4L3PA

Crystal structure of 2-(1-benzothiophen-7-yl)-4-[1-(piperidin-4-yl)-1h-pyrazol-4-yl]furo[2,3-c]pyridin-7-amine bound to tak1-tab1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
308
structure length
295
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 295
sequence length 308
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l3pA01
1G5SA 4FR4A 3MB6A 2GHGA 3NYNA 4YC6A 3DTCA 5DE2A 2WQBA 4QMLA 5T3QA 2YAKA 4ZLYA 5KHWA 3O23A 3SXRA 3U6JA 1Q8YA 3E64A 3ULIA 5C4LA 4FK3A 3RAIA 3U6HA 3FYKX 3TNHA 5LCJA 4O82A 4XP3A 5H2UA 2CNQA 4O83A 3LMHA 1PXNA 2OU7A 5E8XA 5EI8A 1U4DA 3PG1A 5M57A 4JAIA 4B9DA 4R1VA 4JQ8A 1IASA 3RAWA 4D4RA 4IDVA 3BBTB 3VUTA 2CPKE 2VWUA 4R5SA 2Z7RA 4GYGA 5LMKA 3IW8A 2ITUA 5F95A 1EH4A 5CTPA 5A6OA 4UMTA 4IANA 3ZM4A 3QUEA 5EDQA 4FT9A 3EB0A 3EQDA 3NZ0A 4U0IA 5L8JA 5C26A 5KHXA 2XA4A 1SYKA 2A2AA 4R5YA 3GU7A 4O81A 3QKMA 4CT2A 4UWBA 4I23A 3RINA 4WNOA 3G6GA 3PJ8A 2O5KA 3OXZA 3PZEA 4L3JA 5EG3A 2IZTA 4FZ6A 2W1EA 4CZUA 1JAMA 4LOQA 1REJA 4CFUA 4MXAA 4FTQA 3EN7A 4FSUA 1A9UA 3EN5A 3KK8A 3NNWA 3AC4A 4AGUA 5CVHA 4ZP5A 3AD4A 2GCDA 3IDBA 4KBAA 5KMMA 5AWMA 4EOKA 3BYMA 4ACDA 3FLYA 3E8DA 4IAFA 4NT4A 1OKWA 3N4VA 3NNVA 3FSFA 5FXRA 5HBHA 2Y4PA 3CQUA 3PJ2A 4Q9SA 5EDPA 4KWPA 1M7QA 1ZMVA 4JLCA 3WBLA 4QD6A 4U80A 4XH6A 2UZUE 1OPJA 4HVSA 2BFXA 2X2KA 3BHYA 3QYWA 4I6FA 3O0GA 1ZARA 2Z7LA 3LKMA 3RK7A 4OR5A 3R9HA 2FYSA 4X0MA 3LCOA 3HAVA 4C57A 2C6EA 4CFMA 3C13A 4EOLA 5K5XA 2HXLA 3U51A 3AC1A 1H0VA 3BELA 3QX4A 4BY9E 2W5HA 3WF9A 4DC2A 1UA2A 3IGOA 3QL8A 3P78A 3R7EA 4EOMA 4QP9A 1KOBA 5DHJA 4GH2A 2W99B 3ACJA 3BQRA 3CEKA 3ENMA 4RX5A 5LARA 3LFQA 4HNFA 3QD0A 4O0VA 5M44A 5GZ8A 1LEWA 1R0PA 2R3KA 3PIZA 2BR1A 4JAJA 3U8WA 5DEWA 4MKCA 4EORA 3OZ6A 4Y46A 4FV4A 3SHEA 1GOLA 3FAAA 3QCYA 4R77A 3PPZA 4L67A 3D4QA 2C6TA 5T6KA 2Z7QA 1M17A 4U44A 3OEZA 3PP0A 5A14A 4FEUA 2CGXA 3DQWA 3C5IA 3AXWA 4XG9A 2F4JA 2OW3A 4O96A 4YTCA 1Q24A 4FOCA 4NFMA 4C62A 3DCVA 3DDPA 3Q96A 4IZAA 3DFAA 5HE3A 4YJPA 3UODA 4CNHA 2AUHA 4MXXA 2VTAA 4QOXA 1BX6A 2XJ2A 3HRBA 2WD1A 3HDMA 4GT5A 3SW7A 2VO7A 3HA8A 2YFXA 3O7LB 4JI9A 1YXTA 4L7SA 1OI9A 3TEIA 5KMIA 4NYEA 4G31A 2Y8OA 5CI6A 1YDRE 4AZTA 4E4LA 5M53A 3Q52A 3DU8A 3FZSA 4NEUA 4KD1A 3V5QA 3F82A 1CM8A 1PXJA 4UX9A 4JG8A 3G0FA 5FEQA 4Z3VA 4ANMA 5TOZA 3ZHPC 4YZDA 3MIAA 3AT2A 4AW1A 1MRUA 1U54A 3QTZA 3BE9A 4AA0A 5HE2A 3ZSIA 3BGQA 4DTAA 2YZLA 5CF8A 4DEGA 5AP0A 5K4IA 1OMWA 4JRVA 4ZY4A 3DKFA 5EHOA 4FTUA 4G1WA 3C4FA 3LE6A 4M84A 2XK7A 3KULB 1YI6A 3G90X 3PA5A 3Q6WA 4C3FA 2E9UA 2GPHA 2RIOA 2XNBA 3GC7A 5JZJA 1Y6AA 4U3YA 5J79A 2X2LA 3OROA 4FV9A 2J5FA 4NM5A 3OWKA 3OT8A 3QUPA 3KU2A 3SOAA 3GQIA 4EI4A 5K9IA 4A7CA 3TWJA 4E1ZA 4DGMA 2VV9A 4WRGA 5CEIA 3UTOA 3A7IA 3UQFA 5M08A 1KV1A 4WUNA 4XV3A 3EFJA 5HICA 2C0OA 2YM4A 2R3PA 4J8MA 5HU9A 5J5SA 2BHEA 5HOAA 4O7ZA 3A7JA 3QBNA 3UZRA 4GVAA 4I4EA 2BALA 1FOTA 3R8MA 4UEUA 4YLJA 3BRBA 2I7QA 4O6EA 4DITA 2WMTA 5ETCA 2BRNA 4I92A 3D7TB 3I4BA 3MA6A 3F66A 3VIDA 4F7JA 1OGUA 4W4YA 2PE1A 3ALNA 4AT3A 5J5TA 2YIWA 2DUVA 4AUAA 3FLQA 3FEGA 2EB3A 3GUBA 1ZYLA 4P5QA 2B55A 2J2IB 2F57A 3P5KA 3V8TA 4Z9LA 5HNIX 5H9BA 4FIGA 1JLUE 5D7AA 4BCFA 4GT4A 3ZO4A 4PTCA 4D5KA 5A4LA 5E4HA 4I5HA 4PQNA 3O7LD 4JJRA 5IH5A 5I9YA 5D11A 4DFYA 2JKMA 3AGLA 4FEWA 1H1WA 5KCVA 4TYGA 5JFSA 2C0IA 4DF3A 2GS7A 2YN8A 3KB7A 2C69A 2W9FB 3TZ7A 1FBNA 2HWOA 3BU5A 3OWLA 4CT1A 1YDTE 4AFJA 3QHWA 2VTSA 3A60A 4GUEA 2UZVA 1XWSA 1RE8A 2IZSA 3MVMA 4FTLA 2R3OA 2OJGA 3NUSA 2GDOA 5DRDA 2QOHA 1Q3WA 3HV3A 5JMSA 4LGGA 5AUVA 4L9IA 2BDFA 3ORXA 4J95A 4YSJA 3ZUTA 1J91A 3LJ0A 4O21A 3QC9A 4E4NA 4IB0A 2EU9A 5D1JA 4IH8A 4EOJA 2J0JA 2GMXA 2UZNA 2WQNA 2VWBA 4N0SA 4D2VA 2XKEA 2WO6A 4V0GB 3ZONA 3TI1A 4BCIA 4FT7A 2YA9A 1YWRA 4PTEA 3VF8A 4D2WA 3LMGA 1FVTA 4K9YA 4TRLA 2W4KA 4DG3E 3C0IA 4KBCA 4TYHA 4WD5A 2YCFA 5I9XA 5AFVA 1BI8A 2DWBA 3FDNA 4IBMA 3A8WA 3UP7A 4ALVA 4BI0A 3ZEWA 5BUIA 5JGAA 5LMKC 4BCGA 2X7OA 3DB8A 1PY5A 2JFMA 4MWHA 5E92A 4HVDA 1TQIA 3FLWA 3KN5A 4RIOA 2WQMA 3HV5A 3JS2A 4DEIA 4EBWA 4O6LA 1YI4A 3RCDA 4S33A 1OB3A 2E9NA 3OD6X 1YXVA 4JDHA 4ANNA 1ZXEA 4IW0A 1ZYCA 2BZHB 2F7EE 2JITA 4FA2A 4U41A 5A4TA 3KVXA 3FZOA 5ANKA 4CV8A 3V5JA 4ZTHA 1CMKE 3UPZA 3JPVA 4L3PA 5FLFA 4HYUA 4L46A 3NX8A 4DYMA 4DBXA 2W4JA 5J7BA 5ANDA 5E91A 4XG8A 3LXPA 3R9DA 3U54A 3QZIA 1PMEA 5J87A 3AG9A 4BDKA 3UDBA 5GZAA 3B2TA 5BYLA 3CY2A 4S30A 4RJ3A 1YHWA 4IAYA 4KB8A 2P2HA 3GFEA 4NW5A 4BDFA 1T45A 3FE3A 5AV0A 1YXSA 2FH9A 4J71A 2F2UA 4C35A 1GNGA 4XG2A 2RL5A 5AX3A 3WIKA 5HNBA 3RWQA 2Z2WA 3MVHA 4ZIMA 3R8UA 4IX5A 4BDBA 2VO3A 3PTGA 2J0LA 3VVHA 2XIYA 4FV6A 2R7IA 4GSBA 4MNEA 2W1HA 3UYSA 2X6EA 4D2TA 3LZBA 3F88A 4YJSA 5CU4A 4KSPA 2IVUA 2XNMA 3Q5IA 2OJFE 2QO9A 2JIIA 2X1NA 4FNXA 1F5QA 2C3LA 4MH7A 4XNEA 5BVOA 3D94A 4RWJA 3HMIA 2C3KA 4QYYA 4NKSA 1FINA 5DFPA 3GOKA 3PUPA 5AA9A 4O2PA 3DLZA 4DG2E 2ESMA 4I0SA 3TNPC 2QVSE 1YWNA 3R8ZA 1CKPA 1YQJA 3T3UA 4FKRA 3FXWA 2BRBA 3W8QA 3S3IA 3SD0A 1A06A 3R7VA 3NMUF 5TE0A 3KY2A 4FKTA 4K8AA 4EHGA 2J9MA 2BVAA 3A7FA 3G0EA 4MX9A 2GQSA 2B54A 5IA4A 5CVGA 4HYIA 4LV5A 4YHJA 3FUPA 5HO8A 3VNTA 4F9YA 3EZVA 1WBOA 4FZAB 3VC4A 