 4YJSA 4RIYB 1UKIA 3GCPA 2VTLA 3R9NA 3TEIA 2GMXA 4QMWA 3ID6C 2W9FB 2YWPA 3QRIA 4LG4A 3A7HA 3MH0A 5EW3A 4E20A 1DAYA 3SRVA 3E88A 2VUWA 4ANMA 5J1WA 2WELA 4RVMA 3QWKA 3RCJA 5L8LA 3C1XA 4QMMA 4AFJA 4C61A 2BALA 4M0YA 3QCYA 2QONA 5IZFA 3D5UA 4LMNA 3VBYA 1IG1A 1YW2A 2EXMA 2XIYA 4WG5A 3BZ3A 5DG5A 3FDNA 4NIFB 5GJDA 3H0ZA 2X1NA 3ELJA 4QYGA 5EW8A 2PTKA 5E91A 3DV3A 2Y9QA 4I0SA 5E8WA 4ZOGA 1UWJA 4HVSA 2ZDTA 3UMXA 2PE2A 2YJSA 4TYJA 2X8EA 5EH0A 2GQGA 3LCKA 3GQIA 5EYDA 1TQIA 4I5PA 4KRCA 5K0XA 1OECA 3E3BX 3DDQA 3KB7A 2PE1A 3UE4A 4OTPA 4AW0A 2R3NA 2OJ9A 1H01A 4TWPA 4D55A 2WO6A 4D4YA 1W98A 3CTQA 2OO8X 3LM0A 3PG1A 1XH9A 1NXKA 4NWMA 2PZYA 5DEWA 2YA9A 5CU0A 4PV0A 3MW1A 4TNDA 4FEVA 1YRPA 2BRNA 3BE9A 4GU6A 4FKTA 2ZM3A 2JKMA 2QO7A 4W9XA 2X7FA 5CEQA 3MIYA 5JFSA 4WIHA 1QMZA 4E73A 4D0XA 2QOLA 4IWDA 3DDPA 1UU9A 4J8NA 4EHGA 5J1VA 3FHRA 4ITHA 3R8ZA 1H26A 2IN6A 4IBMA 4DEDA 4CV8A 4S33A 3TNWA 4BCFA 4BDEA 3Q5IA 5BMSA 3DS6A 4EQUA 4QOXA 3D2IA 3AMAA 4MXXA 2X6DA 4HVHA 4M15A 2VTAA 2OJGA 3UYTA 3HDMA 4O6LA 5FM2A 4EZ7A 2PVYA 1OL7A 3P7CA 4BDAA 5DVRA 2WQOA 3FSFA 3R8UA 4IAIA 4QPSA 4ZZOA 4FG9A 4HGTA 4MAOA 3HA6A 1IA8A 3HRFA 5J9YA 3RAWA 4A9RA 4J8MA 3WBLA 2WQNA 2WU7A 1Q8TA 4IM2A 1ZOEA 3PIZA 4RG0A 4IAAA 4DEEA 3QRUA 5I4NA 3EFJA 4ALUA 3D9VA 2YM7A 3AGLA 4FICA 2YM8A 5E90A 1H0WA 4MF1A 3ALOA 4XYFA 2VNYA 2R3QA 3V5LA 3DZOA 2HY81 2XVDA 4FTOA 3IO7A 3LQ5A 4BDGA 1Q3DA 3P86A 2XM9A 3PZEA 3AC3A 4J53A 1R39A 4PWNA 4X3JA 4QT1A 4FL1A 3H9RA 4FA2A 4O27B 3AC2A 2ITZA 3KCFA 4O2PA 4O86A 2C4GA 4JRNA 3VUGA 3KMMA 5C03A 4GK3A 4CVAA 4FTIA 3MB6A 4FV5A 4U40A 4QMLA 1U59A 3OUNB 1ZWSA 5EFQA 1K3AA 4A9UA 4ANBA 2FYSA 3BHHA 4UV0A 3HP5A 3FQEA 1WVWA 5L2QA 3GVUA 3KFAA 4KIKA 4DLJA 3PWDA 2WMSA 3FXWA 2BDFA 2X8DA 3JY9A 2UUEA 2OFUA 4L53A 5CZHA 4F1MA 4RC3A 5HO7A 5G6VA 4JRVA 4BGQA 4DT8A 3OZ6A 4MTAA 3S00A 4BZDA 2X8IA 4L3LA 4YGAA 2C0OA 3R7YA 3OWKA 5ANIA 3QQUA 4UXQA 4GW8A 2WIHA 3U4WA 4PNKA 1U4DA 3LFFA 2P0CA 3OC1A 3V5TA 3UQCA 1QPJA 4CRLA 2C68A 5M4UA 4L67A 5CX9A 3LIJA 4FT7A 4LQMA 4D2WA 4RZVA 1PXKA 4BTKA 4FNXA 2C6DA 3OOGA 2GTMA 5JQ5A 4J52A 4FNZA 5M51A 4EORA 4XOYA 3ZO4A 1XWSA 2RGPA 5HLWA 5FEDA 2B0QA 3L8VA 3N4TA 4LM5A 3VHKA 2Y6MA 4PQNA 4EH4A 4MF0A 4BCPA 4EH9A 4F1OA 4LV5A 1KOBA 4FG8A 5BYYA 4TYHA 4K8AA 4V0GB 2BRMA 3G2FA 3NUUA 5HCZA 2F57A 3W8LA 3UZRA 2PVHA 4FK3A 3IKAA 4BDDA 3VS2A 5JRQA 2GNGA 2KULA 3FLZA 4IHPA 3RCDA 4ZLOA 1V0BA 2J0IA 4FBXA 2ZV9A 3PE2A 4ACMA 3QD4A 4RJ8A 3RPVA 1M2QA 4WSYA 3ZUUA 3A7JA 1YDRE 3DOGA 3ZO1A 3LW0A 3CKXA 1HOWA 4L7SA 1OM1A 4MHAA 3LCTA 2ERZE 4QQ5A 2UW3A 2Y7JA 4TWOA 3JUHA 4HCTA 4O0RA 4IWPA 2VTSA 3FMLA 3R1YA 1ZYCA 4XV2A 3TT0A 4A4XA 4U7ZA 4ZSLA 4AT5A 2Y4IB 5CAPA 4IH8A 4DE4A 2VWWA 2J50A 2OICA 4ZP5A 3O71A 3E7OA 4FTLA 5M55A 1NVSA 5C4KA 3DK3A 2HYYA 4L43A 4J97A 4NTSA 2YM4A 4ANQA 2WGJA 4ZLZA 4BTFA 5J5SA 5JN2A 2XK8A 2J51A 4J98A 3C4XA 2JDOA 3E3PA 3RMFA 1GZOA 3WF9A 5LVPA 4FV6A 1XH8A 3F7WA 3KXZA 2PK9A 2WMBA 4DFBA 4Y95A 3GU7A 4IC8A 3EQFA 2WTJA 3AG9A 2O65A 3CPCA 3HAMA 4L46A 2UW8A 2QKRA 2WB8A 4HJOA 4EOKA 3NPCA 3GCSA 2UV2A 2KTYA 2R3RA 4YHJA 5F94A 1Q8YA 2W7XA 3V04A 5EDRA 4WUAA 4ZJJA 4N70A 2O63A 2CKQA 4ZSGA 4EOJA 3PZHA 5HU3A 