2QOBA

Human epha3 kinase domain, base structure
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
298
structure length
279
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITRPSNLLLDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 279
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qobA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qobA01
4CQEA 4USFA 4R1YA 3Q60A 5CX9A 2V62A 3FMKA 3GT8A 5GJGA 1WVWA 3PPKA 3WZEA 2EU9A 2FYSA 2OH4A 4BCJA 4ACDA 1ZOHA 2V7AA 3A4PA 4GS6A 3SA0A 1GNGA 3AT3A 2BZKB 3CC6A 4G3FA 4QYEA 3HX4A 4C35A 4JAJA 3ZBFA 3Q52A 2VO7A 4NM5A 4RWJA 4EK3A 3PY0A 1Q61A 2WTCA 3LFFA 3T3UA 3QQJA 4ZS4A 2W4KA 4CXAA 4LOQA 3P7CA 4USDA 4OT6A 4UEUA 4QMMA 5M53A 4ZZNA 5F94A 2YDIA 4BWXA 4CZYB 3UQFA 2AC5A 2I0YA 1ZMUA 3MH0A 4MF1A 3V5LA 1SVEA 4FICA 5E92A 4GK3A 5EYMA 1PKDA 3VS6A 4R7BA 3MY1A 4I24A 4BGGA 5AR8A 4F0GA 5HTCA 4FIIA 3CY2A 4MXAA 3SC1A 2YIQA 1ZY5A 4C4IA 4J98A 4XJ0A 1L3RE 1BI8A 4BYIA 2BAKA 1J7UA 3R73A 3O8TA 4IVBA 5CEPA 3ORIA 4Y5HA 2ZJWA 4FL2A 4XMOA 2YFXA 5FWKK 4ALUA 3UMXA 2ZV9A 4EJ7A 1JSVA 4PDPA 4RGJA 4FV2A 1L8TA 1PXMA 2YM3A 2XNOA 3GP0A 3I79A 4U3YA 3TNQB 4BFMA 2NRYA 2FA2A 2BHEA 2CGXA 3HNGA 3LOKA 4S31A 2QU6A 4FKOA 3P78A 4FT9A 3TNPC 4BHNA 4O96A 4OBPA 3OEFX 4S34A 4BRXA 5L6WL 4A9RA 3QZGA 1MRYA 4FT3A 3A7HA 1R0EA 2WU6A 5AP3A 3VUIA 2YZLA 3FY2A 4JIKA 4QMVA 4W9XA 2W9FB 4NTTA 4Q9SA 4M69B 1W82A 2JDRA 5A6OA 2Y4IB 4C33A 3RHKA 1AD5A 3OWLA 3QHWA 4G6LA 3FDNA 4QRCA 3ZRMA 3PSBA 4JJRA 4FT7A 4PMMA 4G34A 5FDXA 1HCLA 2HCKA 3JUHA 3NUXA 4FKUA 4I5CA 4CTCA 3DNEA 5J1VA 4X2NA 4M67A 3ORMA 1ND4A 3NIZA 3U8WA 4C58A 5IF1A 1IASA 3VN9A 3KXHA 4QP7A 3OBJA 1XHAA 3OHTA 5FTOA 2HWOA 4X2KA 1HCKA 4AE6A 3T3VA 5A4LA 4II5A 4QNYA 2WIPA 2YM8A 4OTDA 1JOWB 3I0QA 3JY9A 4DCAA 5D11A 2WHBA 2QHMA 5EK7A 1A48A 2C1BA 4IVCA 4DG3E 2WPAA 5C26A 4X0MA 5J87A 2P2IA 2C6MA 3RTPA 2PSQA 2PHKA 4LGHA 3IK3A 3RJCA 3VQUA 4H1MA 3DNDA 2OIQA 4DFLA 3S1HA 1DM2A 4P90A 3ATSA 3F3UA 4FIJA 4ZTHA 4PWNA 4OTRA 2C6IA 4RQVA 5AUWA 4K11A 4DN5A 4FKRA 2UZEA 2X7FA 5CU4A 3BGQA 4AA4A 4D2SA 3KMMA 4E6QA 4OAVB 1BUHA 1PXJA 3C4CA 5BYLA 2FSMX 5TKDA 5K5NA 4JBQA 3CPCA 3OC1A 4K0YA 3B8RA 1ZARA 3EIDA 3MWUA 4OBOA 5DNRA 5JEBA 4LOOA 4XYFA 5HCZA 3GQLA 3SDJA 2XK6A 4FTKA 2P55A 3F3WA 5E1EA 3HDMA 4NM3A 5CT7A 5FQDC 4RJ4A 3NYNA 3EN7A 4FUXA 2FSOX 4V01A 2V55A 3R9NA 3I6WA 5CSHA 3UVRA 5E8TA 4HYIA 3WIKA 4GKHA 3CSVA 2WMUA 5KMLA 1OKVA 1WCCA 3SW4A 3AD4A 2QC6A 2WTKB 3FLNC 3V6SA 3F3ZA 2UZLA 3N51A 3PE1A 4FSWA 4XS2A 3AC2A 2JC6A 5LVPA 1O9UA 2GHMA 3MTLA 1OIRA 4MBIA 1H07A 3IONA 4GYGA 4F9BA 5F95A 4BTFA 5A4EA 4YJOA 3UYSA 3MY0A 3ZO3A 3FE3A 4OTHA 1Z9XA 3TZ7A 3H3CA 2A4LA 3KXNA 4BCMA 3PVWA 4ACMA 4F6UA 3QX4A 5JGDA 3U4WA 1J7LA 5J9YA 3W2CA 4QYFA 3FJQE 4EH5A 2VWVA 5HIBA 5IQBA 4M97A 3LCSA 2HELA 3KF4A 3PXQA 3QFVA 3CPBA 1QCFA 4TKSA 4FKPA 3EB0A 4XH6A 4EJNA 4F64A 2IZSA 4FKQA 4C38A 3LE6A 4AA0A 2QOLA 2ITQA 4QMZA 5FRIA 2C69A 3F6XA 3O96A 1OPJA 3OY1A 4MD8E 5CF6A 1YHSA 3ZEPA 3TV6A 2C5XA 4YTHA 1GIHA 4U97A 1B39A 4OAUC 3ANQA 5BYZA 2ONLA 2PVRA 2XP2A 4MYGA 3VWAA 4MNEA 3PRFA 4FT0A 4F7SA 3JVRA 5HD7A 3VUTA 4MEDA 3VW8A 2Z2WA 4R7IA 3NNXA 4O0WA 4QMOA 2O8YA 2OF4A 4EWQA 3L8XA 1DS5A 4DGNA 4UBAA 4BKYA 4FF8A 3NW5A 2ESMA 2O64A 4UY9A 2YJRA 4IFCA 4QPMA 3CR0A 2Y6MA 4M68A 4MBLA 2J0IA 5JSMA 5IEYA 3FPQA 2DQ7X 3OXZA 4LMUA 4XV1A 5E91A 2Q83A 3QD4A 4FEXA 2C1AA 5HBJA 4MVFA 5HX6A 4JQEA 2CKEA 4M0ZA 5D41A 3AD5A 5L2TA 2QR8A 4KIQA 3L8PA 4QP3A 3OFMA 1W83A 4C61A 2QOHA 2A19B 4JBOA 4X3FC 4YC6A 3FL4A 2YM7A 4D2TA 4RFMA 4YU2A 2X2MA 4YZCA 4FKSA 4KSQA 4LI5A 1PKGA 2ZB0A 4Y83A 4DBNA 3OMVA 4NSTA 4RX5A 3KREA 4AZTA 3RGFA 4EH6A 3DU8A 3E88A 3S0OA 5E8VA 4YNEA 4ASDA 1QPJA 5DFPA 5KBQA 4A06A 2WMXA 4BB4A 2BTSA 3ZHPC 1FPUA 2C3LA 3CQWA 3GBZA 4Q2AA 4A4OA 4D4RA 3R9HA 4I6BA 4BDKA 1YI4A 2IZRA 2R2PA 2E2BA 3LXLA 4G3GA 4BR3A 3UIBA 5HLWA 5LWMA 4FV3A 5IA4A 4YPSA 3Q2JA 1F3MC 4I20A 3R00A 3TV4A 4EH9A 3KMWA 5AR5A 3D2KA 3RCJA 2HW7A 3CKWA 4WA9A 2XCKA 2VU3A 4GVJA 3TNHA 2I40A 3BX5A 3S3IA 2FO0A 4Q5EA 4I94A 3QWJA 3N9XA 1O6YA 1U54B 5J9LA 3FYJX 5AUYA 3KY2A 4EKLA 5FBNC 2WTVA 3PLAE 3QUDA 4Q5HA 3FQHA 4RVLA 5FM2A 5IA2A 3PA4A 4HGLA 4U42A 4BGQA 5HNIX 3DFAA 4TYJA 3ORNA 5J5SA 2EVAA 2UW7A 3QTWA 4F0IA 3C13A 4O6LA 2YLEA 5HG5A 5HESA 3WE8A 4E5WA 3LFCA 4WNKA 3BBWA 1H24A 2B54A 2WQOA 2YWVA 1YXSA 4CT2A 3DK7A 4FKGA 3AC8A 2NRUA 4DFUA 4FSNA 1WVXA 3FQEA 3HMPA 3R02A 3TIZA 4Y85A 3PG1A 4L00A 1J1BA 4NJDA 1Q62A 4O1OA 4UZHA 5CSWA 4YHFA 4BI2A 3EWHA 3AQVA 4YBJA 3UPXA 2VX0A 1M7QA 5JFSA 4KKHA 3EKKA 2P0CA 5CVHA 2OZOA 2XNEA 2YZAA 3BLRA 3KRWA 4CYIA 4E1ZA 3HMNA 3QYWA 2XH5A 2F7ZE 4CFFA 1BL7A 3RK7A 2H96A 4FTAA 4H3QA 3HP5A 2VTJA 2CDZA 3HV3A 4EQCA 4ZTLA 3QTIA 3FZPA 2REIA 4IHPA 5CF8A 4RIOA 3IW5A 4QOXA 1UKHA 2WQBA 4FSZA 4ANOA 4HVHA 2R0IA 1OL1A 3NGAA 3M2WA 4HYSA 3NW7A 3BQRA 3B2WA 5I0BA 3EN9A 1V0PA 2BKZA 4XG9A 3OZ6A 4FEUA 1OBDA 4FE2A 4D58A 4IWOA 1PY5A 1FGIA 2IVSA 4JT3A 1Q8UA 2GTMA 3I7CA 2VTLA 3RINA 3NS9A 2XKDA 3DA6A 5GJDA 4QQJA 5AUTA 1YRPA 3QCQA 1YHWA 3IG7A 3PVGA 3LAUA 2JFLA 4RG0A 5J8IA 4CEGA 5M4CA 4FV6A 3KN6A 5L6PA 4CCUA 4G6OA 5AP2A 2GSFA 3LHJA 5HLPA 5HO8A 3WYXA 4EORA 