4L3PA

Crystal structure of 2-(1-benzothiophen-7-yl)-4-[1-(piperidin-4-yl)-1h-pyrazol-4-yl]furo[2,3-c]pyridin-7-amine bound to tak1-tab1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
308
structure length
295
Chain Sequence
b'GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 295
sequence length 308
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l3pA01
3OC1A 1TQIA 4ANOA 2P3GX 3TI1A 4BGQA 5IH4A 4DG0E 4CV9A 3KULB 4JX3A 4YBKA 3UIBA 5F4NA 4IAZA 1OUKA 3NW5A 3ORKA 4C4HA 3FKOA 2QNJA 5BUEA 1XWSA 5CEMA 2PE1A 4OTHA 4R3CA 4D9TA 2Q83A 1FVTA 1Q8TA 1RJBA 3CP9A 4G17A 5AUWA 3WILA 3LCKA 3D7TB 3BQCA 3MIYA 4UN0C 3TNPC 2GTMA 3FMDA 5HE2A 2ZM1A 1V0PA 4RIXA 3TUDA 3GC0A 4G3DA 1Q99A 3TNWA 5AA9A 4QTBA 4LQMA 2BIYA 4QP1A 5HIEA 4QP8A 4YJQA 4AT4A 4B6LA 3OTUA 2VZ6A 4U81A 4QMUA 4RVKA 3ZUVA 4F08A 3IO7A 3ANRA 3QRIA 2ITYA 3TZMA 5C8KA 3Q5ZA 4I5HA 4BCKA 3E8DA 3W2OA 4TXCA 3NCZA 1UNLA 3F2AA 4OTQA 4WUNA 4RT7A 1JKLA 5CU0A 1YDRE 3G90X 1XKKA 2WO6A 3NUSA 4B0GA 3DZQA 5IQBA 3W16A 2XYUA 4QQTA 3UZRA 4CXAA 5DBXA 4FYNA 2F49A 5F9EA 3EHAA 5H8GA 3PY0A 1YI3A 3C5UA 3KK9A 5FXSA 3VBQA 2XK6A 4NM7A 2C69A 4CMUA 5A4EA 4ZMFA 1M2RA 3ZDUA 3SX9A 3OW4A 2JKQA 5AP6A 2C6EA 3VRYA 4GSBA 1O9UA 5CAPA 4IW0A 2ITQA 4EH4A 3PP1A 4TT7A 2PUPA 5JGAA 5E8UA 4NTSA 4O0SA 4PUZA 2GFCA 5BX0A 1ZXEA 4FV7A 1PXPA 3TEIA 2WU6A 3ZCLA 4FTNA 3KRWA 5JQ8A 1Y6BA 3C0GA 3ORMA 4O0YA 1K3AA 4UYAA 3RHKA 5FP5A 3V04A 1JWHA 1Y8YA 3GNIB 5E8ZA 1DS5A 3U8WA 2B0QA 2DQ7X 4B99A 3R7UA 4BCMA 4UWBA 4IWQA 2LAVA 5EI6A 3DBEA 5AV3A 3R7GA 4O7RA 3EZVA 4YSJA 4RLLA 4XG7A 2V0DA 4BDDA 3A7FA 5I5ZA 3ZEPA 3VRZA 5BUJA 5FP6A 2J0LA 3FI3A 3D5VA 3G0FA 3GFWA 4RC4A 4XV1A 3WZUA 2AC5A 2WMVA 2EB3A 2ZV8A 3V5JA 3ZS5A 5CF4A 3UE4A 1UNHA 2FSLX 4O2PA 4QP7A 4CFWA 3U6HA 2G9XA 2YCSA 1CSNA 3VUGA 4NIFB 2C0IA 4UZHA 2YIYA 3DZOA 5DVRA 2O8YA 4IACA 4WG5A 4C33A 4DEIA 5IPJA 4FG9A 2A27A 1XJDA 2ZYBA 3VS0A 2Y6OA 4ANSA 4FICA 4FOCA 3R6XA 4C4IA 3R9HA 5K5NA 4L67A 5HIBA 2IVVA 3UG2A 1Q3WA 2QOQA 4G9CA 2Y9QA 1P5EA 3ELJA 3LFCA 1WBVA 3CGOA 3E63A 4GG7A 3L8SA 4MF0A 5DMZA 3NAYA 3QQLA 4P5ZA 5EYDA 3QGWA 2VX0A 1VZOA 3QAME 3OEFX 3OEZA 3P1AA 1H24A 5IU2A 3PXQA 3A61A 5E8VA 4EBVA 3T9IA 4O86A 4AGCA 3BHYA 3QD2B 2Q0NA 3NNXA 1JAMA 2CPKE 3LFEA 2E2BA 4GJ2A 1M17A 4S2ZA 4C3PA 4ZXTA 2XRUA 2PMOX 2X8EA 3PP0A 4UMUA 4J1RA 1V0OA 5FDXA 3RAWA 2XK8A 3ZSGA 2VO3A 2ERKA 3LLAA 4ALUA 4EH2A 4FEUA 3ULZA 3MH3A 4BZNA 4KNBA 2FSOX 5HICA 4MXXA 3R73A 1ZYLA 4TL0A 4BCPA 5A54A 1ZOHA 2YCFA 3GU6A 3RALA 2J5EA 3U51A 4QNYA 3C4XA 2P2IA 3PRFA 5JN2A 3FMLA 4FL2A 2WPAA 3F5XA 4PMTA 3AC4A 5AIKA 1H28A 1LR4A 3HMIA 2ERZE 3JVSA 3MA6A 4JT3A 4OTGA 1TVOA 2REIA 4RGJA 4JDHA 3RCJA 5GNKA 3SXRA 5I9YA 5C27A 5AV4A 5IQDA 5C1QB 3FPQA 2QO2A 3R22A 4NM3A 2C1BA 3ZUUA 5EHYA 2VWIA 4CMTA 4O7TA 2OF2A 1P4OA 3L8VA 3LVPA 3P78A 3MTLA 4I0RA 5ANEA 3ZH8A 4LV5A 4EQUA 1WVXA 5AUYA 4EHEA 1UU8A 3ULIA 4FV6A 2FA2A 1KE6A 2JDOA 1IAHA 2YM5A 3EKKA 3COKA 4YJOA 5CVHA 4G34A 1Q8UA 4EOQA 3CJFA 1OB3A 3ROCA 2OH0E 1U59A 4QYFA 1VYZA 3NVMB 3A7GA 2VTOA 3FLWA 4QMZA 4K1BA 4P7EA 4YZDA 2XIZA 3R7YA 1BL6A 1KV1A 3NR9A 3PJ1A 1FQ1B 4M84A 5E7RA 5EI8A 3DXQA 3BWFA 5CF5A 2XIKA 4FNYA 4J98A 5CU4A 3Q4CA 3JR1A 3CTJA 5HCYA 3FKNA 2IN6A 3NUPA 2C5XA 1O6YA 3EFKA 4XV3A 4FA2A 4XG9A 2PZ5A 2VO6A 2QODA 1OECA 4ZZMA 3FZ1A 4ARKA 5HE3A 1JQHA 5L2SA 4ZTMA 1R1WA 3DGKA 3KMUA 2PZPA 2B9IA 3FWQA 3P7CA 4IWDA 2BAJA 4TNBA 3ZRKA 4PP7A 5IUHA 4FK6A 3FZTA 5HHWA 2WZJA 3VS6A 1R78A 4BCOA 4QMPA 2GHGA 4YTFA 5ICPA 4HGEA 4C2VA 4RA5A 3NMUF 4UMQA 4ACCA 1UWJA 3BPRA 4BIEA 3AOXA 4JDIA 3RK9A 4F70A 3LMIA 2VWBA 2JDSA 3ORIA 3OWLA 2BZKB 3HL7A 2EVAA 4HYUA 4L68A 2XNGA 5EKOA 2YIQA 4JS8A 4GFMA 4IAYA 4ZLZA 4X6RA 4JI9A 2JKKA 4NKSA 4YZ9A 4BI1A 3MB7A 5CU3A 3FDNA 5AMNA 4C61A 2W0JA 3EB0A 4E5AX 4X2NA 3V5TA 4A4XA 2PY3A 4GUBA 3N4VA 3FQSA 2UW9A 3C1XA 4L45A 4ZTRA 3KRLA 5FM3A 5IH5A 4I6QA 4ACHA 4D4SA 4GK2A 4LFIA 1URWA 4F9BA 1BI8A 2Z7RA 3LQ5A 3KCFA 4KBKA 4PX6A 4QMWA 4QMSA 4M7IA 4PTCA 4ZLYA 4J7BA 3PJ2A 4V05A 4CZTA 3QYWA 2QOOA 2XNPA 3HUBA 3I60A 2OJ9A 3GI3A 4LUEA 4FTUA 2GNJA 1ZY4A 3UZPA 4Z55A 2PWLA 5L8LA 2WTWA 4N0SA 3ZC5A 3E3BX 2GNGA 5DOSA 2BILB 4A9YA 4LMNA 3ETAA 4L3LA 3ANQA 5HE1A 4IVBA 3ACKA 2XJ2A 2YWPA 4PP9A 5FM2A 3HECA 4FF8A 2FB8A 4X2KA 4LM5A 4ASDA 4YTCA 4C8BA 2VO7A 4LUDA 5CI6A 2CGUA 4WNPA 2UW5A 2X6EA 4ZSGA 4D4VA 5AWMA 3EYGA 5AP3A 4FIHA 4EC8A 4JX7A 2J90A 4QQCA 4W4WA 5CWZA 2PMLX 3UOLA 4LYNA 3RPVA 1YHWA 1RDQE 1Z5MA 4M15A 3D2IA 4PPCA 3TIYA 5I9VA 2QOKA 5KZIA 4DH7A 1YXXA 3QA0A 5L8JA 3DBQA 3UGCA 4OLIA 5FWKK 1MQBA 2QC6A 5B0XA 5KZ0A 3KMWA 4JG8A 3V6SA 1WBTA 4AW1A 2VGOA 1OIRA 1OKZA 2XB7A 4FKUA 2IPXA 5HG7A 4FG7A 4U43A 4IANA 4EH5A 4DBXA 3SRVA 4FIJA 5CEIA 2PUIA 3FZOA 4Y46A 4UALA 2RGPA 3G51A 2OIQA 4YBJA 4GKIA 3PE1A 2C6KA 4DH3A 4U41A 4W8EA 4ZTLA 1JSTA 5CEQA 3UG1A 4HJOA 4CFMA 5I9UA 1IA8A 3JY0A 4TWPA 5I9WA 4PDYA 5BNJA 3F69A 3POOA 4UV0A 4C62A 3NNWA 4RX9A 2GDOA 3PIZA 3QXPA 4LL5A 2XKEA 5AP2A 2OF4A 4O0XA 3VW6A 5LQFA 3VUKA 2ZV9A 2R3IA 4EK6A 1KV2A 5DR6A 4FZ7A 5EI2A 2C3IB 3P9JA 2IO6A 3T3UA 1MUOA 2X7FA 3W32A 1W7HA 3NYNA 3A7IA 4A06A 3TJDA 4G6LA 5ANKA 4QPMA 4U8ZA 4UBAA 