4L3PA

Crystal structure of 2-(1-benzothiophen-7-yl)-4-[1-(piperidin-4-yl)-1h-pyrazol-4-yl]furo[2,3-c]pyridin-7-amine bound to tak1-tab1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
308
structure length
295
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 295
sequence length 308
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l3pA01
4LL0A 3VUGA 2WOUA 4DGGA 2IZTA 1O9UA 3P86A 4EH7A 5IA3A 5AP6A 3V5TA 2R3LA 3TUCA 1G8AA 1YXTA 3AT3A 3F3ZA 5EH0A 3TEIA 4L45A 4D2SA 4YJNA 2V7OA 4O1PA 2GNHA 3RTPA 3QTWA 4M15A 3BHHA 4TYJA 4BDIA 1LUFA 2WTKB 4MH7A 5I9XA 5L8LA 3LCOA 3U51A 5HE2A 4X2NA 3F5PA 4EOMA 5HU9A 1GAGA 3PE1A 4O22A 4F64A 3MFSA 3N4TA 3TJCA 3QGYA 4PP9A 5F95A 5JMSA 2BRHA 4KUJA 2G2FA 2Y6OA 3VW8A 4B99A 3OF0A 1W8CA 4EC8A 5KUPA 2UW7A 4LGGA 3VS5A 4O82A 4R78A 3MI9A 1ZZLA 4R3CA 4O84A 4UMTA 1IEPA 5LOHA 2UZWE 2YAAA 3VS1A 4MD9E 4FGRA 5K3YA 4EOLA 4EKKA 2E2BA 4FKIA 5IG1A 4JIAA 2CGXA 2XIYA 1YDRE 2IW6A 3MB7A 1GZ8A 3NX8A 3OOGA 3GB2A 3QZGA 4GFMA 4YSMA 2VO0A 3CE3A 2XNEA 3ORKA 3MPMA 5C01A 4QYEA 4E26A 4TT7A 3UC3A 3MY5A 2E9UA 3R1NA 5JSMA 3R0TA 2BALA 2FSTX 4G6OA 4QPAA 3V8SA 4UZHA 3E64A 3CTQA 1Y8GA 1M52A 3A8XA 2XNPA 5DR9A 5A9UA 5KKRB 2J6MA 4FVPA 2QI8A 3DGKA 2C1BA 1XBBA 3QWJA 3CSVA 3UZTA 1WBOA 4IXPA 5CAQA 5EI2A 3P0MA 4M69A 4F9CA 1JKSA 3RNYA 2WIHA 2QHNA 2C5OA 4Y95A 4CTBA 3QD0A 4DTBA 5JH6A 4IWDA 5HLPA 3NAYA 5HLWA 5AP3A 4O7TA 2ZOQA 5HBHA 5E90A 1PMVA 2OJGA 3QRKA 4HGTA 5EI6A 4QQJA 3VUTA 2FVDA 4GW8A 2HW7A 4FI1A 4L3JA 2W1EA 1PXOA 3AC2A 2WIPA 4MF0A 4U97A 5IA5A 3NW5A 3UVPA 2PPQA 4O7ZA 3ATSA 4QMQA 1OKWA 1OECA 3NCZA 3V6RA 3MVHA 2GDOA 4FSQA 1T46A 3QD3A 3MIYA 1GZOA 1M2QA 4GVJA 3LCKA 4V04A 4XV2A 3JY9A 2J2IB 1KOAA 5AP5A 4ZLYA 3AD5A 4RG0A 2OW3A 3ORPA 2WQNA 4BWXA 2PK9A 5LQFA 4RLKA 5A4TA 3HAVA 3KA0A 4N6ZA 4A9SA 4YJQA 2WGJA 4M3QA 3T3UA 4F4PA 3FZTA 2XP2A 5E8ZA 1ZOEA 4OT6A 3E8DA 4DAWA 4C4EA 4EH6A 2Y4IC 4EYJA 3AOXA 4GT5A 4DCEA 3DKOA 2WOTA 3PXZA 3TNIA 2PE0A 5C9CA 3WZEA 4PX6A 4BI1A 2VWXA 2HWOA 2VNWA 3BLRA 5IEXA 1H4LA 4NU1A 4RVMA 3DAKA 3W33A 4AXAA 4DEGA 3KY2A 4K6ZA 4WG3A 4YC3A 5H8GA 4AFJA 3UZRA 4FYNA 2VO3A 1UKIA 2YABA 1TKIA 3R8LA 1UWJA 4A7CA 3GENA 3HLLA 1NVQA 1OVEA 2DWBA 5G6VA 3UMWA 2QHMA 4PL3A 3DLSA 4FKRA 4BR3A 2EWAA 2ZDUA 3QCSA 3K54A 2R3KA 4C3RA 3EYGA 3AG9A 4H36A 3PFQA 2UW0A 3EQDA 2W1HA 5AJQA 2CSNA 3EQCA 4APPA 3DK6A 3VW6A 3VUDA 2JC6A 3ZDIA 3SC1A 3NCGA 3FMLA 4NYEA 2YM7A 4DFNA 2YLEA 2IO6A 2JAVA 4A4OA 4NWMA 3VBVA 5KHXA 3SA0A 4L9IA 3EZRA 3GOPA 3Q2MA 3HUBA 3ZYAA 4DE4A 5C8NA 3VBQA 4M7IA 3GCUA 3TM0A 4FG9A 3KULA 4Y5QA 4RFYA 5CNOA 3AXWA 3GC7A 3HP2A 4BIBA 3ZZEA 3LXLA 2UW9A 1OGUA 3B2TA 2PE1A 4IDTA 5EG3A 3N4VA 1ZXEA 2BZJA 1I09A 4QTAA 3DPKA 4TWOA 4J7BA 4E5BA 3HKOA 4QMOA 4FIJA 5IEYA 2VO6A 2X7FA 3DDPA 3W2PA 2QOCA 4ZTNA 4U0IA 3LLTA 3MH2A 4BI0A 5ETFA 2HCKA 2UZTA 4PWNA 3RZFA 2V5QA 4IX6A 3TCPA 3R9OA 4BZNA 1UU3A 5CSWA 1H00A 4HZRA 2FUMA 3OC1A 1H24A 1KE8A 2XRUA 4GFGA 4KD1A 3O7LB 4D5KA 1G8SA 1DAWA 5BQ0A 2ERKA 1MRYA 3F88A 4AUAA 5T6KA 2X6EA 3LLAA 1OUYA 4ASDA 4KNBA 4S34A 4CSVA 5GIOE 2C0OA 2ITXA 1LEZA 2OZOA 4O96A 4YZNA 3TKHA 1YDTE 3CJGA 3LPBA 4JDJA 4KIKA 4BL1A 4R7HA 3TT0A 1FMOE 4FSNA 5FDPA 4R7BA 1Y8YA 3QLFA 5DE2A 5BUEA 3F82A 2V62A 3K3JA 3KMUA 3HV6A 3QTIA 4KS8A 4L67A 4QRCA 4QMZA 1YW2A 1PYEA 2VX3A 4IQ6A 2Z2WA 4W4YA 4I6BA 5L2IA 1JWHA 5K5NA 4F0IA 4FKUA 4BIEA 3QTSA 1FPUA 1OITA 4BDKA 3LE6A 2RSVA 4HYSA 3NZ0A 3ELJA 4EL9A 4EHZA 4R7IA 3DB6A 1XKKA 3O17A 4FV8A 3UPXA 4NTTA 4M8TA 2QU6A 3BLQA 3W10A 4XJ0A 4NKAA 4EQUA 3IW5A 3TZ7A 4YZMA 4YUQA 4ARKA 2YA9A 3OG7A 1Y57A 2B9FA 4JDHA 4F9AA 4QPMA 3A2CA 2PVKA 4Y73A 3NUNA 4YJSA 4CMTA 2P0CA 5AA8A 5K5XA 4ALWA 2R3HA 5EDPA 4JBOA 4MBIA 2I6LA 2WPAA 4KRDA 4BI2A 3NNWA 2PVHA 2PZIA 5FUTA 1WBTA 3Q96A 5JKGA 4XYFA 1H8FA 1KE6A 4EOQA 4D4RA 5CXHA 4DA5A 3ZCLA 2G2HA 3FZRA 4BKZA 3QFVA 4ITJA 1NVSA 2QVSE 4EHVA 2BIKB 3HRCA 2GTNA 3R7GA 3NUSA 4YJVA 3FZPA 4FUYA 3QLGA 5HE1A 3R7YA 5IQEA 4L8MA 3DNDA 4RJ7A 2EUFB 5D41A 3CBLA 3F2AA 4C3PA 1NY3A 4B8LA 4JAIA 4J96A 4OBQA 2W4OA 3EQPA 4Q5HA 2FH9A 4GIHA 2UW3A 1H0WA 1Z5MA 4ZZMA 4Q9ZA 3NWWA 1W7HA 3AC4A 4FMQA 2IWIA 4X21A 2XNBA 2DUVA 4IB3A 4M69B 3W2SA 2I0YA 1Q3DA 3OD6X 5CEPA 2XM8A 4ZTRA 4EBVA 2J51A 2PUPA 1MRVA 3ORLA 3TV4A 3UYSA 4CZTA 4OW8A 4FV9A 5CT7A 1YWVA 4E4XA 3DB8A 2JGZA 2WU6A 1YHVA 3QQFA 5FP5A 3ZO1A 4M97A 4BIDA 4MWIA 3G5DA 2R3JA 4HJOA 1WVXA 2CMWA 2H34A 1UU9A 4IX3A 4NIFB 4DITA 4KA3A 2QU5A 2UZEA 5DGZA 4BCIA 5KX8A 3BE2A 1UU7A 5LMAA 3P4KA 3D7ZA 3RCJA 3PG3A 3WZJA 4QTDA 2WMXA 3BU5A 4R1VA 4UWYA 3R9HA 3MFRA 3F3UA 1BKXA 4FV3A 1M17A 2PE2A 4IHPA 5IF1A 3ZEWA 3IS5A 4QNAA 1G5SA 4IFCA 5BYZA 5HG9A 1H1QA 3NIZA 3VS3A 5EW3A 3QWKA 1RE8A 3ZFMA 2BAKA 4UWBA 5JFSA 4MWHA 3VUMA 5FWKK 3VUKA 4BCPA 4HOKA 2OU7A 3WOWA 5JQ5A 3LFAA 2BRNA 2YIYA 1ZRZA 3MA3A 5BMSA 1GOLA 4ZTHA 4NUSA 2W5AA 5TE0A 3E7OA 5DHJA 2O0UA 2P2IA 4MCVA 3VF9A 3MY0A 3NYVA 3VS0A 4FOBA 4O7RA 4I92A 5DYJA 1UNHA 4WNMA 2XK8A 3LQ5A 5HZNA 4RMZA 4EJNA 4BGQA 3RCDA 4DG2E 5HG7A 1ZARA 2PZ5A 2R4BA 3PDTA 3PRFA 5FBNC 4IB1A 3GFWA 4YJUA 4YHJA 3FZOA 4GJ3A 4KBCA 4X7QA 3W1FA 3H4JA 3NUUA 4CYJA 5I3RA 5CI6A 2QQ7A 4NCTC 4L53A 