2UW0A 4ITHA 2JIIA 2W4OA 4JS8A 2W1GA 4DH5A 3DOGA 4OGRA 2J0KA 5BVEA 3M1SA 2ITOA 3PJ2A 3HRFA 3MBLA 3TXOA 3FMEA 1W84A 4W9WA 3ZRKA 4AW2A 4ZMEA 4LGGA 3VNTA 1SNUA 4DA5A 3D0EA 2VTAA 3UNJA 3LM0A 4ZSGA 2EXEA 4E73A 1CKJA 5E7RA 3A7GA 4CD0A 2IW9A 4U40A 2ZAZA 4EHVA 3NVKI 4FEWA 2V7OA 3MTFA 3TDWA 4B8LA 1OZ1A 2C5YA 4J71A 5F4NA 1VJYA 3BWFA 5LWNA 5CEKA 5HU3A 4XG3A 5TE0A 4A9SA 4WO5A 5DE2A 2IZUA 3ODYX 4EEVA 1Z57A 1WVYA 5M56A 4F1MA 2I7QA 4QYYA 5G6VA 4M15A 4MBJA 1UU8A 3DS6A 4U43A 4E4LA 2XNBA 4HGSA 5AAFA 3QUEA 1ZYSA 4ARKA 4ENXA 3R7IA 3FMMA 3U51A 3Q5IA 2BDJA 2LGCA 3GXLA 1J7IA 2B7AA 5J5TA 3DBFA 2VO3A 3VBVA 1U59A 5ANIA 4UWBA 4PL4A 4F7NA 3D4QA 3RALA 4UYAA 2NPQA 2PMOX 5DBXA 4XG2A 4I41A 4ZLZA 3E5AA 1M2PA 1CTPE 3PFQA 3W55A 2ZMCA 4L01A 2WMQA 4BDGA 4BCIA 2BRHA 5CU0A 3LM5A 2XKEA 5KZIA 2J50A 5EM7A 4FVRA 5EI8A 3R7OA 5EQPA 4TZRA 4WSYA 1JAMA 1T46A 5BUEA 3DBCA 1R3CA 2QURA 3CQUA 3EFKA 3BYMA 4XUFA 1YI6A 1OVEA 3CKXA 1CDKA 2OFUA 5CI7A 3AG9A 4QD6A 4DG0E 1F0QA 5GIOE 2BAJA 2ITVA 3A7FA 3FHRA 4O22A 3DK3A 2YM6A 3Q5ZA 2W1HA 3ORZA 4IAIA 1FMOE 1WFCA 2QO7A 5EDPA 1KOAA 1PXNA 4EH8A 3THBA 3QLFA 2Z8CA 5CI6A 4I0RA 2YWPA 4FG8A 5DH3A 2VUWA 4QP8A 4EC8A 3R8MA 4L42A 4KABA 5AV0A 1JSUA 2R3HA 5E8YA 4ALVA 1RW8A 5J9ZA 3U54A 5H9BA 2YEXA 3A7JA 4YSJA 5EHOA 2X4FA 5D7AA 4EBWA 5E9EA 4WIHA 3HDNA 2KULA 4ZTNA 2YJSA 4ZY5A 3DTWA 4U9AA 2XM9A 4OTQA 5KO1A 2XVDA 2YISA 4L46A 2W1FA 3KEXA 3RNIA 3BU3A 4JXFA 4BN1A 4EYMA 3D14A 3ZMMA 1P5EA 4O6EA 3NAXA 2C4GA 2DWBA 4ASXA 1R1WA 3UE4A 3DV3A 3NNVA 4CFXA 3AD6A 5KZ0A 2BRMA 3PJ1A 5TO8A 1P14A 4ZTSA 3FLSA 2OG8A 4R5YA 4XG8A 4XLIA 5B2LA 3TG1A 5M08A 2EXCX 2F9GA 2BMCA 2PE2A 1GZKA 4E93A 5JFXA 3KB7A 4X2FA 2WOUA 3FZTA 3RAIA 3AOXA 4TYEA 4EOLA 3L9NA 1VYZA 3QGWA 3GC9A 3VHEA 3BWJA 4QMYA 2J5FA 5LJJA 4YHJA 5JQ8A 4LYNA 3PPJA 3NZ0A 3DLSA 3KL8A 3WZJA 3FHIA 3AC3A 3C51A 4IB0A 4E26A 2PVKA 1DAYA 4FYOA 5CAUA 4TN6A 4YJVA 5J79A 4C4GA 2JFMA 4G3DA 4X7QA 5BVWA 3DFCB 2VTPA 4XBRA 5IQHA 3F7ZA 4FZ6A 5EYCA 4RC2A 3U6IA 3HECA 5EH0A 3UNZA 2XNMA 4BTMA 5F20A 4JL9A 3PUPA 3R8VA 5ETAA 2GQRA 5KMKA 3W18A 2BILB 5TOZA 2C5NA 2QQ7A 4HZRA 3K5VA 3L8VA 3GFEA 4X3FA 3MVMA 3W1FA 2YLFA 1U54A 4D9UA 5FXSA 2ZVAA 5IEXA 3D2IA 3LJ2A 4BHZA 4DITA 3NNUA 3JXWA 4AOIA 3TZ8A 5BVNA 3E3BX 3OW4A 4KKEA 5LARA 4FI1A 1BI7A 3BEGA 3W2OA 2VN9A 5GNKA 4U3ZA 4CG9A 2J6MA 2O65A 2OSCA 4YGAA 3ORKA 4UMPA 4D28A 3PDTA 2DYLA 1KOBA 1M7NA 3NUPA 3PJCA 4NWMA 1FGKA 1H1WA 4BCHA 2ZV7A 4AGDA 3SLSA 2B53A 5IDPA 2PVMA 2VD5A 4YPDA 2X8IA 4XNEA 3WE4A 4KBCA 4XRLA 3PLSA 5EDQA 5HO6A 4JBVA 5JRQA 1UVRA 3QZIA 4S2ZA 3ODZX 4BDAA 2B0QA 4DEIA 3TUDA 2UVZA 3VW6A 4R6VA 3MH1A 4E5AX 3I1AA 2HZNA 1OMWA 3ZC5A 4H3BA 3BU5A 3OOMA 5EM6A 5FTQA 3RKBA 1REKA 4EOOA 2JLDA 4O7RA 5DEWA 2R5TA 3E3PA 3Q32A 3ZC6A 1M52A 4HOKA 4D0XA 3EL7A 3LFNA 2X7OA 2IVTA 2R4BA 2XK3A 3IGOA 4AN3A 4ZAUA 1LEWA 2B4SB 3OF0A 4RJ5A 3AT4A 4GG7A 5CSXA 2WQNA 2IWIA 3F5PA 1XO2B 4FV5A 3MIYA 4IB1A 3VUMA 4ANNA 4KIPA 5IPJA 1Q99A 5ETCA 1OITA 3ZRLA 4L7SA 3UP7A 3HV5A 2Y8OA 4IDTA 3G51A 4XP2A 3UVQA 4OT5A 4OUCA 5J7HA 4AQCA 4DTKA 3H10A 5DI1A 4L43A 4V05A 4IX4A 4JQ7A 2R3IA 5IMEA 3Q6WA 5IQFA 1Q4LA 3PXYA 2QONA 3TN8A 4HYHA 3HUBA 2X39A 4LM5A 2OLCA 4IX3A 4QP2A 5HTBA 3R83A 4E6DA 3VHKA 3HGKA 1FBNA 4MXCA 4U44A 1KE8A 5KCVA 4K9YA 4FNWA 4N4SA 3M11A 4NJ3A 4PPBA 3DB8A 3PA3A 3QC9A 3E7OA 1YXXA 4JNWA 1QPDA 4KBAA 1PXIA 4AWIA 5CY3A 3R2BA 3ZUUA 2WMTA 3UDBA 3RWPA 4DFXE 2JDOA 3FEGA 3DK6A 4FZDB 5GJFA 1ZWSA 5F9EA 3OP5A 5HNGA 2FUMA 4K2RA 2JIVA 4AT4A 5CZHA 4CKRA 4J97A 2QOFA 3GCUA 4J8MA 4F99A 4KINA 3UIMA 3R8LA 5JFVA 4XCUA 4OTFA 3Q4ZA 3FI2A 5IUIA 1H0VA 4DEEA 4FOCA 2JIUA 1H26A 4ANQA 4A07A 1REJA 3L8SA 4J53A 4DG2E 1XH9A 3BYVA 4C3RA 4FV8A 4TWOA 5KE0A 2C6DA 2ZOQA 1QMZA 3MFTA 4BDJA 2QO2A 2W5HA 4PPAA 3JS2A 4KKGA 5ANEA 4IWQA 3I60A 3ALNA 5IH6A 3G15A 4GUBA 4RJ8A 4RSSA 3OT3A 5DHJA 3ZSGA 4DTAA 1BMKA 4IAKA 4L44A 4MXXA 4CV8A 2X6DA 3ULZA 4PPCA 5HE1A 4L67A 4A4LA 2XMYA 2W1CA 3KCFA 3D94A 3O7LB 4CNHA 3E63A 3LVPA 3LFBA 3AXWA 4BIBA 5KMNA 3GCSA 4PMPA 3ZO2A 2ITTA 4DGLC 4U5JA 5I9UA 4AW5A 3RPRA 3EFWA 3FMHA 3W10A 4PQNA 4NZWB 4F6SA 3V6RA 3I5ZA 5HG9A 4FC0A 3ZM9A 1Y57A 2VNYA 3K2LA 4G3EA 4EOIA 5A54A 5KX8A 5EKOA 4N70A 2RSVA 4O7ZA 1QPEA 3FXWA 2X6EA 3UGCA 4BCQA 3O50A 1I09A 5CNOA 2IVUA 4WG4A 5HNBA 5L2WA 5C03A 2R3GA 3QWKA 4Z7GA 2CGVA 4BDDA 1CM8A 3OTUA 3QRIA 4K6ZA 2Z7QA 1JBPE 1YWRA 5KHWA 3D83A 2VTRA 1YQJA 4IAZA 1H1PA 2GNLA 4JG8A 4B9DA 4C4EA 4GIHA 2HAKA 4QMLA 3EQRA 4NL0A 5EQEA 3PYYA 3OWJA 2VNWA 2YHVA 4GMYA 4U0IA 4L3PA 4DEDA 5E1SA 2XNPA 2OKRA 3ZYAA 3ZXZA 3Q4CA 5LVNA 1OL2A 4GFGA 4IACA 4FOBA 3MFRA 1YI3A 4WKQA 4YO4A 4QMUA 4WRSA 2XIZA 3KXMA 4IADA 2XYUA 3UVPA 3GU6A 1TVOA 4RWKA 4X21A 5L8LA 4Q9ZA 2BTRA 2OXXA 2IVVA 5JH6A 3GC7A 4M7IA 4HVDA 1YOJA 5IKWA 1MQ4A 4Z9LA 4G9CA 5CXHA 1PRYA 4EC9A 3E92A 5IISA 2R3JA 3DQXA 3HL7A 1PXPA 1Q8YA 3FYKX 4WG3A 2R3MA 4N6YA 2GU8A 5AV2A 3R30A 3W16A 4LFIA 3VS5A 4GUEA 5ANKA 3DLZA 3P86A 2QG5A 2J51A 4C02A 4YURA 2QG7A 2J0LA 3BBTB 3VS7A 3PY3A 2BVAA 2GQGA 2J9MA 3OWPA 3HAVA 2I1MA 3DZQA 2XM8A 2WAJA 4FIFA 4C0TA 4P5ZA 4D1XA 4ENYA 4FV1A 2VGOA 3FKOA 4H36A 3QRJA 4QTBA 1VR2A 5HE0A 4IM3A 2BCJA 