4XNEA 2JKMA 3ZTXA 5LWNA 1YWRA 2XKFA 4X21A 1PXLA 2BROA 2XIYA 5I3OA 3EOCA 3W33A 4F09A 4ACDA 3PXKA 2WIPA 4KSQA 2W1GA 3HEGA 4C34A 2O65A 3VBVA 2GMXA 1H27A 5CSXA 3Q52A 2W1FA 2PMIA 4E4LA 4CKJA 3EJ1A 2NPQA 3FJQE 2JDTA 2O63A 4WKQA 1KE8A 1E1XA 4JNWA 4C4GA 5BMSA 1ZOEA 3ZMMA 3RK7A 3NUXA 3PXYA 1YWVA 4MXCA 4BDFA 3ZLYA 1P4FA 3FLSA 3M42A 3DB6A 3PG1A 4L52A 3VS2A 3OMVA 4HNIA 4DEBA 5FTGA 2W1DA 2CCIA 3U6JA 4NSTA 3PLSA 1U5QA 3U4WA 3MWUA 1IASA 4MWIA 4FEVA 2YZLA 3BGZA 5ACKA 3CKWA 4P90A 4D1XA 1ZMUA 3QA8A 4YC8A 4FTJA 3V5QA 4FTTA 4E3CA 1H01A 1W0XC 3NEWA 4MF1A 3RGFA 3FKLA 4FKPA 4CLJA 4JBOA 5CZIA 3GBZA 4XG3A 4XLIA 2OZOA 3EL8A 5HD4A 4IFGA 3HAVA 4ORKA 2GU8A 5K0KA 3ORNA 2EXEA 4C37A 1WFCA 3DB8A 4AOIA 4IC8A 1LUFA 3Q9ZA 4IX4A 3MY0A 2F7XE 2W9ZB 4IHPA 4OTWA 5KX8A 4D55A 3CQWA 3I81A 5EYKA 4JVGA 4UMTA 5FTQA 4FG8A 5CSWA 4QMMA 1MRVA 4FKVA 3QTIA 2WNTA 5EDPA 3OXIA 1I44A 5TT7A 3QX2A 4BBFA 5JT2A 4I21A 4XHKB 1REKA 4RIWB 1FPUA 3NPCA 4O96A 4JQ7A 2VTPA 3BLRA 2C0OA 4CQGA 4CTBA 4QP6A 2X0GA 1JNKA 2ONLC 4PQNA 3R0TA 3MH1A 4GT5A 1YXSA 3VIDA 3BLHA 3EN4A 2C6OA 3IW5A 3CPCA 1OPLA 2F2CB 2WIHA 4KKEA 5F94A 3OWKA 4MTAA 4QP2A 3VAPA 3ZZWA 4Y73A 3DK6A 4PNIA 1SNXA 4CSVA 1HOWA 4G3GA 2OXDA 4O7WA 2YIXA 3Q6UA 4QTEA 2YFXA 4I3ZA 2JDRA 4N6ZA 3R21A 3HMNA 3R9NA 4AU8A 3HP2A 3LFBA 2UUEA 4GVAA 5BUIA 5IEYA 3VBTA 3IQ7A 3M1SA 4IIRA 3VUHA 3RZBA 4CGAA 1KE7A 4NCTC 3E8CA 4FSQA 3CEKA 2XM9A 4M66A 5AP7A 4HCUA 4WUAA 5HU9A 4OUCA 3LFNA 3I5NA 5M4UA 2YAAA 3KRRA 5ANJA 5EYMA 3PVUA 3I4BA 2RFDA 4FZAB 5EM8A 2FSMX 4ERKA 5IMEA 3DT1A 1JVPP 3BYVA 3V8TA 4BL1A 3R9RA 3R7EA 5FG8A 4QO9A 3D15A 4FC0A 4GRBA 4YJNA 4CMOA 4O0RA 3Q4TA 3RBWA 3V5WA 1ZARA 3G0EA 3SXFA 4D1SA 2OJJA 2XNMA 5HBEA 2RFSA 4MNFA 4O7NA 4DEDA 2HIWA 4CYJA 4V0GB 4BDBA 1ZMVA 4WIHA 2IW9A 3I0QA 3QLGA 4CRLA 3NRMA 4TTHB 4X7QA 4LV8A 1CDKA 4WSYA 1Q5KA 4KB8A 3MY5A 5C4KA 3WIKA 3MESA 2UW6A 3WYXA 3QQJA 2QO9A 4QP9A 3RPYA 4BDGA 4C4EA 3QQUA 4R1YA 2YDJA 5A9UA 1Z57A 2IZSA 3ORLA 1OIQA 2V55A 2VTHA 3FUPA 5F95A 1J1BA 4CCUA 5E8XA 4GFGA 4ZSAA 2GQGA 2BALA 3AQVA 2H96A 1KOAA 4QP4A 2OLCA 3KVXA 3ET7A 5IZFA 4KIKB 3ZFXA 1YVJA 4DTBA 3MS9A 1BMKA 3C4CA 4JR3A 1GZKA 2XNEA 3O96A 4HW7A 5AR4A 4TYHA 3DTWA 3DDQA 1M2PA 2KULA 4H58A 3EN7A 5I9ZA 1TKIA 3GU7A 3GUBA 3TZ9A 1NVQA 4QYYA 2XVDA 4FTAA 2QU6A 4YJSA 3RI1A 4KIOA 2WTKB 3PPJA 5E1EA 3Q9WA 3QXOA 3ACJA 3IGOA 3OXTA 4B4LA 4FT7A 4YPDA 4U9AA 2C5OA 2ZM4A 3EN5A 4K33A 3ZHPC 1X8BA 4O91A 5I4NA 4NM0A 2EU9A 2PHKA 3KF7A 4DEAA 4L8MA 2EB2A 3K3JA 2BFXA 1OZ1A 5L8KA 1WVYA 4B8LA 3L1SA 3EQIA 3QCYA 3PWYA 4PL5A 3SW7A 4XRLA 3E88A 3OWJA 2NP8A 3VVHA 4PL3A 3FAAA 4I92A 4WRGA 3BHTA 4FIGA 4C02A 4E6AA 1BKXA 2J0JA 3R9DA 2NNWB 5CF8A 4FV3A 4C0TA 5KMLA 4UWYA 4MXAA 3A8WA 3UNJA 1JPAA 2R3HA 3FQHA 2Z7QA 4WT6A 4FZ6A 4M13A 5CNOA 1Q4LA 3QBNA 5DIAA 3VQHA 4M69A 4TKSA 4C57A 4X3FB 4AUAA 3K2LA 4G3EA 4EOMA 4AZTA 2WTIA 4XV2A 5M4FA 4GFOA 3UO6A 4HVHA 2WMTA 3PJ3A 3WBLA 1URCA 2BRMA 4IE9A 5FBNC 3F66A 4BDHA 2IVSA 4ITJA 4BDAA 2VGPA 3BU3A 3HRFA 2W05A 3NYVA 4GMYA 4X2GA 2YEXA 3BE9A 5CI7A 4C35A 3KU2A 3V5PA 3OROA 5FBOA 4F7NA 2XP2A 3FZSA 3W2SA 2UW7A 5J87A 5LMKC 4AP7A 2VV9A 2PVJA 4WOVA 3W2PA 5KKRB 2F7ZE 3WZKA 5FTOA 5AR8A 4BCQA 4MK0A 3I79A 2XF0A 3OHTA 4D9UA 2CGVA 1XH9A 2X9EA 5ANDA 2BPMA 3P08A 3SC1A 3VHEA 2CLXA 3A2CA 1UA2A 1ZLTA 2Q0BA 1GIJA 4G5PA 4D2VA 4UMPA 4MEDA 4RJ5A 3RVGA 3ZDIA 2B7AA 2CGXA 3U54A 4QNAA 5EDQA 2UZEA 2EXCX 4PPBA 3WF9A 4EUTA 5J95A 5M4CA 3AMBA 2WTDA 2ZV7A 4ITHA 5JFWA 3HP5A 4MNEA 5AP0A 5IA2A 3QTWA 1J3HA 5IKWA 4IWPA 1PMEA 4E20A 3NW6A 4RMZA 2WHBA 3EH9A 2Y7JA 5L2QA 1CKPA 4C58A 3UOJA 3BZ3A 3PY3A 2PVNA 3LM5A 3CKXA 3N51A 1JBPE 4M8TA 1P14A 3QKKA 1AD5A 3BIZA 4IX3A 5HBHA 3WI6A 3WZDA 4YO4A 2OK1A 3EIDA 1NA7A 1JOWB 1MP8A 4WRSA 3UMWA 3GB2A 3QQGA 2R9SA 3FYKX 4F1TA 2YITA 5ANIA 2VWWA 3MB6A 5KMOA 4GVJA 3LFQA 4J97A 4GYIA 4O6EA 2XEYA 2UVYA 4RJ7A 4EWQA 3F3WA 3Q9YA 4YLKA 4ZK5A 1PYXA 4BI0A 1L8TA 3PJCA 2XK9A 3R63A 2E9VA 2CCHA 3I1AA 4FNXA 5CAUA 4BBEA 2VTAA 3BKBA 3MPAA 4I24A 5BVEA 4OBOA 3F7ZA 4KWPA 3VJOA 3HV3A 2Z7LA 4MBIA 4ASZA 3GP0A 5IMXA 4EOPA 5AUTA 2C3JA 2OZAB 5IQAA 3VS7A 1SVHA 3DNEA 5JMSA 3ORXA 3DJ7A 5I0BA 2B9HA 4RPVA 5BYZA 2XA4A 3P79A 4RA4A 1DI8A 2FUMA 4BWKA 4NZWB 4O2ZA 3V5LA 3UIUA 4Z7GA 2FSTX 5L6WL 3HVCA 3HMPA 5AP1A 4R78A 3VS1A 1IG1A 5KMMA 5ANOA 2C6TA 2VO0A 5IF1A 5GZ9A 3S95A 4G31A 4YMJA 5JFVA 4J71A 4QD6A 4AE9A 3O0GA 3FSKA 5HE0A 3FC2A 4PMSA 3W8QA 4FEWA 3HMOA 4CT1A 3HNGA 2OIBA 3KCKA 3PA3A 5EYCA 4A7CA 3DFAA 4CCBA 4GU9A 2XIRA 4E93A 2ZB1A 3HA6A 4KUJA 3D4QA 4FSNA 2PE2A 4DFYA 2C0TA 4M0ZA 1ND4A 5TE0A 2R64A 4ZJIA 2C6IA 4O0TA 2XJ0A 5TKDA 3Q5IA 3TUBA 4ENXA 3SXSA 2F9GA 3POZA 4TYGA 1NVRA 4RWKA 4I94A 4EEVA 4D2TA 4O84A 1OI9A 2X2LA 3EN6A 4RQKA 3LCTA 3PWDA 3R04A 5HORA 5IH6A 2DWBA 1QPEA 4CZYB 2FH9A 3ODZX 4PL4A 4D5HA 3QZFA 4W4XA 3F2RA 3LXKA 5LJJA 2PYWA 2B53A 3KL8A 3EZRA 5M07A 4E6QA 3P7BA 3DXNA 3SD0A 5HBJA 1XBBA 4BN1A 2ZJWA 3TKHA 3LCSA 5A14A 2WGJA 3KVWA 4FT3A 3DBCA 4U6RA 3ZLXA 3C5IA 3DLSA 3E62A 5JZNA 3N4TA 5IA4A 2WQMA 3BHUA 4AT5A 2PVHA 4H39A 2GTNA 5DLSA 1OKYA 4BKJA 5AV1A 1OPJA 2XYNA 3MVHA 3UYTA 5IG1A 3DAKA 3D5UA 3MJ2A 4NK9A 4WNOA 