4WT6A 2XCKA 2PVJA 1JSUA 3QA0A 4U42A 5BVWA 2X4ZA 4IWOA 4HNIA 3UTOA 3ZO4A 4XLIA 2GQGA 4XOYA 2ERZE 1OPLA 3LCSA 3W8QA 1TQMA 3FZ1A 4GV1A 3UG1A 5CQUA 4IFGA 5AAEA 5GINE 2G9XA 4TYHB 4MXXA 3ACKA 4EHEA 3KULB 2X6DA 2Y6MA 2W9ZB 5CSXA 4DN5A 4C57A 2CPKE 3U4UA 3LIJA 5D9HA 2AUHA 1PXPA 3IONA 3KMMA 5HBEA 5CALA 4YU2A 3NSZA 4ZY6A 3TUBA 2O5KA 2BKKA 4DGNA 2WMUA 3NRMA 4Y83A 3OBGA 5CU3A 5HI2A 3ZFYA 4BBMA 3Q32A 3ANQA 2A0CX 4JDKA 4QOXA 4BF2A 2Y0AA 4F6UA 1M7QA 2VN9A 3G33A 1H25A 3MBLA 1R0EA 1FVTA 4KBAA 4FF8A 2XJ0A 3AC1A 4GK2A 3KXMA 4R5SA 3PVUA 3U55A 2QO9A 5AIKA 2IZRA 2OZAA 1WBNA 2YM5A 3ORTA 4AOJA 1OL2A 3KQ7A 3O8PA 3EHAA 3V5LA 4C2VA 1URCA 3QCQA 2G01A 3VNTA 4YSJA 4G5JA 4L00A 2C5YA 5KMMA 4JOAA 5M57A 4FL2A 4ZZOA 1B6CB 2KTYA 3KMWA 4JQ8A 3FMMA 4NSTA 4EZ3A 3L9LA 5CF5A 3DLZA 3UG2A 3AMYA 2H6DA 4M68A 3IDBA 5HTBA 3DTWA 3G6HA 5DMZA 1S9IA 5AP4A 2ESMA 1R78A 3A60A 3EKNA 1FINA 4OTQA 3KFAA 5ANGA 2GS7A 5DH3A 4FT9A 4U43A 5FRIA 4EONA 1BL7A 4ANQA 3GC0A 3DFAA 5A4LA 2ACXA 4OT5A 4U7ZA 3R02A 1E9HA 2B9HA 5AUZA 3RNIA 2ZV2A 5BVOA 3EL8A 4GKHA 2IVSA 2QURA 4RJ4A 4CRSA 5HLNA 2JKKA 2XKEA 5M06A 2VTJA 3TN8A 5HD4A 5HX6A 3AD4A 2UZVA 3UQGA 4G2FA 2WKMA 5AA9A 3ZLSA 5AR8A 2EXEA 3ETAA 1MRUA 2WTVA 2YDJA 3AGMA 3D2KA 4NM3A 4E6QA 2WQBA 2QO2A 2XK9A 3AT4A 3C4XA 1P14A 2V0DA 5E8WA 4EH3A 4PQNA 3CKWA 4HCUA 4YZ9A 5JGBA 5IEVA 4TPTA 3Q9ZA 2JFLA 4WSYA 3TJDA 3F3VA 4MXYA 1B38A 4FBXA 4YBKA 3QHWA 3R9NA 4O0XA 4O7LA 1OL6A 2QOOA 3F3TA 3VUIA 3GC9A 2E9OA 3TL8A 2C68A 5CZHA 4F1OA 4W4XA 3HMMA 2UW5A 3H0ZA 1Q8ZA 1H26A 4I21A 4BTKA 1QPDA 2XNGA 3CEKA 3Q4TA 4AZVA 3LXKA 4DFUA 1U54B 1Y6AA 3QU0A 4UALA 4A9YA 3UVQA 2XEZA 2OI4X 5HNBA 2QOHA 3UC4A 4X2GA 2VX1A 4O0YA 5AMNA 2B55A 4LUDA 3MIAA 2PMOX 3RK5A 4CTCA 4ZZNA 2PUNA 1FGKA 2GPHA 3QQKA 2W1GA 3BEGA 1G3NA 2XCHA 4FICA 2UW4A 1OIYA 3PJ8A 5FD2A 5I9YA 4C33A 4AFEA 2HELA 4FA2A 4IB0A 3K2LA 4FKQA 3TUDA 4W8EA 4JI9A 4RWKA 3PZEA 1SM2A 4EH9A 1Q8TA 4D4SA 2VGOA 3C0HA 3PVWA 5DT0A 5DEWA 2WFYA 4C35A 4F1TA 5AUUA 4CFXA 5CEMA 3BYOA 3LFQA 2WTIA 3RK7A 3TDWA 4NT4A 1PMNA 2HAKA 1XH6A 2ITPA 5HNGA 4C61A 3UJGA 4EOSA 1Q8UA 4RVKA 2R3MA 4GT4A 4QD6A 5AV3A 3HVCA 4DLJA 2R3FA 3WIKA 3L9MA 1WZYA 1KE5A 3ZUVA 3WE4A 4IM3A 2NNWB 3PA3A 3UDBA 4MQ2A 3N4UA 2B54A 3RGFA 1IA9A 4AA4A 1XH4A 3CIKA 4O86A 4I0SA 4MVFA 3GI3A 5CX9A 2YEXA 2H9VA 2RL5A 3OT8A 4HYIA 4MNFA 4LMNA 4UV0A 5A14A 4IE9A 1DS5A 1YXXA 2B53A 4AA0A 3R73A 4AT4A 3BZ3A 3NMUF 2JBPA 2A27A 2YZAA 3EN4A 3EYHA 4K0YA 4F65A 4DTAA 2I0EA 5DWRA 2OXYA 5ICPA 3R8ZA 2QODA 3RPSA 3VS7A 2F49A 1Q99A 3Q4CA 3FWQA 4YMJA 3MJ2A 3T8OA 4EHGA 5E1SA 3A99A 4FIEA 4DH3A 4AOTA 5C26A 3LKMA 3MN3A 2ZM1A 3CD3A 4GU6A 5IA1A 5I0BA 2OJFE 3C4EA 4QYYA 1FGIA 4ZS4A 1SYKA 3UVRA 4II5A 4AGDA 5A54A 2QO7A 5BNJA 4AZSA 3MH1A 4YPDA 4FSZA 4EK5A 2IVTA 2HZIA 3QTQA 3V51A 4E20A 4GJ2A 4DBNA 5EHYA 2PL0A 5B2LA 5HG5A 5C03A 4C62A 5HE3A 1P5EA 1FQ1B 4FTUA 4E5AX 4I5HA 2R3OA 4FT3A 2GHMA 1MQ4A 3E3PA 2Z8CA 3EQGA 4U8ZA 2BDJA 4IWQA 4EK8A 3UQCA 3EIDA 2R0UA 4LG4A 1CKPA 1PXIA 3PXFA 4FEWA 2OJJA 3CTJA 3I4BA 2ZMDA 4JRVA 3OXTA 2YLFA 1JBPE 4NKSA 4V01A 5M53A 2WZJA 4HYUA 4O7VA 3HDMA 3JVSA 4USDA 4HGEA 4ITIA 4CKIA 4CG9A 3FMHA 5J9LA 2WQEA 2JKQA 4YHFA 4O6EA 3PPKA 4G3GA 3Q3BA 3D5WA 1OZ1A 4GS6A 1PKDA 2JIVA 2O3PA 2YDIA 4G34A 1PMUA 4QQCA 4Y46A 5E8VA 3BWFA 3GU8A 3VBTA 4AGCA 3ZZWA 2W06A 3PPJA 1Y6BA 3B2WA 3E88A 4RVTA 5EYCA 4EUTA 1O6KA 1FVRA 4CFFA 3KN5A 5ETCA 1NXKA 3GGFA 4P2KA 2OWBA 4W4VA 4F7SA 5C8KA 1GJOA 3CPBA 5LVPA 2YM6A 2XK4A 3TNWA 2DQ7X 4WRSA 3D5XA 5IQIA 4MD7E 3L8VA 5LARA 5HG8A 4J71A 2C4GA 4IEBA 4TWNA 3BLHA 4EK4A 4R1YA 2C6IA 4FNXA 3HGKA 5KMJA 2JDTA 4QMVA 4WBBB 1W83A 1LP4A 4F63A 3V04A 4GFOA 4XV9A 5CF6A 3OEZA 4CFNA 5M4CA 4UMQA 3FHIA 3TDVA 3SQQA 3D15A 3VQHA 3R1SA 3D5UA 4AGWA 3EL7A 3Q6WA 3PIXA 3IQ7A 4IVDA 1Q41A 2F2CB 1ZLTA 2JKMA 3T3VA 1U4DA 5IMXA 4ZIMA 2BCJA 5L2WA 2O2UA 2ZMCA 3FMDA 3LFNA 4MX9A 5AR4A 4RWJA 4C58A 5I4NA 4F99A 4AACA 4BCGA 4MXZA 2H8HA 1XH5A 2FSMX 4FUXA 5AV4A 4XEYA 4IACA 1P4OA 4A4XA 4YBJA 2C6TA 4E4NA 1OBGA 4G31A 1H1SA 3W2QA 4O6LA 4ZS0A 4KWPA 1ZY5A 2EB2A 3FV8A 3QTRA 4GEOA 2I0HA 5D7VA 2SRCA 4X2KA 2C6EA 4YGAA 5LCKA 3U9NA 1REKA 3GCSA 3OHTA 3NLBA 4TNBA 4A9RA 4F7LA 3DXPA 4JXFA 3E63A 5FLFA 4DEIA 3W8LA 4BDEA 4D9UA 5IQHA 4FTJA 4BCHA 2PSQA 2IZSA 2V7AA 4K9YA 4FIGA 2RFNA 3RHKA 4FG7A 4UXQA 3CXWA 3ERKA 3MW1A 4YJPA 5HCYA 4KINA 5BX0A 3DZQA 3UOHA 3D2IA 4H39A 4S32A 5L6WL 1VYWA 1Q3WA 3QD4A 4AZWA 3UIBA 4QMXA 5HESA 4U3ZA 3V5JA 4OBPA 3ZUTA 1Z57A 4F9YA 4YLKA 5JGAA 3FSFA 3HUCA 4XS2A 4EQCA 2YCQA 1ZYDA 3QALE 3GU6A 3FYJX 4FGBA 2QOLA 2W1DA 3EOCA 2X39A 4XMOA 5DNRA 2XVDA 3IO7A 2KULA 3VULA 5B0XA 4ACHA 4KKGA 5K4JA 3GXLA 2OFVA 5L3AA 3S0OA 5ETAA 2VRXA 4ITHA 5HTIA 2VX0A 3ACJA 3MGYA 3MTFA 2VTOA 4IW0A 4LRJA 4PMSA 3BKBA 5DBXA 4CV9A 5DLSA 4F9BA 3QQHA 4LOQA 4K18A 2UW6A 2FGIA 3LW0A 4GMYA 5LJJA 3AT2A 2BUJA 5J7BA 3UE4A 1H1PA 3ANRA 2WTCA 1TVOA 1KV2A 2YCRA 4NTSA 5EW8A 3THBA 4QTEA 3SKCA 3EJ1A 4F6WA 3P1AA 5HQ0A 4ALVA 5L2QA 3KK8A 4AN9A 2R5TA 4IZAA 4HYHA 1UNGA 3MVLA 3C4WA 4EWHA 4CG8A 2WD1A 3IDCA 4IAAA 3QZFA 2OLCA 2YCFA 4U81A 3HMOA 4X3JA 4XG3A 3JPVA 1ZY4A 4JR7A 4W9WA 1YOMA 2W99B 