2QOBA

Human epha3 kinase domain, base structure
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
298
structure length
279
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITRPSNLLLDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 279
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qobA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qobA01
3UP7A 5HLNA 5LWMA 3R83A 3CSVA 2NRUA 2P0CA 4XG4A 4LRMA 4CRLA 5A4LA 5EQEA 4GEOA 3LOKA 3NGAA 3T3UA 3ZO1A 2BZKB 1IA8A 2QKWB 1TQPA 3QC9A 4BTJA 4EH6A 3CTJA 4G3GA 5J8IA 4C3RA 2WOTA 4W8DA 1YW2A 4BDIA 5AR4A 4I5PA 2OBJA 4RVTA 3FV8A 3P1AA 2VTLA 3PSBA 3WF7A 4BBEA 2UW0A 2W1HA 3F3VA 2RKUA 3F7ZA 5ANIA 3EN9A 4MD8E 1JSTA 3K2LA 1IA9A 1OITA 2XKFA 4L42A 3T9IA 2ZMCA 1Y91A 2OSCA 2QQ7A 2V7AA 4WNMA 3FLNC 3UE4A 2CJMA 5AP5A 2XK7A 4CTBA 4ZTQA 3W8LA 4C61A 2WIHA 3MGYA 1Z57A 2BTRA 4XG3A 4HNFA 2X2MA 3W1FA 5IQGA 2JBOA 3PDTA 1UVRA 5I3RA 4J71A 1H8FA 1CM8A 3GU7A 1VEBA 4EZ5A 4RVKA 3QZHA 3KRWA 4EOIA 2UW6A 3PIXA 4KSQA 4O86A 2C6MA 3PZEA 4LMNA 3GCPA 3QTIA 1PMNA 3PVUA 3PXFA 5EDQA 3CPCA 2XEYA 4IWQA 2C0OA 4Y85A 3LCKA 2ZDUA 2J0MB 4F0GA 2FGIA 3FSFA 3HX4A 1IR3A 4JDHA 3NVMB 2WHBA 4DFBA 3LXLA 4BHNA 3KCFA 4J7BA 4LOPA 5IH5A 3GCVA 4FKJA 3FZ1A 1OB3A 3UODA 3ZZEA 3MY5A 1Q8TA 2WMQA 4CFUA 4P2KA 4QNYA 5AUTA 2OFUA 2VTSA 2C1BA 3OBGA 2C3LA 5HGIA 4KKHA 4XHKB 3ORLA 4XRLA 4IAAA 4D0WA 2EB2A 5HNGA 3FI3A 4RA5A 2C0TA 3RPVA 3AGLA 5IG1A 3LVPA 5E8UA 2UZTA 3UC3A 3TV6A 5H8EA 3QUPA 2ZMDA 5I9ZA 1PYEA 4RJ7A 3FPQA 2W96B 4RX5A 3C4XA 1YHWA 4DT9A 5LQFA 3E8CA 4ZMEA 3GEQA 4EWQA 3AMYA 4AZEA 2JKQA 1NA7A 5BUEA 3SXFA 3W2QA 4RPVA 2CHLA 2JEDA 3LLTA 1KE5A 3PVBA 4FKTA 1BKXA 3Q4ZA 2XNPA 4O7RA 1R0EA 4PL3A 4O38A 3DBQA 4GK4A 2UVYA 4PY1A 4QNAA 4MVFA 5EHOA 1Y8GA 2VUWA 4FTNA 4XV1A 2IW9A 2H6DA 4E6AA 2PHKA 4IE9A 5IEXA 1DI8A 3VUHA 3KEXA 1OBGA 2XNBA 3PJ1A 4IX4A 1P4FA 2R5TA 4Q5EA 2C6TA 1OL7A 5C4LA 1Q8YA 3O8PA 2V55A 2XNMA 3OWKA 3GT8A 3HV7A 3UIMA 3QCQA 3E7VA 3QX4A 4ACDA 3R9RA 2A0CX 5F95A 4RT7A 2IZUA 3TTJA 3P9JA 2F2UA 3PRFA 3ZDUA 5FD2A 3RK5A 1LP4A 4BWKA 2C6EA 4RZVA 2QG7A 4K9YA 4CYJA 1OIYA 2R3IA 1VR2A 4M69B 4BBFA 4ZEGA 3ATSA 3BU6A 2B54A 4ENXA 4QO9A 4DA5A 3HEGA 3WE4A 2BHEA 4EHEA 1JBPE 4YPSA 5EYCA 5CF8A 3S4QA 2R3QA 5KBQA 3JXWA 4AQCA 3V5PA 2X4FA 4DGOA 3WILA 2XRWA 3FZTA 4UN0C 4CYIA 3QD3A 1GIIA 1G5SA 4GRBA 3FMHA 5CF6A 2BFYA 4RIWB 2PUUA 1OI9A 2OJFE 3PSDA 5AUVA 4AOIA 3BHVA 4JI9A 4MAOA 1YXTA 4WBBB 5CZIA 5J5SA 1ZMUA 4HYHA 4MQ1A 4PPAA 5FLFA 2UZOA 5M44A 4ALWA 1AD5A 4HCUA 3HP5A 4FKGA 3LZBA 3D7TB 4IJ9A 4JBVA 4X2NA 4FSWA 4NIFB 2RF9A 4HGLA 4Y72A 4TYGA 2F7EE 3AXWA 4XG7A 3RAHA 4Z16A 4C7TA 1UU7A 5DG5A 3TI1A 4NTTA 3Q6UA 1L3RE 5AAGA 3EHAA 3I5NA 4CZUA 5EDPA 3C5IA 5HNBA 5AV1A 4F9CA 4QP6A 5E9EA 5C8KA 3UZTA 4YJSA 3D5VA 3TACA 3D83A 3DFAA 4RIXA 4WT6A 2I0YA 3E8EA 3BWJA 3MPMA 4FV6A 1IEPA 4GK2A 4FX3A 4M69A 4U40A 5FRIA 4D1ZA 4LG4A 1SVGA 5DEYA 3V5QA 5BVOA 4FKIA 5L3AA 5TKDA 3MYGA 4CFWA 4YTFA 3SDJA 2P3GX 3THBA 2R3LA 4ZSLA 2BPMA 4BZDA 1JKKA 4R5YA 3DAEA 1YOMA 2R3GA 2I0HA 2PYWA 2JD5A 3WBLA 5EK7A 4DN5A 2BUJA 5L2TA 4R78A 4AA5A 3MESA 3H9FA 2JFLA 4DLJA 5L6OA 5HD4A 4RX8A 4EK4A 1H1RA 4RIWA 4D2VA 4OTPA 3G51A 3NLBA 4O7WA 4U43A 4RLLA 5EFQA 2F7XE 3A61A 3VN9A 4HYIA 4FV3A 4G6LA 2VO7A 4I41A 5EM8A 3VUKA 4D0XA 4DFNA 2WMUA 2EU9A 2PK9A 3BQRA 3D7TA 3HRFA 1B6CB 4LV5A 3QZIA 2GHGA 3UVRA 3UVPA 3VJNA 5IA0A 2J5FA 5IQDA 4GG5A 4NIFA 3OW4A 3IW8A 4FTCA 4BCPA 2IPXA 4I22A 4RJ6A 3ORKA 4RZWA 4F08A 3O23A 5A14A 3JY9A 4P5QA 3A7GA 3QWJA 5FXRA 4AWIA 4XP3A 3ALOA 3ENHA 3FKNA 4RJ5A 2GNHA 3M11A 4KAOA 3E93A 3BYVA 1UNGA 1OL2A 2QU5A 2XYUA 4GYIA 4AGDA 3OT3A 4CD0A 5M4IA 3RNYA 5G6VA 2XUUA 1CTPE 4IWDA 4M13A 3PE1A 1JKTA 2CGWA 4EOLA 4ZMFA 5CAVA 1XH6A 3L1SA 1DI9A 3R9NA 3EFLA 3VF9A 4F09A 1OUKA 2P33A 5CQUA 4CRSA 4R6VA 1WMKA 3O0GA 3IOPA 5KBRA 5CNOA 2W1DA 4IX3A 3W2PA 2XVDA 2PVJA 1XJDA 3V3VA 3WIKA 4AT4A 1ZLTA 1TQIA 3BV3A 4Z9LA 2W0JA 3ORMA 4E8AA 2PMLX 4ZTMA 2E9NA 1U4DA 1ZYSA 4C0TA 2QLUA 3G9LX 1GOLA 4AZSA 1CDKA 5A46A 3LCOA 3OCBA 3KY2A 4NSTA 3NZ0A 5BVEA 4PDSA 4RSSA 2QOLA 3UP2A 3UNZA 1ND4A 4IVBA 4R77A 3DCVA 3GOKA 4G5JA 5HQ0A 2QR7A 3WZEA 2GQRA 3HLLA 2VWYA 4H36A 3U9CA 3G90X 3TTIA 3MVHA 1PKGA 3R30A 4CFFA 2W05A 4FSTA 4O0SA 5J5TA 3QZGA 3UTOA 3DGKA 1P5EA 3DKCA 4NFMA 3KFAA 4QMTA 4MBIA 4ZTHA 3RPRA 4AOTA 4AW0A 1YHVA 5IZFA 3QD4A 4WO5A 3JY0A 1S9JA 2XP2A 2X6DA 3ZXTA 4DBXA 4DE4A 3HMIA 4ZS0A 4QP4A 2PMIA 4W8EA 1OPLA 3AD5A 3R7GA 4B9DA 3AC8A 1BL6A 4YJPA 1YXXA 2YJRA 4ZTLA 3ITZA 5DT0A 2R4BA 4BCFA 4YBJA 4QMZA 4RC3A 1O6YA 3WIGA 4YSJA 3DZOA 4Y46A 4DH1A 2YJSA 3OROA 1DS5A 4KBAA 4FNXA 1ZWSA 2C5OA 3H9OA 4IFCA 5LJJA 2OF4A 4MNFA 4RIYA 4C4EA 5CSHA 4CKRA 4PV0A 3DS6A 3OCTA 4QQ5A 5B2MA 2AC5A 3MB6A 4UZDA 1LEZA 4CFXA 3SC1A 3QTSA 1IAJA 4G31A 3KKVA 1QPEA 4HVDA 2W5HA 3Q5IA 4EH3A 4R3PA 3PYYA 4F1MA 4QMUA 4OTQA 4FT5A 2XZSA 3W55A 3AT3A 4JXFA 5ANJA 5AV3A 4YZ9A 4D2SA 5D11A 2FA2A 4FV0A 4O1PA 3NW5A 5CF5A 5KHXA 4JJRA 5HHWA 4O6EA 2CSNA 2PZRA 5D12A 4EH9A 3UJGA 2C5YA 5CTPA 4D2RA 4XP2A 4FSYA 2WTVA 4GW8A 4AN3A 2HZNA 4KBKA 1Y6AA 2VGOA 5KZIA 3QTRA 3F69A 2C30A 4FL1A 3QRUA 3NUXA 1YDTE 5AMNA 5AAEA 4B7TA 2RFDA 