2FVDA 5HIDA 4QPAA 2BMCA 2CN5A 3M11A 3DY7A 3OW3A 4WNKA 4BR3A 4NW5A 5ETCA 2OBJA 2IW8A 4F9WA 4IBMA 3TDWA 3KXMA 4FTKA 3MPMA 4YZCA 3BX5A 3QZIA 4I4EA 2P0CA 3R71A 3F61A 4ANNA 4B9DA 4QPSA 4RIYA 3AD6A 3ODYX 2C1AA 5EOLA 4DEEA 5EOBA 4F6WA 1IEPA 2XIXA 4EYMA 4QMQA 3F5GA 4NEUA 1Q3DA 4ZZNA 4JBQA 1DI9A 5EM7A 4JR7A 4D4RA 2BRHA 2YA9A 3KREA 4X6QC 1S9IA 3BV2A 2PMNX 3VBWA 4H05A 4LMUA 4USDA 1G8SA 3D5WA 5AM7A 2VNYA 3KULA 3AT2A 4HPTE 2WEIA 5HG8A 3RHXA 3FBVA 4K2RA 2ACXA 4FKOA 3II5A 5HQ0A 4FSMA 3RTPA 1FGIA 2CKPA 1FINA 3F3TA 4FKSA 4NKAA 3G15A 3NNUA 1U54B 5AUZA 4AXAA 3QTQA 1XH8A 4O1OA 4NU1A 3D9VA 5KMIA 3DQXA 4M0YA 3BCEA 5AV2A 4AGDA 5CU6A 4DGGA 4JG7A 4JRNA 5JH6A 2ZMDA 2YLFA 3G6HA 4FV9A 5EW9A 1R0PA 3O23A 3K3IA 3DKFA 3TL8A 5AX9A 5DT4A 3QD4A 3ZBXA 1XHAA 4QYHA 3QX4A 3EQCA 4EOJA 2BTRA 4BGHA 2W1EA 1FOTA 4DTAA 4W4VA 1PHKA 3QUDA 4W9WA 2B54A 4BYJA 2CGWA 3JPVA 4BYIA 4AA0A 1VJYA 4TRLA 2X7OA 2IZTA 3GQIA 3CD3A 4U3ZA 3W8LA 3BEAA 3ZUTA 5A6NA 3LQ3A 3UZTA 1H8FA 2JBPA 4AF3A 1PXNA 2ONLA 2C6DA 4HYSA 5L3AA 4UXLA 4BVUA 3LFSA 2JD5A 4G5JA 2CJMA 3VJNA 2OWBA 4KS7A 3GU5A 3NCGA 4RWLA 3AD5A 2RFEA 2HELA 2R7BA 3D5XA 4YHFA 3WF8A 4BKZA 2BDWA 5AM6A 3F82A 4IDTA 1NW1A 2G01A 3Q6WA 3CY3A 5I9XA 2W1CA 4RJ6A 2WKMA 3P86A 2ITUA 4HVSA 4PY1A 2OFUA 5AJQA 4RJ4A 3GCSA 1YQJA 4TZRA 1S9JA 4NCTA 2J0MB 4BWPA 3GXLA 4FSZA 1BL7A 2JDVA 2W4KA 4L01A 3HMMA 3BU6A 4IX5A 1OM1A 4Z3VA 2IG7A 4HGSA 2PUNA 4N4SA 3FPMA 4DHFA 4OGRA 2WAJA 3MFSA 4PWNA 2PE0A 3ZXZA 3PZEA 2AYPA 4AG8A 1J7UA 3EMGA 3GC9A 3O2MA 2BZIB 1F0QA 2J9MA 2W06A 3OP5A 2X7GA 4K11A 3DK3A 5AAFA 4EOLA 3QC9A 3MDYA 4GG5A 2VX3A 5JQ5A 5IQIA 4Y83A 4EZ5A 4R7HA 2Y4IB 4YC6A 3FXZA 3GENA 4WO5A 4R8QA 5HVKA 4FL1A 3E7VA 3PG3A 2UZLA 4BCIA 2J5FA 3W2RA 4U42A 2VUWA 3F7WA 5GINE 1PF8A 4L3JA 4FNZA 2YCRA 3K5VA 4ZZOA 4USFA 4GKHA 4F0IA 5M08A 3BYMA 1GZNA 3DS6A 4FI1A 4PV0A 4ZS0A 4XJ0A 3V01A 5HG9A 1PMNA 1H1SA 1FBNA 3RPRA 2GS6A 5EQEA 3ZRLA 3JVRA 1WAKA 3PFQA 1UU9A 2ZAZA 2QCSA 3PSCA 5FDPA 5EHLA 4J8NA 3HRBA 1YHSA 3UQCA 5HX8A 3H30A 5DR9A 4FSTA 1XBAA 2F7EE 3AC3A 4ACGA 4LL0A 5GJFA 4AA4A 5B7VA 1WBNA 5DGZA 3VUMA 5LVNA 5J9YA 3OTVA 3MN3A 3C4WA 3LKMA 3D14A 3QZHA 4AGWA 3IDCA 2R7IA 5E8SA 5E91A 5IA5A 5HD7A 1QPDA 4BTFA 1WZYA 4YZNA 5J5TA 5CEKA 2C5NA 4R5YA 5A46A 2Z02A 4IQ6A 4F6UA 3R00A 4JDKA 3CGFA 3F2NA 4HGLA 3A4PA 4I41A 3PYYA 2X9FA 4FV8A 4AZWA 3HLLA 4L44A 3P4KA 4BIDA 5EKNA 2IVTA 1ZYSA 4FTQA 3CTQA 4M12A 3QQFA 2WFYA 4AQCA 4H1MA 2YABA 2R3MA 2QR7A 2WTKC 3DU8A 4YZMA 2ZDUA 4RZVA 4EL9A 4RFYA 2UW3A 3A99A 1ATPE 1YI6A 3I0OA 3MW1A 4O81A 4KBCA 1H1PA 2EUFB 2ETMA 3W2QA 2UVZA 3QD3A 5CSHA 3L8XA 2WQOA 1F3MC 3AG9A 2WTCA 4QMXA 4R7BA 5LCKA 1GAGA 4C7TA 4D2WA 4ZAUA 2HCKA 1Y91A 4JIAA 4EZ7A 4CFFA 4C3FA 1PXIA 1Y57A 3NSZA 3HDNA 2QD9A 5KE0A 2ITZA 4E8AA 3OT8A 4C59A 3VBYA 2XRWA 2I40A 3GVUA 4GS6A 4IDVA 4MQ1A 3QQHA 3VNTA 4F1OA 2OXXA 3JUHA 3FY0A 4Y5QA 5A4TA 3TNIA 3ITZA 3Q9XA 3LPBA 3JXWA 4K77A 1WBOA 5E8YA 4A9SA 3U9NA 3L9LA 1WMKA 5JGBA 2YJRA 5LMKA 3I6UA 4FKWA 3DJ6A 5FEDA 2W5HA 2CHLA 4AN3A 5A4LA 2X8IA 5CNNA 4O7SA 3NVKI 4GK4A 2WMBA 4F7SA 2NRYA 2UW4A 5ANGA 2HW7A 2QG5A 4MXYA 3O17A 3T3VA 1XH5A 4H36A 2C4GA 5KKRC 1Q8YA 2RSVA 2WU7A 3UC3A 2OKRA 4GL9A 4F63A 1H0WA 3L9NA 4J95A 4K9YA 4EQMA 3FLYA 2RG5A 5CSVA 4EWHA 4LOOA 4FTLA 4Y72A 3BBWA 3C13A 4TY1A 4MYGA 4IX6A 2GSFA 1XH4A 1ERKA 5DT0A 5CXZA 5GIOE 3OY3A 2UZOA 5G1XA 4FVRA 3E8NA 4FKQA 3EQRA 1YHVA 4FTRA 4E7WA 3C9WA 5LARA 3ZC6A 3MY1A 3TKIA 5HO6A 4F6SA 3V8SA 5IQFA 2VWZA 3ORZA 3ALOA 5H8EA 1WBSA 2PVFA 2GNIA 3NX8A 4IJPA 1YRPA 3NLBA 4DFUA 1OBDA 4N6YA 2BUJA 3DXPA 4YHJA 1JKTA 2PU8A 4UY9A 2B1PA 3BV3A 2VTJA 1J7IA 5AX3A 2VWVA 2UVXA 2A2AA 4P2KA 4TWNA 3SLSA 3HYHA 4CRSA 5AEPA 2XBJA 5EM5A 5KMNA 5CENA 1BUHA 4BI2A 2BIKB 2X39A 3PIYA 4FKJA 3ENMA 4LRKA 4ANQA 1ZRZA 3OCTA 2OXYA 2FYSA 3R2YA 4CT2A 2J50A 3I6WA 4RC3A 5FXRA 3RWPA 3CD8A 4YR8A 1H08A 1AQ1A 1SMHA 4YJRA 2DUVA 4F7JA 3MV5A 4FIEA 4L9IA 4QTCA 4CV8A 2YLEA 4DGLC 3E5AA 4E5BA 1DAYA 2CN8A 2BKKA 1A48A 4YSMA 4BDCA 3ALNA 4DCEA 4XYFA 4WA9A 3TDVA 5M53A 1Q61A 5AUUA 2BHEA 4AOJA 3KEXA 4DA5A 5HO7A 3WF6A 4EHVA 1M7QA 2W4OA 4EYJA 3LCDA 4EI4A 5KBQA 3RCDA 5BQ0A 3QHRA 3CC6A 4OTPA 4EK4A 2A0CX 1ZZ2A 2A4LA 4TWOA 2PVMA 3WOWA 4V01A 4O82A 2HWOA 4YLJA 3AGMA 4HZRA 1Q41A 1VEBA 5D12A 3NIEA 2E9PA 4Y8DA 3PA5A 5DFPA 3MFRA 3IW7A 4NYEA 3BU5A 4BIBA 2BZHB 3HV6A 4F9AA 4OT6A 5FGKA 3DKGA 4LI5A 5LVOA 4A4OA 3KXXA 4DEHA 1XO2B 4D2PA 5J9LA 4FODA 3QQKA 4EOSA 3QTRA 5HX6A 1GOLA 3KN5A 4S33A 4BHNA 3TCPA 1H1RA 1YWNA 3IECA 4QMYA 5CALA 3OT3A 4ID7A 4DGOA 2R0IA 4IVAA 5FEEA 4HVDA 1H0VA 4TPTA 3IG7A 3LE6A 1R3CA 3R8LA 1UKIA 4KRCA 2XH5A 2X81A 1SVEA 4RJ8A 4BF2A 3JY9A 3V6RA 4PRJA 4BCGA 1WVWA 3DAEA 2GNLA 5J7HA 3PPKA 1M14A 5HKMA 2ITVA 3EFWA 3IKAA 4Y85A 4F7LA 3UO5A 3UQGA 4BCJA 3LW0A 5J9ZA 3FL4A 4PMMA 1U46A 3LOKA 2XNNA 4HPUE 2OFVA 5CXHA 3CQUA 5BVNA 1U4DA 3F5UA 4APCA 4FVQA 1H07A 4JIKA 3R02A 4BRXA 1W83A 4M3QA 2HW6A 2OJIA 3GOPA 5CANA 1JSVA 4FVPA 4AS0A 2QKWB 2ZDTA 4E4XA 3WZEA 5FD2A 4CFNA 1Z9XA 3QC4A 4BCFA 4MH7A 4QQ5A 1B6CB 5EH0A 4S30A 4E1ZA 5C8MA 4R3RA 3VUIA 2YN8A 3AT4A 2XCKA 2H8HA 4M68A 4AOTA 1A06A 3C4EA 1K9AA 1KSWA 4HOKA 