4O7NA 4CT1A 3D83A 4OTRA 4C59A 4NIFA 5AUTA 5F20A 5JFWA 3KRWA 4F09A 1M7NA 3U6IA 2B4SB 2W05A 3K3IA 5HVKA 1UA2A 3RINA 3G2FA 4E73A 4CGAA 4BB4A 5KE0A 4DHFA 3AGLA 4CFWA 3KRLA 2C6OA 2GNFA 5I5ZA 3O71A 5EW9A 2R3RA 3DZOA 5HTCA 3GU7A 4H1MA 3DCVA 5C4LA 1IR3A 3CQWA 1ZAOA 2C6MA 2ZB0A 2R3PA 4IX5A 4RX7A 3DBQA 4XUFA 3QUEA 4EZ7A 4WNPA 4LMUA 4RLLA 3GT8A 3BYUA 5KBRA 4WA9A 3GFEA 3ZM9A 2CGWA 1TQIA 4AZTA 4J99A 5HX8A 4YLJA 3LMGA 1H07A 1YWRA 3PLAE 1JKLA 4FT7A 4JL9A 4YNEA 4CMUA 2ZAZA 4RVLA 4TL0A 4O2ZA 4BTJA 2VTLA 2YDKA 3PXYA 2JEDA 3MPTA 3MS9A 5DA3A 5HHWA 3DK3A 4TZRA 3DKGA 4XP2A 3FPQA 3ZONA 1JKKA 4GYIA 1IAHA 1YHSA 2ETMA 2QOIA 3V5QA 1URWA 2ONLC 3VWAA 4CKRA 5CAPA 3DBDA 2J7TA 2VD5A 4DH8A 5LMKA 5HD7A 3BYVA 4JS8A 3SRVB 5IQAA 4RBLA 5D12A 5CY3A 5ANOA 5AR2A 3W2RA 3Q53A 1JVPP 2GFSA 3BI6A 1TQPA 3GP0A 3PE2A 4M0ZA 4FNWA 5CQWA 3HV5A 3JYAA 3EFWA 3I0OA 5EDRA 5CEQA 2NO3A 3QTUA 2RKUA 3R22A 5I9VA 5JGDA 4NL0A 1KE7A 3DOGA 5LVOA 4ERWA 1KSWA 2PMIA 3ZH8A 2W96B 3RM7A 3TACA 3WYXA 2BZKB 3SDJA 4L6QA 3TNQB 2GS6A 5IA0A 5A6NA 4TYHA 3DT1A 2PYWA 3G0FA 5D11A 4CMOA 4QMNA 4LYNA 5DR6A 3NW7A 2J0KA 3OVVA 4BCFA 4C4JA 3UIXA 3FL4A 4ANSA 2JDVA 4I94A 1CM8A 5DT3A 4K2RA 3TV6A 3R8MA 4DLIA 2J5EA 4O2PA 3TZ9A 2JIIA 4BHNA 5CXZA 5JZJA 4G3DA 4RC3A 3FQEA 4DINA 3O7LD 2DYLA 1PXLA 5D1JA 4C7TA 4MNEB 2JDOA 3KCFA 1SVHA 4L46A 4J53A 3UIUA 2C0TA 3SLSA 5CF4A 3ZC6A 5CAVA 4U80A 3B8RA 2RG5A 5AIRA 4BYIA 3PIZA 1BMKA 2W1FA 4Y8DA 2CKPA 2XF0A 5CU2A 4O1OA 3PVBA 5IKWA 4PY1A 4HPUE 3A7HA 4K33A 4F7JA 2X8EA 1V0BA 4BGGA 4USEA 3PSDA 2PUUA 5C8MA 3CGFA 2X2KA 3ODYX 2FA2A 5EQPA 4FTRA 2Y7JA 4X3FC 4KIOA 2J9MA 1ZMVA 4KS7A 1GZNA 5DR2A 3U4WA 2NRUA 1L8TA 3BU3A 4U41A 4R77A 2IPXA 1QCFA 2ZB1A 3DA6A 4E6CA 2V22A 5LVNA 4PUZA 1E1XA 2J5FA 4QP2A 2IVVA 3ZEPA 4L42A 2WQMA 1O6LA 1PXMA 3QXPA 3DS6A 1LPUA 3AMBA 3EN9A 4WUNA 3MA6A 3UGCA 4GG5A 3S4QA 1VJYA 2ITZA 4GH2A 5M4IA 4QTCA 3A4PA 1ZOHA 1OPJA 3QKMA 2J50A 2UW8A 2UV2A 2ZV9A 5IUHA 4EK6A 4O38A 4FEUA 4O7WA 5CU6A 1CKJA 5M4FA 2XIRA 4YTCA 5BVFA 3FHRA 4C3FA 5LXMA 2VAGA 4HZSA 2VZ6A 3WZKA 2CNUA 3MVMA 4RC4A 4XH6A 4D2VA 3UIMA 5IU2A 3I60A 1H01A 5I9ZA 4ENYA 4RPVA 4BICA 2VV9A 1JSTA 2XB7A 1JNKA 4EK3A 4QMYA 1A48A 3IGGA 3KVXA 4KSQA 1MQBA 2UUEA 4RRVA 3UO5A 4IVBA 3L8PA 3OT3A 4OAVB 1WBSA 3W18A 4B4LA 5K0XA 2BTRA 3PG1A 2Z7RA 2Z7LA 3FLWA 3KRJA 3SVVA 4BDAA 3VJOA 4DYMA 3ODZX 3NNXA 2BDFA 3OXIA 4OUCA 2JBOA 3RWQA 3LFSA 5T68A 3A7IA 4E4MA 4FV4A 3BIZA 2PTKA 3QL8A 4MK0A 2FSLX 4DFZE 4ZLZA 1Q8WA 2A1AB 2UZBA 3KC3A 1GIIA 4FT0A 4XG8A 1Q62A 4AE9A 4C4IA 2IW8A 4S31A 4IANA 4G6NA 4Q2AA 1U54A 3RI1A 4J1RA 3LXPA 2ZM3A 2C3KA 3EH9A 2VTQA 2CDZA 4IAIA 5HICA 3R7VA 2IVUA 2Y4IB 3KREA 5GIPE 3MFUA 4J95A 4L68A 2W1CA 2HIWA 4QP9A 4FTTA 4BBEA 4OTWA 4BCJA 3KKVA 5HEZA 2V55A 3VS4A 1FBNA 3ZO3A 2WB8A 4FL3A 3O51A 3AC8A 2W7XA 5LVMA 5AM6A 2QOQA 4BDBA 4RA4A 3QX2A 2VTNA 2CGUA 4FTNA 4DC2A 4XG4A 5A6OA 2ZYBA 4O91A 1YXUA 2YJSA 5ANEA 3H9OA 2P4IA 3PTGA 3R71A 4I6FA 2PVFA 3OFMA 1QMZA 4UBAA 3DV3A 4AA5A 4E6AA 5HO8A 5L6PA 4BVUA 3TNHA 2WNTA 3DAEA 2PU8A 4PMMA 4FKOA 4TW9A 5IDPA 3KK9A 5M07A 4NCTA 5H9BA 4ALUA 4L43A 2XYNA 4X0MA 2OKRA 2YZLA 4DBXA 2Y4PA 4IAFA 3P5KA 2IN6A 4YZDA 5HNIX 2W9FB 3FI2A 2YERA 4E1ZA 5E4HA 2VO7A 3K5UA 3KXZA 3ZRLA 1YWNA 1WBPA 4H58A 4OR5A 4ANBA 4GT3A 1R1WA 4B7TA 3UNZA 3SXRA 3OWLA 1OIUA 1WFCA 2VWVA 3FMJA 3CJFA 4EC9A 4MAOA 3BGZA 1ND4A 3ID6C 3RPOA 2CJMA 4LI5A 5HO7A 5KCVA 2RFDA 4FVRA 3ORIA 5BYYA 2HZNA 5FXRA 4EOIA 2WEVA 2Q0BA 2RFEA 4GK3A 3B8QA 4TY1A 3SW4A 2GCDA 5KMOA 4QYGA 4X2FA 3EQRA 3OTVA 4FTMA 4QP1A 4FZ7A 4JG8A 3QX4A 2W5BA 4AZEA 3V5PA 3UOLA 4AW5A 4ZXTA 4AAAA 2BROA 3QQLA 2C30A 3E8NA 3P78A 4WG4A 4E6DA 4RIWB 5EQYA 2C1AA 4OTHA 2C6KA 1GZKA 2GTMA 1H1RA 3DJ5A 3H3CA 5ACKA 4BCKA 4UMRA 3LQ3A 4JG6A 2QLUA 2UZDA 1BYGA 2UZLA 3I81A 4FZDB 4XV3A 3UO4A 4AE6A 3ZXTA 2JFMA 5IH5A 5I9UA 2CCIA 1YXSA 3GQLA 3QC4A 3QRJA 2CNQA 3FLYA 4G9RA 4JJRA 4YO6A 2B52A 5TOZA 4D2TA 3PWDA 4FTOA 3UNKA 1J7IA 3DY7A 1A9UA 3S2PA 5CAOA 4I0RA 3Q9WA 3QQUA 2HXQA 3TIYA 4F0FA 2X8DA 2ZDTA 4ACMA 4G6LA 5IUIA 3HA8A 3UOKA 3GUBA 5J1WA 3I79A 2R2PA 2W17A 1YKRA 4MXCA 4PNKA 2GHGA 3HMPA 2OIBA 2PVRA 2XIXA 2WMAA 4NW5A 4C36A 4UZDA 3WZUA 4IBMA 2W1IA 3GOKA 3GVUA 4YR8A 3KXXA 4BCOA 5IA4A 3TKIA 4E3CA 2DS1A 4S30A 3NEWA 4I5PA 3COMA 3HV7A 3BRBA 4GL9A 1PRYA 4MBLA 5IQFA 2BRGA 4J98A 4APCA 3SD0A 5F4NA 5CF8A 2X2LA 3RAWA 4GKIA 4JIKA 2GU8A 3C5UA 3BQCA 3BBTB 3C13A 5E92A 5KZ0A 4BHZA 4KKHA 5L4QA 4C4GA 4DFLA 2UVZA 5DVRA 3ZHPC 1U5RA 3RP9A 4O7YA 1S9JA 5AX3A 5IDNA 4BCNA 3F5GA 4WHZA 3F7ZA 2R3GA 2RFSA 3BYSA 3LXNA 4WRGA 4QP4A 3G90X 2X81A 3P7CA 4YC8A 3FXZA 3VAPA 2YACA 3QGWA 4AN2A 1A06A 4RSSA 4DGMA 3IPHA 2PVYA 2J0LA 4NK9A 5EKNA 4RIYB 3W16A 4IZ7A 4J8MA 3EQHA 4LRMA 5DRDA 5CEOA 4O7SA 2REIA 3QTZA 4CRLA 5IQDA 4Z55A 2PY3A 2HY0A 1JQHA 2B7AA 4I23A 4KIQA 4DFXE 3U54A 3TWJA 3V5WA 3OZ6A 3FYKX 3LJ2A 1XH9A 2H96A 3QUPA 4HCVA 4DG3E 4JBQA 4QP6A 3HEGA 4B9DA 2RG6A 5IA2A 4YLLA 4G5PA 4B8MA 1RDQE 4FK6A 4H1JA 4MF1A 2CHLA 1T45A 3OCBA 1VZOA 2RGPA 4GU9A 2VTAA 5CI7A 4NH1A 3A8WA 3FQSA 4XNEA 2YM8A 1ZMWA 4RZVA 4UY9A 1PXJA 2YFXA 4BDDA 4U45A 1Q61A 3FKOA 5J7HA 5IQGA 2OIQA 5H3QA 