3TTJA 3FV8A 2XK8A 5CSVA 3H9FA 4N0SA 5IA0A 3DQWA 2F2CB 3MS9A 1ZYJA 2WIHA 1ZMVA 4RC4A 2ZDUA 2C6LA 5HX8A 1YXUA 2BPMA 3HV6A 3FMJA 4BKJA 3H0ZA 3MVJA 3ZS5A 2R7BA 4OTPA 3E62A 4GCJA 4M8TA 5AV4A 3R8PA 3GEQA 5IMXA 2Y9QA 1NA7A 2AYPA 3F66A 5EKNA 1Q3WA 3QU0A 5HEZA 3RMFA 2GNIA 2R3LA 2ZDTA 3F2NA 2X9FA 5JZJA 4CFNA 3EQPA 4TWNA 4BBFA 5DPVA 3R6XA 2OGVA 4F09A 1W98A 2H9VA 2JKMA 3D9VA 4K77A 4L3JA 3U87A 2WGJA 4IVAA 4F6WA 4R3PA 4ZIMA 4R3RA 4AU8A 5EW3A 3F5XA 3HKOA 3KQ7A 4RMZA 4OLIA 1MQBA 5FP6A 3LQ3A 3VS0A 4ASEA 2G2HA 4F9CA 3LW0A 2FB8A 1XJDA 5CASA 4BIEA 4R78A 4XV3A 3P7BA 3R9DA 3NRMA 5EYKA 5CXZA 2XKCA 3TEIA 1LR4A 5BNJA 1ZYCA 5EW9A 3DT1A 2CCIA 4DFZE 4W4VA 4O7NA 1U4DA 4ACGA 4A9TA 1S9IA 2QLQA 3EN5A 2GTNA 3L9LA 4HPTE 4YHTA 4BKZA 3R22A 4G1WA 2XIYA 3LXNA 5M55A 4GV1A 4IANA 3RK9A 4FK3A 4XV2A 5EW8A 4EOMA 4EZ5A 3TV7A 2X8EA 2WEVA 3BHYA 3F69A 2DUVA 4HCUA 4I4FA 1GZNA 3SKCA 1DI9A 5HCYA 1R39A 4CMTA 2C6TA 3ZM4A 2R3QA 3C50A 4I93A 1UNHA 4ZJJA 3UG2A 4AZEA 5CAQA 4IXPA 3OXIA 2HZ4A 1KE7A 2CCHA 3FZOA 3MFUA 3F5GA 3R9RA 4EK5A 5IZFA 3LKMA 2UVYA 3LCOA 1SM2A 2ERKA 1AGWA 3OBGA 2QOCA 3Q04A 5CLPA 4B8MA 4ANSA 1W8CA 2C3JA 3TUBA 4C4HA 4MKCA 3ATTA 3R1QA 4GL9A 1G8SA 3F3TA 3DKOA 2E9PA 4FVQA 3ZTXA 5FG8A 3QTZA 4GEOA 2CNQA 3IW6A 1IRKA 3QQGA 3GNIB 4YZBA 4MWIA 5G1XA 3WZDA 2WELA 5LCJA 4W8DA 3ALOA 4TXCA 2WEIA 3WILA 4BI0A 4UMQA 4F1TA 4QMWA 2VWBA 4IH8A 1TQIA 1V0BA 3RK5A 5C4LA 1PXOA 2A0CX 3GCQA 4CZUA 4IVDA 1PMEA 4ZLOA 2F4JA 5CANA 3IS5A 4EHZA 4BCGA 4FNYA 4XHKB 1FVRA 4OBQA 4E4MA 5CSPA 4IE9A 3LXKA 3FLYA 2YIYA 1OI9A 2ITYA 4IAFA 4KRCA 4EK8A 4CV9A 4UMRA 4O7TA 1OL7A 4L45A 2ZV2A 4Z55A 5A4CA 3L9PA 5FP5A 4IX5A 4D5KA 4HZSA 4ZSEA 4ZTRA 5C9CA 3QGYA 4O27B 3ZLXA 2RFNA 2VO6A 5AR4A 2RFEA 4E5BA 3PY1A 4F7LA 3VUDA 2ZM1A 3HMMA 2W5BA 3U9CA 5JRSA 4M84A 3EN4A 3UIXA 2Y4PA 3QQKA 4IJPA 4OR5A 5LVOA 5TF9A 2GNFA 3UZPA 5CAPA 3TACA 3BYOA 5HHWA 3SQQA 2UZTA 4KNBA 3HRBA 4D2PA 4RFZA 2OJIA 3U6HA 3BELA 5D1JA 1Q24A 5AX3A 4YTIA 2B9IA 4NU1A 3LMHA 2WTWA 3GU5A 2BUJA 4RJ6A 4QPAA 5IA1A 5CT0A 4IB5A 3R04A 2OWBA 3DKFA 2BZJA 3NYXA 4DCEA 5JQ5A 4U6RA 5M09A 1NY3A 2OXDA 3RM6A 2OFVA 2X81A 3MVLA 3TKUA 4IM2A 3KGAA 1OECA 1GJOA 1VEBA 2A1AB 3SHEA 4C36A 1QPCA 1A9UA 3P79A 3TL8A 4NM7A 5IH4A 1WBOA 1XBAA 2P33A 4HVGA 4ZMFA 2ZYBA 4NFMA 3C0GA 5DOSA 2BALA 2QR7A 4RX8A 3V8WA 2X0GA 2Y7JA 4F4PA 3ZH8A 4C8BA 3WF9A 3QX2A 3R21A 3M42A 5KBRA 1O6LA 2JBOA 4RJ7A 4XG7A 2LAVA 3T9TA 4BDIA 4DEGA 3HAMA 2P3GX 2YCFA 3JPVA 4LL0A 3VQHA 2PPQA 3MJ1A 3O7LD 3OUKA 1Q3DA 4ZOGA 2G2FA 3SXFA 4E4NA 2JAMA 3NAYA 4IZAA 4AGWA 2B52A 3QLGA 4PTGA 2W99B 3VS4A 4P5QA 4X2JA 3FPMA 3NX8A 5B2MA 5EQYA 2BIYA 1M2QA 4BCNA 3RAKA 2C5OA 3COHA 4MX9A 4XLVA 5EM8A 3ZLSA 3II5A 3NCZA 5C8KA 4JLCA 4QP9A 5CF4A 5IG1A 2UW8A 2WTDA 4WD5A 4PMSA 3V5TA 4UXQA 1OPKA 3C5UA 2YITA 1HOWA 3QTQA 3EQIA 4HCVA 3G2FA 3QAME 5CU6A 4YTCA 3CXWA 4O83A 2GNGA 4U41A 4C2WA 3BYSA 4ZY6A 5ETFA 4DFYA 1ZOGA 5EFQA 4X3FB 4IBMA 2YAAA 2KTYA 3NPCA 4IJ9A 3FBVA 4NCTC 3KRJA 3P23A 3VO3A 2VTIA 3RPVA 1MP8A 3OD6X 5E8SA 3W2SA 4RVKA 4AZFA 2HK5A 4BYJA 2JAVA 3DXNA 4DH8A 4CKJA 2IW8A 3AMYA 3KVXA 1NXKA 5DT3A 3FWQA 2CHLA 4MH7A 3D5VA 5HCXA 2OJFE 5I9ZA 1UNGA 3SOCA 2R3FA 3QTSA 2OJGA 5LVMA 2YDKA 4CMOA 3SD0A 4RLKA 4NIFA 2WMRA 4N6ZA 2H6DA 2EB2A 4D4VA 2WMAA 1OKZA 1BX6A 3BZ3A 5AR2A 5AMNA 3FY0A 1SYKA 2IN6A 3QL8A 3D5WA 2XF0A 3VBWA 4I22A 3LCKA 2PMNX 3O8PA 2ITWA 4AGCA 5BPYA 3GOPA 3UPZA 3BHHA 3S95A 2O0UA 3BEAA 1OBGA 3WZUA 2O3PA 4QTCA 3KXGA 5ACKA 2PZPA 3D15A 3KN5A 4HYUA 5KKRC 4B7TA 2VX1A 3FMLA 4FZAB 3NLBA 4IM0A 2UZNA 1GY3A 5TT7A 2CPKE 5A14A 3R1SA 2V22A 4EOQA 5IUHA 3RWQA 3QF9A 2ITNA 2BAQA 4TRLA 3IECA 3V04A 4EHGA 3QRKA 3SX9A 1KE5A 4G3CA 4YLKA 4APPA 4L7FA 1IEPA 4IC8A 3REPA 4XOZA 4FX3A 1UWJA 4WSQA 4EBVA 4G16A 5GZ9A 3GU8A 2QI8A 5BVFA 1R0PA 3ACJA 3KRRA 3TNIA 4EK4A 4PMTA 5BVKA 3O71A 5DR9A 4GJ3A 2WNTA 3ANRA 1ZAOA 3R0TA 4ANBA 3FXZA 4ZK5A 5DEYA 4NT4A 4K33A 3EL8A 4ZS0A 5GZAA 3ZO1A 4JRVA 1OKYA 3CCNA 1WBWA 1GZOA 3F82A 3KXZA 1K3AA 4PL3A 1H27A 1QL6A 4L68A 3RVGA 4MCVA 1OGUA 4TYIA 4IDVA 5E8WA 2ETRA 4ZSJA 4C62A 4EYJA 1P4FA 4A4XA 3CJGA 1ZLTA 3BRBA 4G5JA 3DZOA 4S32A 4PUZA 2OBJA 3KK9A 5DR6A 1OL6A 4ACCA 4CZTA 3DJ6A 5H8GA 4CRSA 5AX9A 3UOHA 4BDHA 2A2AA 4J95A 2QOKA 5CEOA 5DA3A 4U8ZA 2IJMA 2GS2A 3NYVA 4TYHA 5AV3A 3RZBA 3FXXA 4M14A 4FKLA 4GU9A 4J52A 1YDRE 3D7ZA 2BRBA 4O0XA 5DRBA 3HV7A 4GRBA 4KSPA 2VTNA 3R9OA 2QLUA 3UZRA 2AC3A 3E8DA 1H08A 3FC1X 5IQDA 3OOGA 5EYDA 4R7HA 5JZNA 4NEUA 3FZ1A 4FUYA 4FZ7A 4RZVA 4TWCA 3KF7A 2PZ5A 5AEPA 1ERKA 1ZYLA 3ORTA 3QD3A 4FK6A 4UALA 1SVGA 1B6CB 4O0YA 4BDCA 3BHVA 4BIDA 1OIUA 3EQBA 4GW8A 4CT1A 1JKTA 5CF5A 3ZUTA 1XR1A 4PTCA 3I7BA 2UW9A 2C0OA 3MB6A 4H39A 3V01A 4D4SA 3TUCA 3S00A 3CQEA 2W17A 5AP1A 2WMVA 3KU2A 5BVDA 5L3AA 3TTIA 4FTLA 4BCOA 2GFSA 3MA6A 4DLJA 3QHRA 2CKOA 2UUEA 4Y72A 5ANGA 2FSLX 3CTHA 4RIYA 1H0WA 3OEZA 4IZ5A 3DJ5A 2ZV8A 2PU8A 3H9RA 4S30A 3LFSA 4S33A 4JQ8A 1WBNA 2QKWB 2B1PA 3IO7A 3A2CA 3NIEA 3QKMA 4YJUA 3MESA 3NEWA 2UV2A 4DAWA 3DBQA 3AC1A 5FUTA 3WF5A 1JNKA 2VWWA 2QOIA 5AM7A 3ORXA 1Y6BA 2PWLA 5CEQA 4MQ1A 3MB7A 1I44A 4IW0A 3SAYA 3UOJA 5GHVA 5KHXA 4AW1A 1WBVA 4K18A 3MJ2A 4IZ7A 