5HVYA 5BUJA 3L8XA 5AJQA 3O51A 3K2LA 3QTXA 3TZ9A 4AW2A 4BBMA 2E9VA 3NUAA 3FY0A 4PMPA 3ACKA 3BLHA 3EHAA 4R7IA 4WRGA 3UIXA 4MBLA 2UZLA 3HMNA 4R1YA 2W0JA 3VJOA 4D4VA 4N4SA 3H4JA 4D9UA 3DLSA 4AT4A 1GIHA 2EXCX 5CWZA 4FEXA 2HZNA 4K18A 2RL5A 4YTIA 4YSJA 4FKLA 4ERWA 2YZAA 2UZOA 1JKKA 5C01A 1ZY5A 4MYGA 4A9YA 3KL8A 4FKQA 1JBPE 2XEYA 4LL5A 4I6HA 3KK8A 4I41A 4AF3A 3R9HA 1ERKA 4CYIA 4XV1A 2I0VA 4FC0A 2HK5A 4BFMA 1RW8A 3PFQA 2C1AA 4U79A 4EBVA 4FYNA 3VUDA 4CNHA 3R9DA 2C6IA 3ANQA 3OCBA 1UNLA 2V7AA 4BWXA 3QC4A 4EOQA 2OG8A 4BICA 5AP2A 4S30A 4XLVA 4A4OA 3HUBA 3BGQA 3MV5A 4W4YA 3R71A 3E93A 4KA3A 4I92A 3LJ0A 5HLNA 3ZBFA 3KKVA 5M07A 2YCQA 4DGLC 3AQVA 4C0TA 5KE0A 2BAJA 4EONA 4BCGA 1KWPA 1JNKA 2XNEA 2UVYA 3AGMA 4FT0A 2PE0A 4U43A 1H24A 4P5ZA 3O2MA 4RJ6A 4RX7A 4X0MA 1E9HA 4JAJA 3OWLA 4RIWA 1OL5A 3P08A 4ANOA 3OMVA 5FQDC 5L3AA 3UZTA 4FSRA 5CVGA 1Q24A 1NA7A 4JJRA 5CU4A 3RTPA 4D1SA 2V5QA 2XNGA 4D0WA 1JOWB 4NSTA 4C59A 4H3PA 3ULZA 4YJPA 3GU4A 4B8LA 4C62A 2BFYA 4QPMA 5IQBA 1T46A 4ENYA 3S4QA 5BX0A 2IVUA 2BTSA 3HV7A 5A9UA 4QP4A 1M17A 3GU5A 3WIKA 4EC8A 3FMHA 4E1ZA 5FUTA 4HZSA 5CT7A 3E8DA 3NYNA 5EKNA 3WZUA 1MQ4A 1UNHA 2WOTA 4I94A 2UW4A 3RPRA 4BC6A 5IMEA 4PDYA 4C4IA 3QALE 3ZSHA 2FSMX 2WQMA 3PPKA 3DPKA 3TJDA 2YM3A 4CFUA 4AS0A 4LI5A 3UO4A 4DG0E 3A61A 3SV0A 4UEUA 3FE3A 1REKA 3LVPA 3MY5A 3V51A 2Y0AA 4EUUA 3U8WA 4PDOA 3ZLSA 4A07A 4DCEA 4PUZA 2C3JA 4GEOA 2A1AB 3R7IA 3MFSA 3PVBA 3QX2A 4H39A 5IA4A 3C0HA 5CTPA 5KMIA 4FSTA 2VX1A 3UIBA 2VTTA 5HE1A 3ZFXA 5AA9A 3BHUA 1PJKA 2ZOQA 4QTDA 3UG2A 3S1HA 4IM3A 3W16A 2WAJA 3VBVA 3F5XA 2JIUA 2EWAA 3R7GA 3R63A 3SG9A 1M7NA 3Q53A 2QOIA 3EFLA 2R3FA 3O96A 4HOKA 4GMYA 5GHVA 5KCVA 4RA5A 5IG1A 4UWYA 2QCSA 3CGFA 3L8PA 4BBEA 5JGAA 5JZNA 4BTJA 5AAFA 4DEGA 3BU6A 5HCXA 1Z57A 3CD3A 4XG8A 3RK7A 4F70A 2IPXA 4R3CA 4XMOA 3TNHA 3MFUA 4GT5A 5A6OA 2A4LA 3ORKA 4NU1A 2JAVA 3ATTA 2GFSA 2Z7SA 4Z9LA 2BPMA 3HV3A 5H3QA 3RK9A 2R2PA 4D2TA 5KMKA 3DY7A 3IG7A 3PVGA 3V5JA 3QZFA 4MXYA 5BVFA 5M09A 1YXVA 3DFAA 4NUSA 4RGJA 2ETRA 3QGWA 4JG6A 4KB8A 5J9ZA 1JKSA 4I1ZA 5GIOE 4UZHA 3VAPA 3ROCA 4U45A 5CQUA 4ASEA 1GZ8A 3AC8A 3U6IA 2UW6A 4O84A 5CQWA 4XG4A 1A06A 3H9OA 3PUPA 3FYKX 3DJ6A 3D5VA 3RWQA 1PXOA 2I6LA 3CE3A 3NGAA 1YWNA 3R02A 4JIKA 2CPKE 2CSNA 3EH9A 1IR3A 3AD5A 3RHKA 4JT3A 4KWPA 2HY0A 4C4JA 1TQMA 1SM2A 3EJ1A 4I93A 1CTPE 3PA5A 5AUWA 3GEQA 4UBAA 3LFNA 4QP6A 2FH9A 2HZ0A 4B0GA 2PMOX 4CMOA 5K3YA 4D4RA 3OY3A 4O22A 2B54A 4UMPA 5IA0A 4J71A 1K2PA 3DAJA 3FKLA 3V5PA 2CJMA 3PSCA 4ZEGA 4F9BA 3UIMA 2VGPA 3R1QA 2JITA 2UZTA 4CT2A 4ARKA 4B8MA 3DJ7A 4YPDA 5AUXA 5JK3A 1LP4A 3UDBA 5BUEA 5HNIX 3FKOA 3W2QA 4DEBA 4L3JA 1OI9A 1XQZA 3DBQA 2CHLA 4YZBA 1PMVA 3BQRA 4UN0C 2Z7LA 2YACA 3ZOSA 4ANNA 2XIRA 1Y8YA 2OZAB 3LPBA 1VZOA 3OTVA 5FG8A 4XP2A 3QTZA 1XBCA 3VS0A 1PYEA 4M69B 3AC1A 3W2CA 3SA0A 2H96A 4B9DA 5AR7A 2I0HA 3DB8A 4X3FC 5LCKA 4ZLYA 2OJJA 2R3KA 3FZRA 4MNEB 4S2ZA 1GAGA 3BYMA 3SXRA 4FEUA 4YZMA 4FIJA 5CY3A 5HBJA 1L8TA 4K9YA 2GDOA 2H6DA 4GL9A 4O0TA 1OKWA 4JDIA 4TKSA 4GIIA 5LARA 1Q8WA 4HGSA 3KMWA 4XV9A 4Y85A 3VUIA 1KE7A 4KBAA 4QMUA 5GJFA 3WF7A 2FVDA 2ACXA 4O1PA 4YJRA 4IC7A 3UQFA 3VBQA 3FJQE 1KE5A 