5KMIA 3DDQA 2WMVA 1IRKA 2EVAA 3D4QA 5L2SA 3JR1A 4AGUA 1SVEA 4PPAA 4EH5A 3Q52A 3UPZA 3E92A 4I3ZA 4O0RA 2BRMA 4FKVA 1PXNA 4RQKA 4UXLA 4XBRA 5HIBA 3I5ZA 4JR3A 3ZC5A 3IOKA 3N9XA 1MUOA 4Y72A 4NJDA 4L44A 4FIHA 4FV7A 4O0VA 1YOJA 4FV6A 3DJ7A 2C3IB 3OCSA 4D1XA 1F0QA 2BILB 2OIDA 4JAJA 5FBOA 4C2WA 5A4EA 1CSNA 4RA5A 4EZ5A 3I7BA 3IG7A 2BZHB 5DG5A 4BRXA 4P5ZA 4W8DA 4AG8A 3W2OA 3EWHA 4PMTA 1H1WA 2FSOX 3EQFA 4K77A 5I3OA 5GJDA 4PNIA 3KXHA 5KMKA 3SAYA 3F7WA 1STCE 3KU2A 2PMLX 2PZPA 4IB5A 4YC6A 2C5XA 1PJKA 5ANKA 5GJGA 4H05A 2VTTA 3ZLYA 5IPJA 4QYHA 1J91A 3ZM4A 3R21A 4DCAA 3TZMA 3PY0A 4NFMA 4BDCA 3IW6A 3JXWA 3PXQA 4AW2A 1ATPE 3C0GA 4QTBA 5JZNA 3VJNA 4BWPA 1AGWA 3OW4A 4TKSA 1K9AA 4M84A 2A4LA 4WSQA 4D2RA 3FXWA 2EB3A 5CAUA 2YITA 3KXNA 3SW7A 4HNFA 3BCEA 3UZPA 2O63A 1OMWA 1UWHA 2X1NA 5AR3A 3MVJA 2CCHA 4H3BA 5E8YA 4EUUA 5M4UA 3MY1A 4A07A 2QKWB 3Q6UA 2UZOA 4OTDA 5IUGA 5TO8A 4BDFA 4TNDA 3E93A 4DEHA 5JFXA 2OO8X 4ZSLA 2VWYA 1YI6A 2ETKA 4MHAA 2VUWA 2XJ2A 2XUUA 3LFBA 4IVCA 2Y9QA 2OICA 3LMHA 3K5VA 3FXXA 3DJ6A 4FIIA 3O23A 2FO0A 4UWCA 5EM6A 3R2BA 2WTKC 4AW1A 5DN3A 2XKFA 3BBWA 3PXRA 5HIEA 3H9RA 3MB6A 4CQEA 2HWPA 2VTPA 5B2KA 3GCPA 3G0EA 3MYGA 1V0PA 3H30A 4OTGA 4YHTA 5LWMA 5M56A 1PYXA 4I24A 1Y91A 3RPVA 4QMSA 3VN9A 3WARA 4CT2A 3ZRKA 3QZIA 5GZ9A 3COKA 2QKRA 4I4FA 4QT1A 3ZFXA 4QPSA 3R9RA 3NNVA 4FTAA 1J1BA 2CKOA 5EQEA 1SZMA 1SVGA 2XEYA 4DFYA 5EHLA 2YWPA 3GQIA 3VO3A 4MTAA 1WBWA 2F57A 5D7AA 3V01A 1SMHA 4WG5A 2BHHA 4BC6A 3OTUA 4RQVA 4O0SA 4BDGA 1JPAA 3Q9YA 1UNLA 4GCJA 2OXXA 3A7FA 4FV5A 3CC6A 4ZLOA 2YJRA 3CD8A 3I7CA 4C38A 4XV1A 3UQFA 4ORKA 3ZUUA 4ONAA 4RIOA 5BUJA 5H8BA 4R3PA 3BHVA 3P23A 2YHVA 1YOLA 4C34A 3JUHA 4FX3A 5IQCA 1U59A 4FTKA 5BMMA 3I0QA 3ZS5A 2XNNA 2AYPA 1J1CA 3PXKA 5EI8A 3QRTA 1SNUA 4IH8A 5FXQA 4FSTA 2OF2A 5KKRC 3FE3A 1PW2A 1XH7A 4JQ7A 2QLQA 4RJ8A 2VWWA 1M2RA 4MKCA 4IWPA 4LRKA 4TXCA 5J8IA 3C51A 2ETRA 2X0GA 3BYMA 3SRVA 4ERKA 4JG7A 1M2PA 4I41A 3EB0A 4FEQA 4E4LA 3RPRA 3FQHA 5AUVA 3D7TA 3NIEA 3JVRA 4DT8A 5J5SA 4CVAA 3FZSA 4FC0A 3IK3A 3RM6A 4N4SA 1SNXA 5M55A 2WMTA 4U79A 3MH0A 3Q2JA 2ITUA 3ZO2A 3UP7A 2J90A 5F94A 3D9VA 1YVJA 4FSRA 3UMXA 4CZYB 4JLCA 2VWUA 3C5IA 4IIRA 3HP5A 4XG2A 3SX9A 4CLIA 2E9PA 3C9WA 3QHRA 3R30A 3ZTXA 2ZV7A 3PZHA 4FTIA 5AP0A 2VU3A 3HYHA 3ROYA 4Y85A 1FVVA 3IKAA 1R0PA 1W84A 4G3EA 3EFLA 3VF8A 5DPVA 5T3QA 3R9DA 4UB7A 5JFVA 3QAME 4JX3A 1YXVA 1CDKA 3F9NA 3OWPA 3ORNA 1XJDA 3LHJA 4PRJA 4KBKA 4MNEA 3NVKI 4XHKB 2XYUA 3OY3A 3V3VA 3FSKA 4LL5A 2QG5A 3RMFA 4LM5A 4JDIA 4PDPA 4DEEA 5BPYA 5IZFA 3NR9A 5CASA 2WTJA 1XH8A 2I40A 4OTFA 4AZFA 2VWBA 2GS2A 2QOFA 3ALOA 3EN7A 4CXAA 5CSPA 2FB8A 4C02A 4L3LA 3LOKA 4V0GA 5LVLA 3S3IA 3U9CA 4YP8A 4IC8A 3TXOA 4E8AA 3IECA 4EH8A 2JIUA 4LV8A 5F9EA 1ZOGA 2QD9A 3BWJA 4BTMA 3HNGA 2QC6A 4G16A 2WEIA 2BVAA 2C6LA 3HA6A 3BHTA 2OG8A 1WMKA 4PPBA 4BZDA 1OPKA 4I20A 4E93A 1PMEA 3UBDA 1RJBA 4GRBA 3WE8A 1L3RE 4FV0A 4KIPA 4X2JA 4UEUA 5CT0A 2XNMA 3MSSA 2X9EA 4U44A 3Q4ZA 5KHWA 4P5QA 4XRLA 1J3HA 4ZMFA 4LUEA 4XP3A 4BDJA 4IX4A 4D0XA 4DT9A 3BGQA 5H2UA 3FI3A 5JT2A 2AC3A 4K1BA 4HVIA 3SGCA 2OJ9A 3BHUA 3RPYA 3PIYA 4ANLA 3LM0A 3NVMB 2X4FA 3EN5A 3MJ1A 4ACGA 5CVHA 5EOLA 3RVGA 3CTHA 3EQIA 3Q5ZA 3WILA 1XO2B 3G9NA 4ZSEA 3VRYA 4CNHA 3A7JA 1OL1A 4QQ5A 2RF9A 3F2RA 1JAMA 4QMMA 3CY2A 4FEXA 3PLSA 3NDMA 4D4YA 4ZSGA 3R1YA 5AV0A 4OAUC 4YPSA 3FUPA 3M11A 3IDPA 3OXZA 3CP9A 4NW6A 4D28A 4D2PA 5JK3A 2QR8A 2B9IA 2WELA 3CQUA 3LAUA 3VHKA 4HVGA 5F1ZA 5KNJA 4FSYA 3FBVA 4TWPA 4JBVA 5FG8A 3SXFA 4GUBA 3FLZA 3NS9A 3SV0A 4TYEA 4FKJA 3R8PA 3D5VA 2VTIA 4AWIA 5KMLA 2W5HA 3KN6A 5EYKA 4ASEA 2XKCA 4U9AA 5ANJA 4IJPA 2J0JA 2JKOA 4FSWA 4JRNA 3OUNB 2LGCA 4W9XA 2BMCA 2F7EE 5E91A 3RBWA 4B6LA 3M42A 1WBVA 3O96A 2IZUA 3F69A 4FK3A 3RAIA 3KCKA 4I22A 3R00A 4HGSA 4PTCA 2UZUE 3OMVA 3C1XA 2NPQA 5CSVA 5FGKA 3BV3A 2ONLA 5AAGA 4FG8A 2IG7A 3AC5A 4FODA 3I6WA 5L2TA 1YI4A 2YISA 3KVWA 1OI9A 4WKQA 4CD0A 4FNZA 3KEXA 4G1WA 1DM2A 3OW3A 4C4HA 3FJQE 3R7EA 3HV3A 1KWPA 4AQCA 3L8XA 3LFFA 3Q9XA 2GNGA 1PHKA 4QMTA 5EDQA 4CV8A 2AC5A 5C1QB 2J0IA 3RZBA 2OH4A 3R6XA 1UVRA 4W4WA 4L01A 3FAAA 4UMUA 1ZYJA 2GHLA 1OM1A 3LJ1A 5K9IA 4FE2A 3M1SA 3ZLXA 4IMYA 2GNJA 3A4OX 4ASXA 3BHYA 3C4FA 3KF7A 4IZYA 4XBUA 5EFQA 4QYFA 5HCXA 3L9PA 2OSCA 3R7UA 3FMNA 4ZSAA 3MFTA 4XCUA 4HVHA 1KUTA 5E1EA 5ANDA 2PULA 3ALNA 2PUIA 5E8TA 3V8TA 4FKWA 4EOKA 2GNLA 4IM2A 4ZEGA 4PTGA 2I0VA 4NFNA 5EYDA 2XK3A 3ZU7A 4BGHA 4O81A 3IGOA 3COIA 4AF3A 4RIWA 4EQMA 3LZBA 3D7TB 3OROA 4Z3VA 4FL1A 4USFA 3PY3A 2W1ZA 3QYWA 5FM2A 4N70A 1P2AA 3COHA 4IJ9A 5HO6A 2E9VA 3SHEA 5CWZA 2UVYA 5B2MA 5GZAA 1H28A 3GNIB 4RJ5A 3QA8A 2XIZA 5C27A 3RAHA 1PXKA 4MBJA 3EKKA 3C50A 2PWLA 3DBCA 4FIFA 2A19B 4CFMA 3T9IA 3KRRA 5CLPA 5L6OA 3ULIA 4IZ5A 2BTSA 3NAXA 4X3FA 2XK6A 3EN6A 5J87A 2JLDA 3P08A 3IW7A 5M44A 1XQZA 5A3XA 3EFKA 3RK9A 2J0MB 2Z02A 3O50A 4ACCA 5AP1A 3POOA 1VR2A 3LFCA 3VVHA 1ZMUA 4D1SA 1I44A 2ITQA 3DKFA 4I1ZA 4I4EA 4XG9A 3ATTA 2WTWA 4A9UA 4MEDA 4D58A 3H9FA 3QKLA 5CU4A 4FEVA 5JN2A 1CTPE 2HK5A 1P4FA 3DNEA 3E87A 4XG6A 4GK4A 4L3PA 3P7BA 5AUYA 2OGVA 2EU9A 2C0IA 5HE0A 3Q60A 2WXVA 4QMWA 2OK1A 