4YHTA 2C5XA 4Y83A 3TNHA 1GZ8A 4C3FA 4BYJA 4EK8A 2YWVA 3LFDA 4DEHA 1AQ1A 2X7FA 2ZV8A 3TZMA 1YWNA 1PXPA 5DMZA 4HVGA 3WF5A 5IQIA 4OTDA 4EHZA 5BNJA 4EH7A 4QPSA 2ITVA 2EXEA 4GYGA 4UB7A 4O2PA 5HG8A 2VTIA 3PWYA 1E1VA 3UMXA 3Q9ZA 4YURA 4QYYA 4W4YA 3EQHA 3R02A 3KC3A 3CE3A 2BZHB 5GJDA 1WBOA 3R7EA 4O7NA 3BYSA 4JRVA 2C6LA 3MH1A 3PJ3A 3T3VA 1TVOA 1UWJA 3PA3A 4AW1A 4G2FA 3A7JA 1HCLA 3R8VA 4BWPA 5E8XA 5GNKA 3VRZA 4YPDA 2Z7QA 4LOOA 4WOVA 3ROCA 2YWPA 1WVYA 4FV2A 4V04A 5M08A 3WE8A 4AUAA 3QD2B 3HDMA 3MN3A 4JQ7A 5K4JA 3KCKA 2ZB1A 4JG6A 3ZCLA 2FSTX 1P2AA 2CGUA 4LFIA 4UV0A 5DA3A 3AC2A 3R9DA 4O7TA 5D10A 4L3PA 3DKFA 4WA9A 4YO6A 1H1WA 4K6ZA 1DAYA 5CEQA 3VAPA 4BVUA 5LVPA 4CVAA 4II5A 3R63A 5CU4A 1J91A 3C13A 4GIHA 4XG6A 3ZS5A 3KMUA 3FI8A 2YDKA 3D15A 5AM7A 1XH7A 3NYVA 3BRBA 2GTMA 2X39A 1H08A 3EQPA 4ALUA 2Q83A 2O2UA 3COKA 3LAUA 3Q9YA 4USFA 4XG8A 3NCGA 3ZUVA 3QWKA 5FXQA 5BVWA 3R8LA 2WQMA 4ACMA 3QX2A 4DGMA 3W10A 4FTIA 3QL8A 4FTJA 5FDXA 4ALVA 4DEDA 3R7YA 2Q0BA 3LXPA 4G3DA 2FO0A 4JRNA 4M7IA 4MXYA 2UW8A 3RMFA 4EHGA 1YKRA 3GVUA 3TV4A 4R7IA 2AYPA 5JKGA 5L2WA 5JZNA 5HORA 4DYMA 3Q4CA 2B0QA 4O0YA 3Q6WA 4QP2A 4XH6A 4NL0A 2YN8A 2J7TA 1ZOGA 3H4JA 4FGRA 5KNJA 1QPJA 2X8EA 2VNWA 4S2ZA 5KE0A 3UPXA 2XNOA 1YXSA 3FKOA 1UKIA 3EYHA 3COHA 4RFZA 3C1XA 3RPYA 3KXGA 4AAAA 4GMYA 5LCJA 3UQCA 3Q2JA 5K0KA 4ZK5A 4Q2AA 5A4TA 3MH0A 4XYFA 5TF9A 3BQCA 4H3QA 4PL5A 1WBSA 3V6SA 3RWQA 4ZSJA 1GIHA 4ITJA 4K18A 5H2UA 2F49A 5JRSA 5BVKA 2EXMA 4IANA 4M8TA 2OI4X 4WKQA 5DI1A 4TPTA 3U6JA 4PNIA 3Q32A 4DG0E 2HXLA 2QD9A 2B9HA 3FZSA 5DT3A 3BE9A 4TZRA 2BHHA 5ICPA 5F20A 3DBFA 4GIIA 4YLLA 4HW7A 2XEZA 1BX6A 1V0OA 3QGYA 2GU8A 3PJCA 1ZYJA 2Z7SA 4RRVA 1SZMA 3R2BA 3GCUA 4XCUA 4QQCA 2BMCA 4CXAA 2WTCA 4JVGA 2ETKA 2BIYA 4O0XA 1U59A 3COMA 2HCKA 4JQEA 4BL1A 4EC9A 5D9HA 4YZCA 5DN3A 1XR1A 2VWXA 4CGAA 4X7QA 5K0XA 5E90A 5C9CA 4USEA 4IAKA 4FL3A 4M3QA 4N57A 1J1CA 5JQ5A 5LMKC 2GHLA 3BYOA 3C4EA 2P2IA 3FMLA 2CGVA 1W8CA 1OPJA 3KXMA 4R5SA 2UZUE 4KIOA 4M84A 3RPOA 3UPZA 2I1MA 2GQGA 2CKQA 2I6LA 2R7BA 4ANOA 2O63A 2QOBA 2FSMX 4N4SA 5AP4A 3OWLA 3GC0A 4ANNA 4E93A 3FL4A 4KB8A 3QRIA 4BDHA 2OXYA 4C4IA 2HENA 4EZ3A 3K5UA 3CKXA 4FSUA 4JDJA 3EN7A 4C4GA 2IG7A 4EK3A 3MVLA 4NH1A 1JVPP 4D4SA 4NM7A 5HI2A 3K3JA 4GVJA 4A9RA 3EN5A 3F3TA 4UMQA 4YNEA 4EYJA 3DBEA 4JOAA 4I6HA 4MWHA 4BKJA 3ZBFA 3UQGA 2O3PA 4NM5A 3KXZA 3IS5A 2Y4IC 4UMRA 4O7LA 4L7SA 2Y4IB 3HAVA 1Y6BA 3B2WA 4UALA 5CI6A 1JWHA 2YAKA 4RQKA 4M97A 3TCPA 3VS0A 4KABA 3D14A 4O81A 4JG8A 3BPRA 4WNPA 4AFEA 2VTNA 3FLQA 3LIJA 5IQFA 3NRMA 4C33A 2YM5A 3CGFA 4TWNA 3PXRA 2BVAA 3LFBA 2VU3A 3LPBA 3MDYA 4RWJA 3VUDA 1YI3A 4YJUA 3SG9A 1H0VA 3GC9A 4IB3A 4ZJJA 4BY9E 1XKKA 3OXIA 4E6CA 3BE2A 2PVRA 3GCQA 3L9LA 4LYNA 1TKIA 4PDPA 2QHNA 2XJ0A 4FK3A 4I20A 4KRCA 5AUZA 2R3OA 4O21A 5CEOA 2Z60A 3IDCA 4GVAA 2CNQA 4J8NA 4L7FA 4RVMA 3TDWA 3PPJA 3W2CA 3SW4A 3QCYA 3I7BA 3UDBA 1CKIA 4FNZA 1W83A 5CEPA 3RAKA 5EI6A 2NNWB 4G6OA 4PDOA 3B8QA 2HELA 3FWQA 4GUBA 3W32A 4V05A 2Y4PA 1PMVA 3LKMA 3QKMA 4FZDB 4I4FA 4RJ8A 4ACHA 4PP7A 5EG3A 5ETFA 3V5WA 3BLRA 2YERA 1U5QA 4ZSEA 5ETIA 5LVOA 1BLXA 2QKRA 4FVPA 5EOLA 5I9WA 4OT5A 2H34A 2OIQA 3RM7A 4GS6A 3A2CA 4P90A 5BYZA 4BCGA 4RWLA 3DXPA 4U79A 4YC6A 3HMPA 4BDFA 4G9RA 2BAKA 2UVXA 4LRJA 5HESA 3RAIA 1GZOA 4NZWB 3IQ7A 2F4JA 2WMRA 3EIDA 3NEWA 3ATTA 2G2HA 3VHKA 3VQUA 2WU7A 4BYIA 5CVFA 2XF0A 4P7EA 5L2IA 3RWPA 4MEDA 1J7LA 3NNUA 2YIRA 4FTQA 3R1QA 3RI1A 4BWXA 2F7ZE 3IO7A 2ITYA 3KU2A 4OAUC 2V22A 2WMXA 4YR8A 1U54B 3QGWA 5BUIA 2JKKA 4BICA 4R1YA 1OL6A 4ZS4A 3RZFA 4UWCA 2WEVA 3EH9A 2HY0A 4IMYA 3ANRA 4DEIA 2EXCX 2BFXA 4DBNA 4M0YA 4O7YA 4OW8A 4UY9A 1NVSA 3UG1A 1WBWA 3E7OA 1UA2A 2X0GA 4FGBA 3DJ7A 5HNIX 4Y73A 2J0JA 1KE7A 4CZTA 2X8IA 1I44A 1DAWA 2PSQA 4O0WA 4PMMA 5KZ0A 3QLGA 2BAJA 4CZYB 4XOZA 3KMWA 1RQQA 4BGQA 4WNKA 1SVEA 1L8TA 4QTEA 2I7QA 1BL7A 2CLQA 2OWBA 2R3JA 4PRJA 4S33A 2XKDA 4C4JA 3TL8A 4WBOA 2W1EA 4UWYA 2HZIA 3U6IA 3PG1A 4FTRA 1Q3WA 4WRGA 4ZJIA 4F9YA 3MFSA 5AR7A 2GNJA 3EQCA 3ANQA 4GU9A 5C8MA 3O7LB 5BUJA 5CYIA 4UZHA 3VNTA 4CT2A 4FICA 4B8LA 4EOJA 3EQIA 2VTOA 3ORPA 3HV5A 3SLSA 1YDRE 4FT9A 2PWLA 2YCSA 4BGHA 5IDPA 3FZPA 3MH3A 1PW2A 4GT3A 5HG9A 1XH8A 3R9OA 4EK6A 2B9IA 4PL4A 4QYGA 2GDOA 4TYHB 3UZRA 1B39A 3LJ0A 1UWHA 2X2LA 5EM7A 4YTCA 2WQOA 4BKYA 3VBQA 3EQBA 3HMOA 4IVAA 1U54A 5I4NA 4FSZA 5CEMA 4FKLA 1OIQA 3UIUA 3OOMA 4A4OA 4AT5A 3PIYA 1XH9A 2VTAA 2O8YA 3CY3A 4RQVA 5AR3A 3ZSGA 1M2RA 2WAJA 4L00A 2WTWA 1Q8WA 2XKCA 4PPCA 1PXJA 4FKOA 4GKHA 3ENMA 4RA4A 1UU3A 4BDEA 4I23A 1MRYA 1R1WA 4D58A 2BRGA 4BZOA 3F61A 2GNGA 3S1HA 3OY1A 3DB6A 3L9MA 5DR9A 4IH8A 1IRKA 3FMDA 4DFYA 3FI4A 3OTVA 3FBVA 3R8UA 2HW7A 3VS6A 5KMLA 4YMJA 2XCHA 4BB4A 3IDPA 2BIKB 2GNLA 3HL7A 4PP9A 1ZMWA 5A4EA 4K33A 2C6IA 4BCJA 3FL5A 3UO6A 3MH2A 4FV4A 2YFXA 2B53A 3QA8A 4EOQA 4C62A 1UU8A 4W4XA 4F1OA 3OOGA 2JAMA 2X9EA 4QQTA 3DOGA 4Z7GA 1OIUA 4QMWA 4RX7A 5E1SA 3L9PA 3QUEA 3C0HA 4BBMA 3CCNA 5KMKA 3BGPA 5AUXA 3G0EA 2UV2A 4TYHA 5EKOA 1G3NA 3FZRA 3OC1A 4WNOA 3I1AA 3POZA 2JKMA 3ZXZA 4ANLA 2R0IA 3ZMMA 3F5XA 3DAKA 3ZLYA 5F9EA 4G6NA 4IAIA 3TKIA 3OUNB 3W18A 3N4VA 5AV0A 4L52A 