4XG6A 5EK7A 5L2TA 4EKKA 3FLQA 4BB4A 3A7JA 4NT4A 3ZYAA 5L6PA 4F9YA 4Z7HA 4IAAA 3LMHA 2YJSA 2QOHA 3D0EA 5ETFA 3TKUA 3NDMA 3PE2A 5AAGA 4WBBB 4YZBA 3F88A 2ETRA 3H4JA 4A9RA 3DA6A 4IB5A 4OW8A 1NXKA 4FUXA 4RVLA 4EH7A 3OVVA 4GYGA 4ZLOA 1PW2A 3SVVA 2CNVA 4QYGA 1CKIA 3KMMA 3QALE 5E92A 4FGRA 1ZYDA 2YWVA 5D7VA 4CQEA 1KUTA 1UV5A 2X4FA 4F65A 3C0HA 4PPAA 4AA5A 1YXUA 3QUPA 3LZBA 3V3VA 3EQBA 5ETAA 3R7IA 2RG6A 4HNFA 3R7VA 2PULA 3GCPA 5EM6A 4DBNA 1QPJA 4IMYA 3RPSA 2CKOA 2CNUA 3SAYA 2XNBA 4NFNA 4F1MA 1OVEA 1FMKA 3ERKA 5AIRA 2NO3A 1Q8WA 3R8VA 4ERWA 2BAKA 2QR8A 2X6DA 2ZOQA 3QUEA 4RVTA 3WE4A 4UWCA 3R8MA 2I0EA 2R0UA 2Y0AA 3JS2A 3E93A 3NWWA 3F3ZA 4FX3A 4JL9A 3TUCA 2QHNA 3EYHA 3HV4A 5CEOA 5E1SA 2B55A 3O8TA 4FV4A 5IDPA 2YAKA 5DG5A 4DCAA 2QURA 3Q2MA 4XP0A 5EQPA 3A7HA 2PSQA 2PVYA 4ZSEA 1G3NA 3ZFMA 5HZNA 4PTGA 4FYOA 4PDPA 5EHOA 3EQDA 3ZLWA 3U87A 4DFNA 4J96A 4KRDA 3T9TA 5IQEA 3MGYA 1G5SA 1H1QA 4FKTA 3DJ5A 3D7ZA 4H3QA 4H3BA 3O71A 2JEDA 2XUUA 2R3GA 2RIOA 3SW4A 4F99A 4BFMA 5HO8A 1SZMA 3U9CA 3E92A 1EH4A 4EK3A 3GT8A 4E4MA 1GZ8A 3MA3A 2BRNA 2EXMA 4RIWA 3C7QA 5AP4A 5CF6A 1PRYA 4QMVA 2W1HA 4FEXA 4MXZA 4AN9A 1JLUE 5DI1A 2R3OA 3OZ6A 4RWJA 5J7BA 3V51A 3CTHA 2QOBA 3MVLA 3DNDA 3OOGA 2CLQA 3Q53A 4ALWA 3A62A 4X2FA 5JK3A 3GCVA 4V04A 3MVJA 2OSCA 4FGBA 3R83A 3ATTA 4TW9A 4HZSA 2WQBA 3ORTA 1KWPA 4ZJJA 3RNYA 3R2BA 3T8OA 3DBDA 3F3VA 2J0IA 3P7AA 4CNHA 5M56A 3ZLSA 4OR5A 2UZWE 1KE5A 3S00A 2GQSA 4QMTA 3BQRA 2OI4X 3AMAA 3FMMA 4ASXA 3OOMA 4Q9ZA 2R3JA 3QCXA 3TJCA 1APME 1JKSA 2HZ4A 3IOKA 4NJDA 4X2JA 4FV5A 1QMZA 4CLIA 2ITWA 4NM5A 4JBVA 5ITAA 1LPUA 2C3LA 3COMA 3W55A 4EORA 1OL5A 4BDJA 5JGDA 3ZXTA 4KSPA 2IW6A 4MD7E 5AAEA 3CXWA 3ATSA 3NUAA 3BGQA 3HRCA 5HCXA 4BTKA 3C51A 2OIDA 5CQWA 2O2UA 3D2KA 3UPXA 2BRGA 3RWQA 4ZTSA 3VC4A 3BELA 4AW5A 3FE3A 3REPA 2QLUA 5D10A 3W2CA 3WF7A 3PY1A 4U79A 3MBLA 2I0YA 5CAOA 4DYMA 4U5JA 5AA8A 4E6CA 2RL5A 1Y8GA 1M52A 4RC2A 4RG0A 1ZMWA 4Q5HA 4NFMA 5A4CA 1H00A 5B2MA 5LVLA 2CKQA 4W4YA 4DGNA 3HV5A 3VF8A 4O7ZA 4FV2A 5HOAA 2WQNA 1GIHA 3OD6X 3RM7A 3FQEA 2QO7A 4D0WA 3IGGA 2R3PA 2ITPA 5KUPA 4XP3A 4R6VA 4UYNA 4I93A 2HZNA 1GZOA 4IM2A 4RIXB 3MYGA 4XCUA 1WBWA 5LVMA 3VS5A 4KIKA 3GQLA 4OAUC 4BDIA 2R3QA 3BRBA 4IJ9A 2Y8OA 3COIA 3NW7A 4GV1A 3ZBFA 3FC1X 4GUEA 4MWHA 5BPYA 1FVVA 1L3RE 3EKNA 5JFXA 4IAKA 4DLIA 2WMUA 2WMRA 2QHMA 3MTFA 1LP4A 2V22A 4XLVA 5DT3A 2C5YA 4ZSJA 3D94A 2J51A 3FMNA 5JEBA 4MHAA 4DF3A 3LM0A 4L46A 2NRUA 4UX9A 4GT4A 4YU2A 2W99B 3BLQA 4EH8A 3EL7A 1DM2A 1MRUA 3O50A 4X0MA 3NUYA 3SG9A 4GU6A 3O8UA 2VWYA 3TG1A 1UU7A 2I0HA 4NWMA 4CFUA 3UMXA 4I22A 4GT3A 3UOHA 4IB0A 4AW0A 1HCLA 4QMNA 3U55A 5DEWA 3SGCA 3ZZEA 4LRMA 3LIJA 4R3PA 3KY2A 1Q8ZA 3UYSA 4AZEA 1UKHA 3TXOA 1BLXA 2A19B 3R1QA 5DRBA 3FYJX 4O83A 3OFMA 3O8PA 4GH2A 3FLNC 2O5KA 4QTAA 2VD5A 3TTIA 4AAAA 4D4YA 3FHIA 4XBRA 3PZHA 1YKRA 2R3NA 2BDJA 1XR1A 4XBUA 3ZO4A 3Q60A 4BKYA 5HNIX 4FV1A 4XRJA 3K5UA 1DAWA 1KOBA 3OXZA 4L00A 4ACMA 2J6MA 5FUTA 1NY3A 4IAIA 1FMOE 3G33A 3R1NA 4A07A 4UEUA 3IS5A 3CIKA 4FKGA 4FEQA 1AGWA 3QTZA 4NUSA 3B2WA 3Q3BA 4OBPA 4EC9A 3AC1A 3CCNA 4ZS4A 3TWJA 2ITNA 3AT3A 4J99A 5IISA 3ORPA 5BMMA 5AFVA 2GCDA 3GCQA 4DFZE 4EK5A 3OWPA 1GIIA 3UBDA 1GNGA 2YM4A 1IAJA 1W98A 3HA8A 3VS4A 4C3RA 5E9EA 3R8PA 2W5BA 2OU7A 2VWXA 3IW8A 3PDTA 4ZTHA 1M7NA 4O38A 3KK8A 4X3JA 2F57A 5CSPA 2QONA 2X2MA 3MJ1A 5JKGA 2E9UA 5LCJA 3DAJA 2Z2WA 3OCSA 4FSWA 1SNUA 4BCHA 2OICA 4O27B 3H0ZA 4EONA 5TO8A 2B4SB 1SYKA 1Q97A 4KABA 4U3YA 3NUNA 4KKGA 5BVOA 4EBWA 2XKDA 5B2LA 4MAOA 2ITXA 3L9MA 2OO8X 4ZMEA 3NS9A 4CEGA 1PJKA 2C5VA 3ZO2A 5C4LA 3F9NA 3C50A 3E7OA 4AZFA 5T68A 2GHMA 3UODA 3VBXA 2ZB0A 5I3RA 4O1PA 4FE2A 3ZOSA 3F3UA 1YDTE 2UW8A 3AXWA 5BVFA 1J91A 2IZRA 2W1IA 4I5CA 3QU0A 5KMKA 3VN9A 2P55A 4OTRA 1LEZA 2CMWA 5DE2A 3ZO3A 3KXNA 4IZ5A 2YDKA 2BCJA 4IFCA 5HNBA 2VRXA 4U97A 4I6FA 2OW3A 3RAIA 4IAFA 2V7OA 4E6DA 4QOXA 1FGKA 3RINA 3Q4UA 4JQEA 4RBLA 2QKRA 3NYXA 1VYWA 5LWMA 5JSMA 3W10A 4QMLA 4RX7A 4RFZA 3OF0A 5HGIA 4FSUA 4CFVA 4XX9A 4Z16A 3PVWA 5CS6A 4TYEA 3PJ8A 4UMRA 5HTCA 3GOKA 2A1AB 3EQFA 3H0YA 2H34A 4HGTA 1RW8A 5IDNA 3SOCA 3UIMA 5IA3A 5J1VA 2OZAA 1MQ4A 4AFJA 5M51A 1H25A 2G1TA 2QOIA 3QZGA 4N70A 5EDRA 4DITA 1A9UA 3QRJA 4CD0A 2YDIA 3WIGA 2OJGA 4EH9A 3TIZA 3LMGA 2VAGA 1OL1A 2GFSA 3OUKA 3PXZA 1H26A 5BYYA 5C26A 5AP5A 5HCZA 2FGIA 3SQQA 1UU3A 2JITA 5GJDA 4PNKA 1NT2A 1STCE 3VUTA 4YTHA 3R9OA 4C38A 3EQGA 4H1JA 4QYEA 3D7TA 2QVSE 3FZRA 3O7LD 4MBLA 1R0EA 2IWIA 4JRVA 2O3PA 3VWAA 3EN9A 1BX6A 3ZO1A 2WTVA 3BHVA 4FOBA 2ZVAA 3I7BA 4ZY4A 3DCVA 5CX9A 1E9HA 3R8ZA 2OG8A 3E3PA 5L4QA 4JBPA 2WMAA 1F5QA 5D9HA 1JKKA 3OY1A 4I6HA 4OTFA 4YUQA 4RFMA 4YO6A 4G6NA 5HI2A 2C30A 2QI8A 5CTPA 4DE4A 4BCNA 1BI7A 5HTIA 2CKEA 2BKZA 1MRYA 2GS2A 4YLLA 2B9JA 4O6LA 3UVQA 4B7TA 4Y5HA 2YZAA 4CYIA 5D7AA 3HV7A 5T6KA 3KC3A 4FSYA 4U45A 4MKCA 1JSUA 3FI2A 3H3CA 1YOJA 2X8DA 5KO1A 2OH4A 3GC7A 3ZSIA 3CSVA 4R77A 3LJ1A 4R5SA 2VNWA 5K4IA 3BYSA 2XM8A 4FT0A 3Q2JA 2UZNA 4L53A 4XG8A 3S1HA 3IDBA 4MD9E 4DEGA 2VN9A 4YNEA 4DC2A 3B2TA 1ZAOA 2UZBA 2X4ZA 3AC5A 2C6MA 4ZOGA 5M4IA 3H10A 3OUNB 2XCHA 4EH3A 3SKCA 3KA0A 2R3RA 4DLJA 4EJNA 