4ZP5A 4ZK5A 2YWVA 2XH5A 4QMLA 5AV1A 4XP0A 3U6HA 2P3GX 4GUEA 3O8TA 1YHWA 3PYYA 4M14A 4BCQA 3SG8A 4YTHA 1DAYA 2R0IA 2XBAA 5AR5A 3WF5A 3ZOSA 4V0GB 2WMWA 2QOKA 2XS0A 1WVYA 3MV5A 5FDXA 4F1MA 2BHEA 2XKDA 5CNNA 3BEAA 3E5AA 4EEVA 5LMKC 5J9YA 5ETIA 5JEBA 1HCKA 3A61A 3E8EA 3H10A 3OCGA 4M12A 5H8EA 4CQGA 1FOTA 1YRPA 3QCYA 4IADA 4J97A 1Z9XA 2W4KA 3DU8A 1V0OA 4RX5A 3KRXA 4RIYA 2HW6A 1VYZA 3R2YA 4LFIA 4I6HA 2GFCA 4P7EA 4O83A 3O2MA 3PJ1A 1OL5A 4J52A 1U5QA 3QKKA 4CFUA 2F2UA 4YJOA 2X7OA 1X8BA 5KMNA 5J9ZA 4AT3A 3WF6A 5L8KA 3E7VA 4Y5HA 3LQ8A 5TKDA 4Q5EA 4UYNA 4WUAA 3NPCA 2JAMA 4G3CA 3PUPA 4EWQA 2BRBA 3E3BX 2C69A 2J4ZA 4BDHA 4RT7A 2G2IA 4KB8A 5EM7A 4J8NA 3OS3A 3WF8A 2C6DA 4K8AA 4KABA 5EM8A 2R9SA 4U40A 4YJRA 4C0TA 3ORMA 2O65A 3QQGA 4PF4A 3HAMA 3P7AA 3QBNA 4WNOA 4U3YA 4NM0A 5L8JA 4M13A 2XJ1A 3BPRA 3F61A 5DRBA 1V1KA 5AUWA 4RJ3A 4ANNA 5ACBC 3G15A 3BE9A 4JBPA 4QP3A 3D94A 3GU5A 4UMPA 2WO6A 3F2NA 5FEEA 2CKQA 4ZOGA 1H27A 3F5XA 3WYYA 3CS9A 1OKZA 1IG1A 1QL6A 4NEUA 4RX9A 1BI8A 1XHAA 4JQEA 3HRFA 3QXOA 2ZVAA 5IH4A 4Z7HA 3NW6A 4MD8E 4XRJA 5G1XA 3U6JA 4KRCA 4PL4A 4R3RA 3R7OA 4GYGA 3VQUA 3ZBFA 4IAZA 4GIIA 4YTFA 3LJ0A 3I1AA 4MXOA 4X6RA 4FKGA 5M08A 3TTJA 4A9TA 1NVRA 3QQJA 3F3WA 4FV2A 4PTEA 3A7GA 3NUPA 3NYOA 1Q24A 4QP8A 2Q0NA 4FKSA 2PMNX 1ZYSA 4AT5A 5DOSA 4EI4A 3S00A 4D4VA 2HXLA 3PWYA 1AD5A 1QPJA 2G15A 4IAYA 4MXAA 5AR7A 5TF9A 4S2ZA 2LAVA 2JDSA 4I5MA 5D10A 2BPMA 3NYNA 4YJTA 1ZWSA 3L9NA 5AFVA 2A2AA 3PVGA 1GNGA 4PPCA 3EZVA 5TT7A 3GC8A 2QCSA 4I0TA 1OBDA 2G1TA 4RC2A 3PY1A 5HBJA 1NW1A 4L7FA 4AN3A 4CEGA 3GU4A 5CSHA 3WZDA 4ZTMA 3RHXA 2C47A 1WCCA 4S33A 4GVAA 3FDNA 3NGAA 4BCMA 2ITYA 5HGIA 1GIHA 4EOPA 3IOPA 1CMKE 4ZMEA 2OF4A 4PV0A 2Z60A 4ZAUA 3OEFX 3DKCA 3DQWA 4RGJA 1LEWA 4QNYA 2BFYA 4R5YA 1QPEA 1BL6A 4D55A 2HYYA 2XRWA 1M14A 3Q4UA 4OGRA 1WAKA 4IAKA 1F5QA 1XBAA 4X6QC 4FZ6A 2WMBA 3DXQA 4PDSA 3RWPA 3HECA 2B9JA 4E7WA 4NJ3A 5CZIA 4FKPA 5CTPA 1E1VA 3TIZA 3LVPA 5AM7A 2CGVA 3AQVA 2VGPA 4MQ1A 2IJMA 1Q4LA 2VTHA 5JRQA 4XX9A 3R8VA 1IA8A 2NRYA 3KXGA 3MTLA 1W82A 2F7XE 3ET7A 3GEQA 4I6QA 5GJFA 4HGLA 4Z9LA 4DGOA 2CNVA 3F6XA 4ZY5A 3E8CA 4YURA 5ITAA 4PMPA 3EQBA 3FLSA 4EH4A 3MPAA 4WBOA 4YNOA 4GG7A 5CS6A 4EKLA 4TYGA 3C4CA 4TRLA 4H3QA 4YZBA 1JSVA 4M66A 5LMBA 4IC7A 4P90A 4X3FB 4HVDA 1O6YA 4O27B 4D1ZA 4F9WA 5B7VA 4XLVA 2YIWA 3G6GA 5AUXA 4BYJA 3QF9A 3CQEA 2C5NA 2YM4A 5AWMA 3W2CA 2IW9A 3II5A 5FXSA 4FVQA 2C5VA 4WNKA 3DFCB 5EK7A 3FC1X 5IH6A 5BUIA 5AEPA 3WI6A 3ZMMA 3DXNA 5CENA 4G17A 3SOAA 4RIXA 4ZJVA 3JY0A 3OP5A 1XR1A 3IW4A 4H3PA 1JOWB 2Y8OA 3HMNA 1HCLA 3MDYA 4ZTQA 3RAKA 3GCQA 3AD6A 2ZJWA 3G9LX 3L8SA 3PA4A 4HCTA 1OL7A 2HENA 5DFPA 3HMIA 2I7QA 3FKLA 4HPTE 2BAQA 4HW7A 2FYSA 3AMAA 3CCNA 1RW8A 3E62A 1FMKA 4O0WA 4ANMA 3QD2B 3PRIA 1H0VA 3FL5A 2CLQA 3PJ2A 1WVWA 2F7ZE 4OTIA 3ZRMA 2P2HA 4AOIA 3OWKA 4AX8A 4F6SA 4CKJA 1ZYCA 4O0UA 5E7RA 3VIDA 3ORZA 2WHBA 3UP2A 1K3AA 2YAKA 3KB7A 2R7BA 4JT3A 4ZTSA 5J79A 1HOWA 5BVKA 1OB3A 4R6VA 4BY9E 3RKBA 2HY81 3KGAA 4BN1A 3OY1A 1OKYA 4RWLA 3R8UA 3IW8A 1B39A 4CFVA 4C4FA 5FTQA 1KOBA 4M67A 3CY3A 4XOZA 3OWJA 2CLXA 5CU0A 5IISA 4A4LA 3MWUA 5DIAA 4KIKB 4CCBA 2WU7A 4ZSJA 1Q5KA 4EYMA 3FMEA 4EOJA 4RFMA 3R83A 3UNJA 1R39A 3VRZA 1AQ1A 1BI7A 1DI8A 2VWIA 3UODA 4CYIA 4Q9SA 4FZFB 4N57A 4PDYA 4IM0A 5FQDC 3L1SA 3HDNA 4DH1A 2JDRA 2YN8A 3DK7A 1IASA 5JQ8A 3SG9A 3VBXA 1YDSE 2R3IA 5LCJA 3I5NA 3R28A 3VBYA 3MESA 3JS2A 3LFDA 5C4KA 2WQOA 3S1HA 4P4CA 2GSFA 2YIXA 3ULZA 1KV1A 3PSCA 5GZ8A 1NA7A 3HV4A 4DFBA 4G3FA 2BR1A 2YM3A 3CR0A 3QYZA 3ZLWA 3W32A 1NT2A 5E9EA 2OH0E 4ASZA 4IVAA 3LM5A 3QRUA 1U46A 5K0KA 3NNUA 3S95A 4D0WA 4DEBA 5LWNA 3EMGA 2VTRA 4LGHA 4A06A 2GQRA 3VS6A 3FMKA 2X7GA 4N0SA 3ZBXA 1VEBA 2P33A 3DBEA 1UKHA 2XK7A 3PJ3A 2ITWA 5E8XA 1K2PA 2ITNA 3FY2A 5HOAA 4PL5A 5GHVA 2XZSA 5GNKA 4LGDA 2HOGA 3RALA 4L7SA 2JITA 4RX8A 2F4JA 4YZCA 4E5WA 2YCSA 3REPA 4WOVA 5I9WA 4MYGA 4B0GA 2VWZA 3BX5A 2OBJA 4DEAA 3CGOA 5J95A 1JLUE 3D0EA 5K4IA 1OUKA 5FTOA 3HZTA 4D2WA 4BKJA 4U6RA 2R3QA 3KL8A 5HIDA 2YIQA 1MP8A 5CEIA 4CZUA 5M51A 1PKGA 4RFZA 3O8UA 4NM5A 2QG7A 4FOCA 2X9FA 3GCVA 4PP7A 3N51A 2CN8A 2XMYA 1CKIA 3QZHA 3TZ8A 3U87A 1ERKA 4FTQA 3FLNC 3FPMA 1OKVA 4NM7A 5FEDA 1PY5A 5JRSA 2UZNA 4UN0C 4F08A 2B1PA 4I5CA 4I93A 4ZTLA 1UV5A 5A4CA 3M2WA 4NZWB 2JD5A 2GNIA 2E9NA 2ZV8A 3FKNA 4M0YA 1QPCA 3QUDA 1GY3A 1KE9A 3A62A 3W55A 3NUXA 4ACDA 2XIKA 3O0GA 3R7IA 3VS2A 2BDWA 1JKTA 2VTMA 2BAJA 1J7UA 4JNWA 3OCTA 4Z16A 2VNYA 3C0IA 3OUKA 3TTIA 4FSMA 3ORXA 2O64A 5HU3A 4O21A 3CPCA 4L52A 5KO1A 4GSBA 3LCDA 3T9TA 2PVNA 2P55A 4RWIA 2EXCX 3OBJA 1RQQA 5E8UA 3MH3A 3ZSHA 3R04A 3VUHA 1F3MC 4U5JA 4F0GA 2F9GA 1BX6A 3P9JA 3HRBA 2BFXA 2YIRA 3NUYA 2RIOA 3R1QA 4N6YA 3C7QA 4JX7A 4PDOA 3FY0A 2VTSA 3HL7A 5CVFA 4WIHA 3H0YA 5EKOA 2OXDA 4FT5A 3R01A 4XG7A 5AX9A 3BV2A 4DG0E 3DAJA 5IQBA 4C8BA 3Q5IA 5HORA 5AADA 4DF3A 3DTCA 1W98A 2QOBA 4CCUA 4EBWA 4FR4A 4ID7A 4AP7A 5CEKA 1YQJA 4QMUA 5DT4A 3F5UA 3HX4A 4G9CA 4LOOA 4F70A 3LMIA 4KKEA 2BIYA 3FI4A 4DEDA 3PP0A 4FKTA 3TG1A 2O8YA 4EORA 3DQXA 3ENHA 2XBJA 2ITOA 5FEQA 4EH2A 4BFMA 3I6UA 3PJCA 3VHEA 4CLJA 3AC3A 3UO6A 2PZRA 4AW0A 4V05A 