3PY1A 3DAJA 5ACBC 5IF1A 4JAJA 4XV9A 3R7UA 4RMZA 3DV3A 4MXXA 4U3ZA 4E1ZA 4XV3A 1IAHA 1J3HA 3V8WA 1UNLA 3ZDIA 2QO9A 3DJ5A 2ETMA 3DKOA 4NEUA 4EORA 4GL9A 4S32A 4IB1A 2E9PA 3SXRA 4AS0A 3KK8A 3PIZA 3H0ZA 3NSZA 4MWIA 4U7ZA 2X81A 4CCUA 5KMIA 4KD1A 5HKMA 3HZTA 3VC4A 4EK5A 4BDKA 3LMGA 5DRDA 4O27B 2YZLA 2AC3A 4I0SA 4AACA 2JDOA 5B2LA 4FV7A 2ITQA 2VTJA 4FODA 2YA9A 5HE3A 5HVKA 3I81A 3UOHA 3PVGA 4X6QC 2FSOX 4DEAA 1JPAA 4G34A 4TWCA 4W9XA 2G01A 4I5HA 4Y5HA 3NYXA 3SKCA 3UGCA 5AIRA 5LWNA 3C50A 4BCQA 1JKSA 3U54A 2C69A 3O8UA 4A06A 3W2SA 1HOWA 1FGKA 4AN2A 2XMYA 3W8QA 4FZAB 5IA2A 1ZZ2A 3QA0A 5DIAA 4DITA 5HBJA 2HIWA 5J7BA 4YLJA 1J7IA 4AE9A 3LFCA 5IPJA 2GSFA 5AX3A 5IA5A 4IQ6A 1XBCA 3UMWA 2A1AB 3II5A 4DGGA 3QF9A 2XJ2A 4L9IA 4IM0A 4Y8DA 5GINE 3JUHA 4M0ZA 2PVHA 4J52A 5F4NA 4U41A 3UNJA 5IMXA 2WPAA 5LOHA 5DT4A 5J9LA 4C38A 3HV6A 2FUMA 4OBPA 1CKPA 4FMQA 3TNIA 5HO6A 4A9UA 4HVIA 5HU9A 5HX6A 4L01A 2QNJA 3QCSA 4YSMA 3RINA 3DA6A 3DK6A 3AC5A 4EOKA 4NM0A 4I93A 3TXOA 4LL0A 5JGDA 3LXNA 4HCTA 1OUYA 3O51A 5ANOA 3W33A 3MFUA 5T3QA 4EUTA 3CR0A 3T9TA 2XJ1A 1K3AA 3S00A 3D7ZA 3FHIA 3JVRA 3R22A 1YOJA 4YP8A 3C0GA 5K5NA 3D2IA 4KIKB 4K2RA 4I94A 2OJGA 1H27A 4U0IA 2XS0A 5JMSA 4H3PA 1Y8YA 4D55A 1ZY5A 5DE2A 5J1VA 4JX3A 4ZIMA 2VO6A 3C4ZA 2ZM3A 4JLCA 2QOHA 4F6SA 3BGQA 4I5CA 5HTBA 3EMGA 3IPHA 2C0IA 3CD8A 5CAUA 4QTAA 5JN2A 5CWZA 3KF4A 2ITTA 2JLDA 3DBCA 4L46A 3DDPA 4FF8A 4XP0A 4A9TA 3L8VA 3PZHA 4W4WA 5AADA 1WZYA 5CNNA 3HP2A 2C4GA 2W06A 4ZTNA 3R7IA 4QMMA 5H9BA 4ACCA 1H00A 4FNYA 2BZJA 4IJPA 4XBUA 3F88A 4FSQA 5K3YA 2BKKA 3V8SA 2JDSA 4LGGA 5FEQA 3RK7A 4QOXA 3QBNA 4TNDA 3OG7A 3BYMA 3GU4A 2WTDA 3OEZA 4EOSA 4UX9A 3MIYA 2FSLX 4LGDA 3B2TA 4KA3A 4AF3A 4N70A 2G2IA 3IW5A 2XNGA 5HBEA 3IOKA 3P86A 5I0BA 5M51A 3V51A 3FY0A 2P2HA 1OKWA 4FZFB 3QTUA 2XRUA 5HICA 1CSNA 4GH2A 1PJKA 4NJ3A 3ORTA 4R8QA 2XH5A 4R7HA 1LUFA 3ELJA 4NTSA 3ZFXA 2CNUA 2JBPA 3TM0A 4CV9A 1V0BA 4KIKA 4XEYA 2XB7A 3CEKA 3DK7A 4JDIA 4X0MA 2R7IA 4YJVA 3LM5A 3JS2A 1ZYCA 2YZAA 3DTCA 3POOA 4ENYA 3F5PA 4LMUA 2A2AA 3O8TA 5IH4A 5HZNA 5DPVA 3QTXA 3Q53A 3ZSHA 2QOCA 2BROA 4FI1A 4I21A 1F3MC 3GUBA 4CV8A 4IDTA 2YDJA 2Q0NA 5AP3A 1YXUA 4FZ7A 4G3EA 4NT4A 5CAPA 2H9VA 2WEIA 2XK9A 3KK9A 3E88A 2W9ZB 4FOCA 4NKSA 5AP2A 2WMVA 3LFQA 4FTTA 4V0GB 5IQCA 3BZ3A 2IZSA 2WQNA 4QD6A 3PSCA 4W4VA 1G8AA 3BEAA 2ZM1A 3G15A 2VTPA 5DOSA 4QQJA 3R8PA 4E7WA 2J6MA 4I3ZA 4EH2A 5GJFA 3F7WA 4LL5A 4PMTA 2WO6A 4F7JA 4QYHA 3TZ8A 4RJ3A 2R3FA 4Z7HA 2X1NA 3QHRA 4W9WA 5ANGA 2XK6A 1BYGA 4LUDA 2QONA 3ZBXA 2UZNA 4DEEA 2YM8A 4BI1A 3K54A 5JFSA 2BALA 3BHUA 2V7OA 2XIRA 5JGBA 4O82A 4EQCA 3N4TA 4A07A 1Q3DA 3ACJA 4FIIA 1VJYA 5GZAA 4EH5A 3NNWA 4J99A 3DNDA 3NS9A 1V0PA 4EL9A 4OTWA 1YQJA 3OVVA 3M42A 3LQ3A 1XBAA 4FSRA 3EWHA 1GAGA 2VZ6A 4KKGA 5CU0A 4YC8A 3CQWA 2IN6A 3HUBA 5E7RA 4AE6A 2XBJA 4B99A 3ZOSA 2WMBA 4IZ7A 3KRJA 3JR1A 4GV1A 1YDSE 3KQ7A 4DFZE 4FVRA 3HMMA 4MNEB 5AP1A 2HY81 3ZO3A 4ITIA 1FBNA 5M56A 5M55A 3R1NA 3QUDA 4O7SA 3FY2A 2R9SA 4K77A 5HTIA 3P4KA 3I79A 5KMNA 3GFEA 4MD9E 3P7BA 4E6DA 4K0YA 3PJ2A 4I5MA 4IX5A 3SX9A 4V0GA 2XK4A 2X4ZA 4GSBA 5KUPA 3BV2A 4S34A 4FIJA 3R8ZA 1H4LA 5IEVA 5IQBA 3IK3A 4TY1A 4PX6A 4C3PA 2OJJA 3LJ2A 4PWNA 3RPSA 5FP5A 3Q5ZA 4QPMA 4JQ8A 2VTHA 4OR5A 3LFEA 1KOAA 4JNWA 3F3UA 1OKYA 2JAVA 2VWIA 4ANBA 5LMAA 4EQMA 3FLSA 4CKJA 3WYXA 4FBXA 3TJCA 2ZVAA 3E63A 3UZPA 4R7BA 1SM2A 3FHRA 5HTCA 2ZJWA 5L6WL 2IW8A 3ET7A 1KE6A 4C8BA 4U8ZA 5JEBA 2PVKA 2QU6A 4A7CA 3CQUA 2B55A 3I0QA 3LFSA 3R6XA 5FM2A 3TUDA 4H05A 5EOBA 3ZYAA 2PVLA 2Y6OA 1E1XA 3O7LD 2Y9QA 1OVEA 3RHKA 2XM8A 5AA8A 3R1YA 3FXZA 3WI6A 1W98A 3P08A 3IW7A 5TR6A 5AEPA 4EI4A 3NAXA 2BCJA 1W84A 3D0EA 4EZ7A 4A4LA 5ITAA 3UQFA 1XHAA 1VYZA 4DGLC 5HIEA 2R0UA 3CS9A 3NMUF 2VX1A 5CANA 4D2WA 3AT2A 2EB3A 2WIPA 4IWPA 1VYWA 3QYZA 3EFKA 4D4RA 4D2PA 3OD6X 3CD3A 3ZC5A 1KV2A 1WCCA 2B4SB 4D4YA 3VS3A 5KMOA 1WBNA 4MCVA 2PVNA 1OBDA 4DC2A 4YZBA 2QURA 4QMPA 2CCHA 2CKPA 2HK5A 4EONA 2QOKA 4BI0A 3LW0A 3ZTXA 5FWKK 4X21A 5C26A 5FTOA 2R64A 4TXCA 3MIAA 3V5TA 4DFLA 4HGEA 3RALA 2VX3A 1FINA 4KS7A 4QYFA 5CSWA 3D5UA 4C57A 4GKIA 5GIPE 3BYUA 3A4OX 1H01A 2OJIA 3SA0A 1YVJA 3UOJA 2YM4A 3VW6A 1JAMA 3MPTA 4L53A 3TV7A 4YU2A 2FVDA 3HYHA 2PMOX 3DDQA 4H58A 3ZEWA 3Q9XA 1FMOE 4DFXE 3AC1A 1JKLA 1VZOA 3OTUA 4Q9ZA 4J96A 3EJ1A 3VBTA 5FG8A 2ITOA 5CASA 1AGWA 2BR1A 3FYJX 1SYKA 4KNBA 3HAMA 3RJCA 1CKJA 3S95A 2I40A 3CGOA 4YJOA 5M4FA 3NUNA 1QL6A 3G6HA 3R00A 3TIYA 4HVHA 3K3IA 4ZZNA 2GCDA 4BC6A 1XQZA 2ZV7A 5IH6A 1ZXEA 4JT3A 5JT2A 3ZM9A 5EI2A 3EKKA 1F5QA 2DQ7X 2W9FB 3CTHA 3EKNA 4LV8A 5CAOA 1P14A 2VTQA 3FZOA 4H1MA 3SOAA 3VJOA 2WZJA 4IVDA 5EM6A 1MQ4A 5D7AA 2XK3A 1B38A 3EYGA 3NDMA 5A4CA 5AUUA 3N9XA 4NJDA 1Q41A 5GHVA 3ZUTA 3MJ1A 5CAQA 3FQHA 5AP7A 2PULA 5CQWA 3MTLA 4HPUE 5CU6A 4C36A 2VD5A 3CXWA 5DR2A 4AW2A 3UYTA 1V1KA 3Q4UA 4A9YA 2UUEA 4KINA 3LQ5A 4A9SA 2YEXA 3ZEPA 4GJ3A 3TWJA 5EW9A 3GB2A 1KV1A 3SV0A 3KA0A 5E8ZA 4D28A 3TDVA 4O0UA 4RFYA 3GQIA 5LCKA 2J4ZA 3FMNA 5HE0A 3ZC6A 3C7QA 3PY0A 3QQHA 4HZRA 4BZNA 4AA0A 2O0UA 5LVNA 3SW7A 2A27A 5IUHA 4YTHA 3DQWA 5D41A 3Q96A 4DCEA 3RCDA 3H0YA 2JITA 3V04A 4KBCA 3W16A 1WBPA 3AQVA 