1SVHA 4IIRA 2OK1A 3BE2A 4OW8A 1KUTA 4HGEA 3C7QA 2PMLX 5ANJA 3QQFA 4QQ5A 4KAOA 1OL5A 1M14A 4Y95A 5H8BA 4YC8A 2ITUA 4XEYA 4AT3A 3DAKA 5LOHA 3QQUA 2XRUA 4BY9E 2W9ZB 4FKWA 5F1ZA 1J3HA 2NO3A 2V5QA 2GS6A 4AZSA 4JBPA 4H05A 2WB8A 5C1QB 4U7ZA 1XQZA 4WUNA 3MPAA 3OXTA 3FKNA 3LMGA 4NK9A 3G90X 4CMUA 4DH7A 3E7VA 4RX9A 2BZHB 1BL6A 3VJOA 5AUUA 3SRVB 4WOVA 1XH6A 4IEBA 1SNXA 3CBLA 3LJ0A 5AP5A 4I5MA 4D2WA 4JG6A 5BMSA 3PRIA 5GZ8A 5CWZA 3UOKA 4GFMA 3U4UA 2VRXA 3UO6A 4J1RA 4K8AA 4DHFA 1E9HA 5IEVA 1YXTA 2WXVA 5D12A 1IA8A 3SOAA 4GU6A 5AP4A 4R3CA 4RIWA 3LIJA 1VZOA 2XS0A 5LMAA 4RJ3A 1JVPP 3CS9A 2Z7LA 4QMTA 5FEEA 4A7CA 3UMWA 2CNVA 4P4CA 4DH1A 3A61A 4YSMA 5HI2A 3UIUA 4CLIA 1URWA 1YWNA 4UMTA 4D55A 2W1IA 2WMWA 2UZOA 3K3IA 5EHYA 5CTPA 4PTEA 2UVXA 5DT4A 3RNYA 4UYNA 4TT7A 3ZZEA 5HBHA 3EFJA 3RAHA 2C0TA 5L6OA 5L4QA 4JX3A 3R7GA 3AGMA 5DWRA 3WZKA 4DGOA 4ZP5A 1UV5A 5HGIA 2EXMA 4O1PA 2WOTA 4FGRA 1MRUA 3IOKA 3T8OA 5M4UA 2GPHA 5K5XA 4BTKA 3NUAA 3GB2A 5JMSA 3V5JA 2XIRA 4QYHA 4DGMA 3ROCA 4U81A 2XK7A 4RVMA 4BTJA 3PXRA 4FG9A 4LG4A 3WI6A 5IQGA 3OS3A 2JD5A 3BHTA 3L1SA 2Q0NA 3C4FA 4O0TA 3C1XA 1H1QA 3G9NA 4JDHA 3JVSA 3BV3A 1DAWA 1W7HA 4GK2A 2PUIA 4ZY4A 3EQDA 3QUPA 4W4WA 4RFYA 4AAAA 1P4OA 4CFWA 3QZHA 3IDPA 3C0HA 3G0EA 3QKLA 4G9RA 4R77A 4XG4A 4AG8A 4LL5A 3T9IA 3VUKA 4CRLA 2CJMA 4BWKA 2XJ0A 4D0WA 4UN0C 2X4ZA 5AP0A 3RPSA 1F5QA 3MYGA 4I23A 4YZDA 3C4XA 3VBYA 5I3RA 5A6NA 4IFGA 3JR1A 4TY1A 4HVSA 4PX6A 2JKQA 3MFSA 3RBWA 1LPUA 4FTJA 4Y8DA 1ZYDA 3CY3A 1LP4A 2OJ9A 5ANOA 3F3VA 4EHEA 3N4UA 5AR7A 4QT1A 3QRTA 1V1KA 3V5WA 4MNFA 4LRJA 4NYEA 4UWYA 3RP9A 3CLYA 5AA9A 4NCTA 4BL1A 4O7LA 3VF8A 2OU7A 4M66A 2JDTA 2QVSE 4F7JA 4MD9E 3W32A 5FTGA 3CP9A 1H01A 3EHAA 3W8QA 3BKBA 3EZVA 2GNJA 3PE2A 3BE9A 3GCPA 2BIKB 4FIGA 5HVKA 3IKAA 4MHAA 4DFNA 2RF9A 5AIKA 3KRLA 2F7EE 4FSMA 3SG8A 5DG5A 4QP6A 2W7XA 2YACA 3PWYA 4B6LA 4AOTA 1XWSA 4XOYA 3PIYA 4GG5A 3DBDA 4OTWA 5E8UA 5HZNA 5JFWA 4ZTQA 2HY0A 1NVQA 2PTKA 1P2AA 4BI1A 3E93A 1E1XA 1U5RA 3CTQA 3QALE 2GFCA 2R3PA 1PF8A 3PXZA 4E20A 2RFSA 5FBOA 4AT5A 1NW1A 3B8QA 5J95A 3SVVA 3OROA 4DGGA 2XK4A 4YO6A 3AMAA 2CSNA 3U6JA 2Z7SA 3GC0A 1RQQA 3O17A 2AUHA 5CVGA 3UOLA 2VTSA 1YVJA 1CMKE 4D1ZA 4F0FA 3UYTA 2CLQA 4KUJA 3TJCA 3O23A 3FMNA 3TCPA 4R8QA 2X1NA 4WNMA 2PK9A 4WNPA 4FV0A 3TZ9A 3TZMA 4FSTA 2HYYA 1TQMA 3EFLA 3R28A 4JOAA 3RPYA 3UC4A 5JN2A 5K4JA 1IAHA 3ZLWA 4BBMA 4PNKA 5CNNA 2Z7RA 4IAYA 1GAGA 2R7IA 4G2FA 4JDJA 4QMSA 4ITIA 3UJGA 4F70A 4FODA 3S2PA 4DT8A 3HA8A 5EOLA 5ETIA 2J2IB 5KUPA 3BLQA 5AADA 1WBPA 3VS3A 3RM7A 4AS0A 4C59A 3C5IA 2WTIA 4WT6A 5KMJA 5DVRA 4DTBA 4EUTA 3PG3A 2OIDA 1KE6A 4Y73A 5B7VA 1YOLA 2R3KA 2ETMA 5JT2A 4GT4A 2I0HA 2UW6A 4O0RA 5T6KA 2WTJA 4FYNA 4BZDA 2G9XA 2C6OA 1YW2A 3G6HA 3UZTA 3EQFA 3ZONA 3QYZA 2H34A 1OIQA 2ACXA 4D4YA 1YXVA 3LQ5A 5H2UA 2VWIA 4L6QA 5CZIA 3EJ1A 1OIYA 1X8BA 5IUGA 3MH3A 4XP3A 3WF8A 2BDWA 4NH1A 4TTHB 2YA9A 3ZO4A 3TNWA 3H30A 4JAIA 3AMBA 3LLAA 5ACBC 4O86A 1KWPA 3DKGA 5JGBA 4RRVA 3G5DA 4TW9A 5FEQA 5FGKA 5I4NA 4MWHA 3RHXA 2C6KA 2VWZA 4FEVA 5K4IA 3V8TA 1Y91A 4BGHA 4O0VA 4TYGA 4FKTA 5IQAA 3NUNA 5C27A 4UWCA 3A8WA 2HOGA 2NP8A 2PZIA 3HP2A 3L9MA 3O51A 4GIIA 4RWIA 1NT2A 4O81A 4FTMA 1JKLA 4C4JA 5IU2A 4M3QA 3QXOA 4QQCA 2ZM4A 4EOJA 2WFYA 4FGBA 4W8EA 3GU7A 1H4LA 3TIYA 4ZJVA 3LZBA 2C3KA 2XJ1A 2C47A 3BGZA 4X3JA 3A7IA 3QC4A 3R7EA 4JR3A 2JKOA 4EH3A 4YMJA 5HO7A 3SRVA 4NIFB 4A9UA 1E1VA 3IW8A 3Q2MA 5HVJA 2XK9A 4FV9A 5L8JA 2ITZA 3MIAA 3CGOA 1PMUA 3I5NA 5DRDA 4X6RA 2PMIA 4G17A 4RA5A 4MD7E 3CEKA 3VBXA 3NNWA 3PSCA 3VBTA 3WIGA 3P5KA 2I6LA 4NW5A 2PVLA 3D7TB 3VUGA 2Y4IC 1NVRA 2HIWA 4FTCA 3PXFA 3QTUA 2X9EA 4EQUA 3KCKA 3TKHA 4PF4A 4YJPA 2RKUA 2HZIA 3POOA 4JIAA 5IA5A 5AAEA 4JDKA 3FUPA 4YLLA 4JVGA 2XIKA 2EUFB 2PULA 3LPBA 3P7AA 5FLFA 4NW6A 3HRCA 1ATPE 4D2RA 3BLHA 4PP9A 4BBEA 4KS7A 3QTRA 1FVVA 5EM5A 3RZFA 2W1EA 4ZSLA 4FSRA 5HG8A 2ZMDA 3E8CA 3UBDA 3GGFA 4ACHA 3NW6A 4YLJA 5AAGA 2RGPA 3QD2B 4GYIA 3ZZWA 5KMOA 1H8FA 3FZSA 4J7BA 4LOPA 4RIXB 1XH5A 1JPAA 3OWKA 4O91A 2B9HA 5CENA 3PIZA 3VC4A 4EZ3A 5L2IA 2VV9A 3I0OA 2C3IB 3PXKA 2X2KA 3DAEA 3FC2A 4BVUA 2HXQA 1KV1A 2YERA 3C4WA 3NUUA 3OY3A 4FT5A 5C01A 3UG1A 4UMUA 3N4TA 3LFQA 5HICA 5E4HA 2I0EA 1PMNA 3P4KA 4AW0A 1ZRZA 4MXZA 4QYGA 4DLIA 3BYUA 3PVBA 3A4OX 3CD8A 5HE3A 2BZIB 4FTRA 1W0XC 1K2PA 3TJDA 3U9NA 4A9YA 3KULA 3EKNA 2OZAB 4TYHB 2RIOA 4M13A 4GSBA 5ICPA 3VRZA 3VRYA 3DDPA 4AZVA 2C30A 2QODA 2B55A 2PY3A 3SXRA 1UNLA 4X2GA 3R7VA 2XNNA 4I4EA 4TNBA 4B0GA 4L53A 5I5ZA 3QXPA 4KA3A 5JK3A 2XCHA 3NR9A 2JITA 3R01A 2WTKC 4EK6A 4YJNA 3VVHA 2B9FA 1XH8A 3E87A 2IPXA 5BUJA 3OW3A 4I5HA 3BU6A 4ALWA 3C4ZA 1DI8A 5I9VA 1ZXEA 5HQ0A 3F7WA 4FG7A 2BFYA 2QNJA 4E6AA 3PP0A 3CJFA 4ERKA 2E9OA 4Y5QA 4XP0A 1FINA 3Q9XA 3WF7A 4GK4A 3W2QA 3A62A 4CQGA 4AP7A 2V0DA 3MV5A 4KD1A 2VX3A 4KWPA 4RIYB 1GIJA 4D9TA 1BKXA 2ERZE 1AQ1A 4O0UA 2F2UA 3R7UA 2H8HA 4F9YA 5KMMA 4W4YA 2R3OA 2E9NA 2P2HA 2ZM3A 2JEDA 4RLLA 5BX0A 5K9IA 4MF0A 3MSSA 5L2QA 1UKIA 3LFAA 4G6NA 3LQ8A 3FAAA 4QTAA 3UP2A 4FV7A 3Q9YA 1IA9A 5L2SA 4O2PA 2VO0A 3LMIA 2UW4A 5JKGA 4FKVA 2J5EA 2ITXA 4FSUA 4BDBA 4EI4A 2CGWA 2F57A 1FMKA 2J0JA 