5BVNA 5J5TA 3G51A 5DI1A 1OIRA 3V6SA 1W0XC 4DTKA 2WMQA 5FP6A 3VC4A 1Q8YA 2HZ0A 5HVYA 4BBFA 5A4QA 4AU8A 2WMSA 5EOBA 3PPZA 1GIJA 3BELA 4FNYA 4YO4A 4FYOA 1APME 3FEGA 4JVGA 3FI8A 2BZIB 5HCZA 4RIXB 2OFUA 2HZ4A 2WTDA 1OIQA 3WF9A 2PVLA 4FZAB 3SOCA 2PVMA 5J1VA 3CKXA 4QO9A 4FTLA 1H08A 1PF8A 3TV7A 2W0JA 3D14A 3R63A 3PA5A 4LQMA 2Z7SA 2PZYA 3EFJA 3LFEA 4OTPA 5BVEA 3TI1A 2ZM4A 3CLYA 5TR6A 4OLIA 1J7LA 3DBFA 4WO5A 4BZOA 3FLQA 3WF7A 1ZZ2A 5CVGA 1UU8A 2EXMA 3PSBA 2B0QA 2CKEA 5AP2A 2XNOA 1BLXA 3Q04A 5HKMA 4F7NA 5CANA 4ZJIA 3LCTA 3ZXZA 2ITVA 5A46A 4EOOA 3OOMA 3NUAA 2WMRA 3QTXA 3UYTA 3V8WA 3ZDUA 4DH5A 4LV5A 4KAOA 1XBCA 4BKYA 2WAJA 3WBLA 3GBZA 3TNPC 2GQSA 2OJIA 2UVXA 3QCXA 4IDVA 1EH4A 1Q97A 4RZWA 2X2MA 2R3NA 4BWKA 2OZAB 2I1MA 2QR7A 2W4JA 3BQRA 5BYLA 3POZA 3QRIA 1R3CA 3UOJA 3F66A 5AAFA 3U8WA 1REJA 2Q83A 3VBWA 4FTCA 3FC2A 4O0TA 4YTIA 3ROCA 5E8SA 2BKZA 2CN5A 3WIGA 4HVSA 4RJ6A 4D5HA 4QP7A 4C37A 2C3JA 3BGPA 5AV2A 4UYAA 4KSPA 3PP1A 4TYIA 3ITZA 3ZSGA 4D9TA 4FV1A 3RJCA 4EJ7A 3QC9A 2XA4A 4LOPA 4ZJJA 4AS0A 5IMEA 2PHKA 5AP7A 2GMXA 5BVDA 4FKLA 5KBQA 4ANOA 4UX9A 1BUHA 5M09A 5FM3A 2X8IA 4TWCA 3TKUA 5EM5A 3P79A 2QNJA 3KF4A 4BTFA 1DI9A 2C3LA 1ZYLA 5EHOA 3ZSIA 4TN6A 5KZIA 3SXSA 4Z7GA 4TTHB 3C4ZA 4WD5A 4QMPA 4DH7A 2ITTA 5ANIA 4FSUA 4OBOA 2R64A 2R7IA 2QONA 4QQTA 5EYMA 1LR4A 3NYXA 5DEYA 4ZY4A 2XM9A 4R8QA 3ENMA 5FTGA 1IAJA 2Z7QA 1YI3A 4ENXA 4DGLC 5HVJA 4K11A 3BU6A 2NP8A 1XWSA 5CYIA
chains in the Genus database with same CATH superfamily
4LL0A 3VUGA 2WOUA 4DGGA 2IZTA 1O9UA 3P86A 4EH7A 5IA3A 5AP6A 3V5TA 2R3LA 3TUCA 1G8AA 1YXTA 3AT3A 3F3ZA 5EH0A 3TEIA 4L45A 4D2SA 4YJNA 2V7OA 4O1PA 2GNHA 3RTPA 3QTWA 4M15A 3BHHA 4TYJA 4BDIA 1LUFA 2WTKB 4MH7A 5I9XA 5L8LA 3LCOA 3U51A 5HE2A 4X2NA 3F5PA 4EOMA 5HU9A 1GAGA 3PE1A 4O22A 4F64A 3MFSA 3N4TA 3TJCA 3QGYA 4PP9A 5F95A 5JMSA 2BRHA 4KUJA 2G2FA 2Y6OA 3VW8A 4B99A 3OF0A 1W8CA 4EC8A 5KUPA 2UW7A 4LGGA 3VS5A 4O82A 4R78A 3MI9A 1ZZLA 4R3CA 4O84A 4UMTA 1IEPA 5LOHA 2UZWE 2YAAA 3VS1A 4MD9E 4FGRA 4LV7A 5K3YA 4EOLA 3TYKA 4EKKA 2E2BA 4FKIA 5IG1A 4JIAA 2CGXA 2XIYA 1YDRE 2IW6A 3MB7A 1GZ8A 3NX8A 3OOGA 3GB2A 3QZGA 4GFMA 4YSMA 2VO0A 3CE3A 2XNEA 3ORKA 3MPMA 5C01A 4QYEA 4E26A 4TT7A 3UC3A 3MY5A 2E9UA 3R1NA 5JSMA 3R0TA 2BALA 2FSTX 4G6OA 4QPAA 3V8SA 4UZHA 3E64A 3CTQA 1Y8GA 1M52A 3A8XA 2XNPA 5DR9A 5A9UA 5KKRB 2J6MA 4FVPA 2QI8A 3DGKA 2C1BA 1XBBA 3QWJA 3CSVA 3UZTA 1WBOA 4IXPA 5CAQA 5EI2A 3P0MA 4M69A 4F9CA 1JKSA 3RNYA 2WIHA 2QHNA 2C5OA 4Y95A 4CTBA 3QD0A 4DTBA 5JH6A 4IWDA 5HLPA 3NAYA 5HLWA 5AP3A 4O7TA 2ZOQA 5HBHA 5E90A 1PMVA 2OJGA 3QRKA 4HGTA 5EI6A 4QQJA 3VUTA 2FVDA 4GW8A 2HW7A 4FI1A 4L3JA 2W1EA 1PXOA 3AC2A 2WIPA 4MF0A 4U97A 5IA5A 3NW5A 3UVPA 2PPQA 4O7ZA 3ATSA 4QMQA 1OKWA 1OECA 3NCZA 3V6RA 3MVHA 2GDOA 4FSQA 1T46A 3QD3A 3MIYA 1GZOA 1M2QA 4GVJA 3LCKA 4V04A 4XV2A 3JY9A 2J2IB 1KOAA 5AP5A 4ZLYA 3AD5A 4RG0A 2OW3A 3ORPA 2WQNA 4BWXA 2PK9A 5LQFA 4RLKA 5A4TA 3HAVA 3KA0A 4N6ZA 4A9SA 4YJQA 2WGJA 4M3QA 3T3UA 4F4PA 3FZTA 2XP2A 5E8ZA 1ZOEA 4OT6A 3E8DA 4DAWA 4C4EA 4EH6A 2Y4IC 4EYJA 3AOXA 4GT5A 4DCEA 3DKOA 2WOTA 3PXZA 3TNIA 2PE0A 5C9CA 3WZEA 4PX6A 4BI1A 2VWXA 2HWOA 2VNWA 3BLRA 5IEXA 1H4LA 4NU1A 4RVMA 3DAKA 3W33A 4AXAA 4DEGA 3KY2A 4K6ZA 4WG3A 4YC3A 5H8GA 4AFJA 3UZRA 4FYNA 2VO3A 1UKIA 2YABA 1TKIA 3R8LA 1UWJA 4A7CA 3GENA 3HLLA 1NVQA 1OVEA 2DWBA 5G6VA 3UMWA 2QHMA 4PL3A 3DLSA 4FKRA 4BR3A 2EWAA 2ZDUA 3QCSA 3K54A 2R3KA 4C3RA 3EYGA 3AG9A 3PFYA 4H36A 3PFQA 2UW0A 3EQDA 2W1HA 5AJQA 2CSNA 3EQCA 4APPA 3DK6A 3VW6A 3VUDA 2JC6A 3ZDIA 3SC1A 3NCGA 3FMLA 4NYEA 2YM7A 4DFNA 2YLEA 2IO6A 2JAVA 4A4OA 4NWMA 2IEWA 3VBVA 5KHXA 3SA0A 4L9IA 3EZRA 3GOPA 3Q2MA 3HUBA 3ZYAA 4DE4A 5C8NA 3VBQA 4M7IA 3GCUA 3TM0A 4FG9A 3KULA 4Y5QA 4RFYA 5CNOA 3AXWA 3GC7A 3HP2A 4BIBA 3ZZEA 3LXLA 2UW9A 1OGUA 3B2TA 2PE1A 4IDTA 5EG3A 3N4VA 1ZXEA 2BZJA 1I09A 4QTAA 3DPKA 4TWOA 4J7BA 4E5BA 3HKOA 4QMOA 4FIJA 5IEYA 2VO6A 2X7FA 3DDPA 3W2PA 2QOCA 4ZTNA 4U0IA 3LLTA 3MH2A 4BI0A 5ETFA 2HCKA 2UZTA 4PWNA 3RZFA 2V5QA 4IX6A 3TCPA 3R9OA 4BZNA 1UU3A 5CSWA 1H00A 4HZRA 2FUMA 3OC1A 2XAMA 1H24A 1KE8A 2XRUA 4GFGA 4KD1A 3O7LB 4D5KA 1G8SA 1DAWA 5BQ0A 2ERKA 1MRYA 3F88A 4AUAA 5T6KA 2X6EA 3LLAA 1OUYA 4ASDA 4KNBA 4S34A 4CSVA 5GIOE 2C0OA 2ITXA 1LEZA 2OZOA 4O96A 4YZNA 3TKHA 1YDTE 3CJGA 3LPBA 4JDJA 4KIKA 4BL1A 4R7HA 3TT0A 1FMOE 4FSNA 5FDPA 4R7BA 1Y8YA 3QLFA 5DE2A 5BUEA 3F82A 2V62A 3K3JA 3KMUA 3HV6A 3QTIA 4KS8A 4L67A 4QRCA 4QMZA 1YW2A 1PYEA 2VX3A 4IQ6A 2Z2WA 4W4YA 4I6BA 5L2IA 3W0RA 1JWHA 5K5NA 4F0IA 4FKUA 4BIEA 1ST0A 3QTSA 1FPUA 1OITA 4BDKA 3LE6A 2RSVA 4HYSA 3NZ0A 3ELJA 4EL9A 4EHZA 4R7IA 3DB6A 1XKKA 3O17A 4FV8A 3UPXA 4NTTA 4M8TA 2QU6A 3BLQA 3W10A 4XJ0A 4NKAA 4EQUA 3IW5A 3TZ7A 4YZMA 4YUQA 4ARKA 2YA9A 3OG7A 1Y57A 2B9FA 4JDHA 4F9AA 4QPMA 3A2CA 2PVKA 4Y73A 3NUNA 4YJSA 4CMTA 2P0CA 5AA8A 5K5XA 4ALWA 2R3HA 5EDPA 4JBOA 4MBIA 2I6LA 2WPAA 4KRDA 4BI2A 3NNWA 2PVHA 2PZIA 5FUTA 3O5AA 1WBTA 3Q96A 5JKGA 4XYFA 1H8FA 1KE6A 4EOQA 4D4RA 5CXHA 4DA5A 3ZCLA 2G2HA 3FZRA 4BKZA 3QFVA 4ITJA 1NVSA 2QVSE 4EHVA 2BIKB 3HRCA 2GTNA 3R7GA 3NUSA 4YJVA 3FZPA 4FUYA 3QLGA 5HE1A 3R7YA 