4J97A 4QP8A 4V01A 5CALA 3IGOA 3TIZA 3R7OA 2CKEA 2WMAA 3C9WA 3EQFA 3P7CA 5HCZA 1OKZA 3BHHA 4FA2A 2B9FA 4ZY5A 3AC3A 4C58A 4IC7A 2ONLC 3Q04A 3Q4TA 3ZSIA 3FMEA 3DKGA 3CJFA 5A54A 5K5XA 4I4EA 3E3BX 1NXKA 4L6QA 4L68A 4K8AA 3ZLWA 2PUPA 3VS1A 4I92A 4ZLYA 4PMPA 3NAYA 3RKBA 1CMKE 3MFTA 2OFVA 5C1QB 2CLXA 3C4WA 4E5BA 3BCEA 5HOAA 1LEWA 2PUIA 1Q8UA 3QQFA 3W2RA 4O96A 4FZ6A 1Z9XA 5E8TA 1PXMA 4FV1A 1M2QA 2UZBA 2DUVA 1K9AA 5BVDA 3CY2A 2UZVA 4AZWA 3FLZA 3CLYA 3BBTB 3D4QA 4U3YA 3RNIA 4ANQA 5M07A 4BRXA 4FIFA 3WOWA 1FQ1B 1FVVA 5EM5A 2CMWA 4UXQA 3RTPA 4BGGA 5JFWA 3LCTA 1WBTA 4AW5A 1R78A 1SNUA 3N4UA 3F3WA 1H1SA 4RGJA 4U6RA 4WG3A 4WRSA 2OLCA 3AT4A 4EUUA 4XRJA 3F5GA 1H28A 3GU6A 3PPZA 3VWAA 3W2OA 4CLIA 4D9TA 4F0IA 5JH6A 1Q4LA 5M53A 4I1ZA 2E9OA 3SRVB 2YIQA 3PA5A 5AFVA 1H1QA 4F9AA 4XNEA 2HZ0A 4JR3A 2ITXA 2NRYA 4UWBA 5AUYA 5J9ZA 4FT7A 4FKQA 3CPBA 4O0VA 2WQEA 4IADA 4GFOA 4QT1A 3UIXA 4FSNA 3EL7A 4PDYA 5HO8A 4BTMA 1UKHA 4DCAA 5I9UA 3GU8A 3NUYA 3FLWA 3I6WA 3VIDA 4CQEA 4IM3A 5JQ8A 1DM2A 3E87A 3SHEA 3P7AA 1O6KA 1JSVA 1MP8A 2ONLA 5M06A 5ANEA 5CEKA 2GS2A 1REKA 2ITNA 4QP7A 1H24A 4FIEA 4IM2A 4OGRA 2QHMA 2VWUA 4YJRA 2R3NA 4R1VA 3ORIA 1RDQE 3ZU7A 5CX9A 4ZSAA 3F82A 2BDWA 4WIHA 5HBHA 4CMUA 5CSPA 2YITA 3I6UA 5E8WA 4C35A 3BKBA 3GBZA 4BCNA 3HRBA 4F99A 2E9UA 4ERKA 2WNTA 2YHVA 3LM0A 5F1ZA 4GU6A 4LUEA 1H25A 3IG7A 5A3XA 4YJQA 4EHVA 4BCOA 3S0OA 3UVQA 3GC7A 2PU8A 2PUNA 2QO7A 3BU3A 3GI3A 4YNOA 4CFMA 2VWWA 2J0LA 4O91A 5LMKA 1QCFA 1WVWA 3C5UA 4IAFA 4OTFA 1NY3A 4E73A 4N0SA 2FH9A 3OF0A 4HZSA 3TZ7A 4U42A 2WMTA 2Z7LA 2V62A 4OT6A 3S2PA 4F7NA 2B7AA 2ZAZA 3NUUA 2W99B 4PTCA 2IO6A 5C8NA 2F2CB 2Y6MA 3QRJA 4FYNA 2OZOA 3NYNA 5EYDA 5HVJA 5CI7A 2XM9A 3BI6A 2OIBA 3CTQA 5M09A 2EUFB 4XOYA 2W1CA 5ANKA 4HPTE 3BWFA 1M14A 3HA6A 4O0RA 4HGTA 4DEGA 4CFNA 3R9HA 4ANMA 4YGAA 5IISA 3VBWA 5GIOE 1J1BA 1FMKA 2GNIA 4JIAA 2NP8A 3F2NA 4HNIA 3FC1X 3EQRA 4XLIA 4ASEA 3H30A 3QCXA 4EWHA 5AP6A 2CN8A 4ZZOA 1JQHA 3E64A 2PZYA 2WFYA 3MPAA 3ZRKA 4BDBA 4FYOA 5L2QA 5CZHA 3QTZA 2CN5A 5ANDA 4QRCA 2ERKA 3Q2MA 5EHYA 1OL1A 3VS5A 5IA4A 1YXVA 2JDVA 2ZV9A 3TKUA 2VWZA 3GFWA 4FT3A 5T68A 5EHLA 2WKMA 3L9NA 4CG8A 4EOMA 3NX8A 4I6BA 4QP3A 4WG4A 5CSXA 3E8NA 3E62A 4QMSA 4IB0A 5GJGA 5M4UA 3DTWA 3K5VA 5IUGA 2W7XA 4DH7A 2O65A 4IX6A 5AR8A 1W7HA 3MW1A 4FEVA 3MB7A 1PYXA 1M2PA 3HGKA 3RP9A 4L8MA 2YIWA 5KMMA 3HVCA 3DJ6A 1NVQA 4HVSA 3R01A 4F70A 3BU5A 3I5ZA 3MBLA 3R1SA 3WZJA 1ZOHA 2R2PA 4IACA 2X7OA 2CGXA 3P78A 5H3QA 5FUTA 2FB8A 4O1OA 4J8MA 2YIYA 3WF9A 5TE0A 5AV2A 5AIKA 3ULZA 3NW6A 5DH3A 4EKKA 5FTQA 4K1BA 1MQBA 4U5JA 4BTKA 3OY3A 2IWIA 3ZHPC 4F6UA 3ACKA 4QPAA 2VO3A 3GC8A 3GU5A 2BRMA 2A19B 2H96A 4FR4A 5FGKA 2H8HA 4J53A 4R3RA 1EH4A 4XG9A 2IVUA 3MA3A 4XMOA 3B8RA 4FTUA 3NR9A 3DZQA 5FP6A 3VBVA 5AV4A 1ZY4A 2VGPA 3QQGA 3PG3A 5CY3A 5ETAA 4NU1A 3C4CA 3HUCA 3QTQA 4FE2A 2XNNA 4HCVA 2OW3A 5EYMA 2PL0A 3CQEA 4FTAA 5IQHA 2HWOA 2XIYA 5I9YA 2VRXA 3F5UA 1H1PA 2YISA 3ZO2A 4MXAA 3KXXA 3C0IA 4BR3A 3HDNA 5DR6A 4UMUA 2GQSA 3AMBA 4G9CA 5E91A 5EYKA 1BI7A 3H9RA 4O0TA 4E20A 4JDKA 5JRQA 2C5VA 2G9XA 2GMXA 4XS2A 4KWPA 3I60A 4MHAA 3RVGA 1UNHA 2BDJA 4OTIA 5J87A 2VNYA 4OTHA 2JIIA 2BRHA 1YWVA 2J5EA 2ZB0A 2WQBA 1YI6A 4K11A 4Q5HA 3WARA 4E26A 2VTRA 5IUIA 5BYYA 3BEGA 4RVLA 3F66A 4EBWA 4TYEA 3IECA 4E6QA 4L3JA 3U4WA 1GZKA 1JSUA 3LCSA 1YHSA 3VVHA 1PRYA 4O83A 1OPKA 2PVMA 1A06A 3OUKA 4MH7A 4FTKA 2QOQA 5JSMA 1TQMA 3QXOA 1FVRA 4AX8A 4C02A 2OXXA 2CDZA 2EWAA 3OT8A 4ITHA 3GP0A 4TN6A 3DFCB 3UOLA 5L6PA 1IG1A 1GNGA 4C4FA 5IQAA 2GTNA 3SG8A 3UNKA 3WF8A 3NNVA 2WOUA 4OAVB 4FT0A 2QOIA 3OEFX 4G5PA 2J0KA 3RCJA 2RFSA 1GJOA 2Y0AA 2F57A 4TNBA 3U55A 1A9UA 3AMAA 4CMOA 3COIA 2OG8A 3REPA 1URCA 4EH8A 4ORKA 3R73A 3FI2A 5I9XA 3CJGA 2JDRA 3L8PA 4HYSA 3EQDA 4OUCA 4FKVA 2FYSA 1RW8A 4BTFA 3CC6A 3SAYA 1G8SA 4FV9A 4C37A 1Z5MA 3LFNA 3ZM4A 3FXWA 2Z8CA 4GK3A 5IU2A 4G17A 2E2BA 4F65A 4MTAA 5H8BA 3KULB 3ID6C 2XIZA 1SNXA 3ODYX 4AG8A 3OCSA 1FPUA 2SRCA 4GFMA 4L67A 5KX8A 2ETRA 4AGCA 4UYNA 3QRTA 2YCQA 5DLSA 5CF4A 4MXOA 2VN9A 4YLKA 1XO2B 3DK3A 4I6QA 4IVCA 5DFPA 2Z2WA 2YABA 3DNEA 3O17A 1M52A 1KE9A 1P4OA 3AD4A 3MSSA 4RWKA 4WUNA 5EI8A 4EQUA 2VTTA 3MS9A 4BF2A 4WSQA 4G1WA 3ORXA 4DT8A 2IJMA 3C4FA 5HD7A 4CFVA 3FXXA 4YHFA 1PXLA 2J90A 2CKOA 4ERWA 1A48A 3OP5A 4M12A 4FKWA 1R39A 4BKZA 2WU6A 5B2KA 4IWOA 1M17A 2WGJA 5B7VA 4RIOA 4M68A 3RAWA 3QQKA 3SXSA 3DPKA 4O2ZA 3OZ6A 5EKNA 3KF7A 4WD5A 4QMOA 4I0TA 4MXCA 5FM3A 5HIBA 1O9UA 3TJDA 2OZAB 4MQ2A 4NW5A 3SVVA 4C4HA 3EZRA 3AD6A 2OF2A 3GENA 2ZV2A 4IHPA 2YCRA 5M57A 4E3CA 4JG7A 3FYKX 4TT7A 3KREA 1Q62A 3EFWA 2HW6A 4MYGA 2AUHA 4IZYA 4M14A 5L8LA 4DAWA 4RJ4A 3MV5A 3N51A 3FQEA 4P5ZA 1KOBA 4H3BA 4ZZMA 4RBLA 4RIXB 2J0IA 4FUXA 1PXIA 2BDFA 3O96A 5DNRA 2UZLA 4BCMA 2ACXA 3E5AA 4EC8A 5LXMA 5HX8A 3ALNA 4FEWA 4DTAA 3KMMA 3ZFMA 3CBLA 3KULA 3HV4A 4FEQA 3I7CA 3ODZX 3QQUA 2BKZA 3A4PA 3Q3BA 4TWOA 5ETCA 2R3KA 1Q8ZA 2B1PA 2IZTA 3E3PA 4FKSA 2UZDA 4AP7A 4B4LA 3Q9WA 4MF0A 3GXLA 4D1SA 4NYEA 3FMJA 2OU7A 4HOKA 4EOPA 5DWRA 4OTRA 5CEIA 3NPCA 3PFQA 3P5KA 4GUEA 5E8SA 1X8BA 4D5KA 4PQNA 4GJ2A 4S31A 3UOKA 1YOLA 2W1GA 1PHKA 5EW3A 3VQHA 