5CYIA 1KE9A 4B7TA 3BE2A 2RKUA 2GTNA 4OTRA 1L3RE 1OPKA 2ITWA 2XVDA 3O96A 3FMHA 2OFUA 2UUEA 3FZRA 4TWPA 3H10A 3T3VA 4ZSLA 3VBTA 3VUDA 2PSQA 4U79A 5ETIA 5HX6A 2UV2A 3MTLA 4CD0A 4AWIA 3EL8A 4TNBA 3QWJA 2X4FA 4FBXA 1PMNA 3PJCA 3R04A 1VYWA 5M4CA 4EJ7A 4UALA 4HYHA 3QRJA 2RF9A 3KRLA 3VW6A 5FD2A 3DB6A 3FI4A 4ENYA 1P14A 1OPLA 3T9TA 3ZMMA 5LXMA 3ORKA 3PVGA 2W4OA 3PRIA 3W8LA 5E8ZA 5EW3A 3QTIA 4JDKA 4CTCA 3KREA 3DK6A 4QMMA 1CKJA 1MQ4A 5I3RA 3NYXA 1OECA 4FTAA 2Z02A 4KKHA 5C01A 3LFSA 3OT3A 4C38A 3VRYA 3MW1A 4QP4A 4XRLA 5AR8A 5HZNA 4YSMA 4QO9A 4K1BA 4YO6A 3RKBA 3S1HA 1U5QA 3I7BA 2OLCA 3K5UA 1W82A 4RA5A 3FLZA 3KVWA 2CJMA 3DK3A 3FPMA 2YM7A 1U59A 2CDZA 1ERKA 3QRKA 1J1CA 3PP1A 4M69A 1J7IA 4EH6A 2G2HA 4CCBA 4ZTMA 1KOAA 3JVRA 2OJIA 4RJ4A 2XKCA 3GI3A 3K3IA 5BMMA 5FTOA 3BEGA 2C6KA 5CT0A 1PKGA 4IXPA 5EI6A 5JZNA 4ACCA 4G34A 3ZLXA 4LI5A 4UN0C 2QQ7A 3HP5A 4UYAA 3HMPA 4J52A 2PMNX 3CCNA 3DBCA 4LYNA 3SC1A 3TZ8A 4FZFB 2XIKA 4KINA 3Q53A 4CEGA 4CFNA 2V5QA 5HIEA 4BZDA 4DINA 2ZDTA 2PWLA 3TJCA 5TO8A 4BL1A 4CTBA 2BKKA 3ROCA 3FY2A 2BTRA 3LFCA 4UMQA 4HJOA 4ZJIA 3LFAA 1Q99A 3DAKA 3QCXA 4BCQA 2ITYA 3ETAA 3VUMA 1YXUA 2H9VA 3SRVA 4PL4A 4B4LA 3O51A 4DFZE 2ZAZA 3PWDA 2EXEA 3MPAA 4XV2A 5BVFA 2C3JA 1SZMA 4M8TA 2X9FA 4YTHA 2CNUA 2R3MA 3NYOA 4W4XA 4IX3A 2OXDA 3VW8A 2YLEA 3UG2A 3OXTA 5CQWA 3AC5A 4C4FA 2WMXA 3SA0A 1Q41A 2G01A 2O64A 3FKOA 3HKOA 4IVCA 3NUPA 2PZ5A 4A9SA 3Q4UA 2WU7A 3VS7A 2PVHA 4CMTA 4EK3A 1UKIA 1OM1A 3QA0A 3V5TA 3IECA 4ZZNA 3WOWA 4ANOA 4Y95A 3V51A 4GT3A 4DH5A 5CEQA 1LR4A 5F4NA 3ENHA 3EMGA 4LQMA 5J9LA 4QP3A 3NVMB 2OBJA 4OBOA 3TUBA 2UW7A 2B52A 2VD5A 4FOBA 4QMPA 2BRGA 3F7WA 4EQMA 3KULA 5IEXA 3ZUUA 2JDVA 3U87A 1JKKA 3VJNA 5CAVA 3KF4A 4D9UA 4ASZA 5K0XA 1PMUA 2B9IA 4XRJA 2FSOX 4JDJA 1RDQE 4J8NA 4V04A 3AD6A 2RFNA 3QF9A 5J9ZA 2WMBA 4B0GA 3OBGA 5FWKK 3QX2A 4AXAA 4EHVA 4ALWA 3ANRA 3PSCA 1H25A 1M2RA 3BCEA 3GC8A 3ZU7A 4BWPA 3VS5A 1K9AA 3EQGA 3ZO2A 4C33A 4QTEA 1QPEA 4DA5A 1WBTA 5FP5A 4TY1A 3R7GA 4D0WA 4V01A 4D4VA 2QD9A 3P79A 3QAME 4BFMA 5L6OA 4C3RA 1U54B 1OL6A 2VNYA 3GOPA 1PKDA 1XH4A 3BX5A 1W98A 2X7GA 1HCLA 4L43A 3D7TA 3N4UA 2OZAA 3BHTA 2B1PA 3TKIA 3H9OA 4MF1A 3R8VA 3UO5A 2R9SA 3LOKA 4JX3A 2F2CB 4HGTA 2XCKA 3CPCA 2VO6A 3JY0A 4AOJA 2PULA 5ANGA 5HD7A 3W16A 4CLJA 4CFFA 2FSMX 2IG7A 3SV0A 3VN9A 1H1SA 3L8PA 2AC5A 3NSZA 4CXAA 1OKVA 4BIBA 3ZXTA 4L01A 2VNWA 4PV0A 1YW2A 3IDCA 2XM9A 2FSLX 4FTMA 4AS0A 3QCQA 4NM3A 5DT3A 4LL5A 2HW6A 3W18A 4OAVB 2BPMA 3JYAA 4EKLA 4D0XA 2OKRA 3IOKA 1WBWA 3KXXA 2XMYA 3QRTA 4FGBA 2WTVA 4O38A 2OI4X 1BUHA 5B2MA 3DS6A 2RG5A 3LCTA 3I6UA 4N6ZA 4F70A 2W5BA 5M55A 4DH8A 4M67A 3TT0A 2WEIA 2Y6OA 5M4IA 2IN6A 3FV8A 3SGCA 3IS5A 4MXCA 4RLLA 4RRVA 4W4WA 3RPOA 2GQRA 5I9WA 2C1AA 5EM5A 2YAAA 5D12A 3UG1A 2GNHA 4V0GA 4CVAA 4PPCA 2EB2A 2UZOA 4IB5A 2OZOA 1WAKA 2IVSA 3VBWA 4S32A 5HG7A 2CLQA 1Q3DA 3GT8A 3Q04A 1YHVA 4UMRA 2PYWA 3MWUA 2R3LA 4EONA 1RJBA 3DBEA 3LFNA 5AR7A 4K0YA 5EI2A 5DMZA 4CKJA 5L8LA 1RQQA 3GXLA 4QMZA 5J7HA 5EYCA 1JSTA 4C4EA 4DEAA 4L53A 2ZM1A 1LUFA 5HX8A 5HHWA 3C1XA 5M56A 5BYZA 2VTHA 4DEDA 3S95A 4LOPA 3IG7A 4FV0A 4O1OA 1FQ1B 3GBZA 4J98A 4DH3A 4O0RA 3TDWA 3EN6A 3VS0A 4BB4A 1VJYA 4I0RA 1XO2B 2VZ6A 3C4XA 3CXWA 2RFEA 2PL0A 3FY0A 1E1VA 3F9NA 4LMUA 4C02A 2A27A 1NW1A 2C47A 5EYKA 4U97A 3GCVA 3QC4A 5G1XA 5K3YA 1TVOA 4XG3A 2C5OA 5J8IA 3L9PA 3VUKA 4RGJA 4FYNA 4RC4A 4C4HA 4YPSA 4I6QA 4UZHA 4UWYA 4IWDA 4FKPA 2IWIA 4G9RA 2O0UA 4NSTA 4TZRA 3R8LA 3UQCA 2B9HA 4FSNA 3UZTA 5AP2A 1M14A 2Z60A 4YZBA 4F0FA 3QD4A 4ZTSA 4LGDA 4GIHA 2I0HA 5IDNA 2QNJA 5IISA 3RK5A 2YCQA 3P4KA 4M13A 5FGKA 2BMCA 3QQGA 2OICA 4B99A 4EOSA 3E8EA 3R1SA 4ZEGA 4NH1A 2BIKB 4IADA 3BHHA 4K18A 3BGZA 4F4PA 3BHVA 3VRZA 4Q2AA 4W9XA 3HVCA 3W32A 4MAOA 4FIJA 4JBPA 4RA4A 4IHPA 3E7VA 4OTWA 3ZRMA 1E9HA 4RIWB 2WB8A 4AOTA 4BCOA 4FE2A 5CF4A 3UC4A 4I24A 3FZ1A 3LPBA 5BQ0A 2GNJA 4GFGA 4IAKA 2XRWA 2UZWE 5IMEA 2XNEA 4C0TA 4GU9A 3QXPA 4KIQA 5A54A 4ZS0A 4BTJA 3GEQA 3GU4A 2UW4A 3I5ZA 4JR7A 5IQEA 2GHMA 2J0IA 4RX7A 4C7TA 4PDOA 4BTFA 1OIRA 3AC2A 3UOLA 3CQWA 3W2RA 4OT5A 5C9CA 3BI6A 4BKYA 4M0YA 3W2PA 4EK5A 2PUPA 3UVPA 2IW6A 2OO8X 4XG7A 5AAEA 2UW3A 2XIZA 1OVEA 3B2WA 3LIJA 3QCSA 2R3GA 1Q62A 4I20A 5HO6A 4CYJA 5A4CA 4X7QA 4MNEB 3ITZA 3MFSA 3QYZA 1ZAOA 5DI1A 3EN4A 3CS9A 2PVFA 4QP7A 3ZZEA 1GIIA 1QMZA 2BRHA 2JGZA 4Q5EA 3UNJA 3DXQA 4D55A 2XJ1A 2VTOA 3ORMA 3UIUA 4YJRA 1OKZA 4N70A 3PZHA 1V0PA 5AUWA 3MTFA 3TN8A 4S34A 4YJUA 5E8WA 3Q4CA 3ZLWA 4C36A 3TNQB 1BLXA 4WSQA 3R1YA 5HIBA 2BDWA 5TR6A 2V7AA 3I7CA 3WF8A 4IC7A 2V62A 5LVOA 4LL0A 2NO3A 5AV4A 2XNOA 5KO1A 2YIXA 4XBUA 3LVPA 2VGPA 5DBXA 4AQCA 4FSQA 4FEQA 3QALE 4EH2A 4QNYA 3NNUA 5HBEA 1NVSA 3M1SA 4BBEA 3ALOA 3GVUA 4RX9A 2RG6A 4Z55A 2OIBA 5DOSA 5AX9A 3PXKA 3UOJA 4FTRA 1PXKA 3UP2A 4ACHA 3NVKI 4DEEA 5IQHA 3ZSHA 5HBJA 1G3NA 2EXCX 4UYNA 2C5YA 4UXLA 5HCZA 3BPRA 2JLDA 2C5NA 3EQBA 3KCFA 3POOA 3PY3A 4HGLA 4YC3A 4AGWA 1OZ1A 2O8YA 4GRBA 3FMEA 2BZJA 3D14A 3MPMA 3GB2A 4DCAA 5HG5A 4BDEA 4ITJA 5JFVA 1TQMA 3PYYA 4R7IA 3B8QA 4AE9A 4M14A 2ITQA 5DN3A 4TKSA 1P4FA 2F7ZE 4MD8E 4OGRA 3TV4A 5DYJA 3L9MA 4KAOA 4FKWA 