5IQEA 4L8MA 2AEGA 3DNDA 4RJ7A 2EUFB 5D41A 3CBLA 3F2AA 4C3PA 1NY3A 4B8LA 4JAIA 4J96A 4OBQA 2W4OA 3EQPA 4Q5HA 2FH9A 4GIHA 2UW3A 1H0WA 1Z5MA 4ZZMA 4Q9ZA 3NWWA 1W7HA 3AC4A 4FMQA 2IWIA 4X21A 2XNBA 2DUVA 4IB3A 4M69B 3W2SA 2I0YA 1Q3DA 3OD6X 5CEPA 2XM8A 4ZTRA 4EBVA 2J51A 2PUPA 1MRVA 3ORLA 3TV4A 3UYSA 4CZTA 4OW8A 4FV9A 5CT7A 1YWVA 4E4XA 3DB8A 1W2CA 2JGZA 1YHVA 2WU6A 3QQFA 5FP5A 4M97A 3ZO1A 4BIDA 4MWIA 3G5DA 2R3JA 4HJOA 3UDTA 1WVXA 2CMWA 2H34A 1UU9A 4IX3A 4NIFB 4DITA 4KA3A 2QU5A 2UZEA 5DGZA 4BCIA 5KX8A 3BE2A 1UU7A 2A98A 5LMAA 3P4KA 3D7ZA 3RCJA 3PG3A 3WZJA 4QTDA 2WMXA 3BU5A 4R1VA 4UWYA 3R9HA 3MFRA 3F3UA 1BKXA 4FV3A 1M17A 2PE2A 4IHPA 5IF1A 3ZEWA 3IS5A 4QNAA 1G5SA 4IFCA 5BYZA 5HG9A 1H1QA 3NIZA 3VS3A 5EW3A 3QWKA 1RE8A 3ZFMA 2BAKA 4UWBA 5JFSA 4MWHA 3VUMA 3KIOC 5FWKK 4DHJA 3VUKA 4BCPA 4HOKA 2OU7A 3WOWA 5JQ5A 3LFAA 2BRNA 2YIYA 1ZRZA 3MA3A 5BMSA 1GOLA 4ZTHA 4NUSA 2W5AA 5TE0A 3E7OA 5DHJA 2O0UA 2P2IA 4MCVA 3VF9A 3MY0A 3NYVA 3VS0A 4FOBA 4O7RA 4I92A 5DYJA 1UNHA 4WNMA 2XK8A 3LQ5A 5HZNA 4RMZA 4EJNA 4BGQA 3RCDA 1TFFA 4DG2E 5HG7A 1ZARA 2PZ5A 2R4BA 3PDTA 3PRFA 5FBNC 4IB1A 3GFWA 4YJUA 4YHJA 3FZOA 4GJ3A 4KBCA 4X7QA 3W1FA 3H4JA 3NUUA 4CYJA 5I3RA 5CI6A 2QQ7A 4NCTC 4L53A 4WT6A 2XCKA 2PVJA 1JSUA 3QA0A 4U42A 5BVWA 2X4ZA 4IWOA 4HNIA 3UTOA 3ZO4A 4XLIA 2GQGA 4XOYA 2ERZE 1OPLA 3LCSA 3W8QA 1TQMA 3FZ1A 4GV1A 3UG1A 5CQUA 4IFGA 5AAEA 5GINE 2G9XA 4TYHB 4MXXA 3ACKA 4EHEA 3KULB 2X6DA 2Y6MA 2W9ZB 5CSXA 4DN5A 4C57A 2CPKE 3U4UA 3LIJA 5D9HA 2AUHA 1PXPA 3IONA 3KMMA 5HBEA 5CALA 4YU2A 3NSZA 4ZY6A 3TUBA 2O5KA 2BKKA 4DGNA 2WMUA 3NRMA 4Y83A 3OBGA 5CU3A 5HI2A 3ZFYA 4BBMA 3Q32A 3AKKA 3ANQA 2A0CX 4JDKA 4QOXA 4BF2A 2Y0AA 4F6UA 1M7QA 2VN9A 3G33A 1H25A 3MBLA 1R0EA 1FVTA 4KBAA 4FF8A 2XJ0A 3AC1A 4GK2A 3KXMA 4R5SA 3PVUA 3U55A 2QO9A 5AIKA 2IZRA 2OZAA 1WBNA 2YM5A 3ORTA 4AOJA 1OL2A 3KQ7A 3O8PA 3EHAA 3V5LA 4C2VA 1URCA 3QCQA 2G01A 3VNTA 4YSJA 4G5JA 4L00A 2C5YA 5KMMA 4JOAA 5M57A 4FL2A 4ZZOA 1B6CB 2KTYA 3KMWA 4JQ8A 3FMMA 4NSTA 4EZ3A 3L9LA 5CF5A 3DLZA 3UG2A 3AMYA 2H6DA 4M68A 3IDBA 5HTBA 3DTWA 3G6HA 5DMZA 1S9IA 5AP4A 2ESMA 2XAOA 1R78A 3A60A 3EKNA 1FINA 4OTQA 3KFAA 5ANGA 2GS7A 5DH3A 4FT9A 4U43A 5FRIA 4EONA 1BL7A 4ANQA 3GC0A 3DFAA 5A4LA 2ACXA 4OT5A 4U7ZA 3R02A 1E9HA 2B9HA 5AUZA 3RNIA 2ZV2A 5BVOA 3EL8A 4GKHA 2IVSA 2QURA 4RJ4A 4CRSA 5HLNA 2JKKA 2XKEA 5M06A 2VTJA 3TN8A 5HD4A 5HX6A 3AD4A 2UZVA 3UQGA 4G2FA 2WKMA 5AA9A 3ZLSA 5AR8A 2EXEA 3ETAA 1MRUA 2WTVA 2YDJA 3AGMA 3D2KA 4NM3A 4E6QA 2WQBA 2QO2A 2XK9A 1VLRA 3AT4A 3C4XA 1P14A 2V0DA 5E8WA 4EH3A 4PQNA 3CKWA 4HCUA 4YZ9A 5JGBA 5IEVA 4TPTA 3Q9ZA 2JFLA 4WSYA 3TJDA 3F3VA 4MXYA 1B38A 4FBXA 4YBKA 3QHWA 3R9NA 4O0XA 4O7LA 1OL6A 2QOOA 3F3TA 3VUIA 3GC9A 2E9OA 3TL8A 2C68A 5CZHA 4F1OA 4W4XA 3HMMA 2UW5A 3H0ZA 1Q8ZA 1H26A 4I21A 4BTKA 1QPDA 2XNGA 3CEKA 3Q4TA 4AZVA 3LXKA 4DFUA 1U54B 1Y6AA 3QU0A 4UALA 4A9YA 3UVQA 2XEZA 2OI4X 5HNBA 2QOHA 3UC4A 4X2GA 2VX1A 4O0YA 5AMNA 2B55A 4LUDA 3MIAA 2PMOX 3RK5A 4CTCA 4ZZNA 2PUNA 1FGKA 2GPHA 3QQKA 2W1GA 3BEGA 1G3NA 2XCHA 4FICA 2UW4A 1OIYA 3PJ8A 5FD2A 5I9YA 4C33A 4AFEA 2HELA 4FA2A 4IB0A 3K2LA 4FKQA 3TUDA 4W8EA 4JI9A 4RWKA 3PZEA 1SM2A 4EH9A 1Q8TA 4D4SA 2VGOA 3C0HA 3PVWA 5DT0A 5DEWA 2WFYA 4C35A 4F1TA 5AUUA 4CFXA 5CEMA 3BYOA 3LFQA 2WTIA 3RK7A 3TDWA 4NT4A 1PMNA 2HAKA 1XH6A 2ITPA 5HNGA 4C61A 3UJGA 4EOSA 1Q8UA 4RVKA 2R3MA 4GT4A 4QD6A 5AV3A 3HVCA 1W2FA 4DLJA 2R3FA 3WIKA 3PUFC 3L9MA 1W2DA 1WZYA 1KE5A 3ZUVA 3WE4A 4IM3A 2NNWB 3PA3A 3UDBA 4MQ2A 3N4UA 2B54A 3RGFA 1IA9A 4AA4A 1XH4A 3CIKA 4O86A 4I0SA 4MVFA 3GI3A 5CX9A 2YEXA 2H9VA 2RL5A 3OT8A 4HYIA 4MNFA 4LMNA 4UV0A 5A14A 4IE9A 1DS5A 1YXXA 2B53A 4AA0A 3R73A 4AT4A 3BZ3A 3NMUF 2JBPA 2A27A 2YZAA 3EN4A 3EYHA 4K0YA 4F65A 4DTAA 2I0EA 5DWRA 2OXYA 5ICPA 3R8ZA 2QODA 3RPSA 3VS7A 2F49A 1Q99A 3Q4CA 3FWQA 4YMJA 3MJ2A 3T8OA 4EHGA 5E1SA 3A99A 4FIEA 4DH3A 4AOTA 5C26A 3LKMA 3MN3A 2ZM1A 3CD3A 4GU6A 5IA1A 5I0BA 2OJFE 3C4EA 4QYYA 1FGIA 4ZS4A 1SYKA 3UVRA 4II5A 4AGDA 5A54A 2QO7A 5BNJA 4AZSA 3MH1A 4YPDA 4FSZA 4EK5A 2IVTA 2HZIA 3QTQA 3V51A 4E20A 4GJ2A 4DBNA 5EHYA 2PL0A 5B2LA 5HG5A 5C03A 4C62A 5HE3A 1P5EA 1FQ1B 4FTUA 4E5AX 4I5HA 2R3OA 4FT3A 2GHMA 1MQ4A 3E3PA 2Z8CA 3EQGA 4U8ZA 2BDJA 4IWQA 4EK8A 3UQCA 3EIDA 2R0UA 4LG4A 1CKPA 1PXIA 3PXFA 4FEWA 2OJJA 3CTJA 3I4BA 2ZMDA 4JRVA 3OXTA 2YLFA 1JBPE 4NKSA 4V01A 5M53A 2WZJA 4HYUA 4O7VA 3HDMA 3JVSA 4USDA 4HGEA 4ITIA 4CKIA 4CG9A 2X0PA 3FMHA 5J9LA 2WQEA 2JKQA 4YHFA 4O6EA 1OGYA 3PPKA 4G3GA 3Q3BA 3D5WA 1OZ1A 4GS6A 1PKDA 2JIVA 2O3PA 2YDIA 4G34A 1PMUA 4QQCA 4Y46A 5E8VA 3BWFA 3GU8A 3VBTA 4AGCA 3ZZWA 2W06A 3PPJA 1Y6BA 3B2WA 3E88A 4RVTA 5EYCA 4EUTA 1O6KA 1FVRA 4CFFA 3KN5A 5ETCA 1NXKA 3GGFA 4O4DA 2OWBA 4P2KA 4W4VA 4F7SA 1GJOA 3CPBA 5C8KA 5LVPA 1XMLA 2YM6A 2XK4A 3TNWA 2DQ7X 4WRSA 3D5XA 5IQIA 3W0OA 4MD7E 3L8VA 5LARA 5HG8A 4J71A 2C4GA 4IEBA 4TWNA 3BLHA 4EK4A 4R1YA 2C6IA 4FNXA 3HGKA 5KMJA 2JDTA 4DDIA 4QMVA 4WBBB 1W83A 1LP4A 4F63A 3V04A 4GFOA 4XV9A 5CF6A 3OEZA 4CFNA 5M4CA 4UMQA 3FHIA 3TDVA 3SQQA 3D15A 3VQHA 3R1SA 3D5UA 4O4CA 3EL7A 3Q6WA 4AGWA 3PIXA 3IQ7A 4IVDA 1Q41A 2F2CB 1ZLTA 2JKMA 