2W96B 2Y6MA 1RQQA 4XG4A 4G16A 3Q32A 2HAKA 1YI4A 5IEXA 4B8MA 3PRIA 3LXPA 2XK3A 3FMJA 3P5KA 4L7FA 4IVCA 2VTIA 3PIXA 4XUFA 3LQ8A 3RNIA 5HLPA 1PXOA 1K2PA 4LRJA 5DYJA 4JAJA 2HY0A 2HENA 4DG3E 1OUYA 5KMJA 4ALVA 4I5MA 2QOLA 3TTJA 1I09A 4BY9E 4D0XA 3CBLA 4RSSA 1UWHA 4J53A 5K9IA 4YGAA 4IB3A 2VTMA 3I7CA 3LFDA 4O0WA 4ZSLA 1UNGA 5CAQA 4IB1A 2XBAA 5HLWA 3G5DA 3KGAA 1W84A 5K4JA 5E4HA 2O64A 3CR0A 3D83A 4NIFA 5D1JA 3EQPA 1OMWA 5BVKA 4F0GA 1U5RA 4PMPA 3OG7A 4I20A 4ANBA 4JAIA 2Z60A 3WF5A 2Y4PA 3KRJA 1U54A 5FQDC 4OTIA 3NAXA 3PPZA 2PVRA 3G9LX 2GNHA 5L2IA 2WMSA 2WMXA 3HZTA 4L42A 4C2WA 1PKGA 2XK4A 1YW2A 3KRXA 3QGYA 3QLFA 3VULA 2R3KA 5EW3A 5LOHA 2PZYA 2QQ7A 2W9FB 5F20A 4EZ3A 4BC6A 1PKDA 4O22A 4BZDA 4CKRA 1OL2A 4F64A 4LGDA 4EJ7A 3RJCA 4KAOA 3U4UA 5LXMA 4NL0A 3C0IA 1O6LA 3KXZA 3O51A 2PZIA 5DHJA 3WARA 1CKJA 2B9FA 3LJ0A 3V8WA 5M09A 3KXGA 2J0KA 4K0YA 4E73A 4CG8A 2PTKA 3UOKA 4JJRA 4GIHA 3CJGA 3SRVB 2PK9A 4RX8A 3ZRMA 4H3PA 4QP3A 1FVRA 3DTCA 2GS7A 4JQ8A 3MIAA 3RM6A 5C8NA 3OCGA 1T45A 3BEGA 4D5KA 5G6VA 2XK7A 3PUPA 4P4CA 3LXNA 4DG2E 5IQHA 4KD1A 3TV7A 5J8IA 5C03A 5A4QA 4G3CA 5HNGA 4NTTA 3ZM4A 3I5ZA 3FXXA 4FKLA 4HYIA 4LGHA 5B2KA 3KQ7A 2R2PA 5GIPE 2JFLA 4TN6A 2QOCA 4BHZA 4YNOA 4MD8E 2HXLA 5AADA 4C36A 2JC6A 4U0IA 4DT8A 1PY5A 4WD5A 1XH7A 4CG9A 3ZM9A 3E8EA 3OBGA 4HCTA 4X3FC 2UZDA 5E8TA 4EHGA 1W8CA 2IJMA 5K3YA 3TZ8A 5HEZA 3THBA 3SA0A 4KINA 1RE8A 3SV0A 4A9UA 4M14A 3P23A 4IEBA 2YACA 2BZJA 1CMKE 4G3FA 4QRCA 2JAMA 3IONA 1TQMA 1IRKA 3M2WA 2LGCA 3G6GA 2W5AA 4DAWA 5E8WA 3WYYA 3UVRA 4YJUA 4P5QA 1SM2A 3AD4A 3DLZA 3IDPA 2XMYA 3PVGA 4QMOA 4QTDA 2FO0A 5JZJA 3QHWA 5DN3A 4R1VA 5BVDA 3TNHA 2GPHA 2RFNA 3KKVA 4WHZA 5J1WA 2BDFA 4K18A 3IK3A 3PVBA 3R1YA 3ROYA 4I0SA 1OKVA 5IA0A 3S2PA 4JOAA 5M44A 2PZRA 2CSNA 1M2QA 2RKUA 3HGKA 3R28A 5EFQA 1UVRA 5HESA 5KHXA 4YJPA 1ZWSA 5TF9A 3S0OA 2Z7SA 3FSFA 4OTDA 4ASEA 2YISA 1YXVA 2R4BA 4AACA 4LOQA 3UVPA 3LFAA 5DPVA 2JIUA 3KXHA 2XNOA 4FT9A 4F9CA 4RZWA 4FTIA 2BTSA 3CQEA 3DKOA 3W18A 5CYIA 3TN8A 4XS2A 3CY2A 4FL3A 5L6OA 2WXVA 1ZOGA 2G2IA 5A3XA 3FZPA 5EQYA 5IQCA 4MXOA 3ZFYA 4EHZA 4KA3A 1XH6A 4BTJA 5IA1A 5KHWA 4D28A 5M55A 4ZTQA 3VO3A 3NIZA 3RPOA 2ITTA 3DFCB 5GHVA 4XH6A 5EW8A 2DYLA 1PXJA 2BVAA 3F5PA 1KE9A 1PYEA 1YOLA 2JKOA 2YM8A 4I23A 1BYGA 5JRQA 4L3PA 5JFSA 2YM7A 4G2FA 4UB7A 2EWAA 5M06A 4FTCA 3BBTB 1V1KA 3FY2A 3TNQB 5HU3A 2O0UA 4YHTA 3FL5A 4NH1A 4YURA 3WZJA 2PVKA 4IC7A 2J2IB 2YM3A 1TQPA 2DS1A 4MVFA 3UDBA 4ANMA 2XZSA 4FZFB 2IVUA 2UZTA 4MBJA 4N57A 4AT3A 3SDJA 5FRIA 4D2RA 3ZEWA 3AGLA 2VTLA 3DKCA 4FR4A 3Q96A 3FI8A 5AR5A 3O7LB 3RK5A 3HDMA 2GQRA 1OGUA 4PDOA 3H9FA 2WQEA 3H9RA 4FBXA 3UNKA 4IM3A 2H9VA 2UW0A 5GZAA 1E1VA 3NYOA 5CVGA 3CS9A 2ZM3A 5DEYA 5H9BA 5CLPA 1Q62A 1QCFA 2G15A 3QTUA 2HY81 3FHRA 5HVJA 2P33A 3BWJA 4KIQA 3PLAE 2IZUA 4UZDA 4GK3A 3ZU7A 4DFXE 4O21A 3HX4A 4PTEA 2G2HA 3ENHA 3UP7A 4XMOA 1ZYCA 2AC3A 3P0MA 5CT7A 5CEPA 2VU3A 1ZY5A 3G2FA 4D58A 5M57A 2X1NA 1ZYJA 5HVYA 4ZP5A 4QT1A 2H6DA 2E9NA 3DBFA 2WD1A 4RX5A 3LAUA 2HOGA 4O7VA 4IZYA 5T3QA 3BHHA 4U44A 4II5A 4KS8A 4FIFA 2F4JA 3FI4A 2WOTA 1REJA 2J7TA 3FXWA 4ZEGA 3EFLA 1OKWA 5FXQA 3EWHA 2AUHA 3R1SA 1J1CA 1VR2A 3QRUA 2ZV2A 4FUYA 5EG3A 2WEVA 5C9CA 3QWJA 2HZ0A 2PPQA 2WMWA 1R39A 4USEA 4AN2A 3R30A 4EOIA 3N9XA 4HVIA 4AW2A 4E4NA 5BVWA 2VTRA 3E87A 3LHJA 3C4ZA 2R3FA 2WMQA 3RKBA 4TYHB 4BDEA 3LFFA 3QWKA 4XG2A 3MFTA 4BZOA 4TWCA 4FIIA 4EOKA 3R8UA 2YERA 3EQHA 4D1ZA 3UPZA 2GNFA 3QKLA 1J7LA 4RWIA 4WNMA 3IW4A 3KFAA 3OBJA 2YCQA 2YIRA 3AC2A 1XBCA 3IPHA 4W8DA 5GJGA 3VF9A 2R3LA 4AWIA 4XP2A 4C4JA 5AR3A 4E26A 2VTQA 4YC3A 2BAQA 3DOGA 4AX8A 4ANLA 4CVAA 2HWPA 1OITA 2JFMA 4IWOA 4Z9LA 5E90A 3ZSHA 1NVSA 3MH2A 4WBOA 4BDKA 5GZ8A 3GC8A 3TT0A 5J5SA 2YHVA 3VUDA 3KN6A 3MPTA 2JIIA 5C01A 1YXTA 4IADA 1WCCA 3VQUA 4OT5A 1H4LA 3AC8A 4G1WA 1QPCA 3F6XA 5CT0A 4TNDA 4DH1A 4RLKA 4EUUA 2JBOA 4WG3A 4NJ3A 3MFUA 3NGAA 3GGFA 4ONAA 2V7AA 4GJ3A 4S31A 3SOAA 4MCVA 5CASA 3QFVA 3SHEA 5KBRA 4M69B 5IUGA 3KF4A 4DINA 2VTNA 1YOMA 4M97A 3RAHA 2QU5A 4C4FA 4GIIA 3PSBA 4GW8A 1ZZLA 4PDSA 4TYJA 3B8RA 3EFJA 3UIXA 2UZVA 1IR3A 2ITOA 3MVMA 5L2WA 4AZSA 4NW6A 3H9OA 2PL0A 3QTXA 4JG6A 2YIWA 3TZ7A 4EOOA 2WELA 5H3QA 1PXKA 1OL7A 4MX9A 1T46A 2BFYA 2CDZA 3A60A 3CPBA 5DH3A 3IW6A 4U80A 4BICA 4PF4A 2ETKA 4EH6A 2CNQA 3FMKA 1P2AA 3ID6C 4L6QA 4J52A 3E64A 4YJVA 5JRSA 2F2UA 2XS0A 4D2SA 4U40A 4XOZA 2X2KA 4G9RA 3BE2A 4FZDB 4R7IA 3GFEA 4AE6A 5KCVA 2W4JA 1PXMA 3QF9A 2V5QA 4HYHA 5IQGA 2P4IA 1OIUA 2J4ZA 3TV4A 3PA4A 1HCKA 1H1WA 4HCVA 1PMUA 1CM8A 5CY3A 5D41A 5AUXA 4GCJA 3UO4A 4MNEB 2E9OA 2RF9A 3R7OA 3HAMA 2YM6A 3MH0A 2PUUA 3HUCA 2HXQA 4L7SA 3QCSA 4O0VA 4XEYA 4FTMA 4IZ7A 4MQ2A 3S4QA 2GHLA 5HTBA 4O7LA 3Q04A 5CVFA 3UTOA 2WTJA 2JGZA 2JLDA 4RQVA 4BBMA 3AMYA 4CFXA 4DFLA 3L8PA 2W17A 3VW8A 4AFEA 3G9NA 3NUUA 1V0BA 2XJ1A 4FK3A 1B39A 2R5TA 4BTMA 5IEVA 3UQFA 3KB7A 5HG5A 5LMAA 3PSDA 4ZY6A 5CAVA 5AR7A 5FLFA 4Q2AA 4W9XA 4ENYA 4UXQA 1YDSE 3QD0A 4FKRA 4J8MA 4I0TA 5ETIA 5AV0A 2VWUA 2XEZA 4CKIA 3WE8A 4ITIA 3RAKA 3FEGA 1O6KA 1GJOA 3BYUA 3CLYA 3LXLA 2KTYA 3RZFA 3VHKA 4DFBA 3DK7A 3QKMA 2G2FA 3Q4ZA 3QTSA 4Q5EA 3GU8A 