4QPMA 3ATTA 1B38A 5IA3A 2ZVAA 3R9OA 2P3GX 5L4QA 4R78A 5ANEA 3CJGA 1UNGA 4EH4A 4OTHA 1R1WA 3QGWA 4OBPA 1O6LA 3O50A 4U8ZA 4W8DA 3U9NA 3AQVA 3JR1A 4D2PA 2QURA 3COIA 3Q32A 5EKOA 4H3QA 3P1AA 5L2TA 1UWHA 3IK3A 5LJJA 4M69B 5GINE 2QHNA 4XLIA 4DFNA 4FMQA 5LVMA 1DAYA 1ZYDA 3OW3A 3Q4ZA 3CTHA 4YU2A 3R7OA 4QQ5A 2CN8A 2PMIA 2C68A 4ENXA 4EQUA 2E9VA 3ZLSA 4DTKA 3RPRA 4K6ZA 2QOIA 3F5UA 4FSRA 4IDTA 3A7HA 3UVQA 2OIQA 4OUCA 4F7NA 3PIXA 3R63A 3JUHA 5EW9A 2YISA 4FODA 3ZEPA 5M09A 3DA6A 3VS3A 4ZSJA 1VR2A 5DR2A 2F49A 4CG8A 3B8RA 3ZCLA 2V55A 3EYGA 3DY7A 4EUUA 3SRVB 4AE6A 3QQHA 5HGIA 3CY3A 4QMWA 1WZYA 4IM3A 2IZUA 4CFWA 3OUKA 5FEDA 1H00A 4RFYA 4ZMEA 5DG5A 2XEZA 4E5AX 2QOOA 2WTIA 2HELA 2VTLA 4FSYA 4HOKA 4OTQA 2QU6A 2REIA 4MXZA 4F63A 3DOGA 3H30A 4ASEA 3UJGA 1KE8A 3A4PA 1QPCA 3PE2A 4X21A 2B0QA 4U81A 3AT3A 3IKAA 3PVBA 4EH5A 3UE4A 4GW8A 3RPYA 2JKOA 5IPJA 3O2MA 4F9AA 2BAKA 1OIQA 3MY1A 4KIKB 4X2KA 2LAVA 4D1XA 5CXZA 5KMOA 4IWOA 4EJNA 4FNZA 3WZEA 4TWOA 5CSXA 3HMNA 5HCYA 3UO4A 4DG0E 3ZDUA 4G16A 4YJVA 5G6VA 4OW8A 2VTIA 3D5UA 3KXMA 3W55A 4QMYA 4FV7A 4W9WA 1YXXA 4S31A 2RFDA 4WUAA 3AT4A 2IZRA 4G9CA 3TKUA 4EHEA 4O0YA 2WTWA 5FBNC 1FPUA 3FQHA 4JQEA 2FA2A 4FKOA 4JNWA 3F3UA 3WI6A 3GGFA 5IA1A 5ETFA 4P7EA 3EOCA 5BPYA 3NS9A 5IH6A 4FIFA 2W1ZA 3SXSA 4RBLA 3QTQA 1ZY5A 3S0OA 3AD5A 2W9ZB 5H8EA 2WEVA 4QP1A 3SDJA 3FXZA 4DH1A 4NJ3A 1XJDA 4JX7A 2WZJA 3OBJA 3C0GA 5EM7A 5GJDA 5AUXA 5E1SA 5AP4A 4PWNA 4RZVA 3CJFA 4S2ZA 5JSMA 4GFOA 4KUJA 3D2IA 4NM7A 2XK9A 5LVNA 3M2WA 4OTDA 4PNIA 4RPVA 2DS1A 3OUNB 3VS1A 3HGKA 3IGGA 4QMNA 2OZAB 5KMKA 2I0VA 3TACA 3NRMA 2YDKA 4NW6A 1J1BA 2Y6MA 3LW0A 4MQ1A 3UIXA 4D28A 2GHLA 3F2RA 1YOLA 4BDCA 3AGMA 4EKKA 2C5VA 3SG9A 2OWBA 2LGCA 2YWVA 1UV5A 1Z57A 4BTKA 1PW2A 1KUTA 1JKSA 1VEBA 3QGYA 2O63A 3EL7A 4I94A 4YLLA 2P0CA 5ACBC 5GJGA 4DGNA 4JG7A 5BYYA 4PUZA 5DLSA 4BF2A 4RVLA 3Q2MA 3OF0A 1UNLA 1SVGA 3RI1A 3W33A 1M2QA 3HUBA 3NW6A 3COHA 3F3ZA 4C34A 3LXKA 3KRRA 5M4UA 3MS9A 4IM2A 4BCJA 3LFFA 4W4VA 2WNTA 5BVKA 3QLGA 4M3QA 3PE1A 2Q83A 3L8VA 5CEKA 2BDJA 5FXSA 4F0GA 2OF2A 4G6LA 5I9VA 4A9YA 3WARA 4NUSA 4PMPA 4M66A 2BUJA 3EFLA 5E8UA 3MIYA 2AYPA 1GZNA 3E3PA 4RVKA 4BC6A 3E3BX 2Z7SA 4YR8A 3OTUA 4L3LA 5I3OA 4ARKA 4XBRA 4F64A 1S9JA 3U4UA 3UBDA 4ANBA 2W7XA 2HOGA 2V0DA 5AUUA 5T68A 5CAUA 3NWWA 5JN2A 1WBPA 3ACKA 3F3WA 4PL5A 2WAJA 4CG9A 1P5EA 4X3FA 4FKJA 5F94A 5FDPA 3DAJA 2IPXA 2B7AA 3KXZA 2WQEA 4FG8A 3L9NA 4FIHA 4NIFA 5D10A 3UGCA 2CNVA 3IPHA 5DT0A 3QU0A 4BDJA 4BCKA 3LCDA 3MVJA 3FI8A 5FTQA 1ZLTA 3QZHA 4G5PA 1J7LA 2RFSA 3FI3A 1CDKA 3L8SA 4Z7HA 3C50A 3KCKA 4FF8A 5K0KA 1H8FA 3I60A 1BI7A 3PLSA 3N4TA 3QQLA 3GFWA 1F0QA 2XNPA 4J1RA 4AP7A 3C4EA 2XZSA 5CVFA 3ZC5A 4Y73A 5E8SA 4ZK5A 5DT4A 4NU1A 3DBQA 4YP8A 4RIWA 5JQ5A 1ATPE 3R28A 4CRLA 1QPJA 1H4LA 2UW9A 5B2KA 2UVYA 3WZKA 1CKIA 3ZDIA 2ETRA 2ACXA 3P23A 5IZFA 5DIAA 4E6CA 5ACKA 1OIYA 3SAYA 1JWHA 1LP4A 1XKKA 3D5VA 3OEFX 4PNKA 1NA7A 3LFEA 3PLAE 3V6RA 5H8BA 5TF9A 2YIRA 4GV1A 3V8WA 5IA2A 2QO2A 1ZRZA 4GJ2A 4L44A 4XUFA 5EYDA 3SOCA 3VBYA 3PXFA 1AD5A 4IM0A 4JVGA 4IAZA 3NCGA 2NNWB 1H08A 3W2CA 4DTBA 3KQ7A 3DT1A 3I5NA 4QQCA 2XK4A 3P86A 3RNYA 3PIYA 3SX9A 4IZYA 4X2FA 2CGUA 3OY3A 1KE6A 3TL8A 3W2OA 1Q61A 2CKEA 3ZSGA 5JH6A 3R9RA 5AUZA 2WFYA 4IC8A 2VWWA 4Z16A 4BWKA 5LOHA 3P7CA 5AUTA 4I41A 4XMOA 3UC3A 3RMFA 3K3JA 2OF4A 3FJQE 5CANA 2OH4A 1OBGA 1XBAA 4BVUA 4QTBA 3TNWA 1A48A 3KFAA 4HVIA 5LWMA 3KXGA 4ZZMA 3R2BA 5I9UA 4DLIA 3UYTA 3KMWA 4KABA 2ONLA 3OCBA 3VBQA 4RIYA 4CMUA 4LRKA 1UU3A 3LCKA 3SXFA 3UPXA 5E9EA 3UNKA 1GIHA 3EFKA 3QQJA 4CSVA 3D2KA 3SKCA 2SRCA 4E26A 4KA3A 3FMKA 3KC3A 2ZV2A 4OTGA 3BIZA 3LFBA 4O0XA 5IQGA 4WNKA 1GY3A 4PY1A 1JVPP 3C0HA 1H27A 4DEHA 3KXHA 4AX8A 5AEPA 1U5RA 3HRFA 4JXFA 4WNPA 3KKVA 3OOGA 1UNHA 2YDIA 4MBJA 4OTIA 4BI2A 4IFCA 1T46A 3P7BA 4CFXA 3CD8A 3CSVA 3VS4A 3F2AA 2HK5A 5E8VA 4D2SA 5EK7A 4G3EA 3O8TA 4FTCA 3G51A 4AW2A 3NUNA 4QMOA 1ZMWA 3MFUA 3MPTA 2BILB 4FICA 4BYJA 4ZAUA 5JK3A 2J0KA 2XIRA 4IB3A 1PXOA 2R3QA 3HECA 4IZ7A 2HW7A 4RG0A 4RJ5A 3PA3A 2GSFA 4ZY6A 4F08A 2C1BA 4YZ9A 1M52A 2CMWA 5DPVA 4CFVA 1XH5A 2YIQA 4M0ZA 1Z5MA 3MFTA 3FYJX 4MCVA 1YKRA 4O0SA 4EEVA 3MH1A 4EUTA 4BR3A 4FSWA 2OIDA 4BRXA 1GJOA 2WU6A 3BLHA 5CI7A 4EOPA 3HUCA 1DM2A 3C9WA 3OWPA 2UZTA 4CCUA 1YRPA 3C4WA 5L6WL 3NNXA 4EK8A 5ICPA 3LM0A 5FM2A 3D5WA 3QTUA 3UVRA 1IAJA 2BROA 5IH4A 2PPQA 3R02A 2A4LA 3QTRA 4O22A 1Y6BA 5AMNA 5EHYA 3VUGA 5JT2A 2C6DA 2OJJA 4A4XA 4O84A 5I0BA 4C37A 1YHSA 3BLQA 3DKGA 3O8PA 4QMVA 5AP3A 1KE7A 4Y8DA 3MBLA 4NZWB 4F99A 4P5ZA 3THBA 4FIIA 4FTIA 4RZWA 5HLNA 3ZZWA 2IW8A 3DK7A 3QHRA 3RAKA 3TG1A 3ZC6A 3F3TA 4FZDB 4G6OA 4RFZA 1O6YA 1ZYJA 5IA5A 3EHAA 5CS6A 3VQUA 4HNIA 5AP5A 4MD7E 4A06A 5J9YA 3LCSA 3RCJA 5JEBA 5CZHA 1OITA 3GU6A 4FNYA 4RC3A 4E20A 2QCSA 4LV8A 5IA0A 1HCKA 2W06A 3VO3A 4NCTA 4QMSA 2PUIA 4L6QA 3BYOA 4YTIA 1Q5KA 3ZFMA 1GIJA 2EUFB 5HI2A 3DBFA 5EH0A 4ZSEA 4PL3A 1KE5A 2WMAA 2CKPA 1ZOEA 5M07A 1LEZA 4I22A 2HY81 2R0UA 2VTQA 2Y0AA 4FG7A 5HVJA 2CKOA 3LJ2A 4FTNA 5IEYA 2QOLA 4BDIA 5F20A 4ZXTA 4RX8A 1GAGA 3TNIA 1G8SA 3FPQA 1Y57A 4CRSA 4EK4A 5CF6A 3KMUA 3NYVA 4CYIA 3LXNA 2PUUA 