3TNIA 5CAUA 4AZEA 4BI0A 3F3ZA 3CD8A 3OEZA 4G5PA 4NZWB 2C3LA 4O0VA 5HG5A 2QR7A 3DT1A 4GSBA 3CQEA 2GNFA 3COIA 4EC9A 2GQSA 3BWJA 5C4LA 4BZNA 4NJDA 3VS1A 2RG5A 3PPJA 3S95A 3BRBA 3TKHA 3U6HA 3ZO3A 4FT3A 1TVOA 2WPAA 4MXOA 3O8PA 4PX6A 1B6CB 5HVJA 3DB6A 1H25A 4FVPA 4X3FA 3DBDA 4M84A 5H8GA 4C7TA 4FK6A 4R6VA 4R7HA 3EL8A 3GT8A 3LLTA 5CU3A 3FLQA 3TTJA 4X21A 1YI3A 2QODA 4TWNA 3A4OX 2CMWA 3DAEA 4C57A 4F0FA 1YVJA 4EH6A 5HTCA 4Y73A 3CGOA 4X2FA 4E6AA 3ORZA 4ONAA 4O7VA 5DE2A 4FL3A 3M1SA 4L9IA 4QP8A 5GZAA 3A7IA 3CIKA 1JSUA 3MB7A 3FZPA 4WNOA 3KF4A 1ZOHA 2XK4A 3UQGA 4MD7E 3SAYA 5FEQA 2WMXA 3R0TA 5D41A 3EWHA 4MWIA 3WZEA 5DEYA 2Y6OA 5JGBA 4G3GA 4NW6A 1SNUA 2ZM4A 2BAKA 3GXLA 3OP5A 4OTRA 2R7IA 4I23A 5BNJA 4E5BA 3ZEPA 3T8OA 5KHWA 5ETCA 3NZ0A 5ACBC 2J0KA 3K54A 3IECA 4CZUA 5HVKA 4AP7A 3A8XA 2PY3A 5CYIA 1AD5A 3VUHA 2W4KA 2FSTX 3NSZA 1CM8A 3KF7A 4U8ZA 4CSVA 2E9PA 3FHIA 5BYLA 1YDTE 3W8QA 4DFYA 4BCHA 1H28A 2X2KA 3KEXA 1M7QA 4GH2A 2R3GA 2ZM1A 3NWWA 4FTNA 4GFGA 4CKJA 5DI1A 4O7SA 3GC9A 4BIEA 4QMPA 5CI7A 4RJ4A 3EOCA 3EZRA 1YXSA 4XS2A 3R1NA 4FMQA 4QP3A 2XM8A 3RVGA 3RALA 3QQHA 3G9LX 4Y72A 4O91A 2OXYA 3V8TA 2JGZA 4M14A 4ZZMA 3FSKA 4DFXE 2W1EA 4V01A 2X0GA 3F3TA 2XH5A 3W1FA 4DH5A 3QFVA 4UYAA 4JXFA 4XP3A 4FG7A 4R3RA 2CNQA 1WZYA 4E5WA 4GJ3A 3EL7A 3F82A 4PL5A 3SX9A 3Q9XA 5IQFA 2I40A 3C4ZA 4QMXA 3HZTA 4FR4A 4E3CA 4BVUA 2IZUA 3QU0A 2W06A 1JQHA 4MD8E 4FT9A 2W96B 2VWIA 4BIDA 5CF8A 3HECA 5AADA 3BLRA 3EN5A 4UZDA 4XG3A 3BCEA 4PMSA 3E5AA 2J5EA 2QNJA 2J0MB 4EKLA 1FOTA 1H1SA 4QMVA 3U9CA 3RPSA 4D28A 1J1CA 3NUNA 4O21A 1YHSA 5AP4A 3AT4A 4YJQA 1OIRA 3IONA 5AP7A 4M68A 4I6BA 5E8ZA 1BYGA 2WQBA 4LOPA 4G3DA 5HX6A 3CR0A 3OXIA 4CFNA 4RWLA 3E8NA 3VRYA 4TL0A 3MY1A 4KBCA 3G33A 4RVLA 3NVKI 4K6ZA 4BB4A 5DR2A 4H36A 1ZZLA 4FKWA 4WA9A 3QL8A 4MX9A 1GIJA 4FZAB 3O17A 3ALNA 4OAUC 2BIKB 4OT5A 1SVGA 5IQAA 2IVSA 5JQ8A 3ENHA 3DLZA 2IW8A 3VO3A 4TPTA 3E64A 3WE4A 2G15A 4AQCA 3ERKA 3FMKA 2BR1A 4FL2A 4AZSA 4DH8A 5JEBA 2W1DA 3LMHA 5EQEA 4CG8A 3M42A 2BCJA 2R64A 2WTKB 2XRWA 1OVEA 3LCSA 2WFYA 3BV3A 5HBHA 2V0DA 3R83A 2B9FA 3JVSA 3ZH8A 5AX9A 5CI6A 2XKEA 2QD9A 4S32A 4EQCA 5AMNA 2OXDA 2H8HA 2VTQA 4G5JA 5EI6A 2VTOA 4JOAA 4R1VA 3AMYA 5D10A 4CCBA 2FA2A 4YJOA 5DMZA 5FXSA 1G3NA 1PYXA 5K4IA 2VTHA 1G5SA 4O0SA 2PU8A 2R3MA 2RFNA 4NKSA 4EH7A 2VO3A 2QU6A 4DG3E 3BHTA 3I6WA 1OGUA 2WMAA 4YP8A 2Y4IC 3OF0A 3QXPA 1UNGA 1FQ1B 1YOJA 3HP2A 3TKUA 3EYGA 1ZRZA 4GVJA 3CTHA 3BYSA 3H0YA 3TNPC 2CGWA 4FKPA 1W83A 2R3JA 4V0GA 4F7NA 2OXXA 5IQIA 4D1ZA 2OWBA 4QP9A 2VD5A 4FI1A 4M0ZA 3Q9ZA 4M12A 3F88A 2DYLA 5LVNA 2B9IA 2R3PA 4O7LA 1CDKA 1NVRA 3F6XA 3KRLA 3QTQA 4X7QA 5CS6A 2VTIA 3MY0A 2PVNA 3EZVA 3QXOA 4FUXA 5TE0A 4FKIA 4QO9A 4U6RA 1LEZA 3ZUTA 4M13A 4KIPA 4IANA 4ZTHA 3MPMA 5CNNA 1FBNA 4DGMA 3AT3A 3GI3A 4N0SA 3ZTXA 1OKVA 4W4VA 3Q4CA 4XRLA 3CCNA 5CSPA 4ACCA 3KULA 5C9CA 4FSWA 3KMUA 4U3ZA 1SYKA 3V8SA 1BKXA 3D7TB 3W32A 3BYOA 4FE2A 3POZA 3A60A 5FP6A 3ZRMA 4C4HA 4Z7GA 2VZ6A 4CZYB 1FINA 4O0WA 3OXZA 4Z16A 2F2UA 5ETFA 4RLLA 2EXEA 3OT8A 3P1AA 3HX4A 4FZFB 4E4NA 5EQPA 3R9RA 1ZMVA 4LRMA 4B6LA 3CXWA 1U5RA 4OBOA 3LXKA 2B52A 3RM7A 2C3KA 1YXUA 4QTAA 1SZMA 4HYUA 