5CS6A 4NUSA 3R2YA 5LCKA 2BROA 4YP8A 3DAJA 2OXYA 5HD4A 2CGUA 4HGTA 5AFVA 4QMXA 2UW3A 3FLWA 3IDCA 5M06A 2ITPA 4EUUA 3PZHA 3Q6UA 4FNZA 3E8EA 4KBKA 3SV0A 3PSDA 1Y6AA 5AUZA 3TDVA 5CEMA 5C8MA 3G33A 5AM6A 5DYJA 2XYNA 1M2RA 5E8ZA 4QMNA 5K0XA 4JG7A 3VUHA 3GC8A 5EI2A 1Y8YA 4IWPA 4J99A 3ZFYA 3AT2A 4UX9A 1S9JA 4BCPA 2R0UA 3DXPA 2RG6A 3IW4A 4DH3A 2X2LA 4QMPA 3AGLA 3QQLA 1WBTA 4F1OA 3TM0A 4KIOA 5A9UA 3FI3A 3QD0A 4RIWB 1APME 2QOQA 2X7GA 4CGAA 5CU2A 4C37A 4HNIA 3K3JA 5FM3A 5IQEA 5LMBA 2OI4X 2YCSA 4BWPA 3ZFMA 2W06A 2JDSA 1M17A 4FTUA 5T68A 4C4FA 4EKKA 4HPUE 4RBLA 3WOWA 4YZMA 3ZSHA 4F08A 5LMKC 4GKIA 2Q0BA 3UQGA 1ZZ2A 2BRGA 4RWLA 2PE1A 3KMUA 4G31A 5D10A 3R7YA 4KIKA 4UZDA 4N57A 4C7TA 1Q41A 3GCVA 4IZYA 3PPZA 1VYWA 3WBLA 2W0JA 1G8AA 5CVFA 3WARA 4BZOA 3Q3BA 4P7EA 4O7YA 4O82A 2J4ZA 4FSQA 4FTTA 2GHLA 1Q8ZA 4I3ZA 2YM4A 4B4LA 2JKKA 4C2VA 4O2ZA 4ZSAA 5BVOA 5ITAA 4ANLA 2C0IA 1KSWA 1H1SA 2J7TA 3HUCA 2PZRA 4HCTA 3H9OA 3HVCA 4XG6A 4GVAA 4TNDA 5B0XA 2GNHA 3ETAA 3OCTA 3W33A 5EI6A 2HWPA 2VGPA 3OCGA 2XBAA 2EB3A 3MW1A 2VZ6A 2WZJA 4FIHA 4GFOA 4WBBB 1PMVA 5M4FA 3U55A 4IAAA 4ID7A 4O0SA 2PVJA 3DTCA 3LCDA 3UO4A 1XKKA 1PW2A 4QPSA 4OTGA 4CKIA 4FR4A 1OM1A 3KKVA 1U5QA 4I1ZA 3DBEA 2O2UA 4X6QC 4ZEGA 2PVNA 5EOBA 3K54A 2FSTX 4ONAA 4EH2A 3BIZA 1PXLA 3V3VA 4YBKA 3F9NA 4U45A 1XH7A 1IR3A 5HVYA 1FVTA 1PYXA 4Z3VA 2W1DA 3RPOA 5AP6A 3BCEA 3FKLA 3K5UA 5D9HA 5D7VA 5IQIA 5DN3A 4QNAA 4F63A 1JWHA 5AA8A 2FVDA 3SG9A 3IDBA 3GU4A 3KC3A 4ZTMA 3D7TA 4PDOA 2QHNA 4NKSA 5M07A 2YABA 2PL0A 3I4BA 3RI1A 2GS7A 4UXLA 1O6KA 3R63A 1YDSE 2R3NA 3MGYA 4WG5A 4AN9A 3NYOA 4ZJIA 2FGIA 3D5UA 3MPMA 4XRJA 5DMZA 2XNGA 5AV1A 2GQSA 2YM5A 2GCDA 3EQCA 4ASZA 3KK8A 5CALA 2QD9A 4O84A 2C68A 1Q5KA 4AF3A 4JR7A 3RAWA 4D2VA 3ORPA 4YUQA 1JLUE 4LRMA 3W2RA 2F49A 3JY0A 4O7WA 4NTSA 4ZZMA 2XA4A 5HIDA 5C8NA 4MK0A 3Q4UA 5DIAA 3HZTA 4ERWA 2PZYA 2XBJA 3Q4TA 4FL1A 3LJ1A 3GI3A 4QP4A 4RIXA 1J91A 3ZLYA 2GDOA 4U80A 3MN3A 3BI6A 1WAKA 5M57A 2E9VA 3IOPA 4W4XA 2J0MB 1Y8GA 3Q9WA 4QP1A 4I6FA 3VS1A 5FXRA 2C6EA 4QO9A 5IH5A 3BHUA 4M69A 4O21A 2VTTA 3QA0A 3ZDIA 4CFUA 5A4TA 4L52A 2I0VA 2WMSA 4CVAA 3ZU7A 5KKRB 4PDYA 4E8AA 3DGKA 3LLTA 4FA2A 1UU3A 5H8EA 4FTOA 3W8LA 3MY5A 3TWJA 3N4VA 3VF9A 3EYHA 3IW7A 3PJ3A 5I3OA 3OVVA 2UW5A 5AJQA 3B2TA 1URCA 3Q9ZA 2R3RA 1ZMWA 2VWUA 3LFEA 1GZ8A 4M0YA 3G0FA 1SMHA 1CKIA 1SZMA 2OZAA 3COIA 3I6UA 1CKPA 5H3QA 3V51A 3FL5A 1RJBA 3CD3A 3PA5A 5CEIA 4OTIA 3H0YA 2DS1A 3DDQA 3PIXA 4M12A 2CN8A 4Y46A 4YJRA 3QBNA 3DJ7A 3D5XA 3FI4A 1KV2A 5HOAA 4WNOA 3DPKA 4I6QA 4DC2A 3CGFA 3OTVA 5AWMA 4RPVA 3QCSA 4LRKA 4AZWA 5GINE 3CTJA 2OO8X 5BMMA 4DYMA 5J7BA 5A4QA 4V0GB 4IWDA 3VJNA 3HYHA 1K9AA 3ROYA 3ET7A 1UWHA 3KA0A 2OJJA 4FTQA 4LQMA 2G01A 5HU9A 3MI9A 3CIKA 2E9UA 2JGZA 2XRWA 4FL3A 4J96A 4V04A 3ZFXA 5BYYA 4MXOA 3ZOSA 3O2MA 4FEQA 4WHZA 2QKRA 1BYGA 3GUBA 3BV2A 3C4EA 2W4JA 2HZ0A 2Y6OA 5LXMA 2R9SA 2SRCA 2YIRA 2O5KA 3FSFA 4RX7A 3DCVA 4J8NA 5HBEA 4NM0A 3ORLA 4C3FA 2W96B 2YCRA 1TQPA 4DE4A 4LUEA 4DFBA 3QTXA 5FEDA 1MRVA 4BC6A 4DT9A 2UZVA 2XJ2A 4AE9A 4E3CA 4C57A 4I0TA 4JDIA 5CQWA 1PXKA 3HA6A 2B9JA 3HLLA 3ZEWA 1JKSA 4FBXA 2PVYA 4O38A 5E90A 4MAOA 2IG7A 5CQUA 4YJQA 3C9WA 5EG3A 3UC3A 2UZWE 4AOJA 4ZXTA 4FKJA 1XBBA 3COMA 4BICA 3VIDA 4EWHA 5ANDA 5AUXA 4AN2A 5J1WA 5A3XA 1BLXA 1MUOA 3H4JA 1IG1A 3O8UA 1B38A 3Q96A 1LEZA 2QOBA 5AUVA 3ZBXA 3AC5A 3GFWA 5T3QA 4HW7A 5IDNA 4C34A 1OB3A 5FXQA 4YZ9A 4EOKA 3ZSIA 4EQMA 2HY81 3WF6A 2WMBA 3EQGA 4MTAA 5BUIA 2VTOA 4L8MA 3ZCLA 1JKKA 4EH4A 1GOLA 2YDJA 4PP7A 3KVWA 4KB8A 1JSTA 4FZFB 3F2RA 1KE9A 5K0KA 2WU7A 5B2KA 5HLNA 3FZRA 4RVTA 4BDFA 2PVHA 4WUAA 2VWYA 1OPLA 4WBOA 5EHLA 5HE2A 4APCA 2C5VA 3O0GA 3V8SA 4IC7A 4QTDA 1H00A 4D1SA 2QCSA 2OH0E 1G5SA 4FVPA 4H58A 2G1TA 3DB6A 3NWWA 4AXAA 4CSVA 2P4IA 5I9XA 2J90A 2VTHA 4AFJA 4XBUA 5E8XA 3VS2A 3GQIA 2PUNA 4DF3A 3PP1A 2VTMA 3W2PA 3SXSA 4EL9A 3QA8A 4CG8A 1UU9A 4FTNA 2YIWA 4CCBA 3HMIA 3BPRA 2O63A 3ENMA 3POZA 1NVSA 3QKKA 3VAPA 3IPHA 3R1YA 4TPTA 1WMKA 3GENA 2WQMA 3AC4A 1EH4A 2ZB1A 4I0SA 4IQ6A 4C3PA 5HIEA 2XUUA 3BGPA 3UODA 4EOPA 4ORKA 2F7XE 3MA3A 3TT0A 4YC3A 4CLJA 3DXQA 3R8UA 1UU7A 3S4QA 1G3NA 4JX7A 3UNKA 1ZY4A 4I21A 4I92A 2UZUE 1U46A 5HG7A 4LGDA 4L3LA 3VULA 5JGAA 2Z02A 3MDYA 4YZNA 2RFDA 5TR6A 3NMUF 1H1RA 3PJ8A 4FMQA 1JQHA 2R64A 3SGCA 4F9AA 5A46A 2W1ZA 4CFMA 2GMXA 2CNUA 2XZSA 3SW7A 4PNIA 1OUKA 3GVUA 2YAKA 1WBSA 4RC3A 5HORA 4RA4A 5C4KA 4FV4A 3GOKA 3P0MA 1IAJA 2IO6A 3ULIA 4ZZOA 2VWXA 3F5UA 1OUYA 2BFXA 5HKMA 4E4XA 4I5PA 3PVUA 1XBCA 4GJ2A 4IB3A 3FI8A 4BDEA 2VAGA 4R1VA 1CSNA 5AP7A 3FLZA 5LMKA 4DEAA 1YDTE 4O7VA 3EN6A 3P9JA 4L9IA 4UV0A 3OT8A 1UA2A 3EQHA 4MXYA 4AACA 4QQTA 3UO5A 5FDPA 3KULB 4R5SA 2VTQA 2YCQA 3DY7A 5AR3A 4DINA 5CYIA 2CKPA 5GIPE 2EWAA 3MH2A 3QRUA 4PDSA 5BQ0A 3WYYA 5AIRA 4P2KA 3NUSA 4HVIA 3HEGA 3QQHA 4PRJA 4XV9A 4H3PA 5CU3A 3EOCA 4F9WA 1ZOEA 3R71A 3EMGA 3ITZA 3LCTA 3PZEA 4QMQA 4YTFA 4JRNA 1Q8TA 4FIEA 4KRDA 5CAOA 4ANMA 4LUDA 2YIXA 4FNXA 3IQ7A 4NFNA 4I6HA 3PWDA 1FOTA 4PY1A 3ID6C 1R78A 1ZZLA 3F88A 2X8DA 3EYGA 5M4IA 3ELJA 4Z7HA 5CAVA 4EH7A 4F65A 3QCYA 3I81A 2BR1A 2HENA 3V5PA 2BRNA 4D5HA 3F61A 4JI9A 4WRGA 