3PSDA 4ASXA 3ZM9A 4APPA 3ZRKA 4EH3A 4F7LA 3ELJA 4FT5A 1BL6A 3RPSA 4FG9A 5KKRB 1PRYA 5JFWA 2UZLA 2W05A 4GEOA 2HENA 3HV6A 5AIKA 4XP2A 2XNGA 4ZTRA 4PP7A 2QOKA 4KIKA 3HYHA 3FZPA 4WIHA 1YWVA 1JSVA 1Q8ZA 3Q9ZA 2EVAA 1BL7A 1W8CA 5IQCA 1YOMA 4NK9A 4IWPA 3RHXA 1ZOHA 4E8AA 3NUAA 4DT9A 3A4OX 4AFEA 4UB7A 2XF0A 2WMVA 2X81A 4QP2A 4R3CA 2FO0A 3AMAA 5C27A 1GZOA 4N6YA 4XP0A 4FV1A 3ZLYA 4E5WA 2UVXA 4UY9A 2XM8A 4IX6A 2ZDUA 1OUKA 1R3CA 4RWIA 2ITVA 3DJ7A 3RPVA 3V5WA 3QFVA 2OXYA 3OHTA 5EQYA 3PPKA 5FQDC 1XHAA 2YACA 3MY0A 3IOPA 4D4YA 2BTSA 2R3NA 4YBJA 4ERWA 5ANJA 3REPA 1H01A 2OGVA 3VHKA 4ZTLA 4E6AA 4MYGA 2CGWA 3F5PA 2QKWB 4Q9ZA 4A4OA 4WA9A 2VAGA 4USFA 2P4IA 3HL7A 3I6WA 2WOTA 3GENA 1CSNA 2XH5A 3JVSA 3QD2B 2BHHA 3QRUA 4H1MA 3BWFA 5BUEA 3I79A 1APME 4ITIA 5AP7A 5I5ZA 3R0TA 3PPJA 3S2PA 1SNUA 4FVRA 2R3FA 4TT7A 3C4CA 2PUNA 2WTCA 3BZ3A 3L8XA 4X3JA 4Y83A 3HMOA 2B9FA 4IJPA 3Q9XA 2ZM3A 5E8YA 2W17A 5GIOE 3VWAA 3ZUVA 4XEYA 2QONA 3A2CA 1CTPE 3KA0A 5HE0A 4IIRA 4C2WA 4J99A 5AP1A 4ACMA 5HO7A 5FBOA 2AC3A 4FTOA 1I44A 4KIOA 4RIXA 3R83A 5L2QA 5CSHA 2QG5A 4IB1A 2YEXA 3ZFXA 2VWIA 3GCPA 4M7IA 1P2AA 4GS6A 2JAVA 2WTKB 2PE0A 1MUOA 3MVLA 4NJDA 4L45A 4TW9A 1ND4A 2UW6A 4R7HA 4FSMA 1H26A 3QA8A 3NCZA 4NTTA 3DFCB 2J50A 2E9OA 5EM6A 2Y4IB 3JY9A 2FSTX 2PZYA 3E62A 3KXNA 3NW5A 4FI1A 3QKKA 5CQUA 5BX0A 3G33A 1JNKA 1Y91A 3I0OA 3MB7A 4DFUA 2ONLC 2OXXA 4FT0A 3EJ1A 4YNOA 5AM7A 4D4SA 2PZPA 2WMWA 3FWQA 4E4MA 5GIPE 2J4ZA 2RGPA 5IMXA 4H36A 2GNIA 2QOBA 3TKHA 3D9VA 3R2YA 4KRDA 4YPDA 4GIIA 3CBLA 3I1AA 3R8PA 5IEVA 3CLYA 5CNOA 3D7ZA 4ALUA 3NUUA 3G15A 4E6DA 2P2IA 4QMTA 1W0XC 4IE9A 3JXWA 2IVVA 5HTBA 4IVBA 4UZDA 4L00A 5C8KA 2XS0A 4YHTA 3QRIA 3CGFA 4YBKA 5KX8A 4FKUA 4EC8A 5IQIA 5DNRA 3UNZA 5AADA 4I5CA 2GS2A 4DFXE 2QU5A 1NXKA 2BCJA 2C30A 3S00A 1UVRA 3EYHA 1YVJA 4K33A 3IONA 4ZLZA 3VF9A 3IW4A 3GCQA 2PVJA 5HCXA 3DDQA 2QG7A 5HD4A 3CR0A 3NAYA 5CEPA 2HYYA 4ZJJA 2A1AB 2ERKA 2OK1A 5L2IA 1XH7A 3V5PA 3TDVA 2EWAA 2XRUA 5DH3A 4BZOA 4F1OA 1OUYA 4R8QA 3AC8A 4ANLA 4B8LA 1YDSE 4BYIA 2V22A 3P08A 3TIZA 4X3FB 5JRSA 4EK6A 3LLTA 3AC3A 4BCNA 5DRBA 2UVZA 4F6SA 4A4LA 4NIFB 5A46A 1PXPA 2WKMA 4DLJA 4YTFA 3GC0A 4MXYA 5HEZA 5CEOA 3LQ5A 1H1RA 4AZFA 3OOMA 5A4QA 4PF4A 4G17A 1H1PA 3LXLA 2ZB0A 3DZQA 5AJQA 4ZTNA 3GC9A 3WILA 2Y7JA 2VTTA 4ID7A 1OL5A 3Q5ZA 1NY3A 1Q8UA 1IA8A 2ITXA 4O0UA 3E8NA 4AT5A 2C6MA 3GNIB 5L3AA 5L6PA 1FMKA 5AR4A 1UU8A 5EYMA 4UV0A 4JR3A 3HMMA 1NVQA 4GL9A 3PA4A 4BKZA 5E7RA 4IWQA 4MHAA 3FKLA 4AGDA 4XYFA 3F6XA 3WE4A 3DXPA 4MD9E 1G8AA 4BIEA 3NPCA 4NCTC 2BKZA 5AA8A 4KS7A 4E93A 5CSPA 5IU2A 3FI2A 4DN5A 5LMBA 1O6KA 5KE0A 1GZ8A 2BAQA 2W1CA 3MJ1A 2PK9A 3KRJA 4CQGA 3DKCA 5JRQA 3FL5A 2WMUA 2YCSA 3H3CA 4L68A 3MFRA 4ZY5A 2Y9QA 2I6LA 2CCIA 4K2RA 2JKKA 2WIHA 4BDGA 4EBVA 3FC1X 4I3ZA 2JDRA 4PX6A 3MA3A 5AIRA 3H9RA 1QL6A 3KGAA 4D9TA 2F9GA 3CGOA 3O71A 4QTDA 2YJRA 2ITNA 3OXIA 4MF0A 2BZKB 4Y72A 3OMVA 4C3PA 4RIYB 3ZS5A 1UU9A 3NDMA 3WYXA 1U46A 5HG9A 5EM8A 1IEPA 1TQPA 3VQHA 2GNLA 3C51A 3R1NA 3PY0A 5EHLA 4F1TA 5IQDA 3EH9A 3LQ3A 1B6CB 1WVWA 4QMUA 3RGFA 1NT2A 5D7VA 4A9TA 5CT7A 4C4GA 4PPBA 1OIUA 3WZUA 1M7NA 2R0IA 4FKSA 4PDPA 1RW8A 3CP9A 4U40A 3WF6A 4J7BA 3A61A 5EFQA 4V05A 4AA5A 2XCHA 3AMYA 1DI8A 4HZSA 4AT4A 4TNDA 4RVMA 2VX1A 2YM5A 1XR1A 3NLBA 1REKA 4JL9A 4K77A 5FUTA 4DFBA 2QODA 4XG4A 4HW7A 5KBQA 5CENA 4IEBA 4UMUA 1V0BA 1W7HA 2ITZA 3NUYA 2C0TA 3NW7A 3R6XA 1DI9A 5I4NA 3FL4A 5HQ0A 4C8BA 2XKFA 4A9RA 4RWKA 1H24A 3NUXA 4WT6A 4XCUA 1ZZLA 3RALA 2PVNA 3LM5A 4ZS4A 3O17A 3A7GA 1VZOA 5CU6A 3VS6A 3MN3A 4QMQA 5KZ0A 3HRCA 4FV2A 4P2KA 4AGCA 3OG7A 3CQEA 5M51A 2V7OA 2QLUA 4ACGA 4UBAA 4FSZA 3FLNC 3BKBA 4XOYA 4AN9A 3EQPA 4M15A 1ZOGA 2ITOA 4X2JA 4CLIA 1URCA 5AP6A 3R01A 3SQQA 5HVKA 3HV4A 5E8TA 2OH0E 1QPDA 4IVAA 3FZTA 2YWPA 4JIKA 4GKIA 4YMJA 5HLPA 3F5XA 5JGBA 4JRNA 3ZO1A 2R3HA 2HY0A 5FTGA 3OW4A 4IAIA 2JBOA 5DEYA 4EWQA 1SNXA 4OT6A 5IQFA 1M2PA 3W2SA 4J53A 3LLAA 4HVGA 3UO6A 4BN1A 5FEEA 5CSWA 3Q2JA 3KF7A 4MVFA 4FEVA 2JIUA 5AUYA 4AN3A 3U6IA 4R6VA 4X6QC 4Y85A 5AV3A 4PTGA 3VAPA 3II5A 3K54A 3CIKA 4MBIA 3S4QA 3DXNA 3COMA 3FXXA 3HX4A 3EN9A 3OVVA 3TCPA 2VWVA 5HESA 5HE1A 3UOKA 3PJ1A 4RFMA 3WF7A 4FV8A 4AAAA 4FV3A 3QZFA 4X2GA 3COKA 2PVLA 2KULA 3RAHA 2PY3A 3LJ1A 3ZXZA 4EWHA 2DYLA 3F2NA 3ZBFA 4QQTA 1XH6A 3G9NA 2BZIB 3R22A 2VTNA 4QQJA 4B8MA 4XJ0A 4ZSAA 3KN6A 3EIDA 4DT8A 2KTYA 4EH7A 1E1XA 5HVYA 5B7VA 3R73A 4GG5A 4KSQA 4I93A 4RMZA 4D1ZA 2GU8A 4G6NA 5LVLA 2CGVA 4ORKA 1WMKA 4LGHA 1S9IA 5CF5A 5EQPA 4C59A 3OCTA 4F65A 3HP2A 2ZJWA 4XHKB 4ZZOA 4BBMA 2QO7A 1V1KA 1H1QA 4A07A 1PHKA 2WPAA 2XIXA 4FKLA 4WKQA 5ANOA 2NPQA 3ZYAA 4FL2A 3HDNA 1WVYA 3F61A 2BAJA 4IAAA 3FHIA 1PXLA 2VN9A 2VTRA 2VTMA 5L2WA 4O7TA 4CQEA 2R3IA 3EQFA 2I1MA 1PYEA 5EQEA 1W83A 5L2SA 4O1PA 5CALA 2WIPA 1WBSA 3DNEA 4RVTA 3TXOA 2PMLX 2YDJA 3DQXA 1UU7A 2H34A 4JS8A 2JDOA 4HGEA 4TXCA 5KUPA 2BIYA 3WZJA 3E93A 4E4XA 3V5LA 5CSVA 5EKNA 2IW9A 3MSSA 2YLFA 2G2FA 2H6DA 2GQGA 2W1IA 3IW6A 4ANQA 3BV3A 3Q9WA 2R5TA 1YOJA 4U5JA 1Q8TA 5GHVA 3EWHA 5A4EA 2B53A 3ZO3A 4QPSA 4WBOA 3RWPA 5ANIA 2VTPA 2VU3A 2NRUA 5GNKA 4H3PA 2CLXA 1AGWA 3EQHA 