2YISA 3I7CA 5EW9A 4RBLA 4XG9A 4KIQA 1M52A 3EFWA 5EM7A 1APME 2BROA 3RAKA 5A4LA 3LCDA 2F7XE 4EKKA 4G3CA 1W7HA 2OK1A 1LEWA 4IADA 3KVXA 3SOCA 3QZIA 3UP7A 5H9BA 1V1KA 4IXPA 2XK6A 4YHTA 4WG4A 5AUZA 3JVRA 2B55A 3MVJA 4KS8A 1WBPA 1ZXEA 3IOPA 2BDJA 4FTUA 3BE2A 1KUTA 2YDKA 4CGAA 1ATPE 3COMA 2IVTA 1PHKA 4L7FA 4OW8A 2HW6A 3AXWA 3FL4A 2DUVA 3AMBA 5AM6A 3VQUA 4D5HA 4OTIA 2C47A 2UZNA 2HWPA 2VWXA 5B2KA 2Z60A 4QD6A 4QPAA 4ZSEA 3BIZA 2W1CA 3KQ7A 2PUIA 5AX3A 3R28A 5AR8A 4QNAA 3T3VA 5A4QA 4IEBA 4BZOA 2ZYBA 3KRXA 4IACA 1UV5A 2RSVA 2WTDA 3PP0A 1V0OA 2C5VA 2XF0A 1XHAA 2JDTA 1IEPA 2VWYA 2X2MA 2UZUE 3A62A 3DFCB 1Z5MA 3ETAA 3HV4A 4EWQA 5FBNC 5HD4A 4L8MA 3VBXA 3DAKA 1PMNA 4BF2A 3DXPA 2WTVA 2IG7A 4G17A 2XBJA 5KMNA 3HGKA 3V6SA 1H00A 1AQ1A 2ZVAA 3FLSA 3OCTA 4LRKA 1Q5KA 4USFA 1FPUA 2GTNA 3P0MA 1ZLTA 1DM2A 3G6GA 4GG7A 4KSQA 4AN9A 5M4IA 3ET7A 3SGCA 3EB0A 5FBOA 3PY1A 2WNTA 4P7EA 1OBDA 2PZ5A 4F99A 5DH3A 4UXLA 5HG7A 4E4LA 4Y83A 2FO0A 3Q96A 3EN7A 3UOJA 2QR8A 4B7TA 3PA4A 3SOAA 5CU6A 2E9NA 2HOGA 5HG8A 2BTRA 4YJNA 5BVKA 4FIGA 2ZDUA 5C27A 5J95A 4TRLA 2Z8CA 4DEHA 3FUPA 4LYNA 4Z7HA 3OD6X 2G2HA 5DIAA 3UOHA 4ENXA 1OBGA 3C0IA 3NYXA 5DT4A 4D4SA 3QTWA 5AUVA 4BDFA 1H1RA 2WZJA 3UOLA 1KV1A 3O7LB 3ORMA 4MWHA 4W4XA 4QMSA 2J5FA 4AN3A 5ACKA 3BKBA 4I5HA 2YCSA 4J99A 2R4BA 1E1VA 5FEEA 5I9WA 4E26A 4YC8A 3CKWA 3I5ZA 3DNEA 4OTQA 2BMCA 3TI1A 3RNIA 4K2RA 3KK9A 5FRIA 2VWZA 3R8MA 2YIXA 4CMTA 4K33A 1CKJA 5H8BA 3E63A 3D2KA 2JFLA 3G15A 3CS9A 4I6QA 1DS5A 4IZYA 4X2JA 3Q4TA 4IWQA 4D5KA 4FUYA 3OBJA 4F08A 4K1BA 4Y46A 3L9NA 4UALA 3MA6A 2J2IB 4FTKA 3U4UA 3DGKA 5HX8A 4DH7A 5I5ZA 2ETKA 3W55A 1YWRA 2C5YA 2GPHA 5AR4A 4D2RA 4ZIMA 3SRVB 3EIDA 4IVCA 4IB0A 2HW7A 2JEDA 3R01A 3Q32A 3S3IA 5FXRA 1J7LA 2Z02A 3UNJA 4ZZNA 4FV2A 4QP2A 3JR1A 3EKKA 3F69A 3LKMA 1G8SA 3VW8A 3UP2A 3HEGA 1QPEA 2LAVA 2C69A 5JGDA 4QQCA 4BCNA 4BKJA 3FZTA 3SHEA 4RVTA 2NPQA 4U5JA 2XJ1A 3CJFA 3TUDA 3QQGA 4HNFA 3FL5A 1URCA 5IEXA
chains in the Genus database with same CATH superfamily
1ZMUA 3POOA 2GCDA 4PMMA 4QTEA 1VJYA 1KE6A 2BHHA 3LXLA 3VUMA 3UNZA 3HA8A 3NUPA 4LMUA 3A8WA 1Q97A 3I5NA 2VU3A 3QUEA 1DI8A 2UZDA 4W8EA 2QO2A 1ZMWA 1U5QA 2DQ7X 3E7VA 3IOKA 4NM3A 3HV5A 4IFGA 4QP7A 4RA4A 3EMGA 4WHZA 4YJTA 4ZTMA 1OITA 3DCVA 5HORA 4IVDA 1OPKA 2GS6A 4NH1A 4FKGA 2C1BA 5ANGA 1MRYA 4QMQA 5AAEA 5KBQA 3II5A 4XP0A 5IA5A 3RM6A 3O7LD 3D4QA 3ZDIA 2NYAA 4BDBA 4LUDA 2CNUA 3Q4ZA 5KKRB 4M8TA 1KE8A 3GFEA 4MK0A 5CASA 2YERA 3OBGA 4G34A 1SVHA 5ICPA 4NL0A 4G6LA 3UBDA 3WZDA 4LV7A 1PXPA 1U54B 3FMDA 3IW6A 3U54A 4OTHA 3R8LA 3W2RA 3TG1A 2JFMA 3C0GA 3D5WA 3D15A 3P78A 3QZGA 4TWCA 4DC2A 2WMRA 4TNBA 3QQKA 2BIYA 2X9FA 5HTIA 3LJ1A 1ND4A 3QD3A 4EK5A 1XH4A 4AXCA 3WARA 3O5AA 3L9LA 5A3XA 5E8UA 2YFXA 1RDQE 1OPLA 4PDPA 4PMTA 3R8PA 3Q9WA 1FVTA 3DBFA 4FSMA 4DG2E 1YHVA 2XBAA 3F5PA 4AQKA 4Q9ZA 3GCVA 2I7QA 5EYMA 4FTMA 4C38A 3PXFA 4G3EA 4RFZA 2X6EA 4CT1A 4CXAA 4QDEA 2REIA 3G0EA 4K11A 3BYVA 2I0EA 3C50A 3EN4A 4AAYA 3IK3A 2VWUA 3DKFA 4USDA 5ANKA 4CQGA 4MKCA 2OLCA 2ITNA 2VN9A 3BX5A 3OXTA 3BQCA 3TXOA 4IDTA 5JFVA 2XEZA 2PWLA 5LOHA 4O7TA 2B1PA 3F7ZA 3G5DA 4BL1A 5EDQA 4I0TA 4D1XA 1BI7A 2PMLX 4EH3A 