1TKIA 1FQ1B 4YR8A 3FSKA 3HV4A 2IZTA 3JYAA 5KMIA 3V5QA 2WKMA 4AGUA 3F2AA 5FD2A 3VBQA 3NDMA 4YJTA 1H25A 1YOMA 2QO9A 3COKA 4FTIA 4GT5A 2RL5A 1Z5MA 4DBXA 4LV5A 4ZLYA 2A27A 5DR2A 3HMOA 2Y0AA 4U79A 2XKFA 4FSYA 3ZXTA 4FKIA 4LV8A 4HNFA 4H1JA 5DLSA 1STCE 4CTBA 3G9LX 5HTIA 3ERKA 3OG7A 5LVLA 4TWPA 2ONLC 1GIIA 4XX9A 4BCFA 4IX6A 1PJKA 4RZWA 2OICA 2CMWA 3KXXA 3ENHA 2RG5A 3QZFA 2PUUA 2IW6A 2JBPA 3PTGA 5DGZA 3A99A 4BZNA 4MQ2A 1YKRA 2G2IA 3FQSA 4Z16A 4LMNA 2CLXA 4BCKA 3A60A 5EDRA 2QOOA 4GT3A 4K1BA 2HW6A 4E7WA 4EZ7A 2XEZA 4TL0A 3MPTA 5L8KA 5DT0A 1YHVA 4ITJA 3G6GA 3LFDA 4E6CA 1V0OA 4BF2A 4RT7A 4GH2A 4EOSA 3P1AA 2W05A 2XEYA 2YN8A 4NKAA 3MVHA 1PYEA 2WQEA 2G15A 3C0IA 3EZRA 3DKCA 5I9WA 4AFEA 4HJOA 5IA3A 3A8XA 4UB7A 2OIBA 4CFVA 2FH9A 2NNWB 2XIXA 4V0GA 1Q8WA 4RQKA 3R8ZA 3QCXA 4MNEB 3E8NA 4CYJA 2W5AA 3E64A 2Z60A 4YJSA 3UQCA 4DEHA 1OKWA 1RE8A 3FMDA 5IQCA 2UZBA 1XH4A 4AX8A 2PYWA 4PV0A 5I9YA 4B99A 2BDFA 1WZYA 3NVMB 3R1NA 5KNJA 5M44A 4YNOA 4AA5A 2BKKA 1YWVA 3CE3A 3TI1A 3P08A 2HXLA 4USEA 1LUFA 3IGGA 3KRXA 2QU5A 3NUYA 3ZDUA 4IMYA 2XB7A 4KS8A 2WD1A 4O7SA 3NCGA 3Q53A 3TKIA 1T45A 4DEBA 4KIKB 2OF2A 3UTOA 2CN5A 3BQCA 2UZDA 3KFAA 4QTEA 5M51A 4G5PA 1J1CA 3ACKA 2ETKA 4EONA 3OCBA 2GHGA 1Q97A 3FLQA 2JDVA 3EH9A 3NSZA 3OUNB 2WO6A 1H28A 4PL5A 5K3YA 3LXPA 5LQFA 3ZUVA 2PUPA 2BHHA 2PVFA 3OCSA 1PHKA 1A06A 2CKQA 2OW3A 3RCDA 2PE0A 1RDQE 4AUAA
chains in the Genus database with same CATH superfamily
4CQEA 4USFA 4R1YA 3Q60A 5CX9A 2V62A 3FMKA 3GT8A 5GJGA 1WVWA 3PPKA 3WZEA 2EU9A 2FYSA 2OH4A 4BCJA 4ACDA 1ZOHA 2V7AA 3A4PA 4GS6A 3SA0A 1GNGA 3AT3A 2BZKB 3CC6A 4G3FA 4QYEA 3HX4A 4C35A 4JAJA 3ZBFA 3Q52A 2VO7A 4NM5A 4RWJA 4EK3A 3PY0A 1Q61A 2WTCA 3LFFA 3T3UA 3QQJA 4ZS4A 2W4KA 4CXAA 4LOQA 3P7CA 4USDA 4OT6A 4UEUA 4QMMA 5M53A 4ZZNA 5F94A 2YDIA 4BWXA 4CZYB 3UQFA 2AC5A 2I0YA 1ZMUA 3MH0A 4MF1A 3V5LA 1SVEA 4FICA 4DHJA 5E92A 4GK3A 5EYMA 1PKDA 3VS6A 4R7BA 3MY1A 4I24A 4BGGA 5AR8A 4F0GA 2XAOA 5HTCA 4FIIA 3CY2A 4MXAA 3SC1A 2YIQA 1ZY5A 4C4IA 4J98A 4XJ0A 1L3RE 1BI8A 4BYIA 2BAKA 1J7UA 3R73A 3O8TA 4IVBA 5CEPA 3ORIA 4Y5HA 2ZJWA 4FL2A 4XMOA 2YFXA 5FWKK 4ALUA 3UMXA 2ZV9A 4EJ7A 1JSVA 4PDPA 4RGJA 4FV2A 1L8TA 1PXMA 2YM3A 2XNOA 3GP0A 3I79A 4U3YA 3TNQB 4BFMA 2NRYA 2FA2A 2BHEA 2CGXA 3HNGA 3LOKA 4S31A 2QU6A 4FKOA 3P78A 4FT9A 3TNPC 4BHNA 4O96A 4OBPA 3OEFX 4S34A 4BRXA 5L6WL 4A9RA 3QZGA 1MRYA 4FT3A 3A7HA 1R0EA 2WU6A 5AP3A 3VUIA 2YZLA 3FY2A 4JIKA 4QMVA 4W9XA 2W9FB 1G8JA 4NTTA 4Q9SA 4M69B 1W82A 2JDRA 5A6OA 2Y4IB 2X0OA 3RHKA 4C33A 1AD5A 3OWLA 3UDSA 3QHWA 4G6LA 3FDNA 4QRCA 3ZRMA 3PSBA 4JJRA 4FT7A 4PMMA 4G34A 5FDXA 1HCLA 2HCKA 3JUHA 3NUXA 4FKUA 4I5CA 4CTCA 3DNEA 5J1VA 4X2NA 4M67A 3ORMA 1ND4A 3NIZA 3U8WA 4C58A 5IF1A 1IASA 3VN9A 3KXHA 4QP7A 3OBJA 1XHAA 3OHTA 5FTOA 2HWOA 4X2KA 1HCKA 4AE6A 3T3VA 5A4LA 4II5A 4QNYA 4I6LA 2WIPA 2YM8A 4OTDA 1JOWB 3I0QA 3JY9A 4DCAA 5D11A 2WHBA 2QHMA 5EK7A 1A48A 2C1BA 4IVCA 4DG3E 2WPAA 5C26A 4X0MA 5J87A 2P2IA 2C6MA 3RTPA 2XANA 2PSQA 2PHKA 4LGHA 3IK3A 3RJCA 3VQUA 4H1MA 3DNDA 2OIQA 4DFLA 3S1HA 1DM2A 4P90A 1VLRA 3ATSA 3F3UA 4FIJA 4ZTHA 4PWNA 4OTRA 2C6IA 3W0QA 4RQVA 5AUWA 4K11A 4DN5A 4FKRA 2UZEA 2X7FA 5CU4A 3BGQA 4AA4A 4D2SA 3KMMA 4E6QA 4OAVB 1BUHA 1PXJA 3C4CA 5BYLA 2FSMX 5TKDA 5K5NA 4JBQA 3CPCA 3OC1A 4K0YA 3B8RA 1ZARA 3EIDA 3MWUA 4OBOA 5DNRA 5JEBA 4LOOA 4XYFA 5HCZA 3GQLA 3SDJA 2XK6A 4FTKA 2P55A 3F3WA 5E1EA 3HDMA 4NM3A 5CT7A 5FQDC 4RJ4A 3NYNA 3EN7A 4FUXA 2FSOX 4V01A 2V55A 3R9NA 3I6WA 5CSHA 3UVRA 5E8TA 4HYIA 3WIKA 4GKHA 3CSVA 2WMUA 5KMLA 1OKVA 1WCCA 3SW4A 3AD4A 2QC6A 2WTKB 3FLNC 3V6SA 3F3ZA 2UZLA 3N51A 3PE1A 4FSWA 4XS2A 3AC2A 2JC6A 5LVPA 1O9UA 2GHMA 3MTLA 1OIRA 4MBIA 1H07A 3IONA 4GYGA 4F9BA 5F95A 4BTFA 5A4EA 4YJOA 3UYSA 3MY0A 3ZO3A 3FE3A 4OTHA 1Z9XA 3TZ7A 3H3CA 2A4LA 3KXNA 4BCMA 3PVWA 4ACMA 4F6UA 3QX4A 5JGDA 3U4WA 1J7LA 5J9YA 3W2CA 4QYFA 3FJQE 4EH5A 2VWVA 5HIBA 5IQBA 4M97A 3LCSA 2HELA 3KF4A 3PXQA 3QFVA 3CPBA 1QCFA 4TKSA 4FKPA 3EB0A 4XH6A 4EJNA 4F64A 2IZSA 4FKQA 4C38A 3LE6A 4AA0A 2QOLA 2ITQA 4QMZA 5FRIA 2C69A 3F6XA 3O96A 1OPJA 3OY1A 4MD8E 5CF6A 1YHSA 3ZEPA 3TV6A 2C5XA 4YTHA 1GIHA 4U97A 1B39A 4OAUC 3ANQA 5BYZA 2ONLA 2PVRA 2XP2A 4MYGA 3VWAA 4MNEA 3PRFA 4FT0A 4F7SA 3JVRA 5HD7A 3VUTA 4MEDA 3VW8A 2Z2WA 4R7IA 3NNXA 4O0WA 4QMOA 2O8YA 2OF4A 4EWQA 3L8XA 1DS5A 4DGNA 4UBAA 4BKYA 4FF8A 3NW5A 2ESMA 2O64A 4UY9A 2YJRA 4IFCA 4QPMA 3CR0A 2Y6MA 4M68A 4MBLA 2J0IA 3W0PA 5JSMA 5IEYA 3FPQA 2DQ7X 3OXZA 4LMUA 4XV1A 5E91A 2Q83A 3QD4A 4FEXA 2C1AA 5HBJA 4MVFA 5HX6A 4JQEA 2CKEA 4M0ZA 5D41A 3AD5A 5L2TA 2QR8A 4KIQA 3L8PA 4QP3A 3OFMA 1W83A 4C61A 2QOHA 2A19B 4JBOA 4X3FC 4YC6A 3FL4A 2YM7A 4D2TA 4RFMA 4YU2A 2X2MA 4YZCA 4FKSA 4KSQA 4LI5A 1PKGA 3P5JC 2ZB0A 4Y83A 4DBNA 3OMVA 4NSTA 4RX5A 3KREA 4AZTA 3RGFA 4EH6A 3DU8A 3E88A 3S0OA 5E8VA 4YNEA 4ASDA 1QPJA 5DFPA 5KBQA 4A06A 2WMXA 4BB4A 2BTSA 3ZHPC 1FPUA 2C3LA 3CQWA 3GBZA 4Q2AA 4A4OA 4D4RA 3R9HA 4I6BA 4BDKA 1YI4A 2IZRA 2R2PA 2E2BA 3LXLA 4G3GA 4BR3A 3UIBA 5HLWA 5LWMA 4FV3A 5IA4A 4YPSA 3Q2JA 1F3MC 4I20A 3R00A 3TV4A 4EH9A 3KMWA 5AR5A 3D2KA 3RCJA 2HW7A 3CKWA 4WA9A 2XCKA 2VU3A 4GVJA 3TNHA 