4LUEA 2OJ9A 1SMHA 3FMJA 3LMIA 3TV7A 2VWXA 4RQKA 2C6OA 3ORPA 3LAUA 4FUYA 4GMYA 2QOCA 4F6UA 5IQAA 3LQ8A 3QZGA 4F0IA 4EYMA 2G1TA 3OFMA 4AZSA 2CSNA 3RM6A 4C4IA 5AV1A 2XYUA 3ODZX 3R30A 3OCSA 4IFGA 1OL7A 1PXIA 2X39A 4BGQA 4UXQA 3QLFA 4QP6A 4W8EA 4IQ6A 5CAOA 3V8SA 4B6LA 2J5EA 1FGIA 2HZNA 2YZAA 3BEAA 5AR3A 3ZFYA 1UKHA 3IW7A 4AW0A 1MRVA 4TTHB 2FUMA 5LVPA 2HWPA 3MY5A 1XH8A 2W1FA 3DJ5A 3TIYA 4C58A 4EYJA 4EQCA 2UW0A 3E92A 2PMOX 4WG5A 4RIXB 2W1DA 4XOZA 3BBWA 4GJ3A 3BU6A 5FM3A 2H8HA 4E73A 4BGHA 4RJ8A 2ETMA 2PZIA 4USEA 1R78A 2RSVA 1ZZ2A 4FVQA 1SM2A 3KL8A 3R71A 4I6BA 2O65A 4MBLA 2VGOA 3DBDA 4LUDA 3QXOA 3RZFA 2QHMA 4GVJA 3BYUA 1OBDA 1H07A 4QYEA 5CXHA 3VBVA 3RM7A 3UZPA 5BVEA 4RQVA 4TPTA 4E7WA 2QR8A 4Y5HA 3U4WA 2X8EA 4MK0A 4RC2A 3C4ZA 5AV2A 5IUHA 5ETAA 3CTQA 3NIEA 1IG1A 4KBKA 4O0WA 2ERZE 4NM0A 3H0ZA 5D41A 3W2QA 4R1YA 2R2PA 3SW4A 4APCA 4F9CA 3EKKA 3DNDA 3OCGA 3W1FA 2O3PA 4U42A 2ZOQA 3FQSA 4O0TA 1Q4LA 4QT1A 3CD3A 3DGKA 2HZ0A 3CKXA 3PFQA 1FGKA 4L42A 5GJFA 1QCFA 3HNGA 4FTJA 4C61A 4U3ZA 4ZMFA 2J0MB 2VTJA 3FMMA 4ZTQA 2X6DA 4YJNA 2X8IA 2YM8A 4QYFA 2XBAA 2GFCA 4AZEA 1KV2A 1XBBA 4BTMA 5D9HA 3FMDA 2VWZA 4TL0A 4LOOA 3QTSA 1DS5A 4FNWA 4YUQA 2X7FA 4QTAA 3F5GA 3OP5A 3V6SA 2JBPA 4PP9A 3QWKA 1KWPA 2ITTA 3DTWA 4KIPA 4FK6A 2FGIA 4MEDA 3V3VA 5H8GA 4XX9A 3PY1A 3QQKA 3TTIA 4ZJVA 1ZY4A 5AR2A 3EKNA 3FBVA 4AZVA 4R7BA 2GNFA 2E2BA 4WSYA 4ITHA 5CU2A 3Q6UA 2C5XA 5DR6A 2WMQA 5CZIA 3BWJA 5KBRA 4IMYA 2JKQA 3HEGA 4CKIA 3C5UA 3QQFA 3G6HA 4YC8A 3TZMA 3GCSA 3V01A 3DPKA 4OTPA 1WFCA 1XH9A 5CEMA 2X8DA 4XV1A 4R3PA 4OBQA 4F9WA 4QPAA 2XEYA 3NGAA 2QR7A 1FVRA 5FDXA 3T8OA 3ORZA 3U55A 1F3MC 5CU0A 5CWZA 2ZV9A 3ZOSA 2J7TA 4PPAA 1PYXA 3GCUA 3KEXA 3GU8A 2CKQA 2PU8A 1SVHA 3BV2A 2VWYA 4BCHA 3WYYA 3H4JA 3AOXA 2J6MA 1Q8WA 4AF3A 5HNGA 4LMNA 2YABA 4NFNA 1W84A 4K11A 4EH8A 4KS8A 1Y8YA 4H58A 4I0TA 4I21A 2Z8CA 5C4KA 5KKRC 3PJ3A 3R21A 3TUDA 5BVNA 2W0JA 4N4SA 4ZSGA 4O7LA 1ZYSA 5IQBA 3OY1A 1IR3A 2CHLA 2X4ZA 2B9JA 4JDIA 5CX9A 3NEWA 2JEDA 3MJ2A 4GYIA 4YHFA 4X6RA 5EW8A 1IRKA 2XJ0A 3HLLA 1MP8A 1WBNA 3GU5A 3OS3A 4O27B 4TYIA 3IO7A 3HA6A 1PF8A 3PWYA 4O7RA 2HIWA 5B2LA 4PDYA 3FSKA 3A99A 4EOOA 4NL0A 3R7UA 4L7FA 1NVRA 4XLVA 3G2FA 3D5XA 4XG6A 3CKWA 2XK8A 4NKAA 2P33A 5BVDA 3BYVA 5J95A 4BDAA 2VRXA 4HZRA 5KNJA 2GTMA 5K4JA 2JD5A 3RK9A 5EOLA 5DWRA 5JGDA 3IW5A 2C4GA 3PVWA 3N51A 4ZOGA 2XK6A 4EOQA 2WMSA 3D15A 2XKDA 1X8BA 2J51A 3WF5A 5TKDA 5B0XA 3MGYA 1H28A 3R1QA 3Q9YA 4E3CA 4U6RA 3RHKA 5BMSA 3FQEA 3HAMA 2R7BA 2XUUA 4WO5A 3RBWA 4LFIA 4GKHA 4PMTA 1VYZA 5DVRA 2YERA 5DA3A 4HGSA 1OKYA 5IUGA 4F6WA 2YM3A 4Z7GA 3EZRA 4H39A 2I40A 3CTJA 4IACA 3PDTA 4BCPA 2W5AA 2PVYA 4FKGA 4H1JA 2XBJA 3UMWA 4RJ6A 2QKRA 4L52A 5K5NA 1URWA 4YZCA 3A62A 4NWMA 3CPBA 2B4SB 3KRWA 5F1ZA 3DV3A 4QMXA 1FMOE 2ZB1A 2EXMA 4P90A 4AU8A 3FMNA 4YURA 1P4OA 4XS2A 2DQ7X 5HKMA 4WOVA 1WVXA 3W10A 3ROYA 4BHNA 2ZMCA 1HOWA 2CCHA 4AOIA 3E63A 3DZOA 3DLSA 5EDRA 4BZNA 5M4FA 4P4CA 2WTKC 2XP2A 5CAPA 4N57A 1IA9A 3F7ZA 4GK2A 2JC6A 3UIMA 4HYSA 1K2PA 4JBQA 5HORA 2CN5A 2Y4IC 3IDPA 5KZIA 4TN6A 4AZWA 5M06A 1PMVA 3ANQA 3BU3A 5AM6A 3ZBXA 5BVWA 4JG6A 3MH2A 4EZ5A 3PVUA 3P9JA 4GU6A 3N9XA 1Y8GA 1ZWSA 2ETKA 2NP8A 5L8KA 4FUXA 4O2ZA 5IKWA 4U43A 3VHEA 2R4BA 3Q60A 4FL1A 4PMSA 1LPUA 2XYNA 3TZ9A 3OC1A 2GFSA 3UOHA 4E6QA 1TKIA 3R7IA 4OAUC 4I5PA 3Q4TA 2OFVA 4C4JA 4DHFA 3A8XA 3ORLA 1O9UA 1OL2A 4FIEA 3T9IA 4IVDA 3SVVA 5H3QA 4UWCA 2G2IA 3LHJA 3BLRA 4YZNA 4EL9A 4M97A 4HCTA 4FVPA 3PXYA 4G5JA 4QYHA 4RSSA 5HG8A 3NIZA 3MV5A 4YLKA 2A0CX 4KRCA 4FGRA 3WZDA 1YI3A 1PJKA 4JBOA 3G9LX 5TT7A 2G15A 2GNGA 4YJOA 4AA4A 1Z9XA 2YCRA 4ONAA 2IVTA 4F1MA 1JKTA 4U7ZA 5EOBA 5KMNA 5J1WA 4FTTA 1K3AA 4GUBA 4WBBB 4NTSA 4BIDA 3QTWA 4X3FC 1DAWA 4MWIA 1WCCA 5LCKA 4D5HA 4F09A 2QOFA 3E5AA 4HPTE 4GK4A 5LWNA 4FZ7A 2WTDA 2WMRA 4G3GA 2WOUA 3QUDA 4HVHA 5JKGA 2VO0A 3ORTA 4LRMA 4FX3A 4GG7A 4AACA 2E9PA 1B39A 2WHBA 4FKIA 4F9BA 3DJ6A 3TM0A 4CKRA 5C03A 3GP0A 4KKEA 3RVGA 4U9AA 2XK3A 5AR5A 3FMLA 5ITAA 4UMPA 2I0EA 3NAXA 3MH0A 4EZ7A 3D83A 5CY3A 3VUIA 3GQLA 5FG8A 4QP8A 5FRIA 3RTPA 3PG3A 5IG1A 4WG4A 3K5VA 4IX4A 3CE3A 4FYOA 4D58A 5IF1A 1JOWB 3P0MA 2Q0BA 4PMMA 4QYGA 1JSUA 2FVDA 1SVEA 2VX3A 5BNJA 3PSBA 3TJDA 4BHZA 3E88A 3QTXA 5JFXA 3QD3A 3U9CA 3I81A 4OTFA 2XNNA 4IZ5A 2JDSA 3O8UA 5A6NA 1J7UA 4QNAA 5FP6A 5LQFA 3E7OA 4YO4A 4F7SA 5F9EA 1ZMUA 2YM6A 4YJTA 1WBVA 4GK3A 5I9ZA 2WQOA 2QLQA 3ET7A 2JAMA 3F3VA 3H0YA 4FEXA 1J3HA 5HTIA 1BKXA 2W1GA 2HAKA 4GFMA 4KNBA 4YGAA 3UQGA 4DGLC 4O7YA 3M42A 4EHZA 2ZV8A 4DH7A 3E8CA 5DR9A 4CZTA 4WNMA 3ULZA 3ZTXA 4ERKA 4BKJA 5JQ8A 2PHKA 3C7QA 3TUCA 2C3IB 3VS2A 5C8MA 3FC2A 2WGJA 1FVVA 3TTJA 4C2VA 4I4FA 3NR9A 4CGAA 3MESA 1JQHA 3PXRA 2HXQA 5CU3A 1L8TA 2QOQA 3BYSA 3E87A 4D1SA 4AW5A 2JDTA 4FKQA 2X9EA 2IJMA 3QKLA 4II5A 4E5BA 4YNEA 4IJ9A 4M68A 3ODYX 4KKGA 4TWNA 4ANSA 2ZM4A 5KMLA 4O86A 1KSWA 2ZYBA 4G3FA 3SG8A 3Q3BA 2Q0NA 4LG4A 4FV5A 5GZ9A 4BBFA 4G2FA 3R9NA 3ZH8A 1Q97A 4HCVA 1STCE 1JPAA 3R7YA 3MH3A 3L9LA 4JT3A 4OLIA 3DAEA 3WE8A 2C6IA 2G9XA 3L1SA 1R0EA 4BCMA 4FSTA 5IDPA 3DKOA 4O91A 5AAFA 4BI1A 4FC0A 4DGGA 4BGGA 3WIGA 3ERKA 2HCKA 4D2RA 