3T3VA 1U4DA 5IMXA 4ZIMA 2BCJA 5L2WA 2O2UA 2ZMCA 3FMDA 3LFNA 4MX9A 5AR4A 4RWJA 4C58A 5I4NA 4F99A 4AACA 4BCGA 4MXZA 2H8HA 1XH5A 2FSMX 4FUXA 5AV4A 4XEYA 4IACA 1P4OA 4A4XA 4YBJA 2C6TA 4E4NA 1OBGA 4G31A 1H1SA 3W2QA 4O6LA 4ZS0A 4KWPA 1ZY5A 2EB2A 3FV8A 3QTRA 4GEOA 2I0HA 5D7VA 2SRCA 4X2KA 2C6EA 4YGAA 5LCKA 3U9NA 1REKA 3GCSA 3OHTA 3NLBA 4TNBA 4A9RA 4F7LA 3DXPA 4JXFA 3E63A 5FLFA 4DEIA 3W8LA 4BDEA 4D9UA 5IQHA 4FTJA 4BCHA 2PSQA 2X0QA 2IZSA 2V7AA 4K9YA 4FIGA 2RFNA 3RHKA 4FG7A 4UXQA 3CXWA 3ERKA 3MW1A 4YJPA 5HCYA 4KINA 5BX0A 3DZQA 3UOHA 3D2IA 4H39A 4S32A 5L6WL 1VYWA 1Q3WA 3QD4A 4AZWA 3UIBA 4QMXA 5HESA 4U3ZA 3V5JA 4OBPA 3ZUTA 1Z57A 4F9YA 4YLKA 5JGAA 3FSFA 3HUCA 4XS2A 4EQCA 2YCQA 1ZYDA 3QALE 3GU6A 3FYJX 4FGBA 2QOLA 2W1DA 3EOCA 2X39A 4XMOA 5DNRA 2XVDA 3IO7A 2KULA 3VULA 5B0XA 4ACHA 4KKGA 5K4JA 3GXLA 2OFVA 5L3AA 3S0OA 5ETAA 2VRXA 4ITHA 5HTIA 2VX0A 4LDTA 3ACJA 3MGYA 3MTFA 2VTOA 4IW0A 4LRJA 4PMSA 3BKBA 5DBXA 4CV9A 3BL9A 4MUQA 5DLSA 4F9BA 3QQHA 4LOQA 4K18A 2UW6A 2FGIA 3LW0A 4GMYA 5LJJA 3AT2A 2BUJA 5J7BA 3UE4A 1H1PA 3ANRA 2WTCA 1TVOA 1KV2A 2YCRA 4NTSA 5EW8A 3THBA 4QTEA 3SKCA 3EJ1A 4F6WA 3P1AA 5HQ0A 4ALVA 5L2QA 3KK8A 4AN9A 2R5TA 4IZAA 4HYHA 1UNGA 3MVLA 3C4WA 4EWHA 4CG8A 5BV3A 2WD1A 3IDCA 4IAAA 3QZFA 2OLCA 2YCFA 4U81A 3HMOA 4X3JA 4XG3A 3JPVA 1ZY4A 4JR7A 4W9WA 1YOMA 2W99B 4O7NA 4CT1A 3D83A 4OTRA 4C59A 4NIFA 5AUTA 5F20A 5JFWA 3KRWA 4F09A 1M7NA 3U6IA 2B4SB 2W05A 3K3IA 5HVKA 1UA2A 3RINA 3G2FA 4E73A 4CGAA 4BB4A 5KE0A 4DHFA 3AGLA 4CFWA 3KRLA 2C6OA 2GNFA 5I5ZA 3O71A 2IF8A 2R3RA 5EW9A 3DZOA 5HTCA 3GU7A 4H1MA 3DCVA 5C4LA 1IR3A 3CQWA 1ZAOA 2C6MA 2ZB0A 2R3PA 4IX5A 4RX7A 3DBQA 4XUFA 3QUEA 4EZ7A 4WNPA 4LMUA 4RLLA 3GT8A 3BYUA 5KBRA 4WA9A 3GFEA 3ZM9A 2CGWA 1TQIA 4AZTA 4J99A 5HX8A 4YLJA 3LMGA 1H07A 1YWRA 3PLAE 1JKLA 4FT7A 4JL9A 4YNEA 4CMUA 2ZAZA 4RVLA 4TL0A 4O2ZA 4BTJA 2VTLA 2YDKA 3PXYA 2JEDA 3MPTA 3MS9A 5DA3A 5HHWA 3DK3A 4TZRA 3DKGA 4XP2A 3FPQA 3ZONA 1JKKA 4GYIA 1IAHA 1YHSA 2ETMA 2QOIA 3V5QA 1URWA 2ONLC 3VWAA 4CKRA 5CAPA 3DBDA 2J7TA 2VD5A 4DH8A 5LMKA 5HD7A 3BYVA 4JS8A 3SRVB 5IQAA 4RBLA 5D12A 5CY3A 5ANOA 5AR2A 3W2RA 3Q53A 1JVPP 2GFSA 3BI6A 1TQPA 3GP0A 3PE2A 4M0ZA 4FNWA 5CQWA 3HV5A 3JYAA 3EFWA 3I0OA 5EDRA 5CEQA 2NO3A 3QTUA 2RKUA 3R22A 5I9VA 5JGDA 4NL0A 1KE7A 3DOGA 5LVOA 4ERWA 1KSWA 2PMIA 3ZH8A 2W96B 3RM7A 3TACA 3WYXA 2BZKB 3SDJA 4L6QA 3TNQB 2GS6A 5IA0A 5A6NA 4TYHA 3DT1A 4AXFA 2PYWA 3G0FA 5D11A 4CMOA 4QMNA 4LYNA 5DR6A 3NW7A 2J0KA 3OVVA 4BCFA 4C4JA 3UIXA 3FL4A 4ANSA 2JDVA 4I94A 1CM8A 1ST4A 5DT3A 4K2RA 3TV6A 3R8MA 4DLIA 2J5EA 4O2PA 3TZ9A 2JIIA 4BHNA 5CXZA 5JZJA 4G3DA 4RC3A 3FQEA 4DINA 3O7LD 2DYLA 4FRFA 1PXLA 5D1JA 4C7TA 4MNEB 2JDOA 3KCFA 1SVHA 4L46A 4J53A 3UIUA 2C0TA 3SLSA 5CF4A 3ZC6A 5CAVA 4U80A 3B8RA 2RG5A 5AIRA 4BYIA 3PIZA 1BMKA 2W1FA 4Y8DA 2CKPA 2XF0A 5CU2A 4O1OA 3PVBA 5IKWA 4PY1A 4HPUE 3A7HA 4K33A 3W0SA 4F7JA 2X8EA 1V0BA 4BGGA 4USEA 3PSDA 2PUUA 5C8MA 3CGFA 2X2KA 3ODYX 2FA2A 5EQPA 4FTRA 2Y7JA 4X3FC 4KIOA 2J9MA 1ZMVA 4KS7A 1GZNA 5DR2A 3U4WA 2NRUA 1L8TA 3BU3A 4U41A 4R77A 2IPXA 1QCFA 2ZB1A 3DA6A 4E6CA 2V22A 5LVNA 4PUZA 1E1XA 2J5FA 4QP2A 2IVVA 3ZEPA 4L42A 2WQMA 1O6LA 1PXMA 3QXPA 4AAYA 3DS6A 1LPUA 3AMBA 3EN9A 4WUNA 3MA6A 3UGCA 4GG5A 3S4QA 1VJYA 2ITZA 4GH2A 5M4IA 4QTCA 3A4PA 1ZOHA 1OPJA 3QKMA 2J50A 2UW8A 2UV2A 4DDGA 2ZV9A 5IUHA 4EK6A 4O38A 4FEUA 4O7WA 5CU6A 1CKJA 5M4FA 2XIRA 4YTCA 5BVFA 3FHRA 4C3FA 5LXMA 2VAGA 4HZSA 2VZ6A 3WZKA 2CNUA 3MVMA 4RC4A 4XH6A 4D2VA 3UIMA 5IU2A 3I60A 1H01A 5I9ZA 4AQKA 4ENYA 4RPVA 4BICA 2VV9A 1JSTA 2XB7A 1JNKA 4EK3A 4QMYA 1A48A 3IGGA 3KVXA 4KSQA 1MQBA 2UUEA 4RRVA 3UO5A 4IVBA 3L8PA 3OT3A 4OAVB 1WBSA 3W18A 4B4LA 5K0XA 2BTRA 3PG1A 2Z7RA 2Z7LA 3FLWA 3KRJA 3SVVA 4BDAA 3VJOA 4DYMA 3ODZX 3NNXA 2BDFA 3OXIA 4OUCA 2JBOA 3RWQA 3LFSA 5T68A 3A7IA 4E4MA 4FV4A 3BIZA 2PTKA 3QL8A 4MK0A 2FSLX 4DFZE 4ZLZA 1Q8WA 2A1AB 2UZBA 3KC3A 1GIIA 4FT0A 4XG8A 1Q62A 4AE9A 4C4IA 2IW8A 4S31A 4IANA 4G6NA 4Q2AA 1U54A 3RI1A 4J1RA 3LXPA 2ZM3A 2C3KA 3EH9A 2VTQA 2CDZA 4IAIA 5HICA 3R7VA 2IVUA 2Y4IB 3KREA 4QEBA 5GIPE 3MFUA 4J95A 4L68A 2W1CA 2HIWA 4QP9A 4FTTA 4BBEA 4OTWA 4BCJA 3KKVA 5HEZA 2V55A 3VS4A 1FBNA 3ZO3A 2WB8A 4FL3A 3O51A 3AC8A 2W7XA 5LVMA 5AM6A 2QOQA 4BDBA 4RA4A 3QX2A 2VTNA 2CGUA 4FTNA 4DC2A 4XG4A 5A6OA 2ZYBA 4O91A 1YXUA 2YJSA 5ANEA 3H9OA 2P4IA 3PTGA 3R71A 4I6FA 2PVFA 3OFMA 1QMZA 4UBAA 3DV3A 4AA5A 4E6AA 5HO8A 5L6PA 4BVUA 3TNHA 2WNTA 3DAEA 2PU8A 4PMMA 4FKOA 4TW9A 5IDPA 3KK9A 5M07A 4NCTA 4BJJB 5H9BA 4ALUA 4L43A 2XYNA 4X0MA 2OKRA 2YZLA 4DBXA 2Y4PA 4IAFA 2NYAA 3P5KA 2IN6A 4YZDA 5HNIX 2W9FB 3FI2A 2YERA 4E1ZA 5E4HA 2VO7A 3K5UA 3KXZA 3ZRLA 1YWNA 1WBPA 4H58A 4OR5A 4ANBA 4GT3A 1R1WA 4B7TA 3UNZA 3SXRA 3OWLA 1OIUA 1WFCA 2VWVA 3FMJA 3CJFA 4EC9A 4MAOA 3BGZA 1ND4A 3ID6C 3RPOA 2CJMA 4LI5A 5HO7A 5KCVA 2RFDA 4FVRA 3ORIA 5BYYA 2HZNA 5FXRA 4EOIA 2WEVA 2Q0BA 2RFEA 4GK3A 3B8QA 4TY1A 3SW4A 2GCDA 5KMOA 4QYGA 4X2FA 3EQRA 3OTVA 4FTMA 4QP1A 4FZ7A 4JG8A 3QX4A 2W5BA 4AZEA 3V5PA 3UOLA 4AW5A 4ZXTA 4AAAA 2BROA 3QQLA 2C30A 3E8NA 3P78A 4WG4A 4E6DA 4RIWB 5EQYA 2C1AA 4OTHA 2C6KA 1GZKA 2GTMA 1H1RA