2A4LA 2GFSA 4FC0A 1QMZA 1O6LA 4LRKA 3EZVA 1Q99A 2Y7JA 2WELA 4X3FC 4EOOA 4CLJA 4QMLA 2W1ZA 3FSKA 2Y8OA 3WF6A 4X3FB 3P0MA 3LFFA 3RK9A 1KUTA 3V5LA 4ZY6A 4FKRA 4XBRA 1BMKA 4RX9A 2HAKA 2JFMA 2OZAA 3GCSA 4FL2A 4X2FA 5HG7A 4IEBA 4MBLA 4YC3A 4DH3A 4E4LA 3WZDA 5E8YA 2JGZA 3TNPC 5DRBA 1U5RA 2WTJA 2ITZA 4RWIA 5L8KA 2OICA 3MJ2A 4XG2A 3VUGA 2ZDTA 5J95A 3A7IA 2OJ9A 4QP1A 1YRPA 2C3KA 3FDNA 1M7QA 1OKVA 3U87A 4USDA 4CEGA 3P23A 3P79A 3WZUA 4S30A 3AC4A 2PE1A 4IAYA 4OLIA 3O50A 2YAAA 4OTGA 3H3CA 3QTWA 3QZFA 4TRLA 1SMHA 4U97A 1MUOA 4DFUA 2RG5A 5D1JA 2ITUA 1H26A 2XNEA 3FPMA 4MX9A 4J1RA 4LQMA 4IDVA 2YLEA 1PKDA 2F9GA 4D1XA 3AGMA 3NW7A 4YZDA 4YZMA 5J9YA 3DXQA 1JOWB 1RJBA 5KKRC 3PXKA 4XUFA 2X6EA 3PY3A 4TW9A 4BIDA 5KKRB 4AOJA 5T6KA 2ERZE 3PTGA 2BZIB 3PXYA 4IBMA 4EJ7A 5IMEA 2R3RA 4UBAA 4YO4A 4DH5A 2JIUA 2QO2A 3PWDA 3F6XA 2GS6A 3VUMA 5DBXA 1PMUA 3DXNA 3U6HA 4X3FA 2HYYA 2P55A 3GNIB 2YACA 1Q61A 4F9BA 4MD7E 5FDPA 3DBDA 3I0OA 3EFJA 4QTBA 4JR7A 1KE8A 3H10A 2UW7A 2UW4A 3DU8A 3FAAA 5HG5A 2OKRA 4F0FA 4LOQA 1OECA 2XA4A 4E5WA 5FXSA 2GNFA 2QODA 1Q24A 3BBWA 4AXAA 4DEBA 3KRRA 3U8WA 1ZARA 4FG8A 5L8JA 4DGNA 5IKWA 3FLYA 3F2RA 3DT1A 5F94A 2PZIA 4DH8A 4ZAUA 3I4BA 4DTKA 3JYAA 3HNGA 4FKPA 4U45A 1NVRA 3F9NA 5BYLA 3QFVA 5G1XA 3KN6A 3ULIA 4Z3VA 3OS3A 4X2JA 2IW6A 4H1JA 4X3JA 3FQSA 1WFCA 4RIYB 2ESMA 5TT7A 1ERKA 2BAQA 3PPKA 4TKSA 4ZLZA 5HLWA 3QYWA 2C6KA 2W4JA 2WXVA 5IA1A 2XIXA 5AR2A 4DHFA 1OGUA 2GS7A 2PPQA 4L43A 5EW8A 4ZSGA 3A99A 5I3OA 3LJ1A 2GHMA 2PMNX 2YIXA 3DLZA 5AUWA 3G0FA 3IW4A 3KRXA 1K2PA 3MY1A 1PMEA 4JBQA 1J7UA 3LLAA 2BILB 2PZPA 2YLFA 4MK0A 4E4XA 3TUBA 4JL9A 2WB8A 4D2TA 2ITPA 3NNXA 4X2GA 4MKCA 4F7LA 1OMWA 2Z7RA 4O7ZA 2O64A 2PTKA 3BGZA 3FC2A 4UEUA 4J95A 5C03A 4C2WA 5DEWA 2G15A 3C51A 3EB0A 4IB5A 3O2MA 4L44A 4AZVA 5L4QA 5CT0A 4O84A 2W4OA 4KSPA 2PVFA 1H07A 3KXHA 4PPBA 5AWMA 4KKEA 3ZRMA 1QPCA 2EVAA 4FTMA 5ACKA 3ERKA 5JK3A 4U81A 2JKOA 1OIRA 1PXKA 2QVSE 4WHZA 2HZ4A 3OBJA 2QOOA 3QQLA 3TEIA 5DYJA 4APCA 4ZTSA 4ASDA 4P4CA 3BHTA 4FEUA 3LCDA 3T8OA 2JC6A 2CPKE 2QOFA 1BUHA 2O5KA 5FEDA 3F3ZA 3LXKA 2VTMA 3TZ9A 3QKKA 4D4VA 3NYOA 3QLFA 1REJA 4OBQA 3GQLA 3M1SA 4N6YA 1QPDA 2OO8X 3LQ8A 5EQPA 4ONAA 3NVKI 2VX0A 3PUPA 4KRDA 4MF1A 4Y5QA 4PTGA 5BMMA 4ZLOA 2CCIA 1ZYLA 4NK9A 2BRBA 5IA3A 1M7NA 3GOPA 3AG9A 2XK8A 5A9UA 2YM3A 5B0XA 4YZNA 2WTIA 5C27A 2YDIA 1H0WA 2WD1A 3SQQA 3DLSA 4YBKA 5GZ9A 2YM7A 3HA8A 4KIQA 5BPYA 4IXPA 5HCYA 5IEYA 2RGPA 3PLAE 4NUSA 3D9VA 3LFAA 5CSVA 3OWPA 4HGSA 4CT1A 2PY3A 1ZOEA 3KB7A 3R7VA 2X7GA 4MNEA 5I9VA 4UMPA 4IZAA 4RC2A 2W5AA 4EEVA 2R3HA 4KIPA 4NM3A 3HRCA 4IW0A 4FG9A 4FUYA 3TG1A 2RFEA 5E1EA 3LHJA 3PXZA 4U44A 4NFNA 1JNKA 5C01A 4GFGA 3V01A 3ZLSA 5E92A 4CQGA 3UBDA 3KGAA 3PA4A 2C5NA 4TTHB 3KRLA 3A7FA 1NT2A 3U51A 4YJNA 3MFRA 5CVGA 4AT3A 1LR4A 5JGAA 2RFNA 5H8GA 4JIKA 3UYSA 2W1IA 4J98A 4U80A 5KCVA 2BTSA 5I5ZA 4DF3A 3F2AA 1PY5A 5CLPA 5HU3A 5KMJA 4CMTA 1XWSA 5L2SA 4EBVA 4C34A 1GZNA 3EN6A 4R3CA 1KSWA 5E8VA 4AFJA 2XYNA 1UV5A 1ZYDA 3OXTA 4UYAA 3VUIA 4CTCA 3LMIA 4DTBA 4APPA 4BDCA 5IQEA 3JPVA 4L3LA 5J79A 2C3JA 3D2KA 3PP0A 4LM5A 4BIEA 3DB8A 4M15A 5CU3A 5DHJA 4YTIA 2XKEA 3QC4A 3UO4A 5HIDA 3MTFA 3MA6A 2VWVA 5HO7A 1T45A 3OW3A 3EL8A 2LAVA 4CCBA 4GT5A 3RGFA 3BX5A 2QC6A 3EQGA 4F7SA 4ANSA 5A6OA 2YCFA 2QI8A 3PJ8A 4AA4A 3V8TA 4NCTC 4B0GA 2W5BA 2HWPA 4C2VA 3PRIA 4QTDA 4D5HA 4JBOA 5BVFA 4RG0A 1WAKA 3ZO4A 2QCSA 4HYUA 2YM6A 4FNWA 1ZRZA 3QKLA 3AOXA 3R21A 5DGZA 4AU8A 4FG7A 4CG9A 5LVMA 3IONA 1I09A 1Q97A 3KXNA 3QALE 4UXLA 1OZ1A 5CXHA 4BI2A 2ITWA 2R3PA 3FUPA 2Z02A 3FE3A 3L8SA 4BCIA 4RLKA 1XH5A 4XX9A 4QMYA 4E4MA 3FMMA 3VHEA 5CXZA 2ZOQA 2RL5A 3D94A 2QG5A 4EYMA 1Y57A 3DQXA 4F1TA 3MVMA 4UMTA 2UW3A 4XJ0A 3R28A 4ZP5A 4BCKA 3FKLA 2J2IB 3QQJA 3TUCA 3LMHA 5CENA 2PZ5A 4DG3E 3FMKA 3HV3A 2HOGA 3QHWA 2C1AA 5HLPA 4PUZA 3V6RA 3U9NA 4O22A 4G3CA 2VWBA 3OHTA 4FK6A 3R8MA 5LMBA 3MI9A 3UIBA 4F6WA 2OH0E 3A8XA 3PP1A 3PXQA 2V0DA 2UZWE 4ASXA 3NWWA 4BDAA 4MXZA 2OXDA 4FOBA 3HMNA 3VULA 2B9JA 4A4XA 5AJQA 3VF8A 4X2KA 3ZH8A 2RG6A 3Q60A 3VS7A 4DINA 2UZEA 4ACGA 3OMVA 4TYIA 5FBNC 2KTYA 1WBVA 5AR5A 3GGFA 3RM6A 3BELA 3VBXA 3VBYA 4ZJVA 5KHWA 2UVZA 1YWRA 4FKUA 4NCTA 5AP0A 5K9IA 1WVXA 4L45A 5HVYA 5LARA 1E9HA 3HECA 3O71A 3D5XA 2WMSA 5EH0A 4QMXA 4B8MA 4KUJA 3NCZA 3VW8A 4HJOA 4BDJA 3BHYA 3CIKA 4QMVA 3RBWA 5HCXA 3NIEA 3OFMA 2KULA 2PE0A 4FEXA 4FIGA 3UC4A 1URWA 5JFXA 2GPHA 2X2KA 1NW1A 4FSMA 4FV5A 4YUQA 4G16A 4I0RA 3PE2A 1W0XC 2BRNA 3KVWA 2C68A 5HEZA 2C47A 2DWBA 2J51A 3BLHA 4LI5A 2CNVA 1T46A 4QMNA 3R0TA 5CU2A 1FGIA 5FQDC 5TO8A 3KVXA 3S3IA 4ID7A 4IFGA 3ZUUA 4BN1A 4RC4A 4TWPA 2I0EA 5AA9A 2ZYBA 2QLQA 4YJTA 5AAFA 4F9WA 3TN8A 4TYJA 1PXOA 4FVQA 1MRVA 4NKAA 2GFCA 3D5WA 3RHXA 4CSVA 1OL5A 4DG2E 1XH4A 4FTLA 2R3MA 3VRYA 4PMSA 1ZZLA 2RSVA 3LE6A 2C3IB 4BDDA 4PTEA 1KWPA 2G2FA 4BIBA 5GZ8A 2ZM4A 5BX0A 3QXPA 4FIHA 4ASZA 4G3FA 3SOCA 1ATPE 2WTKC 5A6NA 3CP9A 3TKHA 3U4UA 3FEGA 3VO3A 2OGVA 2WTKB 3WZKA 4JAIA 5J7HA 2REIA 1FOTA 2XBAA 3PVWA 5CS6A 3VS4A 4IZ5A 4WUAA 1R3CA 4AGUA 4DLIA 2VO0A 4ZY4A 2W1FA 2PE2A 3MY0A 3NIZA 1MRUA 2UW5A 3R71A 5LVLA 5DVRA 4M67A 4EJNA 3QU0A 5EQYA 3E92A 