2I40A 3BX5A 3S3IA 2FO0A 4Q5EA 4I94A 3QWJA 3N9XA 1O6YA 1U54B 5J9LA 3W0SA 3FYJX 5AUYA 3KY2A 4EKLA 5FBNC 2WTVA 3PLAE 3QUDA 4Q5HA 3FQHA 4RVLA 5FM2A 5IA2A 3PA4A 4HGLA 4U42A 4BGQA 5HNIX 3DFAA 4TYJA 3ORNA 5J5SA 2EVAA 2UW7A 3QTWA 4F0IA 3C13A 4O6LA 2YLEA 5HG5A 5HESA 3WE8A 4E5WA 3LFCA 4WNKA 4O4BB 3BBWA 1H24A 2B54A 2WQOA 2YWVA 1YXSA 4CT2A 3DK7A 4FKGA 3AC8A 2NRUA 4DFUA 4FSNA 1WVXA 3FQEA 3HMPA 1TFFA 3R02A 3TIZA 4Y85A 3PG1A 4L00A 1J1BA 4NJDA 1Q62A 4O1OA 4UZHA 5CSWA 4YHFA 4BI2A 3EWHA 3AQVA 4MUQA 4YBJA 3UPXA 2VX0A 1M7QA 5JFSA 4KKHA 3EKKA 2P0CA 5CVHA 2OZOA 2XNEA 2YZAA 3BLRA 3KRWA 4CYIA 4E1ZA 3HMNA 3QYWA 2XH5A 2F7ZE 4CFFA 1BL7A 3RK7A 2H96A 4FTAA 4H3QA 3HP5A 2VTJA 2CDZA 3HV3A 4EQCA 4ZTLA 3QTIA 3FZPA 2REIA 4IHPA 5CF8A 4RIOA 3IW5A 3BL9A 4QOXA 1UKHA 2WQBA 4FSZA 4ANOA 4HVHA 2R0IA 1OL1A 3NGAA 3M2WA 4HYSA 3NW7A 3BQRA 3B2WA 5I0BA 3EN9A 1V0PA 2BKZA 4XG9A 3OZ6A 4FEUA 1OBDA 4FE2A 4D58A 4IWOA 1PY5A 1FGIA 2IVSA 4JT3A 1Q8UA 2GTMA 3I7CA 2VTLA 3RINA 3NS9A 2XKDA 3DA6A 5GJDA 4QQJA 5AUTA 1YRPA 3QCQA 1YHWA 3IG7A 3PVGA 3LAUA 2JFLA 4RG0A 5J8IA 4CEGA 5M4CA 4FV6A 3KN6A 5L6PA 4CCUA 4G6OA 5AP2A 2GSFA 3LHJA 5HLPA 5HO8A 3WYXA 4EORA 2UW0A 4ITHA 2JIIA 2W4OA 4JS8A 2W1GA 4DH5A 3DOGA 4OGRA 2J0KA 5BVEA 3M1SA 2ITOA 3PJ2A 3HRFA 3MBLA 3TXOA 3FMEA 1W84A 4W9WA 3ZRKA 4AW2A 4ZMEA 4LGGA 3VNTA 1SNUA 4DA5A 3D0EA 2VTAA 3UNJA 3LM0A 4ZSGA 2EXEA 4E73A 1CKJA 5E7RA 3A7GA 4CD0A 2IW9A 4U40A 2ZAZA 4EHVA 3NVKI 4FEWA 2V7OA 2AQXA 3MTFA 3TDWA 4DHZA 4B8LA 1OZ1A 2C5YA 4J71A 5F4NA 1VJYA 3BWFA 5LWNA 5CEKA 5HU3A 4XG3A 5TE0A 4A9SA 4WO5A 5DE2A 2IZUA 3ODYX 4EEVA 1Z57A 1WVYA 5M56A 4F1MA 2I7QA 4QYYA 5G6VA 4M15A 4MBJA 1UU8A 3DS6A 4U43A 4E4LA 2XNBA 4HGSA 5AAFA 3QUEA 1ZYSA 4ARKA 4ENXA 3R7IA 3FMMA 3U51A 3Q5IA 2BDJA 2LGCA 3GXLA 1J7IA 2B7AA 5J5TA 3DBFA 2VO3A 3VBVA 1U59A 5ANIA 4UWBA 4PL4A 4F7NA 3D4QA 3RALA 4UYAA 2NPQA 2PMOX 5DBXA 4XG2A 4I41A 4ZLZA 3E5AA 1M2PA 1CTPE 3PFQA 3W55A 2ZMCA 4L01A 2WMQA 4BDGA 4BCIA 2BRHA 5CU0A 3LM5A 2XKEA 5KZIA 2J50A 5EM7A 4FVRA 5EI8A 3R7OA 5EQPA 4TZRA 4WSYA 1JAMA 1T46A 5BUEA 3DBCA 1R3CA 2QURA 3CQUA 3EFKA 3BYMA 4XUFA 1YI6A 1OVEA 3CKXA 1CDKA 2OFUA 5CI7A 3AG9A 4QD6A 4DG0E 1F0QA 5GIOE 2BAJA 2ITVA 3A7FA 3FHRA 4O22A 3DK3A 3KIOC 2YM6A 3Q5ZA 2W1HA 3ORZA 4IAIA 1FMOE 1WFCA 2QO7A 5EDPA 1KOAA 1PXNA 4EH8A 3THBA 3QLFA 2Z8CA 5CI6A 4I0RA 2YWPA 4FG8A 5DH3A 2VUWA 2IEWA 3NFFB 4QP8A 4EC8A 3R8MA 4L42A 4KABA 5AV0A 1JSUA 2R3HA 5E8YA 4ALVA 1RW8A 5J9ZA 3U54A 5H9BA 2YEXA 3A7JA 4YSJA 5EHOA 2X4FA 5D7AA 4EBWA 5E9EA 4WIHA 3HDNA 2KULA 4ZTNA 2YJSA 4ZY5A 3TMOA 4FRFA 3DTWA 4U9AA 2XM9A 4OTQA 5KO1A 2XVDA 2YISA 4L46A 2W1FA 3KEXA 3RNIA 3BU3A 4JXFA 4BN1A 4EYMA 3D14A 3ZMMA 1P5EA 4O6EA 3NAXA 2C4GA 2DWBA 4ASXA 1R1WA 3UE4A 3DV3A 3NNVA 4CFXA 3AD6A 5KZ0A 2BRMA 3PJ1A 5TO8A 1P14A 4ZTSA 3FLSA 2OG8A 4R5YA 4XG8A 4XLIA 5B2LA 3TG1A 5M08A 2EXCX 2F9GA 2BMCA 2PE2A 1GZKA 4E93A 5JFXA 3KB7A 4X2FA 2WOUA 3FZTA 3RAIA 3AOXA 4TYEA 4EOLA 3L9NA 1VYZA 3QGWA 3GC9A 3VHEA 3BWJA 4QMYA 2J5FA 5LJJA 4YHJA 5JQ8A 4LYNA 3PPJA 3NZ0A 3DLSA 3KL8A 3WZJA 3FHIA 3AC3A 3C51A 4IB0A 4E26A 3W0NA 2PVKA 1DAYA 4FYOA 5CAUA 4TN6A 4YJVA 5J79A 4C4GA 2JFMA 4G3DA 4X7QA 5BVWA 3DFCB 2VTPA 4XBRA 5IQHA 3F7ZA 4FZ6A 5EYCA 4RC2A 3U6IA 3HECA 5EH0A 3UNZA 2XNMA 4BTMA 5F20A 4JL9A 3PUPA 3R8VA 5ETAA 2GQRA 5KMKA 3W18A 2BILB 5TOZA 2C5NA 2QQ7A 4HZRA 1ST0A 3K5VA 3L8VA 3GFEA 4X3FA 3MVMA 3W1FA 2YLFA 1U54A 4D9UA 5FXSA 2ZVAA 5IEXA 3D2IA 3LJ2A 4BHZA 4DITA 3NNUA 3JXWA 4AOIA 3TZ8A 5BVNA 3E3BX 3OW4A 4KKEA 5LARA 4FI1A 1BI7A 3BEGA 3W2OA 2VN9A 5GNKA 4U3ZA 4CG9A 2J6MA 2O65A 2OSCA 4YGAA 3ORKA 4UMPA 4D28A 3PDTA 2DYLA 1KOBA 4FJVA 1M7NA 3NUPA 3PJCA 4NWMA 1FGKA 1H1WA 4BCHA 2ZV7A 4AGDA 3SLSA 2B53A 5IDPA 2PVMA 2VD5A 4YPDA 2X8IA 4XNEA 3WE4A 4KBCA 4XRLA 3PLSA 5EDQA 5HO6A 4JBVA 5JRQA 1UVRA 3QZIA 4S2ZA 3ODZX 4BDAA 2B0QA 4DEIA 3TUDA 2UVZA 3VW6A 4R6VA 3MH1A 4E5AX 3I1AA 2HZNA 1OMWA 3ZC5A 4H3BA 3BU5A 3OOMA 5EM6A 5FTQA 3RKBA 1REKA 4EOOA 2JLDA 4O7RA 5DEWA 2R5TA 3E3PA 3Q32A 3ZC6A 1M52A 4HOKA 4D0XA 3EL7A 3LFNA 2X7OA 2IVTA 2R4BA 2XK3A 3IGOA 4AN3A 4ZAUA 1LEWA 2B4SB 3OF0A 4RJ5A 3AT4A 4GG7A 5CSXA 2WQNA 2IWIA 3F5PA 1XO2B 4FV5A 3MIYA 4IB1A 3VUMA 4ANNA 4KIPA 5IPJA 1Q99A 5ETCA 1OITA 3ZRLA 4L7SA 3UP7A 3HV5A 2NYAA 2Y8OA 4IDTA 3G51A 4XP2A 4AXDA 3UVQA 4OT5A 4OUCA 5J7HA 4AQCA 4DTKA 3H10A 5DI1A 4L43A 4V05A 4IX4A 4JQ7A 2R3IA 5IMEA 3Q6WA 5IQFA 1Q4LA 3PXYA 2QONA 3TN8A 3VONA 4HYHA 3HUBA 2X39A 4LM5A 2OLCA 4IX3A 4QP2A 5HTBA 3R83A 4E6DA 3VHKA 3HGKA 3W0MA 1FBNA 4MXCA 4U44A 1KE8A 5KCVA 4K9YA 4FNWA 4N4SA 3M11A 4NJ3A 4PPBA 3DB8A 3PA3A 3QC9A 3E7OA 1YXXA 4JNWA 1QPDA 4KBAA 1PXIA 4AWIA 5CY3A 3R2BA 3ZUUA 2WMTA 3UDBA 3RWPA 4DFXE 2JDOA 3FEGA 3DK6A 4FZDB 5GJFA 1ZWSA 5F9EA 3OP5A 5HNGA 2FUMA 4K2RA 2JIVA 4AT4A 5CZHA 4CKRA 4J97A 2QOFA 3GCUA 4J8MA 4F99A 4KINA 3UIMA 3R8LA 5JFVA 4XCUA 4OTFA 3Q4ZA 3FI2A 5IUIA 1H0VA 4DEEA 4FOCA 2JIUA 1H26A 4ANQA 4A07A 1REJA 3L8SA 4J53A 4DG2E 1XH9A 3BYVA 4C3RA 4FV8A 4TWOA 5KE0A 2C6DA 2ZOQA 1QMZA 3MFTA 4BDJA 2QO2A 2W5HA 4PPAA 3JS2A 4KKGA 5ANEA 4IWQA 3I60A 3ALNA 5IH6A 3G15A 4GUBA 4RJ8A 4RSSA 3OT3A 5DHJA 3ZSGA 4DTAA 1BMKA 4IAKA 