4ZTNA 5CU2A 3IOPA 4A9TA 4DH8A 2BHHA 3PXRA 3SG8A 4DN5A 4ZJVA 5H2UA 3UP2A 4OAVB 2Y4IC 1G8AA 1B38A 4A4LA 2Z8CA 3GCUA 4RVMA 2HK5A 4RRVA 1Y6AA 2WB8A 4V0GA 4IM0A 5DRDA 4I5PA 5DNRA 3NZ0A 4DTKA 4BGGA 1XQZA 1SVGA 5TOZA 4DGMA 1PMVA 4JDJA 2JAVA 3ZONA 3BYOA 4FKIA 4FTOA 5AR2A 4YTIA 3A4OX 3CE3A 2VX1A 1GY3A 1QL6A 4FNWA 4I4FA 4IXPA 4LGGA 3QCQA 4XOYA 5CZHA 5IUIA 4F4PA 4HVGA 3BI6A 4DH5A 4YP8A 2C68A 3LCOA 3PTGA 4FMQA 2SRCA 3K54A 3U6IA 4DT9A 2QG7A 3UJGA 2PVLA 3BGPA 3DDPA 3VS3A 3PXFA 4GEOA 2I7QA 5BYLA 3UC4A 1OL6A 5LMBA 4JXFA 4S32A 4RIOA 4G6OA 5DWRA 1W82A 4EQCA 3FMEA 4IZAA 1OBGA 3W1FA 3RMFA 2QOFA 3HKOA 5F1ZA 4YPSA 2W7XA 3S3IA 4ZIMA 3UNZA 5TR6A 2W1ZA 4YJTA 4I1ZA 2P2HA 3B8QA 3QRKA 4WSQA 3RP9A 4ZY5A 3MI9A 3L9PA 3R01A 2C3KA 5J79A 3QYZA 4Q9SA 4FT5A 2BRBA 5K0XA 3N4UA 4K8AA 5AUVA 3DV3A 4O0UA 4F0FA 1IA9A 4I6BA 5DR2A 3OCBA 2ZMCA 4K6ZA 2BR1A 2HZIA 3NNVA 4KIPA 3C4FA 3FV8A 4O7YA 4Y95A 4KBAA 2OJFE 4JLCA 4RJ3A 4QQJA 5DA3A 1LEWA 4FV0A 2C6LA 3MSSA 1OPKA 2ESMA 1CTPE 2I0VA 4APPA 5A6OA 2C47A 4XV9A 3FLZA 2V62A 3JYAA 2XKCA 5D11A 4M67A 5KNJA 2QLQA 4WG4A 2WOUA 3A8XA 4X3FA 4FSRA 3GU4A 4CTCA 4LG4A 2I1MA 3FMHA 3GEQA 4CZUA 3QL8A 3LLTA 4IH8A 3DQWA 5FEQA 4L43A 4E5WA 4TYIA 3TM0A 5CQUA 3DPKA 4RIYB 2I6LA 5ACBC 5K5XA 3COHA 2JIVA 1Q24A 2UZUE 3QRTA 5H8BA 2VTTA 1OIYA 4AZVA 3TACA 4IVDA 2VTSA 4KKHA 4LOPA 4BWXA 4U7ZA 3TV6A 4AGUA 3OS3A 4S34A 5LVPA 4EK8A 5HLNA 4EKLA 2OGVA 3LJ2A 2UV2A 2HYYA 4OBQA 1WBPA 2B52A
chains in the Genus database with same CATH superfamily
3OC1A 1TQIA 4ANOA 2P3GX 3TI1A 4BGQA 5IH4A 4DG0E 4CV9A 3KULB 4JX3A 4YBKA 3UIBA 5F4NA 4IAZA 1OUKA 3NW5A 3ORKA 4C4HA 3FKOA 2QNJA 5BUEA 1XWSA 5CEMA 2PE1A 4OTHA 4R3CA 4D9TA 2Q83A 1FVTA 1Q8TA 1RJBA 3CP9A 4G17A 5AUWA 3WILA 3LCKA 3D7TB 3BQCA 3MIYA 4UN0C 3TNPC 2GTMA 3FMDA 5HE2A 2ZM1A 1V0PA 4RIXA 3TUDA 3GC0A 4G3DA 1Q99A 3TNWA 5AA9A 4QTBA 4LQMA 2BIYA 4QP1A 5HIEA 4QP8A 4YJQA 4AT4A 4B6LA 3OTUA 2VZ6A 4U81A 4QMUA 4RVKA 3ZUVA 4F08A 3IO7A 4DDIA 3ANRA 3QRIA 2ITYA 3TZMA 5C8KA 3Q5ZA 4I5HA 4BCKA 3E8DA 3W2OA 4TXCA 3NCZA 1UNLA 3F2AA 4OTQA 4WUNA 4RT7A 1JKLA 5CU0A 1YDRE 3G90X 1XKKA 2WO6A 3NUSA 4B0GA 3DZQA 5IQBA 3W16A 2XYUA 4QQTA 3UZRA 4CXAA 5DBXA 4FYNA 2F49A 5F9EA 3EHAA 5H8GA 3PY0A 1YI3A 3C5UA 3KK9A 5FXSA 3VBQA 2XK6A 4NM7A 2C69A 4CMUA 5A4EA 4ZMFA 1M2RA 3ZDUA 3SX9A 3OW4A 2JKQA 5AP6A 2C6EA 4DHZA 3VRYA 4GSBA 1O9UA 5CAPA 4IW0A 2ITQA 4EH4A 3PP1A 4TT7A 2PUPA 5JGAA 5E8UA 4NTSA 4O0SA 4PUZA 2GFCA 5BX0A 1ZXEA 4FV7A 3BLAA 3AKKA 1PXPA 3TEIA 2WU6A 3ZCLA 4FTNA 4FJVA 3KRWA 5JQ8A 1Y6BA 3C0GA 3ORMA 4O0YA 1K3AA 4UYAA 3RHKA 5FP5A 3V04A 1JWHA 1Y8YA 3GNIB 5E8ZA 1DS5A 3U8WA 2B0QA 2DQ7X 4B99A 3R7UA 4BCMA 4UWBA 4IWQA 2LAVA 5EI6A 3DBEA 5AV3A 3R7GA 4O7RA 3EZVA 4YSJA 4RLLA 4XG7A 2V0DA 4BDDA 3AKLA 3A7FA 5I5ZA 3ZEPA 3VRZA 5BUJA 5FP6A 2J0LA 3FI3A 3D5VA 3G0FA 3GFWA 4RC4A 4XV1A 3WZUA 2AC5A 2WMVA 2EB3A 2ZV8A 3V5JA 3ZS5A 5CF4A 3UE4A 1UNHA 2FSLX 4O2PA 4QP7A 4CFWA 3U6HA 2G9XA 3BL7A 2YCSA 1CSNA 3VUGA 4NIFB 2C0IA 4UZHA 2YIYA 3DZOA 5DVRA 2O8YA 4IACA 4WG5A 4C33A 4DEIA 5IPJA 4FG9A 2A27A 1XJDA 2ZYBA 3VS0A 2Y6OA 4ANSA 4FICA 4FOCA 3R6XA 4C4IA 3R9HA 5K5NA 4L67A 5HIBA 2IVVA 3UG2A 1Q3WA 2QOQA 4G9CA 2Y9QA 1P5EA 3ELJA 3LFCA 1WBVA 3CGOA 3E63A 4GG7A 3L8SA 4MF0A 5DMZA 3NAYA 3QQLA 4P5ZA 5EYDA 3QGWA 2VX0A 1VZOA 3QAME 3OEFX 3OEZA 3P1AA 1H24A 5IU2A 3PXQA 3A61A 5E8VA 4EBVA 3T9IA 4O86A 4AGCA 3BHYA 3QD2B 2Q0NA 3NNXA 1JAMA 2CPKE 3LFEA 2E2BA 4GJ2A 1M17A 4S2ZA 4C3PA 4ZXTA 2XRUA 2PMOX 2X8EA 3PP0A 4UMUA 4J1RA 1V0OA 5FDXA 3RAWA 2XK8A 3ZSGA 2VO3A 2ERKA 3LLAA 4ALUA 4EH2A 3W0OA 4FEUA 3ULZA 3MH3A 4BZNA 4KNBA 2FSOX 5HICA 3ML1A 4MXXA 3R73A 1ZYLA 4TL0A 4BCPA 5A54A 1ZOHA 2YCFA 3GU6A 3RALA 2J5EA 3U51A 4QNYA 3C4XA 2P2IA 3PRFA 5JN2A 3FMLA 4FL2A 2WPAA 3F5XA 4PMTA 3AC4A 5AIKA 1H28A 1LR4A 3HMIA 2ERZE 3JVSA 3MA6A 4JT3A 4OTGA 1TVOA 2REIA 4RGJA 4JDHA 3RCJA 5GNKA 3SXRA 5I9YA 5C27A 5AV4A 5IQDA 5C1QB 3FPQA 2QO2A 3R22A 4NM3A 2C1BA 3ZUUA 5EHYA 2VWIA 4CMTA 4O7TA 2OF2A 1P4OA 3L8VA 3LVPA 3P78A 3MTLA 4I0RA 5ANEA 3ZH8A 4LV5A 4EQUA 1WVXA 5AUYA 4EHEA 1UU8A 3ULIA 4FV6A 2FA2A 1KE6A 2JDOA 1IAHA 2YM5A 3EKKA 3COKA 4YJOA 5CVHA 4G34A 1Q8UA 4EOQA 3CJFA 1OB3A 3ROCA 2OH0E 1U59A 4QYFA 1VYZA 3NVMB 3A7GA 2VTOA 3FLWA 4QMZA 4K1BA 4P7EA 4YZDA 2XIZA 3R7YA 1BL6A 1KV1A 3NR9A 3PJ1A 1FQ1B 4M84A 5E7RA 5EI8A 3DXQA 3BWFA 5CF5A 2XIKA 4FNYA 4J98A 5CU4A 3Q4CA 3JR1A 3CTJA 5HCYA 3FKNA 2IN6A 3NUPA 2C5XA 1O6YA 3EFKA 4XV3A 4FA2A 4XG9A 2PZ5A 2VO6A 2QODA 1OECA 4ZZMA 3FZ1A 4ARKA 5HE3A 1JQHA 5L2SA 4ZTMA 2ZFYA 1R1WA 3DGKA 3KMUA 2PZPA 2B9IA 3FWQA 3P7CA 4IWDA 2BAJA 4TNBA 3ZRKA 4PP7A 5IUHA 4FK6A 3FZTA 5HHWA 2WZJA 3VS6A 1R78A 4BCOA 4QMPA 2GHGA 4YTFA 5ICPA 4HGEA 4C2VA 4RA5A 3NMUF 4UMQA 4ACCA 1UWJA 3BPRA 4BIEA 3AOXA 4JDIA 3RK9A 4F70A 3LMIA 2VWBA 2JDSA 3ORIA 3OWLA 2BZKB 3HL7A 2EVAA 4HYUA 4L68A 2XNGA 5EKOA 2YIQA 4JS8A 4GFMA 4IAYA 4ZLZA 4X6RA 4JI9A 2JKKA 4NKSA 4YZ9A 4BI1A 3MB7A 5CU3A 3FDNA 5AMNA 4C61A 2W0JA 3EB0A 4E5AX 4X2NA 3V5TA 4A4XA 2PY3A 4GUBA 3N4VA 3FQSA 2UW9A 3C1XA 4L45A 4ZTRA 3KRLA 5FM3A 5IH5A 4I6QA 4ACHA 4D4SA 4GK2A 4LFIA 1URWA 4F9BA 1BI8A 2Z7RA 3LQ5A 3KCFA 