3ZONA 4ARKA 2OH4A 2VV9A 3G6GA 2IVTA 4ZOGA 3ZRLA 2J50A 3ZZWA 3RZBA 4QTCA 3TNWA 4AGWA 4Q9SA 3HKOA 2NPQA 4JX7A 4Z55A 2DYLA 3FJQE 4CNHA 3WYYA 5JZJA 4QP9A 5EDRA 2PVYA 3R04A 4PF4A 4F4PA 3UG2A 1GY3A 3MVJA 1BI8A 3DY7A 4LGHA 4X6RA 3IGGA 5AX9A 3L8XA 4I24A 5D7VA 3MWUA 3SRVA 1W82A 1APME 1IASA 3KL8A 3IKAA 1SVHA 1HCKA 1YI4A 1ZAOA 2XIKA 1R0PA 5E4HA 5KO1A 3QRKA 3R2YA 4FV8A 4AZFA 4C59A 1RE8A 1UU9A 1F0QA 3IDBA 2P4IA 3ROYA 5K4IA 4MBJA 4N6ZA 3QAME 4E5AX 4U9AA 3G5DA 2IVVA 5JFVA 4OBOA 4B6LA 4PNKA 4KS8A 3PLSA 3Q52A 3QD0A 2I0VA 1PF8A 3CKWA 4D9UA 3UO5A 2IVSA 3KN5A 1GIJA 3TT0A 3VS2A 1ZMVA 2B52A 2HXQA 5CVHA 3VUTA 2OK1A 4AZTA 5BVNA 3OXZA 4GG7A 4BDGA 3G2FA 4JBPA 4BHZA 4H39A 3IW6A 2DS1A 4AN9A 3E8DA 4ZXTA 2X9FA 2UW9A 3ZFYA 1Q5KA 2W4KA 4EH4A 2QR8A 3OCGA 4XV2A 3BLQA 2G1TA 2IZRA 4NWMA 5IDNA 2LGCA 3V5JA 4F63A 3G9NA 2V5QA 5HE1A 3A62A 5BQ0A 4EKLA 4WG5A 1S9IA 3A7HA 5CT7A 5BMSA 4QYEA 4O7VA 2C6DA 4ZTRA 3ZLXA 4CKIA 4XLVA 1FVTA 5FEEA 5HE2A 5C4KA 2X8DA 4BCHA 2W17A 4JS8A 4WSYA 2C6OA 4IAZA 4IIRA 4M66A 4E4NA 3SD0A 3BIZA 4TL0A 1LPUA 4GCJA 4FTOA 2OIDA 4NW6A 4QMQA 3OWJA 2JDTA 5FTGA 3NUSA 1PXNA 3ORNA 5TOZA 2NO3A 2WMWA 3A8WA 4I6FA 4IC8A 3TNQB 3SGCA 2J9MA 4YHJA 4BFMA 3M2WA 3A60A 1OM1A 1JLUE 5A4QA 4O6LA 2XCKA 1STCE 4Y95A 1U46A 4GT4A 4F64A 3ETAA 3ORZA 2RIOA 3EOCA 4RFMA 3EN4A 3JVSA 5M4CA 3NUAA 2JIVA 2VAGA 5J1WA 5AM6A 5FBOA 3G33A 1XBBA 2E9VA 3NUPA
chains in the Genus database with same CATH superfamily
3UP7A 5HLNA 5LWMA 3R83A 3CSVA 2NRUA 2P0CA 4XG4A 4LRMA 4CRLA 5A4LA 5EQEA 4GEOA 3LOKA 3NGAA 3T3UA 3ZO1A 2BZKB 1IA8A 2QKWB 3O5AA 1TQPA 3QC9A 4BTJA 4EH6A 3AKLA 3CTJA 4G3GA 5J8IA 4C3RA 2WOTA 4W8DA 1YW2A 4BDIA 5AR4A 4I5PA 2OBJA 4RVTA 3FV8A 3P1AA 2VTLA 3PSBA 3WF7A 4BBEA 2UW0A 2W1HA 3F3VA 2RKUA 3F7ZA 5ANIA 3EN9A 4MD8E 1JSTA 3K2LA 1IA9A 1OITA 2XKFA 4L42A 3T9IA 2ZMCA 1Y91A 2OSCA 2QQ7A 2V7AA 4WNMA 3FLNC 3UE4A 2CJMA 5AP5A 2XK7A 4CTBA 4ZTQA 3W8LA 4C61A 2WIHA 3MGYA 1Z57A 2BTRA 4XG3A 4HNFA 2X2MA 3W1FA 5IQGA 2JBOA 3PDTA 1UVRA 5I3RA 4J71A 1H8FA 1CM8A 3GU7A 1VEBA 4EZ5A 4RVKA 3QZHA 3KRWA 4EOIA 2UW6A 3PIXA 4KSQA 4O86A 2C6MA 3PZEA 4LMNA 3GCPA 3QTIA 1PMNA 3PVUA 3PXFA 5EDQA 3CPCA 2XEYA 4IWQA 2C0OA 4Y85A 3LCKA 2ZDUA 2J0MB 4F0GA 2FGIA 3FSFA 3HX4A 1IR3A 4JDHA 3NVMB 2WHBA 4DFBA 3LXLA 4BHNA 3KCFA 4J7BA 4LOPA 5IH5A 3GCVA 4FKJA 3FZ1A 1OB3A 3UODA 3ZZEA 3MY5A 1Q8TA 2WMQA 4CFUA 4P2KA 4QNYA 5AUTA 2OFUA 2VTSA 2C1BA 3OBGA 2C3LA 5HGIA 4KKHA 4O4DA 4XHKB 3ORLA 4XRLA 4IAAA 3W0MA 4D0WA 2EB2A 5HNGA 3FI3A 4RA5A 2C0TA 3RPVA 3AGLA 5IG1A 3LVPA 5E8UA 2UZTA 3UC3A 3TV6A 5H8EA 3QUPA 2ZMDA 5I9ZA 1PYEA 4RJ7A 3FPQA 2W96B 4RX5A 3C4XA 1YHWA 4DT9A 5LQFA 3E8CA 4ZMEA 3GEQA 4EWQA 4FJVA 3AMYA 4AZEA 2JKQA 1NA7A 5BUEA 3SXFA 3W2QA 4RPVA 2CHLA 2JEDA 3LLTA 1KE5A 3PVBA 4FKTA 1BKXA 3Q4ZA 2XNPA 4O7RA 1R0EA 4PL3A 4O38A 3DBQA 4GK4A 2UVYA 4PY1A 4QNAA 4MVFA 5EHOA 1Y8GA 2VUWA 4FTNA 4XV1A 2IW9A 2H6DA 4E6AA 2PHKA 4IE9A 5IEXA 1DI8A 3VUHA 3KEXA 1OBGA 2XNBA 3PJ1A 4IX4A 1P4FA 2R5TA 4Q5EA 2C6TA 1OL7A 5C4LA 1Q8YA 3O8PA 2V55A 2XNMA 3OWKA 3GT8A 3HV7A 3UIMA 3QCQA 3E7VA 4QEBA 3QX4A 4ACDA 3R9RA 2A0CX 5F95A 4RT7A 2IZUA 3TTJA 3P9JA 2F2UA 3PRFA 3ZDUA 5FD2A 3RK5A 1LP4A 4BWKA 2C6EA 4RZVA 2QG7A 4K9YA 4CYJA 1OIYA 2R3IA 1VR2A 4M69B 4BBFA 4ZEGA 3ATSA 3BU6A 2B54A 4ENXA 2AEGA 4QO9A 4DA5A 3HEGA 3WE4A 2BHEA 4EHEA 1JBPE 4YPSA 5EYCA 5CF8A 3S4QA 2R3QA 5KBQA 3JXWA 4AQCA 3V5PA 2X4FA 4DGOA 3WILA 2XRWA 3FZTA 4UN0C 4CYIA 3QD3A 1GIIA 1G5SA 4GRBA 3FMHA 5CF6A 2BFYA 4RIWB 2PUUA 1OI9A 2OJFE 3PSDA 5AUVA 4AOIA 3BHVA 4JI9A 4MAOA 1YXTA 4WBBB 5CZIA 5J5SA 1ZMUA 4HYHA 4MQ1A 4PPAA 5FLFA 2UZOA 5M44A 4ALWA 1AD5A 4HCUA 3HP5A 4FKGA 3LZBA 3D7TB 4IJ9A 4JBVA 4X2NA 4FSWA 4NIFB 2RF9A 4HGLA 4Y72A 3ML1A 4TYGA 2F7EE 3AXWA 4XG7A 3RAHA 4Z16A 4C7TA 1UU7A 5DG5A 3TI1A 4NTTA 3Q6UA 1L3RE 5AAGA 3EHAA 3I5NA 4CZUA 5EDPA 3C5IA 5HNBA 5AV1A 4F9CA 4QP6A 5E9EA 5C8KA 3UZTA 4YJSA 3D5VA 3TACA 3D83A 3DFAA 4RIXA 4WT6A 2I0YA 3E8EA 3BWJA 3MPMA 4FV6A 1IEPA 4GK2A 4FX3A 4M69A 4U40A 5FRIA 4D1ZA 4LG4A 1SVGA 5DEYA 3V5QA 5BVOA 4FKIA 5L3AA 5TKDA 3MYGA 4CFWA 4YTFA 3SDJA 2P3GX 3THBA 2R3LA 4ZSLA 2BPMA 4BZDA 1JKKA 4R5YA 3DAEA 1YOMA 2R3GA 2I0HA 1G8JA 2PYWA 2JD5A 3WBLA 5EK7A 4DN5A 2BUJA 5L2TA 4R78A 4AA5A 3MESA 3H9FA 2JFLA 4DLJA 5L6OA 5HD4A 4RX8A 4DDIA 4EK4A 1H1RA 4RIWA 4D2VA 4OTPA 3G51A 3NLBA 4O7WA 4U43A 4RLLA 5EFQA 2F7XE 3A61A 3VN9A 4HYIA 4FV3A 4G6LA 2VO7A 4I41A 5EM8A 3VUKA 4D0XA 4DFNA 2WMUA 2EU9A 2PK9A 3BQRA 3D7TA 3HRFA 1B6CB 4LV5A 3QZIA 2GHGA 3UVRA 3UVPA 3VJNA 5IA0A 2J5FA 5IQDA 4GG5A 4NIFA 3OW4A 3IW8A 4FTCA 4BCPA 2IPXA 4I22A 4RJ6A 3ORKA 4RZWA 4F08A 3O23A 5A14A 3JY9A 4P5QA 3A7GA 3QWJA 5FXRA 4AWIA 4XP3A 3ALOA 3ENHA 3FKNA 4RJ5A 2GNHA 3M11A 4KAOA 3E93A 3BYVA 1UNGA 1OL2A 2QU5A 2XYUA 4GYIA 4AGDA 3OT3A 4CD0A 5M4IA 3RNYA 5G6VA 2XUUA 1CTPE 4IWDA 3W0RA 4M13A 3PE1A 1JKTA 2CGWA 4EOLA 4ZMFA 5CAVA 1XH6A 2XANA 3L1SA 1DI9A 3R9NA 3EFLA 3VF9A 4F09A 1OUKA 2P33A 5CQUA 4CRSA 4R6VA 1WMKA 3O0GA 3IOPA 5KBRA 5CNOA 2W1DA 4IX3A 3W2PA 2XVDA 2PVJA 1XJDA 3V3VA 3WIKA 4AT4A 1ZLTA 1TQIA 3BV3A 4Z9LA 2W0JA 3ORMA 4E8AA 3BLAA 2PMLX 4ZTMA 2E9NA 1U4DA 1ZYSA 4C0TA 2QLUA 