2X2LA 2IVVA 2QG5A 4ITJA 3FC1X 2ITXA 2QG7A 3RPOA 1G8KA 4YSMA 1H1QA 2IEWA 5L6OA 1Q62A 2O3PA 4M3QA 4CFVA 3R6XA 2JD5A 2XJ2A 5CVFA 4KAOA 3FI3A 1GIIA 3DBCA 4W9WA 3WF6A 2JAMA 3LQ8A 5AP1A 4DFNA 5AR3A 2X0QA 4BCJA 4KIKB 3NLBA 3HV6A 2OZAA 1SVEA 5ANDA 3ZZWA 4DTBA 1A9UA 2QOHA 4AW1A 4GUEA 3V6RA 1JSVA 3IS5A 4M69A 4ERKA 4DEIA 1GZKA 2OH0E 3E8EA 3TYKA 3VRZA 2JDVA 3FXZA 4U97A 2ZB0A 2AQXA 3OT3A 3PJ3A 5DR6A 5EG3A 4XOZA 2J4ZA 4JBOA 4DGNA 4ORKA 3QWJA 1FGIA 4RWKA 5AUTA 3UPZA 5T6KA 3QZHA 4S34A 3TUBA 2PZRA 3HAVA 5CEOA 1I44A 2YAAA 4I5CA 4R8QA 4RSSA 5AV1A 2W1FA 3DQXA 4MUQA 3O8TA 1PMUA 4K77A 3VJNA 4FKUA 5BVNA 2W5AA 1JSTA 5K5XA 1PKDA 4Y5HA 3TV4A 4V04A 3B2TA 4NFNA 4D2VA 4CFMA 4E93A 2QKWB 2OGVA 1BI8A 2FSLX 4QTBA 3W10A 2ZAZA 2BRBA 1MRUA 3EN6A 2JDRA 1TKIA 2FSOX 2CNVA 5D7VA 4QEBA 4JI9A 3BLQA 4QYEA 4TT7A 3ODZX 5HIBA 4PTCA 1S9IA 4F1TA 5HO8A 3REPA 3TZMA 3CBLA 4RC4A 3ZLYA 5A4EA 1IA9A 2XS0A 4KNBA 2QHMA 4BDCA 1Q61A 3L9MA 5L6PA 2JIIA 5L2SA 3QYWA 3DZQA 4NM5A 2UZWE 2B7AA 4LGDA 5CENA 3FQHA 4C02A 4OTFA 3HMOA 4QMZA 4F63A 1R3CA 1XKKA 5I3RA 1Y6AA 4R5YA 2Y8OA 4IZ5A 3UIUA 1JAMA 3OS3A 4R5SA 3PA3A 2QOQA 5L8JA 1OL1A 3ZDUA 3UYSA 5AAGA 1V0PA 3QRTA 5KHXA 4G31A 4MXZA 4CG9A 3A7GA 3B8QA 5HKMA 3VVHA 3ZCLA 4XCUA 3FZSA 3TM0A 2XNPA 3PXRA 3RBWA 3TJCA 3RGFA 4AZVA 5ITAA 3IW8A 3MFTA 4QP1A 3BU3A 2VTNA 3AKJA 3RZBA 4CFXA 5TR6A 3MESA 2GHLA 2XCKA 2XB7A 5IF1A 4DHJA 4J1RA 4JS8A 2O64A 1A48A 4JMQA 4GCJA 3UDSA 3PG3A 5DYJA 4GYGA 3VNTA 5DA3A 3FI8A 1J3HA 3UJGA 3ZM4A 3P4KA 3MYGA 2RG6A 3WOWA 5ANJA 4QQJA 3Q2JA 1NVQA 4JQEA 4C4EA 3FY2A 5LQFA 5AUUA 4II5A 4L52A 3NS9A 3TN8A 4QRCA 2NP8A 4FGBA 2J0LA 4WSQA 1Y57A 3QF9A 3R2BA 5FTQA 3TZ8A 3H9FA 5FDPA 3UO5A 1PRYA 3W0OA 2ERKA 3PSBA 2BZJA 4WKQA 3OEFX 3HRCA 2QHNA 2P33A 4LOQA 3TWJA 1YQJA 3LFQA 5E8YA 5HZNA 3DTWA 3FLWA 3UG1A 5HD7A 1NY3A 4KINA 4GUBA 5E8XA 2VWBA 2C6OA 3LHJA 3QQJA 3LE6A 5TF9A 2QVSE 2Z7RA 3KXGA 2XAMA 3BL9A 2OF2A 5AWMA 4TY1A 5LJJA 3P5KA 5JFWA 3BV2A 1WBVA 2VV9A 3LFBA 2IZSA 4W4WA 1Q41A 3FWQA 4BDKA 1JKTA 1QCFA 4KKEA 3DJ5A 3QLGA 3I1AA 3L1SA 5CSWA 1GNGA 2RFEA 1ZYDA 3Q2MA 4RQVA 2ZMDA 4ZMFA 4RPVA 3JXWA 4ASZA 2UVZA 2ZMCA 4LV8A 3HRBA 5KMOA 3C4WA 4E8AA 4UWCA 4RFYA 1Q3WA 3GGFA 1R1WA 4RIXB 3KN5A 4FIHA 1WVXA 4I4EA 4L01A 5CSVA 5T68A 5CF5A 4DHFA 5C1QB 2XP2A 2WTKC 4WRSA 5C8NA 5E1SA 4AN2A 3HMMA 3NYVA 4HNIA 4RZWA 4EL9A 3FQSA 4QDVA 3FV8A 4KUJA 2OW3A 2XRUA 5IQEA 2PZPA 3QA0A 5IUHA 3P79A 3F66A 2YCFA 4EBWA 4USEA 2C3IB 5GJGA 4FKOA 4A9TA 4AZWA 2ONLC 3CP9A 3N51A 3QTRA 4C35A 4RIWB 2HAKA 2RKUA 4FF8A 4G1WA 5CAOA 5FTGA 3BHYA 4ZS0A 3AD4A 3D83A 1IAHA 3V5QA 1H1WA 2A19B 5FM3A 2XIKA 2R0UA 5HBEA 3NIEA 5IQDA 3IDCA 4A4LA 2H34A 2E9OA 2QOKA 4IW0A 4E6QA 3GBZA 2WOUA 2YDIA 5HE2A 3ODYX 5DN3A 1MRVA 5L4QA 2VAGA 4YTCA 4M67A 4I6LA 1IRKA 4Q5EA 4WT6A 4AA4A 3R9OA 5IA3A 1XJDA 3NR9A 4LGGA 2IJMA 3NW7A 3W2PA 5L2WA 4IM0A 4QYYA 3RI1A 2F9GA 4JX7A 3T9IA 4O6EA 2CKEA 5F4NA 2C6TA 2CCIA 3LMGA 5EM5A 3GC8A 4AOJA 4FV8A 1H4LA 4KSPA 4YO4A 2G1TA 4IMYA 1JKLA 3RINA 2ONLA 2F2CB 4YTHA 2YLEA 4DFLA 1Q99A 2H9VA 3JS2A 1UU3A 4G6NA 4G9CA 4RIYA 4BI2A 4HVIA 5LXMA 3CPBA 3CY2A 4Y8DA 1CKPA 4I0RA 3RJCA 3M2WA 2AUHA 2WTWA 4BN1A 2W4OA 3WF8A 