4KBKA 4PX6A 4QMWA 4QMSA 4M7IA 4PTCA 4ZLYA 4J7BA 3PJ2A 4V05A 4CZTA 3QYWA 2QOOA 2XNPA 3HUBA 3I60A 2OJ9A 3GI3A 4LUEA 4FTUA 2GNJA 1ZY4A 3UZPA 4FRFA 4Z55A 2PWLA 5L8LA 2WTWA 4N0SA 3ZC5A 3E3BX 2GNGA 5DOSA 2BILB 4A9YA 4LMNA 3ETAA 4L3LA 3ANQA 5HE1A 4IVBA 3ACKA 2XJ2A 2YWPA 4PP9A 5FM2A 3HECA 4FF8A 2FB8A 4X2KA 4LM5A 4ASDA 4YTCA 4C8BA 2VO7A 4LUDA 5CI6A 2CGUA 4WNPA 2UW5A 2X6EA 4ZSGA 4D4VA 5AWMA 3EYGA 5AP3A 4FIHA 4EC8A 4JX7A 2J90A 4QQCA 4W4WA 5CWZA 2PMLX 3UOLA 4LYNA 3RPVA 1YHWA 1RDQE 1Z5MA 4M15A 3D2IA 4PPCA 3TIYA 5I9VA 2QOKA 5KZIA 4DH7A 1YXXA 3QA0A 5L8JA 4JMQA 3DBQA 3UGCA 4OLIA 5FWKK 1MQBA 2QC6A 5B0XA 5KZ0A 3KMWA 4JG8A 3V6SA 1WBTA 4AW1A 2VGOA 1OIRA 1OKZA 2XB7A 4FKUA 2IPXA 5HG7A 4FG7A 4U43A 4IANA 4EH5A 4DBXA 3SRVA 4FIJA 2XAMA 5CEIA 2PUIA 3FZOA 4Y46A 4UALA 2RGPA 3G51A 2OIQA 4YBJA 4GKIA 3PE1A 2C6KA 4DH3A 4U41A 4W8EA 4ZTLA 1JSTA 5CEQA 3UG1A 4QDVA 4HJOA 4CFMA 5I9UA 1IA8A 3UDZA 3JY0A 4TWPA 5I9WA 4PDYA 5BNJA 3F69A 3POOA 4UV0A 4C62A 3NNWA 4RX9A 2GDOA 3PIZA 3QXPA 4LL5A 2XKEA 5AP2A 2OF4A 4O0XA 3VW6A 5LQFA 3VUKA 2ZV9A 2R3IA 4EK6A 1KV2A 5DR6A 4FZ7A 5EI2A 2C3IB 3P9JA 2IO6A 3T3UA 1MUOA 3PUFC 2X7FA 3W32A 1W7HA 3NYNA 3A7IA 4A06A 3TJDA 4G6LA 5ANKA 4QPMA 4U8ZA 4UBAA 4XNEA 2JKMA 3ZTXA 4AXEA 5LWNA 1YWRA 2XKFA 4X21A 1PXLA 2BROA 2XIYA 5I3OA 3EOCA 3W33A 4F09A 4ACDA 3PXKA 2WIPA 4KSQA 2W1GA 3HEGA 4C34A 2O65A 3VBVA 2GMXA 1H27A 5CSXA 3Q52A 2W1FA 2PMIA 4E4LA 4CKJA 3EJ1A 2NPQA 3FJQE 2JDTA 2O63A 4WKQA 1KE8A 1E1XA 4JNWA 4C4GA 5BMSA 1ZOEA 3ZMMA 3RK7A 3NUXA 3PXYA 1YWVA 4MXCA 4BDFA 3ZLYA 1P4FA 3FLSA 3M42A 3DB6A 3PG1A 4L52A 3VS2A 3OMVA 4HNIA 4DEBA 5FTGA 2W1DA 2CCIA 3U6JA 4NSTA 3PLSA 1U5QA 3U4WA 3MWUA 1IASA 3O5AA 4MWIA 4FEVA 2YZLA 3BGZA 5ACKA 3CKWA 4P90A 4D1XA 1ZMUA 3QA8A 4YC8A 4FTJA 3V5QA 4FTTA 4E3CA 1H01A 1W0XC 3NEWA 4MF1A 3RGFA 3FKLA 4FKPA 4CLJA 4JBOA 5CZIA 3GBZA 4XG3A 4XLIA 2OZOA 3EL8A 5HD4A 4IFGA 3HAVA 4ORKA 2GU8A 5K0KA 3ORNA 2EXEA 4C37A 1WFCA 3DB8A 4AOIA 4IC8A 1LUFA 3Q9ZA 4IX4A 3MY0A 2F7XE 2W9ZB 4IHPA 4OTWA 5KX8A 4D55A 3CQWA 3I81A 5EYKA 4JVGA 4UMTA 5FTQA 4FG8A 5CSWA 4QMMA 1MRVA 4FKVA 3QTIA 2WNTA 5EDPA 3OXIA 1I44A 5TT7A 3QX2A 4BBFA 5JT2A 4LV7A 4I21A 4XHKB 1REKA 4RIWB 1FPUA 3NPCA 3W0SA 4O96A 4JQ7A 2VTPA 3BLRA 2C0OA 4CQGA 4CTBA 4QP6A 2X0GA 1JNKA 2ONLC 4PQNA 3R0TA 3MH1A 4GT5A 1YXSA 3VIDA 3BLHA 3EN4A 2C6OA 3IW5A 3CPCA 1OPLA 2F2CB 2WIHA 4KKEA 5F94A 3OWKA 4MTAA 4QP2A 3VAPA 3ZZWA 4Y73A 3DK6A 4PNIA 1SNXA 4CSVA 1HOWA 4G3GA 2OXDA 4O7WA 2YIXA 3Q6UA 4QTEA 2YFXA 4I3ZA 2JDRA 4N6ZA 3R21A 3HMNA 3R9NA 4AU8A 3HP2A 3LFBA 2UUEA 4GVAA 5BUIA 5IEYA 3VBTA 3IQ7A 3M1SA 4IIRA 3VUHA 3RZBA 4CGAA 1KE7A 4NCTC 3E8CA 4FSQA 3CEKA 2XM9A 4M66A 5AP7A 4HCUA 4WUAA 5HU9A 4OUCA 3LFNA 3I5NA 5M4UA 2YAAA 3KRRA 5ANJA 5EYMA 3PVUA 3I4BA 2RFDA 4FZAB 5EM8A 2FSMX 4ERKA 5IMEA 3DT1A 1JVPP 3BYVA 3V8TA 4BL1A 3R9RA 3R7EA 5FG8A 4QO9A 3D15A 4FC0A 4GRBA 4YJNA 4CMOA 4O0RA 3Q4TA 3RBWA 3V5WA 1ZARA 3G0EA 3SXFA 4D1SA 2OJJA 2XNMA 5HBEA 2RFSA 4MNFA 4O7NA 4DEDA 2HIWA 4CYJA 4V0GB 4BDBA 1ZMVA 4WIHA 2IW9A 3I0QA 3QLGA 4CRLA 3NRMA 4TTHB 4X7QA 4LV8A 1CDKA 4WSYA 1Q5KA 4KB8A 3MY5A 5C4KA 3WIKA 3MESA 2UW6A 3WYXA 3QQJA 2QO9A 4QP9A 3RPYA 4BDGA 4C4EA 3QQUA 4R1YA 2YDJA 5A9UA 1Z57A 2IZSA 3ORLA 1OIQA 2V55A 2VTHA 3FUPA 5F95A 1J1BA 4CCUA 5E8XA 4GFGA 4ZSAA 2GQGA 2BALA 3AQVA 2H96A 1KOAA 4QP4A 2OLCA 3KVXA 3ET7A 5IZFA 4KIKB 3ZFXA 1YVJA 4DTBA 3MS9A 1BMKA 3C4CA 4JR3A 1GZKA 2XNEA 3O96A 4HW7A 5AR4A 4TYHA 3DTWA 3DDQA 1M2PA 2KULA 4H58A 3EN7A 5I9ZA 1TKIA 3GU7A 3GUBA 3TZ9A 1NVQA 4QYYA 2XVDA 4FTAA 2QU6A 4YJSA 3RI1A 4KIOA 2WTKB 3PPJA 5E1EA 3Q9WA 3QXOA 3ACJA 3IGOA 3OXTA 4B4LA 4FT7A 4YPDA 4U9AA 2C5OA 2ZM4A 3EN5A 4K33A 3ZHPC 1X8BA 4O91A 5I4NA 4NM0A 2EU9A 2PHKA 3KF7A 4DEAA 4L8MA 2EB2A 3K3JA 2BFXA 1OZ1A 5L8KA 1WVYA 4B8LA 3L1SA 3EQIA 3QCYA 3PWYA 4PL5A 3SW7A 4XRLA 3E88A 3OWJA 2NP8A 3VVHA 4PL3A 3FAAA 4I92A 4WRGA 3BHTA 4FIGA 4C02A 4E6AA 1BKXA 2J0JA 3R9DA 2NNWB 5CF8A 4FV3A 4C0TA 5KMLA 4UWYA 4MXAA 3A8WA 3UNJA 1JPAA 2R3HA 3FQHA 2Z7QA 4WT6A 4FZ6A 4F78A 4M13A 5CNOA 1Q4LA 3QBNA 5DIAA 3VQHA 4M69A 4TKSA 4C57A 4X3FB 4AUAA 3K2LA 4G3EA 4EOMA 4AZTA 2WTIA 4XV2A 5M4FA 4GFOA 3UO6A 4HVHA 2WMTA 3PJ3A 3WBLA 1URCA 2BRMA 4IE9A 5FBNC 3F66A 4BDHA 2IVSA 4ITJA 4BDAA 2VGPA 3BU3A 3HRFA 2W05A 3NYVA 4GMYA 4X2GA 2YEXA 3BE9A 5CI7A 4C35A 3KU2A 3V5PA 3OROA 5FBOA 4F7NA 4AQKA 2XP2A 3FZSA 3W2SA 2UW7A 5J87A 5LMKC 4AP7A 2VV9A 2PVJA 4WOVA 3W2PA 5KKRB 2F7ZE 3WZKA 5FTOA 5AR8A 4BCQA 4MK0A 3I79A 2XF0A 3OHTA 4D9UA 2CGVA 1XH9A 2X9EA 5ANDA 2BPMA 3P08A 3SC1A 3VHEA 2CLXA 3A2CA 1UA2A 1ZLTA 2Q0BA 1GIJA 4G5PA 4D2VA 4UMPA 4MEDA 4RJ5A 3RVGA 3ZDIA 2B7AA 2CGXA 3U54A 4QNAA 5EDQA 2UZEA 2EXCX 4PPBA 3WF9A 4EUTA 5J95A 5M4CA 3AMBA 2WTDA 2ZV7A 4ITHA 5JFWA 3HP5A 4MNEA 5AP0A 5IA2A 3QTWA 1J3HA 5IKWA 4IWPA 1PMEA 4E20A 3NW6A 4RMZA 2WHBA 1OGYA 3EH9A 2Y7JA 5L2QA 1CKPA 4C58A 3UOJA 3BZ3A 3PY3A 2PVNA 3LM5A 3CKXA 3N51A 1JBPE 4M8TA 1P14A 3QKKA 1AD5A 3BIZA 4IX3A 5HBHA 3WI6A 3WZDA 4YO4A 2OK1A 3EIDA 1NA7A 1JOWB 1MP8A 4WRSA 3UMWA 3GB2A 3QQGA 2R9SA 3FYKX 4F1TA 2YITA 5ANIA 2VWWA 1W2DA 3MB6A 5KMOA 4GVJA 3LFQA 4J97A 4GYIA 2XANA 4O6EA 