3G9LX 1GOLA 4AZSA 1CDKA 5A46A 3LCOA 3OCBA 3KY2A 4NSTA 3NZ0A 5BVEA 4PDSA 4RSSA 2QOLA 3UP2A 3UNZA 1ND4A 4IVBA 4R77A 3DCVA 3GOKA 4G5JA 5HQ0A 2QR7A 3WZEA 2GQRA 3TYKA 3HLLA 2VWYA 4H36A 3U9CA 3G90X 3TTIA 3MVHA 1PKGA 3R30A 4CFFA 2W05A 4FSTA 4O0SA 5J5TA 4AXFA 3QZGA 3UTOA 3DGKA 1P5EA 3DKCA 4NFMA 3KFAA 4QMTA 4MBIA 4ZTHA 3RPRA 4AOTA 4AW0A 1YHVA 5IZFA 3QD4A 4WO5A 3JY0A 1S9JA 2XP2A 2X6DA 3ZXTA 4DBXA 4DE4A 3HMIA 4ZS0A 4QP4A 2PMIA 4W8EA 1OPLA 3AD5A 3R7GA 4B9DA 3AC8A 1BL6A 4YJPA 1YXXA 2YJRA 4ZTLA 3ITZA 5DT0A 2R4BA 4BCFA 4YBJA 4QMZA 4RC3A 1O6YA 3WIGA 4YSJA 3DZOA 4Y46A 4DH1A 2YJSA 3OROA 1DS5A 4KBAA 4FNXA 1ZWSA 2C5OA 3H9OA 4IFCA 5LJJA 2OF4A 4MNFA 4RIYA 4C4EA 5CSHA 4CKRA 4PV0A 3DS6A 3OCTA 4QQ5A 5B2MA 2AC5A 3MB6A 4UZDA 1LEZA 4CFXA 3SC1A 3QTSA 1IAJA 4G31A 3KKVA 1QPEA 4HVDA 2W5HA 3Q5IA 4EH3A 4R3PA 3PYYA 4F1MA 4QMUA 4OTQA 3W0OA 4FT5A 2XZSA 3W55A 3AT3A 4JXFA 5ANJA 5AV3A 4YZ9A 4D2SA 5D11A 2FA2A 4FV0A 4O1PA 3NW5A 5CF5A 5KHXA 4JJRA 5HHWA 4O6EA 2CSNA 2PZRA 5D12A 4EH9A 3UJGA 2C5YA 5CTPA 4D2RA 4XP2A 4FSYA 2WTVA 4GW8A 4AN3A 2HZNA 4KBKA 1Y6AA 2VGOA 5KZIA 3QTRA 3F69A 2C30A 4FL1A 3QRUA 3NUXA 1YDTE 5AMNA 5AAEA 4B7TA 2RFDA 4YHTA 2C5XA 4Y83A 3TNHA 1GZ8A 4C3FA 4BYJA 4EK8A 2YWVA 3LFDA 4DEHA 1AQ1A 2X7FA 2ZV8A 3TZMA 1YWNA 1PXPA 5DMZA 4HVGA 3WF5A 5IQIA 4OTDA 4EHZA 5BNJA 4EH7A 4QPSA 2ITVA 2EXEA 4GYGA 4UB7A 4O2PA 5HG8A 2VTIA 3PWYA 1E1VA 3UMXA 3Q9ZA 4YURA 4QYYA 4W4YA 3EQHA 3R02A 3KC3A 3CE3A 2BZHB 5GJDA 1WBOA 3R7EA 4O7NA 3BYSA 4JRVA 2C6LA 3MH1A 3PJ3A 3T3VA 1TVOA 1UWJA 1G8KA 3PA3A 4AW1A 4G2FA 3A7JA 1HCLA 3R8VA 4BWPA 5E8XA 5GNKA 3VRZA 4YPDA 2Z7QA 4LOOA 4WOVA 3ROCA 2YWPA 1WVYA 4FV2A 4V04A 5M08A 3WE8A 4AUAA 3QD2B 3HDMA 3MN3A 4JQ7A 5K4JA 3KCKA 2ZB1A 4JG6A 3ZCLA 2FSTX 1P2AA 2CGUA 4LFIA 4UV0A 5DA3A 3AC2A 3R9DA 4O7TA 5D10A 4L3PA 3DKFA 4WA9A 4YO6A 1H1WA 4K6ZA 1DAYA 5CEQA 3VAPA 4BVUA 5LVPA 4CVAA 4II5A 3R63A 5CU4A 1J91A 3C13A 4GIHA 4XG6A 3ZS5A 3KMUA 3FI8A 2YDKA 3D15A 5AM7A 1XH7A 3NYVA 3BRBA 2GTMA 2X39A 1H08A 3EQPA 4ALUA 2Q83A 2O2UA 3COKA 3LAUA 3Q9YA 4USFA 4XG8A 3NCGA 3ZUVA 3QWKA 5FXQA 5BVWA 3R8LA 2WQMA 4ACMA 3QX2A 4DGMA 3W10A 4FTIA 1W2FA 3QL8A 4FTJA 5FDXA 4ALVA 4DEDA 3R7YA 2Q0BA 3LXPA 4G3DA 2FO0A 4JRNA 4M7IA 4MXYA 2UW8A 3RMFA 4EHGA 1YKRA 3GVUA 3TV4A 4R7IA 2AYPA 5JKGA 5L2WA 5JZNA 5HORA 4DYMA 3Q4CA 2B0QA 4O0YA 3Q6WA 4QP2A 4XH6A 4NL0A 2YN8A 2J7TA 1ZOGA 3H4JA 4FGRA 5KNJA 1QPJA 2X8EA 2VNWA 4S2ZA 5KE0A 3UPXA 2XNOA 1YXSA 3FKOA 4AQKA 1UKIA 3EYHA 3COHA 4RFZA 3C1XA 3RPYA 3KXGA 4AAAA 4GMYA 5LCJA 3UQCA 3Q2JA 5K0KA 4ZK5A 4Q2AA 5A4TA 3MH0A 4XYFA 5TF9A 3BQCA 4H3QA 4PL5A 1WBSA 3V6SA 3UDSA 3RWQA 4ZSJA 1GIHA 4ITJA 4MUQA 4K18A 5H2UA 2F49A 5JRSA 5BVKA 2EXMA 4IANA 4M8TA 2OI4X 4DHZA 4WKQA 5DI1A 4TPTA 3U6JA 4PNIA 3Q32A 4DG0E 2HXLA 2QD9A 2B9HA 3FZSA 5DT3A 3BE9A 4TZRA 2BHHA 5ICPA 5F20A 3DBFA 4GIIA 4YLLA 4HW7A 2XEZA 1BX6A 1V0OA 3QGYA 2GU8A 3PJCA 1ZYJA 2Z7SA 4RRVA 1SZMA 3R2BA 3GCUA 4XCUA 4QQCA 2BMCA 4CXAA 2WTCA 4JVGA 2ETKA 2BIYA 4O0XA 1U59A 3COMA 2HCKA 4JQEA 4BL1A 4EC9A 5D9HA 4O4CA 4YZCA 5DN3A 1XR1A 2VWXA 4CGAA 4X7QA 5K0XA 5E90A 5C9CA 4USEA 4IAKA 4FL3A 4M3QA 4N57A 1J1CA 5JQ5A 5LMKC 2GHLA 3BYOA 3C4EA 2P2IA 3FMLA 2CGVA 1OPJA 1W8CA 3KXMA 4R5SA 2UZUE 4KIOA 4M84A 3RPOA 3UPZA 2I1MA 2GQGA 2CKQA 2I6LA 2R7BA 4ANOA 2O63A 2QOBA 2FSMX 4N4SA 5AP4A 3OWLA 3GC0A 4ANNA 4E93A 3FL4A 4KB8A 3QRIA 4BDHA 2OXYA 4C4IA 2HENA 4EZ3A 3K5UA 3CKXA 4FSUA 2X0PA 3EN7A 4JDJA 4C4GA 4EK3A 2IG7A 3MVLA 4NH1A 1JVPP 4D4SA 4NM7A 4LV7A 5HI2A 3K3JA 4GVJA 4A9RA 3EN5A 3F3TA 4UMQA 4YNEA 4EYJA 3DBEA 4JOAA 4I6HA 1TZDA 4MWHA 4BKJA 3ZBFA 3UQGA 2O3PA 4NM5A 3KXZA 3IS5A 2Y4IC 4UMRA 4O7LA 4L7SA 2Y4IB 3HAVA 1Y6BA 3B2WA 4UALA 5CI6A 1JWHA 2YAKA 4RQKA 4M97A 3TCPA 3VS0A 4KABA 3D14A 4O81A 4JG8A 3BPRA 4WNPA 4AFEA 2VTNA 3FLQA 3LIJA 5IQFA 3NRMA 4C33A 2YM5A 3CGFA 4TWNA 3PXRA 2BVAA 3LFBA 2VU3A 3LPBA 3MDYA 4RWJA 3VUDA 1YI3A 4YJUA 3SG9A 1H0VA 3GC9A 4IB3A 4ZJJA 4BY9E 1XKKA 3OXIA 4E6CA 3BE2A 2PVRA 3GCQA 3L9LA 4LYNA 1TKIA 4PDPA 2QHNA 2XJ0A 4FK3A 4I20A 4KRCA 3UDZA 5AUZA 2R3OA 4O21A 5CEOA 2Z60A 3IDCA 4GVAA 2CNQA 4J8NA 4L7FA 4RVMA 3TDWA 3PPJA 3W2CA 3SW4A 3QCYA 3I7BA 3UDBA 1CKIA 4FNZA 1W83A 5CEPA 3RAKA 5EI6A 2NNWB 4G6OA 4PDOA 3B8QA 2HELA 3FWQA 4GUBA 3W32A 4V05A 2Y4PA 1PMVA 3LKMA 2X0OA 3QKMA 4FZDB 4I4FA 4RJ8A 4ACHA 4PP7A 5EG3A 5ETFA 3V5WA 3BLRA 2YERA 1U5QA 4ZSEA 5ETIA 5LVOA 1BLXA 2QKRA 4FVPA 5EOLA 5I9WA 4OT5A 2H34A 2OIQA 3RM7A 4GS6A 3A2CA 4P90A 5BYZA 4BCGA 4RWLA 3DXPA 4U79A 4YC6A 3HMPA 4BDFA 4G9RA 2XAMA 2BAKA 2UVXA 4LRJA 5HESA 3RAIA 1GZOA 4NZWB 3IQ7A 2F4JA 2WMRA 3EIDA 3NEWA 3ATTA 2G2HA 3VHKA 3VQUA 2WU7A 4BYIA 5CVFA 2XF0A 4P7EA 5L2IA 4O4FA 3RWPA 4MEDA 1J7LA 3NNUA 2YIRA 4FTQA 3R1QA 3RI1A 4BWXA 2F7ZE 3IO7A 2ITYA 3KU2A 4OAUC 2V22A 2WMXA 4YR8A 1U54B 3QGWA 5BUIA 2JKKA 4BICA 4R1YA 1OL6A 4ZS4A 3RZFA 4UWCA 2WEVA 3EH9A 2HY0A 4IMYA 3ANRA 4DEIA 2EXCX 2BFXA 4DBNA 4M0YA 4O7YA 4OW8A 4UY9A 1NVSA 3UG1A 1WBWA 3E7OA 1UA2A 2X0GA 4FGBA 3DJ7A 5HNIX 4Y73A 2J0JA 1KE7A 4CZTA 2X8IA 1I44A 1DAWA 2PSQA 4O0WA 4PMMA 5KZ0A 3QLGA 2BAJA 4CZYB 4XOZA 3KMWA 1RQQA 4BGQA 4WNKA 1SVEA 1L8TA 4QTEA 2I7QA 1BL7A 