2CN8A 4F7JA 3LM5A 2OH4A 3L9PA 1Z9XA 3A2CA 4F9YA 3MVHA 2VO0A 4CKIA 4P2KA 3WF5A 4APPA 3NCZA 4NT4A 1FVVA 2YABA 3F5GA 4PNIA 3HKOA 3TNQB 3IDPA 1M2RA 5E4HA 4AZTA 3MTFA 4NIFA 1L3RE 5D11A 3HYHA 2ITWA 5I9XA 5EOLA 5CZIA 3U9NA 5J79A 3VS3A 3IPHA 5FP5A 4X6QC 3I4BA 5H8EA 2G2IA 5DWRA 2HXLA 4DBNA 2HELA 2XNNA 2PMIA 3DQWA 2GS7A 3FKNA 5EK7A 3RP9A 2X4FA 4CTBA 3PXYA 4DLIA 4EQMA 4Q2AA 4XLIA 2C6EA 4F4PA 2Q0BA 2BKZA 5M56A 4ANSA 4F7LA 5CEKA 4UB7A 1J7UA 3NEWA 3VF8A 5IDPA 4ITIA 2I0YA 3OWJA 1P4FA 3DK6A 4LL0A 1ZYJA 3CQUA 3ZYAA 5LCJA 4ZTSA 4ZTRA 3LFAA 4YO6A 4HW7A 3ORIA 4BDJA 5ETAA 2G9XA 5EYCA 3WYXA 3EQPA 2BHEA 3MN3A 3I0OA 2WHBA 2A27A 4OTDA 4NM0A 3ORNA 5JT2A 2C5OA 1XBBA 3TZ7A 4BYJA 3PIXA 5M4FA 2XJ0A 2IWIA 2P3GX 3MPAA 3TTIA 3KREA 3PLAE 5CEPA 2W1GA 4YZ9A 4JDKA 2XK7A 5KZ0A 5HICA 1OKYA 2O2UA 3P9JA 2E9UA 2OIBA 3ROYA 3T3UA 4EZ3A 2C5XA 4IVAA 3LFSA 3UDZA 4BIBA 3UC4A 2PVRA 3DK7A 2V7OA 3I81A 4QMTA 4YHFA 4AE9A 3RAIA 4J7BA 5BUIA 5J7BA 3EQGA 4C36A 4CFFA 2IO6A 4E7WA 5K5NA 1VR2A 2GU8A 1ZAOA 3R7UA 5KX8A 3UNKA 3K3IA 4TXCA 2GNHA 3IGOA 4F6UA 3TKIA 3VBWA 4CEGA 5DR9A 4JR3A 1K9AA 2X7OA 4CTCA 5K9IA 3OCGA 4MBIA 2GNIA 4HYSA 4NJ3A 4PTEA 1JPAA 5LVLA 4IB1A 3G6HA 3TCPA 2A98A 3IW7A 5FLFA 1YOLA 2ZV7A 5BVDA 4U80A 1DAWA 5KMLA 2X0PA 3N4UA 3V8WA 3OCSA 5I3OA 4P5QA 3R00A 5IKWA 4IJPA 5HQ0A 4RFMA 3VN9A 4IIRA 4EHEA 2W05A 2W4JA 2AYPA 2FB8A 2R7BA 3LFCA 4BKYA 3K5UA 3OTUA 3ZMMA 3QA8A 3F2NA 3ZUVA 4L44A 2R5TA 4EK6A 4X2NA 1Q4LA 2C30A 2WMTA 3LFDA 3OW4A 2GFCA 5AUYA 3BGZA 2B9JA 5BVEA 3C7QA 5IQGA 1WCCA 2YZLA 4AW5A 1NW1A 4XH6A 5IUGA 5CSHA 4RJ7A 1M14A 2F7ZE 1VYWA 2C6LA 3F9NA 3O50A 4XEYA 4O83A 1UU7A 3PLSA 4HCVA 4BDIA 4MBJA 3NW6A 4TYIA 1GOLA 2BFXA 3D0EA 3BU5A 3DKCA 3QKKA 4FOBA 5CXHA 4IX5A 3MBLA 4EOLA 3I7BA 4UMQA 2WTCA 3F2RA 2AC5A 2C0IA 4MQ2A 5LVOA 2SRCA 4R7BA 4DF3A 4CZTA 3FMJA 4LDTA 4GS6A 4YLJA 2PMNX 5BYZA 3V01A 2X7GA 3LCOA 5GNKA 2WIPA 3ZLWA 3C5IA 3EN9A 3OHTA 3S0OA 4HYIA 3B2WA 4PF4A 1UKHA 4YLKA 3DXQA 4ZMEA 2ITYA 1OIUA 1XR1A 3VULA 4RT7A 5DLSA 4BCQA 2VX3A 4H1MA 1BLXA 2YIYA 5DNRA 5CAQA 3NUYA 5IH5A 4BHZA 5HE3A 4RMZA 5E7RA 4MEDA 4GK4A 3VUKA 3NX8A 4MXAA 1RE8A 3OWPA 3Q5ZA 2GNJA 2O5KA 2W99B 2FGIA 3GOPA 3QBNA 4ZSJA 2PYWA 3TL8A 4F9CA 4AA0A 3PRFA 3R30A 3PDTA 3Q4UA 5L2IA 4RIOA 3LXPA 5GINE 3ULIA 1WFCA 4DH1A 5H2UA 3D5XA 2EU9A 3NNXA 2YAKA 4LUEA 4ASXA 1XH7A 5F95A 1BL7A 4UMUA 5A4CA 4HVDA 3DKOA 4FKVA 4RX5A 3W0SA 3MWUA 4KIOA 4S31A 5DT0A 2QQ7A 5BQ0A 1VYZA 4XHKB 2XNOA 4NW5A 2XANA 3QQLA 1O6YA 4PPAA 5LWMA 1RQQA 2BRHA 3GC7A 4XBRA 2CKOA 3Q9YA 4GT3A 5D1JA 3FMMA 1KOAA 2X81A 2Z2WA 4FRFA 2WEVA 5EQYA 3FC2A 3ZO2A 3PJ1A 3NVMB 5KKRC 2W17A 4IFCA 3OFMA 2VTPA 5HIDA 3ZEWA 5HTBA 1WBWA 4Z3VA 1EH4A 5E92A 3UTOA 5AR2A 3QCXA 4A7CA 3G0FA 3E87A 4GU9A 4RWJA 4RLKA 4XG7A 4NCTC 5CLPA 3TIZA 3GCQA 1OZ1A 1XH6A 3SC1A 5HNGA 4DTKA 3PXKA 4I3ZA 1O6LA 4KKGA 3CLYA 5HNBA 3I60A 4JNWA 2VWVA 5FD2A 3VS5A 4RX8A 4AX8A 3TDVA 3ATSA 5AEPA 5M44A 3GQLA 4C8BA 3TDWA 3ANRA 3QYZA 2XYNA 4ALVA 3KXHA 3NIZA 3MPTA 2PVMA 3EFKA 1UU8A 3PVUA 4C3FA 4DITA 3O8UA 3DKGA 2UW7A 2XZSA 2HZIA 4AXFA 2YCRA 2XK9A 5AIKA 5CALA 3NRMA 1WBOA 3SW7A 1H27A 2CGVA 2DWBA 2YIWA 3Q52A 5DBXA 4ZTLA 5HO6A 4FV7A 