4DFLA 3AMBA 4MQ2A 4Y5QA 2IO6A 4BDHA 3POZA 1IAHA 4XV9A 4DE4A 2OG8A 5HU3A 5J1VA 1V0OA 5HLWA 2PVMA 3RNIA 4RJ7A 1H0WA 4I1ZA 4BICA 4EZ3A 4CMOA 4O7NA 3MI9A 3F69A 3PRFA 3RP9A 2WXVA 3KRXA 4I6HA 5AAGA 1UWJA 4GCJA 4MXOA 2WELA 4FT3A 1MQBA 3ORIA 4RT7A 4J97A 4MTAA 4ASDA 3VUHA 2PVKA 2HZIA 3OTVA 4USDA 4BWXA 4AN2A 4TWCA 4QTCA 4CV9A 5CASA 2ZMDA 4QRCA 5KMJA 4JOAA 2UZBA 4FTKA 4DBNA 4YZMA 5C1QB 3VJOA 1BMKA 1OL1A 1PXMA 2ZV7A 3KK9A 2PVRA 2A19B 3PXQA 3VBXA 3BGPA 3HZTA 2UW5A 3ORNA 5IUIA 2YJSA 2PTKA 3RJCA 3SLSA 4G3DA 2YITA 5CAQA 4JBVA 5A3XA 2I0YA 2QC6A 3KMMA 4WG3A 4DCEA 3QQUA 2ITPA 5HTCA 2YHVA 3P7AA 1JKLA 5BUJA 2X0GA 4TYJA 4JIAA 5FXQA 2P55A 5LMAA 4WRSA 3UIBA 2R3JA 3EQIA 2UZEA 3BQCA 4M12A 4O7VA 2OSCA 3R00A 3FKNA 4TYHB 2R64A 2W96B 5E90A 4H3BA 5A9UA 3ATSA 4L8MA 2UW8A 4HPUE 4LRJA 3MDYA 4PRJA 4X2NA 2YIYA 4BDDA 4DAWA 4MNFA 4WHZA 1GZKA 3K2LA 3D0EA 2VUWA 3FLSA 4RLKA 1I09A 2JFLA 1BYGA 4J96A 4DGOA 4EOIA 4ZLOA 3ID6C 2J90A 2WTJA 3RZBA 4A9UA 2JIVA 2NRYA 3EFWA 3LFDA 4CZYB 4O7WA 4O7SA 5DGZA 2R3RA 5C8NA 3V04A 5CLPA 2C6LA 2F7XE 4RWLA 5CNNA 3EQRA 4EC9A 1R39A 4JQ7A 4FL3A 4Q5HA 3MYGA 3HV7A 2QI8A 5E1EA 2BRMA 3FHRA 4PDSA 2H96A 3M11A 2PZRA 4I5MA 3UMXA 4HCUA 4H05A 2GS6A 3PXZA 1JBPE 4G3CA 1MRYA 3EQCA 3OWJA 3CC6A 4EH9A 3G5DA 2VX0A 1XQZA 2PE2A 3IQ7A 2FB8A 4U45A 2BFYA 3TV6A 4FKVA 2UZDA 3I0QA 3ZRLA 4LM5A 4AG8A 2X2MA 5HIDA 1AQ1A 3H9FA 4R3RA 4TYEA 2HZ4A 4DEBA 1XBCA 2XB7A 2O2UA 3VULA 4YJQA 3BHUA
chains in the Genus database with same CATH superfamily
1G5SA 4FR4A 3MB6A 2GHGA 3NYNA 4YC6A 3DTCA 5DE2A 2WQBA 4QMLA 5T3QA 2YAKA 4ZLYA 5KHWA 3O23A 3SXRA 3U6JA 1Q8YA 3E64A 3ULIA 5C4LA 4FK3A 3RAIA 3U6HA 3FYKX 3TNHA 5LCJA 4O82A 4XP3A 5H2UA 2CNQA 2XAMA 4O83A 3LMHA 1PXNA 2OU7A 5E8XA 5EI8A 1U4DA 3PG1A 5M57A 4JAIA 4B9DA 4R1VA 4JQ8A 1IASA 3RAWA 4D4RA 4IDVA 3BBTB 3VUTA 2CPKE 2VWUA 4R5SA 2Z7RA 4GYGA 5LMKA 3IW8A 2ITUA 5F95A 1EH4A 5CTPA 5A6OA 4UMTA 4IANA 3ZM4A 3QUEA 5EDQA 4FT9A 3EB0A 3EQDA 3NZ0A 4U0IA 5L8JA 5C26A 5KHXA 2XA4A 1SYKA 2A2AA 4R5YA 3GU7A 4O81A 3QKMA 4CT2A 4UWBA 4I23A 3RINA 4WNOA 4BJJA 3G6GA 3PJ8A 2O5KA 3OXZA 3PZEA 4L3JA 5EG3A 2IZTA 4FZ6A 2W1EA 4CZUA 1JAMA 4LOQA 1REJA 4CFUA 4MXAA 4FTQA 3EN7A 4FSUA 1A9UA 3EN5A 3KK8A 3NNWA 3AC4A 4AGUA 5CVHA 4ZP5A 3AD4A 2GCDA 3IDBA 4KBAA 5KMMA 2X0OA 5AWMA 3BYMA 4ACDA 4EOKA 3FLYA 3E8DA 4IAFA 4NT4A 1OKWA 3N4VA 3NNVA 3FSFA 5FXRA 5HBHA 2Y4PA 3W0SA 3CQUA 3PJ2A 4Q9SA 5EDPA 4KWPA 1M7QA 1ZMVA 4JLCA 3WBLA 4QD6A 4U80A 4XH6A 2UZUE 1OPJA 4HVSA 2BFXA 2X2KA 3BHYA 3QYWA 4I6FA 3O0GA 1ZARA 2Z7LA 3LKMA 3RK7A 4OR5A 3R9HA 2FYSA 4X0MA 3LCOA 3HAVA 4C57A 3TMOA 2C6EA 4CFMA 3C13A 4EOLA 5K5XA 2HXLA 3U51A 3AC1A 1H0VA 3BELA 3QX4A 4BY9E 2W5HA 3WF9A 4DC2A 1UA2A 3IGOA 3QL8A 3P78A 3R7EA 4EOMA 4QP9A 1KOBA 5DHJA 4GH2A 2W99B 3ACJA 3BQRA 3CEKA 3ENMA 4RX5A 5LARA 3LFQA 4HNFA 3QD0A 4O0VA 5M44A 5GZ8A 1LEWA 1R0PA 2R3KA 3PIZA 2BR1A 4JAJA 3U8WA 5DEWA 4MKCA 4EORA 3OZ6A 4Y46A 4FV4A 3SHEA 1GOLA 3FAAA 3QCYA 4R77A 3PPZA 4L67A 3D4QA 2C6TA 5T6KA 2Z7QA 1M17A 4U44A 3OEZA 3PP0A 5A14A 4FEUA 2CGXA 3DQWA 3C5IA 3AXWA 4XG9A 2F4JA 2OW3A 4O96A 4YTCA 1Q24A 4FOCA 4NFMA 4C62A 3DCVA 3DDPA 3Q96A 4IZAA 3DFAA 5HE3A 4YJPA 3UODA 4CNHA 2AUHA 4MXXA 2VTAA 4QOXA 1BX6A 2XJ2A 3HRBA 2WD1A 3HDMA 4GT5A 3SW7A 2VO7A 3HA8A 2YFXA 3O7LB 4JI9A 1YXTA 4L7SA 1OI9A 3TEIA 5KMIA 4NYEA 4G31A 2Y8OA 5CI6A 1YDRE 4AZTA 4E4LA 5M53A 2XANA 3Q52A 3DU8A 3FZSA 4NEUA 4KD1A 3V5QA 3F82A 1CM8A 1PXJA 4UX9A 4JG8A 3G0FA 5FEQA 4Z3VA 4ANMA 5TOZA 3ZHPC 4YZDA 3MIAA 3AT2A 4AW1A 1MRUA 1U54A 3QTZA 3BE9A 4AA0A 5HE2A 3ZSIA 3BGQA 4DTAA 2YZLA 5CF8A 4DEGA 5AP0A 5K4IA 1OMWA 4JRVA 4ZY4A 3DKFA 5EHOA 4FTUA 4G1WA 3C4FA 3LE6A 4M84A 4DHZA 2XK7A 3KULB 1YI6A 3G90X 3PA5A 3Q6WA 4C3FA 2E9UA 2GPHA 2RIOA 2XNBA 3GC7A 5JZJA 1Y6AA 4U3YA 5J79A 2X2LA 3OROA 4FV9A 2J5FA 4NM5A 3OWKA 3OT8A 3QUPA 3KU2A 3SOAA 3GQIA 4EI4A 5K9IA 4A7CA 1TFFA 3TWJA 4E1ZA 1ST4A 4DGMA 2VV9A 4WRGA 5CEIA 3UTOA 3A7IA 3UQFA 5M08A 1KV1A 4WUNA 4XV3A 3EFJA 5HICA 2C0OA 2YM4A 2R3PA 4J8MA 5HU9A 5J5SA 2BHEA 5HOAA 4O7ZA 3A7JA 3QBNA 3UZRA 4GVAA 4I4EA 2BALA 1FOTA 3R8MA 4UEUA 4YLJA 3BRBA 2I7QA 4O6EA 4DITA 2WMTA 3AKLA 5ETCA 2BRNA 4I92A 3D7TB 3I4BA 3MA6A 3F66A 3VIDA 4F7JA 1OGUA 4W4YA 2PE1A 3ALNA 4AT3A 5J5TA 2YIWA 2DUVA 4AUAA 3FLQA 3FEGA 2EB3A 3GUBA 1ZYLA 4P5QA 2B55A 2J2IB 2F57A 3P5KA 3V8TA 4Z9LA 5HNIX 5H9BA 4FIGA 1JLUE 5D7AA 4BCFA 4GT4A 3ZO4A 4PTCA 4D5KA 5A4LA 5E4HA 4I5HA 4PQNA 3O7LD 4JJRA 5IH5A 5I9YA 5D11A 4DFYA 2JKMA 3AGLA 4FEWA 1H1WA 5KCVA 3UDSA 4TYGA 5JFSA 2C0IA 4DF3A 2GS7A 2YN8A 3KB7A 2C69A 2W9FB 3TZ7A 1FBNA 2HWOA 3BU5A 3OWLA 4CT1A 1YDTE 4AFJA 3QHWA 2VTSA 3A60A 4GUEA 2UZVA 1XWSA 1RE8A 2IZSA 3MVMA 4FTLA 2R3OA 2OJGA 3NUSA 2GDOA 5DRDA 2QOHA 1Q3WA 3HV3A 5JMSA 4LGGA 5AUVA 4L9IA 2BDFA 3ORXA 4J95A 4YSJA 3ZUTA 1J91A 3LJ0A 4O21A 3QC9A 4E4NA 4IB0A 2EU9A 5D1JA 4IH8A 4EOJA 2J0JA 2GMXA 2UZNA 2WQNA 2VWBA 4N0SA 4D2VA 2XKEA 2WO6A 4V0GB 3ZONA 3TI1A 4BCIA 4FT7A 2YA9A 1YWRA 4PTEA 3W0RA 3VF8A 4D2WA 3LMGA 1FVTA 4K9YA 4TRLA 2W4KA 4DG3E 3C0IA 4KBCA 4TYHA 4WD5A 2YCFA 5I9XA 5AFVA 1BI8A 2DWBA 3FDNA 4IBMA 3A8WA 3UP7A 4ALVA 4BI0A 3ZEWA 5BUIA 