2CLQA 2OWBA 2R3JA 4PRJA 4S33A 2XKDA 4C4JA 3TL8A 4JMQA 4WBOA 2W1EA 4UWYA 2HZIA 3U6IA 3PG1A 4FTRA 1Q3WA 4WRGA 4ZJIA 4F9YA 3MFSA 5AR7A 2GNJA 3EQCA 3ANQA 4GU9A 5C8MA 3O7LB 5BUJA 5CYIA 4UZHA 3VNTA 4CT2A 4FICA 4B8LA 4EOJA 3EQIA 2VTOA 3ORPA 3HV5A 3SLSA 1YDRE 4FT9A 2PWLA 2YCSA 4BGHA 5IDPA 3FZPA 3MH3A 1PW2A 4GT3A 5HG9A 1XH8A 3R9OA 4EK6A 2B9IA 4PL4A 4QYGA 2GDOA 4TYHB 3UZRA 1B39A 3LJ0A 1UWHA 2X2LA 5EM7A 4YTCA 2WQOA 4BKYA 3VBQA 3EQBA 3HMOA 4IVAA 1U54A 5I4NA 4FSZA 2X0QA 5CEMA 4FKLA 1OIQA 3UIUA 3OOMA 4A4OA 4AT5A 3PIYA 1XH9A 2VTAA 2O8YA 3CY3A 4RQVA 5AR3A 3ZSGA 1M2RA 2WAJA 4L00A 2WTWA 1Q8WA 2XKCA 4PPCA 1PXJA 4FKOA 4GKHA 3ENMA 4RA4A 1UU3A 4BDEA 4I23A 1MRYA 1R1WA 4D58A 2BRGA 4BZOA 3W0NA 3F61A 2GNGA 3S1HA 3OY1A 3DB6A 3L9MA 5DR9A 4IH8A 1IRKA 3FMDA 4DFYA 3FI4A 3OTVA 3FBVA 3R8UA 2HW7A 3VS6A 4F78A 5KMLA 4YMJA 2XCHA 4BB4A 3IDPA 2BIKB 2GNLA 3HL7A 4PP9A 1ZMWA 5BV3A 5A4EA 4K33A 2C6IA 4BCJA 3FL5A 3UO6A 3MH2A 4FV4A 2YFXA 2B53A 3QA8A 4EOQA 4C62A 1UU8A 4W4XA 4F1OA 3OOGA 2JAMA 2X9EA 4QQTA 3DOGA 4Z7GA 1OIUA 4QMWA 4RX7A 5E1SA 3L9PA 3QUEA 3C0HA 4BBMA 3CCNA 5KMKA 3BGPA 5AUXA 3G0EA 2UV2A 4TYHA 5EKOA 1G3NA 3FZRA 3OC1A 4WNOA 3I1AA 3POZA 2JKMA 3ZXZA 4ANLA 2R0IA 3ZMMA 3F5XA 3DAKA 3ZLYA 5F9EA 4G6NA 4IAIA 3TKIA 4DHJA 3OUNB 3W18A 3N4VA 5AV0A 4L52A 3PY1A 3DAJA 5ACBC 5IF1A 4JAJA 4XV9A 3R7UA 4RMZA 3DV3A 4MXXA 4U3ZA 4E1ZA 4XV3A 1IAHA 1J3HA 3V8WA 1UNLA 3ZDIA 2QO9A 3DJ5A 2ETMA 3DKOA 4NEUA 4EORA 4GL9A 4S32A 4IB1A 2E9PA 3SXRA 1OGYA 4AS0A 3W0QA 3KK8A 3PIZA 3H0ZA 3NSZA 4MWIA 4U7ZA 2X81A 4CCUA 5KMIA 4KD1A 5HKMA 3HZTA 3VC4A 4EK5A 4BDKA 3LMGA 5DRDA 4O27B 2YZLA 2AC3A 4I0SA 4AACA 2JDOA 5B2LA 4FV7A 2ITQA 2VTJA 4FODA 2YA9A 5HE3A 5HVKA 3I81A 3UOHA 3PVGA 4X6QC 2FSOX 4DEAA 1JPAA 4G34A 4TWCA 4W9XA 2G01A 4I5HA 4Y5HA 3P5JC 3NYXA 3SKCA 3UGCA 5AIRA 5LWNA 3C50A 4BCQA 1JKSA 3U54A 2C69A 3O8UA 4A06A 3W2SA 1HOWA 1FGKA 4AN2A 2XMYA 3W8QA 4FZAB 5IA2A 1ZZ2A 3QA0A 5DIAA 4DITA 5HBJA 2HIWA 5J7BA 4YLJA 1J7IA 4AE9A 3LFCA 5IPJA 2GSFA 5AX3A 5IA5A 4IQ6A 1XBCA 3UMWA 2A1AB 3II5A 4DGGA 3QF9A 2XJ2A 4L9IA 4IM0A 4Y8DA 5GINE 3JUHA 4M0ZA 2PVHA 4J52A 5F4NA 4U41A 3UNJA 5IMXA 2WPAA 5LOHA 5DT4A 3AKJA 5J9LA 4C38A 3HV6A 2FUMA 4OBPA 1CKPA 4FMQA 3TNIA 5HO6A 4A9UA 4HVIA 5HU9A 5HX6A 4L01A 2QNJA 3QCSA 4YSMA 3RINA 3DA6A 3DK6A 3AC5A 4EOKA 4NM0A 4I93A 3TXOA 4LL0A 5JGDA 3LXNA 4HCTA 1OUYA 3O51A 5ANOA 3W33A 3MFUA 5T3QA 4EUTA 3CR0A 3T9TA 2XJ1A 1K3AA 3S00A 3D7ZA 3FHIA 3JVRA 3R22A 1YOJA 4YP8A 3C0GA 1ST4A 5K5NA 3D2IA 4KIKB 4K2RA 4I94A 2OJGA 1H27A 4U0IA 2XS0A 5JMSA 4H3PA 1Y8YA 4D55A 1ZY5A 5DE2A 5J1VA 4JX3A 4ZIMA 2VO6A 3C4ZA 2ZM3A 4JLCA 2QOHA 4F6SA 3BGQA 4I5CA 5HTBA 3EMGA 3IPHA 2C0IA 3CD8A 5CAUA 4QTAA 5JN2A 3AKKA 5CWZA 3KF4A 2ITTA 2JLDA 3DBCA 4L46A 3DDPA 4FF8A 4XP0A 4A9TA 3L8VA 4QDVA 3PZHA 4W4WA 5AADA 1WZYA 5CNNA 3HP2A 2C4GA 2W06A 4ZTNA 3R7IA 4QMMA 5H9BA 4ACCA 1H00A 4FNYA 2BZJA 4IJPA 4XBUA 3F88A 4FSQA 5K3YA 2BKKA 3V8SA 2JDSA 4LGGA 5FEQA 3RK7A 4QOXA 3QBNA 4TNDA 3OG7A 3BYMA 3GU4A 2WTDA 3OEZA 4EOSA 4DDGA 4UX9A 3MIYA 2FSLX 4LGDA 3B2TA 4KA3A 4AF3A 4N70A 2G2IA 3IW5A 2XNGA 5HBEA 3IOKA 3P86A 5I0BA 5M51A 3V51A 3FY0A 2P2HA 1OKWA 4FZFB 3QTUA 2XRUA 5HICA 1CSNA 4GH2A 1PJKA 4NJ3A 3ORTA 4R8QA 2XH5A 4R7HA 1LUFA 3ELJA 4NTSA 3ZFXA 2CNUA 2JBPA 3TM0A 4CV9A 1V0BA 4KIKA 4XEYA 2XB7A 3CEKA 3DK7A 4JDIA 4X0MA 2R7IA 4YJVA 3LM5A 3JS2A 1ZYCA 2YZAA 3DTCA 3POOA 4ENYA 3F5PA 4LMUA 2A2AA 3O8TA 5IH4A 5HZNA 5DPVA 3QTXA 3Q53A 3ZSHA 2QOCA 2BROA 4FI1A 4I21A 1F3MC 3GUBA 4CV8A 4IDTA 2YDJA 2Q0NA 5AP3A 1YXUA 4FZ7A 4G3EA 4NT4A 5CAPA 2H9VA 2WEIA 2XK9A 3KK9A 3E88A 2W9ZB 4FOCA 4NKSA 5AP2A 2WMVA 3LFQA 4FTTA 4V0GB 5IQCA 3BZ3A 2IZSA 2WQNA 4QD6A 3PSCA 4W4VA 1G8AA 3BEAA 2ZM1A 3G15A 2VTPA 5DOSA 4QQJA 3R8PA 4E7WA 2J6MA 4I3ZA 4EH2A 5GJFA 3F7WA 4LL5A 4PMTA 2WO6A 4F7JA 4QYHA 3TZ8A 4RJ3A 2R3FA 4Z7HA 2X1NA 3QHRA 4W9WA 5ANGA 2XK6A 1BYGA 4LUDA 2QONA 3ZBXA 2UZNA 4DEEA 2YM8A 4BI1A 3K54A 5JFSA 2BALA 2IF8A 3BHUA 2V7OA 2XIRA 5JGBA 4O82A 4EQCA 3N4TA 4A07A 1Q3DA 3ACJA 4FIIA 1VJYA 5GZAA 4EH5A 3NNWA 4J99A 3DNDA 3NS9A 1V0PA 4EL9A 4OTWA 1YQJA 3OVVA 3M42A 4QDEA 3LQ3A 1XBAA 4FSRA 3EWHA 1GAGA 2VZ6A 4KKGA 5CU0A 4YC8A 3CQWA 2IN6A 3HUBA 5E7RA 4AE6A 2XBJA 4B99A 3ZOSA 2WMBA 4IZ7A 3KRJA 3JR1A 4GV1A 1YDSE 3KQ7A 4DFZE 4FVRA 3HMMA 4MNEB 5AP1A 2HY81 3ZO3A 4ITIA 1FBNA 5M56A 5M55A 3R1NA 3QUDA 4O7SA 3FY2A 2R9SA 4K77A 5HTIA 3P4KA 3I79A 5KMNA 3GFEA 4MD9E 3P7BA 4E6DA 4K0YA 3PJ2A 4I5MA 4IX5A 3SX9A 4V0GA 2XK4A 2X4ZA 4GSBA 5KUPA 3BV2A 4S34A 4FIJA 3R8ZA 1H4LA 5IEVA 5IQBA 3IK3A 4TY1A 4PX6A 4C3PA 2OJJA 3LJ2A 4PWNA 3RPSA 5FP5A 3Q5ZA 4QPMA 4JQ8A 2VTHA 4OR5A 3LFEA 1KOAA 4JNWA 3F3UA 1OKYA 2JAVA 2VWIA 4ANBA 5LMAA 4EQMA 3FLSA 4CKJA 3WYXA 4FBXA 3TJCA 2ZVAA 3E63A 3UZPA 4R7BA 1SM2A 3FHRA 5HTCA 2ZJWA 5L6WL 2IW8A 3ET7A 1KE6A 4C8BA 4U8ZA 5JEBA 2PVKA 2QU6A 4A7CA 3CQUA 2B55A 3I0QA 3LFSA 3R6XA 5FM2A 3TUDA 4H05A 5EOBA 3ZYAA 2PVLA 2Y6OA 1E1XA 3O7LD 2Y9QA 1OVEA 3RHKA 2XM8A 5AA8A 3R1YA 3FXZA 3WI6A 3PFYA 2XALA 1W98A 3P08A 3IW7A 5TR6A 5AEPA 4EI4A 3NAXA 2BCJA 1W84A 3D0EA 4EZ7A 4A4LA 5ITAA 3UQFA 1XHAA 1VYZA 4DGLC 5HIEA 2R0UA 3CS9A 3NMUF 2VX1A 5CANA