2XEYA 2UVYA 4RJ7A 4EWQA 3F3WA 3Q9YA 4YLKA 4ZK5A 1PYXA 4BI0A 1L8TA 3PJCA 2XK9A 3R63A 2E9VA 2CCHA 3I1AA 4FNXA 5CAUA 4BBEA 2VTAA 3BKBA 3MPAA 4I24A 5BVEA 4OBOA 3F7ZA 4KWPA 3VJOA 3HV3A 2Z7LA 4MBIA 4ASZA 3GP0A 5IMXA 4EOPA 5AUTA 2C3JA 2OZAB 5IQAA 1W2FA 1SVHA 3VS7A 3DNEA 5JMSA 3ORXA 3DJ7A 5I0BA 2B9HA 4RPVA 5BYZA 2XA4A 3P79A 4RA4A 1DI8A 2FUMA 4BWKA 4NZWB 4O2ZA 3V5LA 3UIUA 4Z7GA 2FSTX 5L6WL 3HVCA 3HMPA 5AP1A 4R78A 3VS1A 1IG1A 5KMMA 5ANOA 2C6TA 2VO0A 5IF1A 5GZ9A 3S95A 4G31A 4YMJA 5JFVA 4J71A 4QD6A 4AE9A 3O0GA 3FSKA 5HE0A 3FC2A 4PMSA 3W8QA 4FEWA 3HMOA 4CT1A 3HNGA 2OIBA 3KCKA 3PA3A 5EYCA 4A7CA 3DFAA 4CCBA 4GU9A 2XIRA 4E93A 2ZB1A 3HA6A 4KUJA 3D4QA 4FSNA 2PE2A 4DFYA 2C0TA 4M0ZA 1ND4A 5TE0A 2R64A 4ZJIA 2C6IA 4O0TA 2XJ0A 5TKDA 3Q5IA 3TUBA 4ENXA 3SXSA 2F9GA 3POZA 4TYGA 1NVRA 4RWKA 4I94A 4EEVA 4D2TA 4O84A 1OI9A 2X2LA 3EN6A 4RQKA 3LCTA 3PWDA 3R04A 5HORA 5IH6A 2DWBA 1QPEA 4CZYB 2FH9A 3ODZX 4PL4A 4D5HA 3QZFA 4W4XA 3F2RA 3LXKA 5LJJA 2PYWA 2B53A 3KL8A 3EZRA 5M07A 4E6QA 3P7BA 3DXNA 3SD0A 5HBJA 1XBBA 4BN1A 2ZJWA 3TKHA 3LCSA 5A14A 2WGJA 3KVWA 4FT3A 3DBCA 4U6RA 3ZLXA 3C5IA 3DLSA 3E62A 5JZNA 3N4TA 5IA4A 2WQMA 3BHUA 4AT5A 2PVHA 4H39A 2GTNA 5DLSA 1OKYA 4BKJA 5AV1A 1OPJA 2XYNA 3MVHA 3UYTA 5IG1A 3DAKA 3D5UA 3MJ2A 4NK9A 4WNOA 2FVDA 5HIDA 4QPAA 2BMCA 2CN5A 3M11A 3DY7A 3OW3A 4WNKA 4BR3A 4NW5A 5ETCA 2OBJA 2IW8A 4F9WA 4IBMA 3TDWA 3KXMA 4FTKA 3MPMA 4YZCA 3BX5A 3QZIA 4I4EA 2P0CA 3R71A 3F61A 4ANNA 4B9DA 4QPSA 4RIYA 3AD6A 3ODYX 2C1AA 5EOLA 4DEEA 5EOBA 4F6WA 1IEPA 2XIXA 4EYMA 4QMQA 3F5GA 4NEUA 1Q3DA 4ZZNA 4JBQA 1DI9A 5EM7A 4JR7A 4D4RA 2BRHA 2YA9A 3KREA 4X6QC 1S9IA 3BV2A 2PMNX 3VBWA 4H05A 4LMUA 4USDA 1G8SA 3D5WA 5AM7A 2VNYA 3KULA 3AT2A 4HPTE 2WEIA 5HG8A 3RHXA 3FBVA 4K2RA 2ACXA 4FKOA 3II5A 5HQ0A 4FSMA 3RTPA 1FGIA 2CKPA 1FINA 3F3TA 4FKSA 4NKAA 3G15A 3NNUA 1U54B 5AUZA 4AXAA 3QTQA 1XH8A 4O1OA 4NU1A 3D9VA 5KMIA 3DQXA 4M0YA 3BCEA 5AV2A 4AGDA 5CU6A 4DGGA 4JG7A 4JRNA 5JH6A 2ZMDA 2YLFA 3G6HA 4FV9A 5EW9A 1R0PA 3O23A 3K3IA 3DKFA 3TL8A 5AX9A 5DT4A 3QD4A 3ZBXA 1XHAA 4QYHA 3QX4A 3EQCA 4EOJA 2BTRA 4BGHA 2W1EA 1FOTA 4DTAA 4W4VA 1PHKA 3QUDA 4W9WA 2B54A 4BYJA 2CGWA 3JPVA 4BYIA 4AA0A 2IF8A 1VJYA 4TRLA 2X7OA 2IZTA 3GQIA 3CD3A 4U3ZA 3W8LA 3BEAA 3ZUTA 5A6NA 3LQ3A 3UZTA 1H8FA 2JBPA 4AF3A 1PXNA 2ONLA 2C6DA 4HYSA 5L3AA 4UXLA 4BVUA 3LFSA 2JD5A 2X0OA 4G5JA 2CJMA 3VJNA 2OWBA 4KS7A 3GU5A 3NCGA 4RWLA 3AD5A 2RFEA 2HELA 2R7BA 3D5XA 4YHFA 3WF8A 4BKZA 2BDWA 5AM6A 3F82A 4DHIB 4IDTA 1NW1A 2G01A 3Q6WA 3CY3A 5I9XA 2W1CA 4RJ6A 2WKMA 3P86A 2ITUA 4HVSA 4PY1A 2OFUA 5AJQA 4RJ4A 3GCSA 1YQJA 4TZRA 1S9JA 4NCTA 2J0MB 4BWPA 3GXLA 4FSZA 1BL7A 2JDVA 2W4KA 4L01A 3HMMA 3BU6A 4IX5A 1OM1A 4Z3VA 2IG7A 4HGSA 2PUNA 4N4SA 3FPMA 4DHFA 4OGRA 2WAJA 3MFSA 4PWNA 2PE0A 3ZXZA 3PZEA 2AYPA 4AG8A 1J7UA 3EMGA 3GC9A 3O2MA 2BZIB 1F0QA 2J9MA 2W06A 3OP5A 2X7GA 4K11A 3DK3A 5AAFA 4EOLA 3QC9A 3MDYA 4GG5A 2VX3A 5JQ5A 5IQIA 4Y83A 4EZ5A 4R7HA 2Y4IB 4YC6A 3FXZA 3GENA 4WO5A 4R8QA 5HVKA 2X0QA 4FL1A 3E7VA 3PG3A 2UZLA 4BCIA 2J5FA 3W2RA 4U42A 2VUWA 3F7WA 5GINE 1PF8A 4L3JA 4FNZA 2YCRA 3K5VA 4ZZOA 4USFA 4GKHA 4F0IA 5M08A 3BYMA 1GZNA 3DS6A 4FI1A 4PV0A 4ZS0A 4XJ0A 3V01A 5HG9A 1PMNA 1H1SA 1FBNA 3RPRA 2GS6A 5EQEA 3ZRLA 3JVRA 1WAKA 3PFQA 1UU9A 2ZAZA 2QCSA 3PSCA 5FDPA 4DHJA 5EHLA 4J8NA 3HRBA 1YHSA 3UQCA 5HX8A 3H30A 5DR9A 4FSTA 1XBAA 2F7EE 3AC3A 4ACGA 4LL0A 5GJFA 4AA4A 5B7VA 1WBNA 5DGZA 3VUMA 5LVNA 5J9YA 3TMOA 3OTVA 3MN3A 3C4WA 3LKMA 3D14A 3QZHA 4AGWA 3IDCA 2R7IA 5E8SA 5E91A 5IA5A 5HD7A 1QPDA 4BTFA 1WZYA 4YZNA 5J5TA 5CEKA 2C5NA 4R5YA 5A46A 2Z02A 4IQ6A 2XARA 4F6UA 3R00A 4JDKA 3CGFA 3F2NA 4HGLA 3A4PA 4I41A 3PYYA 2X9FA 4FV8A 4AZWA 3HLLA 4L44A 3P4KA 4BIDA 5EKNA 2IVTA 1ZYSA 4FTQA 3CTQA 4M12A 3QQFA 2WFYA 4AQCA 1ST4A 4H1MA 2YABA 2R3MA 2QR7A 2WTKC 3DU8A 4YZMA 2ZDUA 4RZVA 4EL9A 4RFYA 2UW3A 3A99A 1ATPE 1YI6A 3I0OA 3MW1A 4O81A 4KBCA 1H1PA 2EUFB 2ETMA 3W2QA 2UVZA 3QD3A 5CSHA 3L8XA 2WQOA 1F3MC 3AG9A 2WTCA 4QMXA 4R7BA 5LCKA 1GAGA 4C7TA 4D2WA 4ZAUA 2HCKA 1Y91A 4JIAA 4EZ7A 4CFFA 4C3FA 1PXIA 1Y57A 3NSZA 3HDNA 2QD9A 5KE0A 2ITZA 4E8AA 3OT8A 4C59A 3VBYA 2XRWA 2I40A 3GVUA 4GS6A 4IDVA 4MQ1A 3QQHA 3VNTA 4F1OA 2OXXA 3JUHA 3FY0A 4Y5QA 5A4TA 3TNIA 3ITZA 3Q9XA 3LPBA 3JXWA 4K77A 1WBOA 5E8YA 4A9SA 3U9NA 3L9LA 1WMKA 5JGBA 2YJRA 5LMKA 4AXCA 3NFFB 3I6UA 4FKWA 3DJ6A 5FEDA 2W5HA 2CHLA 4AN3A 5A4LA 2X8IA 5CNNA 4O7SA 3NVKI 4GK4A 2WMBA 4F7SA 2NRYA 2UW4A 4AXFA 5ANGA 2HW7A 2QG5A 4MXYA 3O17A 3T3VA 1XH5A 4H36A 2C4GA 5KKRC 1Q8YA 2RSVA 2WU7A 3UC3A 2OKRA 4GL9A 4F63A 1H0WA 3L9NA 4J95A 4K9YA 4EQMA 3FLYA 2RG5A 5CSVA 4EWHA 4LOOA 4FTLA 4Y72A 3BBWA 3C13A 4TY1A 4MYGA 4IX6A 2IEWA 2GSFA 1XH4A 1ERKA 5DT0A 5CXZA 5GIOE 3OY3A 2UZOA 5G1XA 4FVRA 3E8NA 4FKQA 3EQRA 1YHVA 4FTRA 4E7WA 3C9WA 5LARA 3ZC6A 3MY1A 3TKIA 4O4EA 5HO6A 4F6SA 3V8SA 5IQFA 2VWZA 3ORZA 3ALOA 5H8EA 1WBSA 2PVFA 2GNIA 3NX8A 4IJPA 1YRPA 3NLBA 4DFUA 1OBDA 4N6YA 2BUJA 3DXPA 4YHJA 1TZDA 1JKTA 2PU8A 4UY9A 2B1PA 3BV3A 2VTJA 1J7IA 5AX3A 2VWVA 2UVXA 2A2AA 4P2KA 4TWNA 3SLSA 3HYHA 4CRSA 5AEPA 2XBJA 5EM5A 5KMNA 5CENA 1BUHA 4BI2A 2BIKB 2X39A 3PIYA