4BY9E 3OROA 2GHGA 2WD1A 2EB3A 2RIOA 3Q6WA 2IF8A 4G2FA 4DT9A 2GNLA 3LXNA 4GJ2A 5DT3A 2VTRA 1U54A 2CCHA 3BELA 4D2PA 2BRGA 4L3PA 5IDNA 4DAWA 1P4OA 3H3CA 4NCTA 4HGEA 4ZXTA 4FX3A 1H07A 4CLIA 1PXMA 3KU2A 3QD0A 4OBPA 3K3JA 4H3BA 4FVQA 5E1EA 3VS4A 4CMUA 5AV2A 4O1OA 5C8MA 4ACHA 3U51A 4WNKA 4PP9A 3NNWA 3WI6A 5F9EA 4GRBA 2DS1A 3DXNA 4IJ9A 5DFPA 4MNFA 2I1MA 4QMNA 4FTJA 4U41A 3VF9A 2WTIA 4OBQA 5KNJA 5J8IA 5AP6A 3PJ8A 1QPCA 3SDJA 4BCIA 4C3PA 2WU6A 3WIGA 5EHYA 4EUTA 4AGUA 5LMBA 3QHWA 4TZRA 3ZXTA 4QYFA 3SXFA 3PXZA 4Y5QA 3HUCA 4WO5A 3M11A 4FV1A 1IAJA 3UZPA 5B0XA 4BRXA 4DEAA 2R9SA 4C4FA 3NMUF 3BYUA 3PJCA 5J87A 3UVRA 4XUFA 3R2YA 2CDZA 2YJRA 3U6JA 2UZVA 3KRWA 4M66A 3PTGA 5L8KA 2XCHA 3BBWA 2PUNA 4IDVA 3MH3A 5HESA 2ITTA 3ORPA 3VS7A 3W2OA 5EHLA 3WZJA 4E6CA 4WBBB 2FUMA 3D14A 4R3PA 4ZTQA 4ANLA 5M57A 3SW4A 2HZ4A 4DDGA 2BDWA 4FV3A 4KD1A 1M2PA 1O6KA 3EQBA 3LJ2A 3LMIA 1P14A 4JDJA 3R1SA 1FVRA 1REJA 2ETMA 1F5QA 3OOMA 4BCKA 5A54A 5JKGA 5A14A 5K4JA 3GNIB 3HMPA 4YLLA 5KO1A 3KXMA 3ZFYA 4DHIB 1LR4A 3NNVA 3MI9A 2VGOA 3A99A 4AGWA 3A4PA 4IX3A 1Q8ZA 4JR7A 3QUDA 4DA5A 1BX6A 4YBKA 4E4XA 1YXXA 5D12A 1ZZ2A 4FNWA 4R78A 3UC3A 4GKHA 2BILB 1H08A 4GG5A 4RJ3A 4TYGA 4YZDA 5CT0A 4BCOA 2CGXA 4JQ7A 4C3RA 5I0BA 5AV0A 4BR3A 3BEGA 5AP5A 4DH3A 3ORXA 4HGLA 4C37A 4FIEA 4U44A 3COHA 3R7OA 2QO9A 4GFOA 3QUPA 5EKOA 2W9ZB 3UMWA 2JKQA 2BKKA 1H0VA 4FTQA 2P4IA 3N4VA 1PW2A 1MP8A 1BUHA 2J0JA 3R8VA 1J91A 2BAQA 3ZHPC 4JG8A 2OSCA 3G51A 3QC9A 2Y4PA 4IB3A 2VNWA 5DRDA 4EJ7A 4YUQA 4FNYA 3KXXA 4JIAA 2QC6A 4BYIA 1JLUE 3LOKA 4FIIA 3OUKA 1W82A 2G2FA 4FEQA 4WBOA 2GHMA 3KCKA 3IGGA 2VO7A 4IX4A 4JDHA 5AIRA 5EM6A 1FMOE 1CKIA 3COKA 3GC0A 4ZY4A 1XH5A 1OIQA 3HLLA 3QTSA 1WBSA 5CNOA 2QURA 3CEKA 4OTWA 5FXQA 1AGWA 3KULB 5HI2A 2ZFYA 2BZKB 5A4TA 3FLNC 4X6RA 5TOZA 2LGCA 1F0QA 2OFVA 4F64A 1FMKA 5BVOA 4TYEA 4HCUA 5ETIA 4JVGA 4EK8A 5IMXA 3H10A 5M53A 4GFMA 1Y8GA 4F6WA 2CLXA 4WNPA 2ESMA 1MUOA 3QTIA 4U0IA 2Z7QA 2OJIA 3ZM9A 3ML1A 3AKLA 2VTJA 4JAIA 1PXNA 1Y91A 3EQCA 3AKKA 4O0XA 4YC3A 4IZAA 1GJOA 4KRDA 4O7WA 4IWOA 3GCUA 4GVAA 2V22A 4AZFA 2UW9A 4JBPA 4EH8A 3FI2A 4FV4A 4RVKA 5AV3A 2PVFA 5IH4A 4JX3A 2QOOA 4MCVA 1MQBA 4G6OA 4N57A 3CJGA 4M97A 3VQHA 4FZDB 4BGGA 4EI4A 4DYMA 4AGCA 4XBUA 2JBPA 3OY1A 4XNEA 4PPBA 1WVYA 4AT3A 5IEVA 1WBTA 4GIHA 4U3YA 3ZRKA 3QCSA 3MS9A 2J9MA 4FTRA 5C8KA 4ZTNA 3MGYA 1QL6A 4IAZA 2UZBA 4EOPA 3HNGA 4OUCA 3FPQA 4H05A 3UVPA 1LPUA 4F6SA 4DFUA 3MH2A 1YKRA 1H1PA 3C4CA 2QOCA 4NEUA 3C51A 3F2AA 4FKSA 4FT5A 4G16A 4AAAA 3ZXZA 4L6QA 2XKCA 4YR8A 3PVWA 3WILA 2JIVA 4O7NA 4PTGA 4HVGA 1E1XA 3WZKA 1WAKA 3K5VA 5IPJA 3ENMA 4YURA 2BUJA 4FEWA 2QLQA 4WNMA 4MXCA 3FPMA 3CTJA 5IISA 3PJ2A 4DGGA 2YIQA 4JBVA 3DA6A 2IW9A 4P90A 4F9WA 5FGKA 3DBEA 3SG8A 1OL6A 4ZS4A 4BDHA 2QLUA 4BJJB 2W5BA 1W2CA 4BI1A 4ZK5A 3BL7A 3PYYA 5KMMA 1OKZA 2NRUA 3KXNA 4RIXA 2CGUA 4KABA 4XX9A 1OIYA 4PL3A 4AG8A 5J7HA 2CKPA 4A06A 5M08A 5I9YA 4YZCA 3U87A 3FMEA 4DTAA 4FTTA 3N9XA 2PPQA 4DINA 1XBAA 3NUSA 3ZLXA 2C6KA 4FSZA 4C4GA 3I0QA 2YEXA 3TMOA 3EQRA 4EH2A 4MNEA 5HEZA 5CANA 1J7IA 3O0GA 4FKJA 5AA8A 3R7EA 4UYNA 3PXQA 2A0CX 4U81A 5ANEA 3IDBA 1YWVA 4J95A 2XIXA 4ACDA 2XMYA 