5JGAA 5LMKC 4BCGA 2X7OA 3DB8A 1PY5A 2JFMA 4MWHA 5E92A 4HVDA 1TQIA 3FLWA 3KN5A 4RIOA 2WQMA 3HV5A 3JS2A 4DEIA 4EBWA 4O6LA 1YI4A 3RCDA 4S33A 1OB3A 2E9NA 3OD6X 1YXVA 4JDHA 4ANNA 1ZXEA 4IW0A 1ZYCA 2BZHB 2F7EE 2JITA 4FA2A 2AEGA 4U41A 5A4TA 3KVXA 3FZOA 5ANKA 4CV8A 3V5JA 4ZTHA 1CMKE 3UPZA 3JPVA 4L3PA 5FLFA 4HYUA 4L46A 3NX8A 4DYMA 4DBXA 2W4JA 5J7BA 5ANDA 2AQXA 4XG8A 3LXPA 5E91A 3R9DA 3U54A 3QZIA 1PMEA 5J87A 3AG9A 4BDKA 3UDBA 5GZAA 3B2TA 5BYLA 3CY2A 4S30A 4RJ3A 1YHWA 4IAYA 4KB8A 2P2HA 3GFEA 4NW5A 4BDFA 1T45A 4O4FA 3FE3A 5AV0A 1YXSA 2FH9A 4J71A 2F2UA 4C35A 1GNGA 4XG2A 2RL5A 5AX3A 3WIKA 5HNBA 3RWQA 2Z2WA 3MVHA 4ZIMA 3R8UA 4IX5A 4BDBA 2VO3A 3PTGA 2J0LA 3VVHA 4FRFA 2XIYA 4FV6A 2R7IA 4GSBA 4MNEA 2W1HA 3UYSA 2X6EA 4D2TA 3LZBA 3F88A 4YJSA 5CU4A 1VLRA 4KSPA 2IVUA 2XNMA 3Q5IA 2OJFE 2QO9A 2JIIA 2X1NA 4FNXA 1F5QA 2C3LA 4MH7A 4XNEA 5BVOA 3D94A 4RWJA 3HMIA 2C3KA 4QYYA 4NKSA 1FINA 5DFPA 3GOKA 3PUPA 5AA9A 4O2PA 3DLZA 4DG2E 2ESMA 4I0SA 3TNPC 2QVSE 1YWNA 3R8ZA 1CKPA 1YQJA 3T3UA 4FKRA 3FXWA 2BRBA 3W8QA 3S3IA 3SD0A 1A06A 3R7VA 3NMUF 5TE0A 3KY2A 4FKTA 4K8AA 4EHGA 2J9MA 2BVAA 3A7FA 3G0EA 4MX9A 2GQSA 2B54A 5IA4A 5CVGA 4HYIA 4LV5A 4YHJA 3FUPA 5HO8A 3VNTA 4F9YA 3EZVA 1WBOA 4FZAB 3VC4A 5CYIA 1KE9A 4B7TA 3BE2A 2RKUA 2GTNA 4OTRA 1L3RE 1OPKA 2ITWA 2XVDA 3O96A 3FMHA 2OFUA 2UUEA 3FZRA 4TWPA 3H10A 3T3VA 4ZSLA 3VBTA 3VUDA 2PSQA 4U79A 5ETIA 5HX6A 2UV2A 3MTLA 4CD0A 4AWIA 3EL8A 4TNBA 3QWJA 2X4FA 4FBXA 1PMNA 3PJCA 3R04A 1VYWA 5M4CA 4EJ7A 4UALA 4HYHA 3QRJA 2RF9A 3KRLA 3VW6A 5FD2A 3DB6A 3FI4A 4ENYA 1P14A 1OPLA 3T9TA 3ZMMA 5LXMA 3ORKA 3PVGA 2W4OA 3PRIA 3W8LA 5E8ZA 5EW3A 3QTIA 4JDKA 4CTCA 3KREA 3DK6A 4QMMA 1CKJA 1MQ4A 5I3RA 3NYXA 1OECA 4FTAA 2Z02A 4KKHA 5C01A 3LFSA 3OT3A 4C38A 3VRYA 3MW1A 4QP4A 4XRLA 5AR8A 5HZNA 4YSMA 4QO9A 4K1BA 4YO6A 3RKBA 3S1HA 4BJJB 1U5QA 3I7BA 2OLCA 3K5UA 1W82A 4RA5A 3FLZA 3KVWA 2CJMA 3DK3A 3FPMA 2YM7A 1U59A 2CDZA 1ERKA 3QRKA 1J1CA 3PP1A 4M69A 1J7IA 4EH6A 2G2HA 4CCBA 4ZTMA 1KOAA 3JVRA 2OJIA 4RJ4A 2XKCA 3GI3A 3K3IA 5BMMA 5FTOA 3BEGA 2C6KA 5CT0A 1PKGA 4IXPA 5EI6A 5JZNA 4ACCA 4G34A 3ZLXA 4LI5A 4UN0C 2QQ7A 3HP5A 4UYAA 3HMPA 4J52A 2PMNX 3CCNA 3DBCA 4LYNA 3SC1A 3TZ8A 4FZFB 2XIKA 4KINA 3Q53A 4CEGA 4CFNA 2V5QA 5HIEA 4BZDA 4DINA 2ZDTA 2PWLA 3TJCA 5TO8A 4BL1A 4CTBA 2BKKA 3ROCA 3FY2A 2BTRA 3LFCA 4UMQA 4HJOA 4ZJIA 2X0PA 3LFAA 1Q99A 3DAKA 3QCXA 4BCQA 2ITYA 3ETAA 3VUMA 1YXUA 2H9VA 3SRVA 4PL4A 4B4LA 3O51A 4DFZE 2ZAZA 3PWDA 2EXEA 3MPAA 4XV2A 5BVFA 2C3JA 1SZMA 4M8TA 2X9FA 4YTHA 2CNUA 2R3MA 3NYOA 4W4XA 4IX3A 2OXDA 3VW8A 2YLEA 3UG2A 3OXTA 5CQWA 3AC5A 4C4FA 2WMXA 3SA0A 1Q41A 2G01A 2O64A 3FKOA 3HKOA 4IVCA 3NUPA 2PZ5A 4A9SA 3Q4UA 2WU7A 3VS7A 2PVHA 4CMTA 4EK3A 1UKIA 1OM1A 3QA0A 3V5TA 3IECA 4ZZNA 3WOWA 4ANOA 4Y95A 3V51A 4GT3A 4DH5A 5CEQA 1LR4A 5F4NA 3ENHA 3EMGA 4LQMA 5J9LA 4QP3A 3NVMB 2OBJA 4OBOA 3TUBA 2UW7A 2B52A 2VD5A 4FOBA 4QMPA 1G8JA 2BRGA 3F7WA 4EQMA 3KULA 5IEXA 3ZUUA 2JDVA 3U87A 1JKKA 3VJNA 5CAVA 3KF4A 4D9UA 4ASZA 5K0XA 1PMUA 2B9IA 4XRJA 2FSOX 4JDJA 1RDQE 4J8NA 4V04A 3AD6A 2RFNA 3QF9A 5J9ZA 2WMBA 4B0GA 3OBGA 5FWKK 3QX2A 4AXAA 4EHVA 4ALWA 3ANRA 3PSCA 1H25A 1M2RA 3BCEA 3GC8A 3ZU7A 4BWPA 4O4CA 3VS5A 4F78A 1K9AA 3EQGA 3ZO2A 4C33A 2NYAA 4QTEA 1QPEA 4DA5A 1WBTA 5FP5A 4TY1A 3R7GA 4D0WA 4V01A 4D4VA 2QD9A 3P79A 3QAME 4BFMA 5L6OA 4C3RA 1U54B 1OL6A 2VNYA 3GOPA 1PKDA 1XH4A 3BX5A 1W98A 2X7GA 1HCLA 4L43A 3D7TA 3N4UA 2OZAA 3BHTA 2B1PA 3TKIA 3H9OA 4MF1A 3R8VA 3UO5A 2R9SA 3LOKA 4JX3A 2F2CB 4HGTA 2XCKA 3CPCA 2VO6A 3JY0A 4AOJA 2PULA 5ANGA 5HD7A 3W16A 4CLJA 4CFFA 2FSMX 2IG7A 3SV0A 3VN9A 1H1SA 3L8PA 2AC5A 3NSZA 4CXAA 1OKVA 4BIBA 3ZXTA 4L01A 2VNWA 4PV0A 1YW2A 3IDCA 2XM9A 2FSLX 4FTMA 4AS0A 3QCQA 4NM3A 5DT3A 4LL5A 2HW6A 3W18A 4OAVB 4DDGA 2BPMA 3JYAA 4EKLA 4D0XA 2OKRA 3IOKA 1WBWA 3KXXA 2XMYA 3QRTA 4FGBA 2WTVA 4O38A 2OI4X 1BUHA 5B2MA 3DS6A 2RG5A 3LCTA 3I6UA 4N6ZA 4F70A 2W5BA 5M55A 4DH8A 4M67A 3TT0A 2WEIA 2Y6OA 5M4IA 2IN6A 3FV8A 3SGCA 3IS5A 4MXCA 4RLLA 4RRVA 4W4WA 3RPOA 2GQRA 5I9WA 2C1AA 5EM5A 2YAAA 5D12A 3UG1A 2GNHA 4V0GA 4CVAA 4PPCA 2EB2A 2UZOA 4IB5A 2OZOA 1WAKA 2IVSA 3VBWA 4S32A 5HG7A 2CLQA 1Q3DA 3GT8A 3Q04A 1YHVA 4UMRA 2PYWA 3MWUA 2R3LA 4EONA 1RJBA 3DBEA 3LFNA 5AR7A 4K0YA 5EI2A 5DMZA 4CKJA 5L8LA 1RQQA 3GXLA 4QMZA 5J7HA 5EYCA 1JSTA 4C4EA 4DEAA 3W0MA 4L53A 2ZM1A 1LUFA 5HX8A 5HHWA 3C1XA 5M56A 5BYZA 2VTHA 4DEDA 3S95A 4LOPA 3IG7A 4FV0A 4O1OA 1FQ1B 3GBZA 4J98A 4DH3A 4O0RA 3TDWA 3EN6A 3VS0A 4BB4A 1VJYA 4I0RA 1XO2B 2VZ6A 3C4XA 3CXWA 2RFEA 2PL0A 3FY0A 1E1VA 3F9NA 4LMUA 4C02A 2A27A 1NW1A 2C47A 5EYKA 4U97A 3GCVA 3QC4A 5G1XA 5K3YA 1TVOA 4XG3A 2C5OA 5J8IA 3L9PA 3VUKA 4RGJA 4FYNA 4RC4A 4C4HA 3TYKA 4YPSA 4I6QA 4UZHA 4UWYA 4IWDA 4FKPA 2IWIA 4G9RA 2O0UA 4NSTA 4TZRA 3R8LA 3UQCA 2B9HA 4FSNA 3UZTA 5AP2A 1M14A 2Z60A 4YZBA 4F0FA 3QD4A 4ZTSA 4LGDA 4GIHA 2I0HA 5IDNA 2QNJA 5IISA 3RK5A 2YCQA 3P4KA 4M13A 5FGKA 2BMCA 3QQGA 2OICA 4B99A 4EOSA 3E8EA 3R1SA 4ZEGA 4NH1A 2BIKB 4IADA 3BHHA 4K18A 3BGZA 4F4PA 3BHVA 3VRZA 4Q2AA 4W9XA 3HVCA 3W32A 4MAOA 4FIJA 4JBPA 4RA4A 4IHPA 3W0NA 3E7VA 4OTWA 3ZRMA 1E9HA 