4L44A 4MXXA 4CV8A 2X6DA 3ULZA 4PPCA 5HE1A 4L67A 4A4LA 2XMYA 2W1CA 3KCFA 3D94A 3O7LB 4CNHA 3E63A 3LVPA 3LFBA 3AXWA 4BIBA 5KMNA 3GCSA 4PMPA 3ZO2A 2ITTA 4DGLC 4U5JA 5I9UA 4AW5A 3RPRA 3EFWA 3FMHA 4AQKA 3W10A 4PQNA 4NZWB 4F6SA 3V6RA 3I5ZA 5HG9A 4FC0A 3ZM9A 1Y57A 2VNYA 3K2LA 4G3EA 4EOIA 5A54A 5KX8A 5EKOA 4N70A 2RSVA 4O7ZA 1QPEA 3FXWA 2X6EA 3UGCA 4BCQA 3O50A 1I09A 5CNOA 2IVUA 4WG4A 5HNBA 5L2WA 5C03A 2R3GA 3QWKA 4Z7GA 2CGVA 4BDDA 1CM8A 3OTUA 3QRIA 4K6ZA 2Z7QA 1JBPE 1YWRA 5KHWA 3D83A 2VTRA 1YQJA 4IAZA 1H1PA 2GNLA 4JG8A 4B9DA 4C4EA 1XMLA 4GIHA 2HAKA 4QMLA 3EQRA 4NL0A 5EQEA 3PYYA 3OWJA 2VNWA 2YHVA 4GMYA 4U0IA 4L3PA 4DEDA 5E1SA 2XNPA 2OKRA 3ZYAA 3ZXZA 3Q4CA 5LVNA 1OL2A 4GFGA 4IACA 4FOBA 3MFRA 1YI3A 4WKQA 4YO4A 4QMUA 4WRSA 2XIZA 3KXMA 4IADA 2XYUA 3UVPA 3GU6A 1TVOA 4RWKA 4X21A 5L8LA 4Q9ZA 2BTRA 2OXXA 2IVVA 5JH6A 3GC7A 4M7IA 4HVDA 1YOJA 5IKWA 1MQ4A 4Z9LA 4G9CA 5CXHA 1PRYA 4EC9A 3E92A 5IISA 2R3JA 3DQXA 3HL7A 1PXPA 1Q8YA 3FYKX 4WG3A 2R3MA 4N6YA 2GU8A 5AV2A 3R30A 3W16A 4LFIA 3VS5A 4GUEA 5ANKA 4DDIA 3DLZA 3P86A 2QG5A 2J51A 4C02A 4YURA 2QG7A 2J0LA 3BBTB 3VS7A 3PY3A 2BVAA 2GQGA 2J9MA 3OWPA 3HAVA 2I1MA 3DZQA 2XM8A 2WAJA 4FIFA 4C0TA 4P5ZA 4D1XA 4ENYA 4FV1A 2VGOA 3FKOA 4H36A 3QRJA 4QTBA 1VR2A 5HE0A 4IM3A 2BCJA 3TTJA 3FV8A 2XK8A 5CSVA 3H9FA 4N0SA 5IA0A 3DQWA 2F2CB 3MS9A 1ZYJA 2WIHA 1ZMVA 4RC4A 2ZDUA 2C6LA 5HX8A 3PUFC 1YXUA 2BPMA 3HV6A 3FMJA 4BKJA 3H0ZA 3MVJA 3ZS5A 2R7BA 4OTPA 3E62A 4GCJA 4M8TA 5AV4A 3R8PA 3GEQA 5IMXA 2Y9QA 1NA7A 2AYPA 3F66A 5EKNA 1Q3WA 3QU0A 5HEZA 3RMFA 2GNIA 2R3LA 2ZDTA 3F2NA 2X9FA 5JZJA 4CFNA 3EQPA 4TWNA 4BBFA 5DPVA 3R6XA 2OGVA 4F09A 1W98A 2H9VA 2JKMA 3D9VA 4K77A 4L3JA 3U87A 2WGJA 4IVAA 4F6WA 4R3PA 4ZIMA 4R3RA 4AU8A 5EW3A 3F5XA 3HKOA 3KQ7A 4RMZA 4OLIA 1MQBA 5FP6A 3LQ3A 3VS0A 4ASEA 2G2HA 4F9CA 3LW0A 2FB8A 1XJDA 5CASA 4BIEA 4R78A 4XV3A 3P7BA 3R9DA 3NRMA 5EYKA 5CXZA 2XKCA 3TEIA 1LR4A 5BNJA 1ZYCA 5EW9A 3DT1A 2CCIA 4DFZE 4W4VA 4O7NA 1U4DA 4ACGA 4A9TA 1S9IA 2QLQA 3EN5A 2GTNA 3L9LA 4HPTE 4YHTA 4BKZA 3R22A 4G1WA 2XIYA 3LXNA 5M55A 4GV1A 4IANA 3RK9A 4FK3A 4XV2A 5EW8A 4EOMA 4EZ5A 3TV7A 2X8EA 2WEVA 3BHYA 3F69A 2DUVA 4HCUA 4I4FA 1GZNA 3SKCA 1DI9A 5HCYA 1R39A 4CMTA 2C6TA 3ZM4A 2R3QA 3C50A 4I93A 1UNHA 4ZJJA 3UG2A 4AZEA 5CAQA 4IXPA 3OXIA 2HZ4A 1KE7A 2CCHA 3FZOA 3MFUA 3F5GA 3R9RA 4EK5A 5IZFA 3LKMA 2UVYA 3LCOA 1SM2A 2ERKA 1AGWA 3OBGA 2QOCA 3Q04A 5CLPA 4B8MA 4ANSA 1W8CA 2C3JA 3TUBA 4C4HA 4MKCA 3ATTA 3R1QA 4GL9A 1G8SA 3F3TA 3DKOA 2E9PA 4FVQA 3ZTXA 5FG8A 3QTZA 4GEOA 2CNQA 3IW6A 1IRKA 3QQGA 3ML1A 3GNIB 4YZBA 3W0OA 4MWIA 5G1XA 3WZDA 2WELA 5LCJA 4W8DA 3ALOA 4TXCA 4AXCA 2WEIA 3WILA 4BI0A 4UMQA 4F1TA 4QMWA 2VWBA 4IH8A 1TQIA 1V0BA 3RK5A 5C4LA 1PXOA 2A0CX 3GCQA 4CZUA 4IVDA 1PMEA 4ZLOA 2F4JA 5CANA 3IS5A 4EHZA 4BCGA 4FNYA 4XHKB 1FVRA 4OBQA 4E4MA 5CSPA 4IE9A 3LXKA 3FLYA 2YIYA 1OI9A 2ITYA 4IAFA 4KRCA 4EK8A 4CV9A 4UMRA 4O7TA 1OL7A 4L45A 2ZV2A 4Z55A 5A4CA 3L9PA 5FP5A 4IX5A 4D5KA 4HZSA 4ZSEA 4ZTRA 5C9CA 3QGYA 4O27B 3ZLXA 2RFNA 2VO6A 5AR4A 2RFEA 4E5BA 3PY1A 4F7LA 3VUDA 2ZM1A 3HMMA 2W5BA 3U9CA 5JRSA 4M84A 3EN4A 3UIXA 2Y4PA 3QQKA 4IJPA 4OR5A 5LVOA 5TF9A 2GNFA 3UZPA 5CAPA 3TACA 3BYOA 5HHWA 3SQQA 2UZTA 4KNBA 3HRBA 4D2PA 4RFZA 2OJIA 3U6HA 3BELA 5D1JA 1Q24A 5AX3A 4YTIA 2B9IA 4NU1A 3LMHA 2WTWA 3GU5A 2BUJA 4RJ6A 4QPAA 5IA1A 5CT0A 4IB5A 3R04A 2OWBA 3DKFA 2BZJA 3NYXA 4DCEA 5JQ5A 4U6RA 5M09A 1NY3A 2OXDA 3RM6A 2OFVA 2X81A 3MVLA 3TKUA 4IM2A 3KGAA 1OECA 1GJOA 1VEBA 2A1AB 3SHEA 4C36A 1QPCA 1A9UA 3P79A 3TL8A 4NM7A 5IH4A 1WBOA 1XBAA 2P33A 4HVGA 4ZMFA 2ZYBA 4NFMA 3C0GA 5DOSA 2BALA 2QR7A 4RX8A 3V8WA 2X0GA 2Y7JA 4F4PA 3ZH8A 4C8BA 3WF9A 3QX2A 3R21A 3M42A 5KBRA 1O6LA 2JBOA 4RJ7A 4XG7A 2LAVA 3T9TA 4BDIA 4DEGA 3HAMA 2P3GX 2YCFA 3JPVA 4LL0A 3VQHA 2PPQA 3MJ1A 3O7LD 3OUKA 1Q3DA 4ZOGA 2G2FA 3SXFA 4E4NA 2JAMA 3NAYA 4IZAA 4AGWA 2B52A 3QLGA 4PTGA 2W99B 3VS4A 4P5QA 4X2JA 3FPMA 3NX8A 5B2MA 4LDTA 5EQYA 2BIYA 1M2QA 4BCNA 3RAKA 2C5OA 3COHA 4MX9A 4XLVA 5EM8A 3ZLSA 3II5A 3NCZA 5C8KA 4JLCA 4QP9A 5CF4A 5IG1A 2UW8A 2WTDA 4WD5A 4PMSA 3V5TA 4UXQA 1OPKA 3C5UA 2YITA 1HOWA 3QTQA 3EQIA 4HCVA 3G2FA 3QAME 4O4DA 5CU6A 4YTCA 3CXWA 4O83A 2GNGA 4U41A 4C2WA 3BYSA 4O4EA 4ZY6A 5ETFA 4DFYA 1ZOGA 5EFQA 4X3FB 4IBMA 2YAAA 2KTYA 3NPCA 4IJ9A 3FBVA 4NCTC 3KRJA 3P23A 3VO3A 2VTIA 3RPVA 1MP8A 3OD6X 5E8SA 3W2SA 4RVKA 4AZFA 2HK5A 4BYJA 2JAVA 3DXNA 4DH8A 4CKJA 2IW8A 3AMYA 3KVXA 1NXKA 5DT3A 3FWQA 2CHLA 4MH7A 3D5VA 5HCXA 2OJFE 5I9ZA 1UNGA 3SOCA 2R3FA 3QTSA 2OJGA 5LVMA 2YDKA 4CMOA 3SD0A 4RLKA 4NIFA 2WMRA 4N6ZA 2H6DA 2EB2A 4D4VA 2WMAA 1OKZA 1BX6A 3BZ3A 5AR2A 5AMNA 3FY0A 1SYKA 2IN6A 3QL8A 3D5WA 2XF0A 3VBWA 4I22A 3LCKA 2PMNX 3O8PA 2ITWA 4AGCA 5BPYA 3GOPA 3UPZA 3BHHA 3S95A 4O4CA 2O0UA 3BEAA 1OBGA 3WZUA 2O3PA 4QTCA 3KXGA 5ACKA 2PZPA 3D15A 3KN5A 4HYUA 5KKRC 4B7TA 2VX1A 3FMLA 4FZAB 3NLBA 4IM0A 2UZNA 1GY3A 5TT7A 2CPKE 5A14A 3R1SA 2V22A 4EOQA 5IUHA 3RWQA 3QF9A 2ITNA 1ST4A 2BAQA 4TRLA 3IECA 3V04A 4EHGA 3QRKA 3SX9A 1KE5A 4G3CA 4YLKA 4APPA 4L7FA 1IEPA 4IC8A 3REPA 4XOZA 4FX3A 1UWJA 4WSQA 4EBVA 4G16A 5GZ9A 3GU8A 2QI8A 5BVFA 1R0PA 3ACJA 3KRRA