5CF4A 4EOOA 2HENA 3FMNA 3FZ1A 4UX9A 4O7ZA 4HPUE 3RWPA 4IAYA 4DCAA 2WMVA 4KKHA 4I22A 4PPCA 4GV1A 5KBRA 3RAHA 5DHJA 2C0TA 3PY3A 4FSYA 2EUFB 3AD6A 2XA4A 3QD2B 3LLAA 4C58A 5EOBA 1O9UA 4CKRA 3DU8A 2Q83A 4Q9SA 1R0PA 4TYHB 2CN5A 3S2PA 3QCQA 4PL4A 4NFMA 4A9SA 4EH5A 5KUPA 2WQEA 3BEAA 4QMOA 4XG2A 4OT6A 3MSSA 3VW6A 2XYUA 4WUNA 3D7ZA 4GT4A 1OMWA 1W2DA 3IW4A 3LFEA 1J1BA 2F7EE 5DGZA 1U46A 1YI4A 3KN6A 4L42A 4YJUA 4YNEA 5EDPA 4ZY6A 4CV9A 4OAVB 1X8BA 3ZZEA 3NW5A 4B4LA 5FDXA 5K0KA 4YC6A 1TFFA 3FEGA 2RF9A 4E6DA 1PMEA 4OTGA 3KRRA 1T45A 3ZONA 4NYEA 2R3IA 2YDJA 3R73A 4XJ0A 4EK3A 3V3VA 4DBXA 3MJ2A 4QNYA 4CQEA 3ORTA 4AUAA 2WXVA 4IQ6A 4Q5HA 3RHXA 3KY2A 4C2VA 4TW9A 1F3MC 4F0GA 3HVCA 2C6MA 4O38A 4AWIA 3Q3BA 4BGHA 3RNYA 3EQHA 4GYIA 1UA2A 4B99A 2PUPA 3QLFA 4UMTA 4C34A 1TQPA 1STCE 3MDYA 4LGHA 4I6FA 4YJVA 2V62A 3DTCA 3PIYA 3FYJX 4FKRA 3PPZA 3THBA 3E62A 3AC5A 4FZ6A 5BMMA 4FTCA 4O7RA 3NAYA 1H8FA 3AC4A 2XUUA 4D2SA 3PSDA 3Q04A 2XNMA 2QOBA 4JQ8A 4NK9A 1CMKE 2X39A 3ZSIA 1KV2A 5AM7A 2YM5A 4MD9E 4FV0A 4JLCA 4YPSA 4C33A 2F4JA 1GZNA 2JBOA 3R04A 3NCGA 5I9ZA 2NO3A 3GB2A 2E2BA 1URWA 3W33A 2WKMA 3E8CA 4L68A 4MVFA 3VHEA 2PZIA 4EOSA 5AV4A 2IZTA 2IZRA 2XARA 3C13A 5LMAA 2WMQA 3UO6A 2UW5A 3I6UA 3ORLA 5AP0A 5G1XA 4F9AA 1BL6A 4YNOA 5CAVA 4AA5A 5L2TA 2OI4X 4O2ZA 1UWHA 2HXQA 5IU2A 2W1ZA 4OLIA 1P5EA 5HE0A 4YMJA 3BI6A 4H3QA 5E8VA 2AC3A 4D58A 2YWVA 2OJFE 4RJ5A 3UOKA 2IW6A 5CVHA 4ZJVA 1PF8A 4Z55A 4DDIA 4FSNA 4W8DA 3F3VA 4N6ZA 3JY0A 3F3WA 3KRJA 2HCKA 1XO2B 4I4FA 3ZSGA 4CCUA 5J5TA 3LQ3A 5IQHA 1SNXA 1ZYLA 2HIWA 5FTOA 4AACA 5JH6A 1TZDA 3NNUA 4HYHA 2XIZA 4IB5A 2QI8A 2J6MA 3FBVA 2R3LA 5DPVA 1PY5A 3BGPA 4QQTA 1S9JA 1BMKA 3PP1A 1WMKA 2ITQA 2ZV8A 4APCA 4EYMA 2W5HA 5JMSA 5AFVA 3NFGB 2Q0NA 1YOMA 2PVJA 3WE8A 4D9TA 1G8AA 4FOCA 3ZFMA 4E4MA 5B2LA 2ITUA 2JC6A 3ACJA 3DNDA 3UPXA 3R22A 4DN5A 1QPDA 5DRBA 4EEVA 4F09A 3NAXA 4IE9A 4ID7A 4XG6A 2OIDA 2PSQA 2YLFA 1OL2A 1W0XC 2PUUA 5EYKA 1LUFA 4NKAA 4FSQA 3EYHA 4BWKA 3GFWA 5I9UA 3TIYA 2PULA 1I09A 2OBJA 5CU2A 5EI8A 2UVXA 5EM8A 2R0IA 3FXXA 5HIEA 4F0IA 1G8JA 4FV9A 4NM7A 4H1JA 2JLDA 4AOTA 3MVMA 4YBJA 2PL0A 3D94A 1UVRA 1RJBA 4BTMA 4FGRA 4EJNA 3B8RA 4IX6A 4L00A 3RZFA 5EHOA 3W18A 2RFDA 4FZ7A 4WG3A 3UODA 3W2SA 3LAUA 4IZ7A 2HWOA 3KVWA 4O0UA 4AE6A 3BPRA 4FODA 2V55A 4E5AX 4CD0A 3VS6A 2VX0A 3GENA 4O7YA 5TKDA 3QQFA 3EQIA 5A6NA 4N6YA 2VO6A 4FYOA 5KMJA 4FVRA 4CRSA 2PVKA 4O0YA 4K0YA 3ZU7A 4IVBA 3F5UA 3RK5A 3MVLA 4PDSA 2ITOA 4KS7A 3VC4A 2GQRA 4O81A 3F61A 1NT2A 2YM6A 2JDSA 3KC3A 3OW3A 4XV3A 3OG7A 3C9WA 1W84A 1WBNA 4UY9A 1OUKA 1PXIA 4U42A 5EI2A 5FWKK 3ZC5A 5JSMA 4QYHA 4EOMA 4BHNA 3NDMA 4CFWA 2P55A 3FI4A 1KSWA 2XKFA 2XK3A 4EYJA 3W0RA 2OZOA 3G9NA 1OUYA 3MJ1A 4H58A 4ASDA 3QX4A 1YXTA 2R3HA 4MH7A 2OKRA 1ZARA 2ITPA 5HU9A 4GK2A 4ZY5A 3G90X 3P23A 3QHRA 3I79A 4FIFA 4OGRA 2B9HA 4G9RA 3JPVA 4I5MA 4XRJA 5LVMA 1ZYSA 4QMYA 4DHZA 2W1IA 3OVVA 4PP7A 4FJVA 4I20A 2YHVA 4FSUA 4UWBA 3SQQA 3P7AA 2NRYA 2YN8A 3PE1A 3R21A 5TT7A 4CLJA 4P4CA 4BKZA 4LOOA 1CSNA 2GSFA 2OIQA 5BVWA 1GY3A 3H30A 5LMKC 3AT2A 3LZBA 3QRKA 3CQWA 4LRJA 3MH1A 3EKNA 3Q60A 3TACA 4AGDA 3FAAA 3PRIA 3TV7A 2X9EA 2ZJWA 4ZSAA 4O4EA