4RIWB 2WB8A 4AOTA 4BCOA 4FE2A 5CF4A 3UC4A 4I24A 3FZ1A 3LPBA 5BQ0A 2GNJA 4GFGA 4IAKA 2XRWA 2UZWE 5IMEA 2XNEA 4C0TA 4GU9A 3QXPA 4KIQA 5A54A 4ZS0A 4BTJA 3GEQA 3GU4A 2UW4A 3I5ZA 4JR7A 5IQEA 2GHMA 2J0IA 4RX7A 4C7TA 4PDOA 4BTFA 1OIRA 3AC2A 3UOLA 3CQWA 3W2RA 4OT5A 5C9CA 3BI6A 4BKYA 4M0YA 3W2PA 4EK5A 2PUPA 3UVPA 2IW6A 2OO8X 4XG7A 5AAEA 2UW3A 2XIZA 1OVEA 3B2WA 3LIJA 3QCSA 2R3GA 1Q62A 4I20A 5HO6A 4CYJA 5A4CA 4X7QA 4MNEB 3ITZA 3MFSA 3QYZA 1ZAOA 5DI1A 3EN4A 3CS9A 2PVFA 4QP7A 3ZZEA 1GIIA 1QMZA 2BRHA 2JGZA 4Q5EA 3UNJA 3DXQA 4D55A 2XJ1A 2VTOA 3ORMA 3UIUA 4YJRA 1OKZA 4N70A 3PZHA 1V0PA 5AUWA 3MTFA 3TN8A 4S34A 4YJUA 5E8WA 3Q4CA 3ZLWA 4C36A 3TNQB 1BLXA 4WSQA 3R1YA 5HIBA 2BDWA 5TR6A 3O5AA 2V7AA 3I7CA 3WF8A 4IC7A 2V62A 5LVOA 4LL0A 2NO3A 5AV4A 2XNOA 5KO1A 2YIXA 4XBUA 3LVPA 2VGPA 5DBXA 4AQCA 4FSQA 4FEQA 3QALE 4EH2A 4QNYA 3NNUA 5HBEA 1NVSA 3M1SA 4BBEA 3ALOA 3GVUA 4RX9A 2RG6A 4Z55A 3UDTA 2OIBA 5DOSA 5AX9A 3PXKA 3UOJA 4FTRA 1PXKA 3UP2A 4ACHA 3NVKI 4DEEA 5IQHA 3ZSHA 5HBJA 1G3NA 2EXCX 4UYNA 2C5YA 4UXLA 5HCZA 5BV3A 3BPRA 2JLDA 2C5NA 3EQBA 3KCFA 3POOA 3PY3A 4HGLA 4YC3A 4AGWA 1OZ1A 2O8YA 2ZFYA 4GRBA 3FMEA 2BZJA 3D14A 3MPMA 3GB2A 4DCAA 5HG5A 4BDEA 4ITJA 5JFVA 1TQMA 3PYYA 4R7IA 3B8QA 4AE9A 4M14A 2ITQA 4O4BB 5DN3A 4TKSA 1P4FA 2F7ZE 4MD8E 4OGRA 3TV4A 5DYJA 3L9MA 4KAOA 4FKWA 4DHIB 4FJVA 4QPMA 3ATTA 1B38A 5IA3A 2ZVAA 3R9OA 2P3GX 5L4QA 4R78A 5ANEA 3CJGA 1UNGA 4EH4A 4OTHA 1R1WA 3QGWA 4OBPA 1O6LA 3O50A 4U8ZA 4W8DA 3U9NA 3AQVA 3JR1A 4D2PA 2QURA 3COIA 3Q32A 5EKOA 4H3QA 3P1AA 5L2TA 1UWHA 3IK3A 5LJJA 4M69B 5GINE 2QHNA 4XLIA 4DFNA 4FMQA 5LVMA 1DAYA 1ZYDA 3OW3A 3Q4ZA 3CTHA 4YU2A 3R7OA 4QQ5A 2CN8A 2PMIA 2C68A 4ENXA 4EQUA 2E9VA 3ZLSA 4DTKA 4QDEA 3RPRA 4K6ZA 2QOIA 3F5UA 4FSRA 4IDTA 3A7HA 3UVQA 2OIQA 4OUCA 4F7NA 3PIXA 3R63A 3JUHA 5EW9A 2YISA 4FODA 3ZEPA 5M09A 3DA6A 3VS3A 4ZSJA 1VR2A 5DR2A 2F49A 4CG8A 3BLAA 3B8RA 3ZCLA 2V55A 3EYGA 3DY7A 4EUUA 3SRVB 4AE6A 3QQHA 5HGIA 3CY3A 4QMWA 1WZYA 4IM3A 2IZUA 3BL7A 4DDIA 4CFWA 3OUKA 5FEDA 1H00A 4RFYA 4ZMEA 5DG5A 2XEZA 4E5AX 2QOOA 2WTIA 2HELA 2VTLA 4FSYA 4HOKA 4OTQA 3PUFC 2QU6A 2REIA 4MXZA 4F63A 3DOGA 3H30A 4ASEA 3UJGA 1KE8A 3A4PA 1QPCA 3PE2A 1OGYA 4X21A 2B0QA 4U81A 3AT3A 3IKAA 3PVBA 4EH5A 3UE4A 4GW8A 3RPYA 2JKOA 5IPJA 3O2MA 4F9AA 2BAKA 1OIQA 3MY1A 4KIKB 4X2KA 2LAVA 4D1XA 5CXZA 5KMOA 4IWOA 4EJNA 4FNZA 3WZEA 4TWOA 5CSXA 3HMNA 5HCYA 3UO4A 4DG0E 3ZDUA 4G16A 4YJVA 5G6VA 4OW8A 2VTIA 3D5UA 3KXMA 3W55A 4QMYA 4FV7A 4W9WA 1YXXA 4S31A 2RFDA 4WUAA 3AT4A 2IZRA 4G9CA 3TKUA 4EHEA 4O0YA 2WTWA 5FBNC 1FPUA 3FQHA 4JQEA 2FA2A 4FKOA 4JNWA 3F3UA 3WI6A 3GGFA 5IA1A 5ETFA 4P7EA 3EOCA 5BPYA 3NS9A 5IH6A 2IF8A 4FIFA 2W1ZA 3SXSA 4RBLA 3QTQA 1ZY5A 3S0OA 3AD5A 2W9ZB 5H8EA 2WEVA 4QP1A 3SDJA 3FXZA 4DH1A 4NJ3A 1XJDA 4JX7A 2WZJA 3OBJA 3C0GA 5EM7A 5GJDA 5AUXA 5E1SA 5AP4A 4PWNA 4RZVA 3CJFA 4S2ZA 5JSMA 4GFOA 4KUJA 3D2IA 4NM7A 2XK9A 5LVNA 3M2WA 4OTDA 4PNIA 4RPVA 2DS1A 3OUNB 3VS1A 3HGKA 3IGGA 4QMNA 2OZAB 5KMKA 2I0VA 3TACA 3NRMA 2YDKA 4NW6A 1J1BA 2Y6MA 3LW0A 4MQ1A 3UIXA 4D28A 2GHLA 3F2RA 1YOLA 4BDCA 3AGMA 4EKKA 2C5VA 3SG9A 2OWBA 2LGCA 2YWVA 1UV5A 1Z57A 4BTKA 1PW2A 1KUTA 1JKSA 1VEBA 3QGYA 2O63A 3EL7A 4I94A 4YLLA 2P0CA 5ACBC 5GJGA 4DGNA 4JG7A 5BYYA 4PUZA 5DLSA 4BF2A 4RVLA 3Q2MA 3OF0A 1UNLA 1SVGA 3RI1A 3W33A 1M2QA 3HUBA 3NW6A 3COHA 3F3ZA 4C34A 3LXKA 3KRRA 5M4UA 3MS9A 4IM2A 4BCJA 3LFFA 4W4VA 2WNTA 5BVKA 3QLGA 4M3QA 3PE1A 2Q83A 3L8VA 5CEKA 2BDJA 5FXSA 4F0GA 2OF2A 4G6LA 5I9VA 4A9YA 3WARA 4NUSA 4PMPA 4M66A 2BUJA 3EFLA 5E8UA 3MIYA 2AYPA 1GZNA 3E3PA 4RVKA 4BC6A 3E3BX 2Z7SA 4YR8A 3OTUA 4L3LA 5I3OA 4ARKA 4XBRA 4F64A 1S9JA 3U4UA 3UBDA 4ANBA 2W7XA 2HOGA 2V0DA 5AUUA 5T68A 5CAUA 3NWWA 2IEWA 5JN2A 1WBPA 3ACKA 3F3WA 4PL5A 2WAJA 4CG9A 1P5EA 4X3FA 4FKJA 5F94A 5FDPA 3DAJA 2IPXA 2B7AA 3KXZA 2WQEA 4FG8A 3L9NA 4FIHA 4NIFA 5D10A 3UGCA 2CNVA 3IPHA 5DT0A 3QU0A 4BDJA 4BCKA 3LCDA 3MVJA 3FI8A 5FTQA 1ZLTA 3QZHA 4G5PA 1J7LA 2RFSA 3FI3A 1CDKA 3L8SA 4Z7HA 3C50A 3KCKA 4FF8A 5K0KA 1H8FA 3I60A 1BI7A 3PLSA 3N4TA 3QQLA 3GFWA 1F0QA 2XNPA 4J1RA 4AP7A 3C4EA 2XZSA 5CVFA 3ZC5A 4Y73A 5E8SA 4ZK5A 5DT4A 4NU1A 3DBQA 4YP8A 4RIWA 5JQ5A 1ATPE 3R28A 4CRLA 1QPJA 1H4LA 2UW9A 5B2KA 2UVYA 3WZKA 1CKIA 3ZDIA 2ETRA 2ACXA 3P23A 5IZFA 5DIAA 4E6CA 5ACKA 1OIYA 3SAYA 1JWHA 1LP4A 1XKKA 3D5VA 3OEFX 4PNKA 1NA7A 3LFEA 3PLAE 3V6RA 5H8BA 5TF9A 2YIRA 4GV1A 3V8WA 5IA2A 2QO2A 1ZRZA 4GJ2A 4L44A 4XUFA 5EYDA 3SOCA 3VBYA 3PXFA 1AD5A 4IM0A 4JVGA 4IAZA 3NCGA 2NNWB 1H08A 3W2CA 4DTBA 3KQ7A 3DT1A 3I5NA 4QQCA 2XK4A 3P86A 3RNYA 3PIYA 3SX9A 4IZYA 4AXDA 4X2FA 2CGUA 3OY3A 1KE6A 3TL8A 3W2OA 1Q61A 2CKEA 3ZSGA 5JH6A 3R9RA 5AUZA 2WFYA 4IC8A 2VWWA 4Z16A 4BWKA 5LOHA 3P7CA 5AUTA 4I41A 4XMOA 3UC3A 3RMFA 3K3JA 2OF4A 3FJQE 3BL9A 5CANA 2OH4A 1OBGA 1XBAA 4BVUA 4QTBA 3TNWA 1A48A 3KFAA 4HVIA 5LWMA 3KXGA 4ZZMA 3R2BA 5I9UA 4DLIA 3UYTA 3KMWA 4KABA 2XARA 2ONLA 3OCBA 3VBQA 4RIYA 4CMUA 4LRKA 1UU3A 3LCKA 3SXFA 3UPXA 5E9EA 3UNKA 1GIHA 3EFKA 3QQJA 4CSVA 3D2KA 3SKCA 2SRCA 4E26A 4KA3A 3FMKA 3KC3A 2ZV2A 4OTGA 3BIZA 3LFBA 4O0XA 4I6LA 5IQGA 4WNKA 1GY3A 4PY1A 1JVPP 3C0HA