2QOBA

Human epha3 kinase domain, base structure
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
298
structure length
279
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITRPSNLLLDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin receptor
total genus 94
structure length 279
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qobA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qobA01
4ASDA 3RGFA 2VD5A 3NW6A 1QPDA 2OIDA 3R01A 5IKWA 4X3JA 3H9FA 2ZMDA 2V22A 2VTRA 1NT2A 4FI1A 4FUYA 3FXXA 4GT5A 5EKOA 1UKHA 2GCDA 3OCBA 4YJOA 4LRKA 3DKCA 3TCPA 1KWPA 3BHTA 1BUHA 2UVXA 1KE5A 3SX9A 3KA0A 5D7AA 4FSUA 2H96A 4L52A 4MEDA 5J95A 3RMFA 3I79A 3ZRMA 4D28A 4IH8A 2JKMA 3E7OA 4AXAA 4I4EA 3A7FA 3VS6A 1J7UA 4XLVA 1Q3WA 2GNGA 4CZTA 4O81A 3F69A 3R21A 1H1RA 2OH0E 3UODA 3FUPA 3UOLA 3O2MA 2HAKA 1P5EA 2EU9A 3TZMA 4RA4A 3TEIA 2Z7QA 3IW8A 3ZOSA 3CJFA 4XX9A 3CQWA 5IH4A 3NEWA 3TT0A 3EH9A 4EH6A 1YVJA 4RLLA 3P7AA 4IAAA 2C6KA 2BRNA 3DTWA 2Z2WA 5ICPA 1H0VA 1OZ1A 3CLYA 4E93A 3WE4A 3BQCA 3UOJA 1P4OA 3H30A 4W8DA 4DLIA 4F7NA 3FAAA 5AADA 4QP2A 2IWIA 4UWCA 1YWNA 4MVFA 3RCJA 5CAVA 3HRFA 5IUGA 5JMSA 2W4JA 4K1BA 1FINA 5HBEA 2XJ1A 4L53A 2YITA 4AA5A 3UG1A 3UO6A 1Y6AA 3KEXA 3VHEA 1FQ1B 3OTUA 4ZY6A 2W17A 2X7OA 2PVKA 5CS6A 2XK7A 2JITA 5CVHA 3OCTA 3QYZA 4AE9A 2W1DA 3TV6A 5K5NA 1K2PA 3Q60A 4QMMA 5LVLA 5DOSA 5E1EA 4CFMA 4D9UA 2ZYBA 4IDTA 3WYXA 3RNYA 3KREA 4DBXA 5AUZA 3ZO4A 3O17A 3DKOA 4GJ2A 4ONAA 4RX9A 4ALUA 3HKOA 2A0CX 3Q2JA 3VUMA 2ZV8A 3VJNA 3LE6A 2DWBA 4DEEA 4DFLA 3R28A 4H05A 2GHLA 4E4NA 2Z02A 4YURA 3ORXA 4NCTC 3UNJA 3E8CA 3KVXA 2ITPA 1KE9A 3C4CA 3NUUA 4XG8A 3DJ6A 4OTDA 5AUVA 4BCNA 5FXRA 5BVOA 4G6NA 2OJGA 5C8NA 1PXKA 4YZ9A 1SVHA 5DR9A 1UU8A 4FKOA 5CSWA 5FWKK 4E4XA 3QX2A 4RC2A 4KIKA 4RQVA 3VS1A 4L6QA 1ZYLA 3NCZA 4IX4A 2XK3A 3PP1A 4QQJA 2PVFA 3NX8A 2W96B 4FSZA 4WG5A 4YJPA 2NP8A 2UZWE 4WSYA 4CRSA 4FZAB 2I40A 1CKJA 3MB6A 2JLDA 4UMUA 4JIAA 4FKVA 4NYEA 2PUNA 3EZRA 1ZZLA 4PTGA 3VBWA 3TUBA 4O0RA 5I9UA 4BIEA 1W8CA 4RVLA 1KE6A 4N4SA 5A46A 2ZM4A 3ZM9A 4Y46A 5JQ5A 4GS6A 5LMKC 4ZS4A 4LFIA 1FGKA 3R2BA 4G9RA 5J7HA 4TWPA 5B0XA 2SRCA 4OGRA 4BB4A 5BMMA 1GIIA 1DI9A 2WO6A 3L8VA 4FTTA 4BDIA 3NLBA 4FSMA 1R0PA 2W7XA 4FSWA 5H9BA 4AW5A 5LXMA 3H3CA 5HICA 4DFXE 4HZRA 3MFSA 4BCMA 3DB6A 5DT3A 3MYGA 2VWBA 4KSPA 1OL5A 5GHVA 4CCUA 4EBWA 5E8SA 3QGYA 1QMZA 3ZYAA 5I9XA 5LVOA 2RFSA 1GZ8A 4ZZOA 2GHGA 1UWHA 3GU8A 3TNQB 3RAKA 3UPZA 4WG4A 2WMWA 3AG9A 3Q5IA 2YIXA 1JLUE 1WBOA 5GINE 4LI5A 5AX3A 5BVDA 5T6KA 5HG5A 3E7VA 4M14A 3DBDA 4FKPA 4RWJA 3C4ZA 5D9HA 3PXFA 1PXMA 3TN8A 2UZLA 2ITVA 1FPUA 3W10A 4LGGA 4MD7E 2IVUA 4DEGA 4MX9A 4EK6A 4FKIA 2QONA 3S4QA 1BI7A 4YP8A 3PIYA 1VYWA 4XV3A 5EOLA 5AV0A 4EH9A 3C5IA 3FLSA 2WQEA 4Z55A 4C59A 4IFGA 4QP9A 5DIAA 2CLQA 5EDPA 2OFUA 4R1YA 4JOAA 2CKPA 3HECA 3F66A 3WYYA 2LAVA 2BALA 3HV3A 2C5VA 3AT2A 1R78A 3FMMA 3IW6A 3PRIA 1ERKA 4J8MA 4YSMA 4D2VA 4D2PA 5CXZA 5KMMA 4O7NA 3FSFA 2WMVA 1TQMA 2PSQA 2QU5A 4G17A 4NH1A 4B4LA 4O7RA 2HENA 2OF2A 4MF0A 4U3YA 3I0OA 5CF8A 3BHHA 4CVAA 2DQ7X 5LARA 1PMUA 3I60A 2PMLX 4D2TA 4H1MA 5I5ZA 1Z9XA 3UTOA 4IVDA 3PJ2A 4HGLA 4YHTA 5C4KA 3DDPA 3KULB 3FYJX 3BKBA 3RWPA 4GFMA 1OL2A 3GC8A 4A9RA 4C4HA 4MXCA 3FLNC 4PDSA 5TF9A 4OTRA 4AX8A 2PL0A 4XRLA 5LVMA 2ZOQA 4U43A 3UOKA 3FHRA 3ZDIA 2W5BA 3R7UA 1WVYA 2XMYA 4X21A 4NWMA 4ZSJA 2J51A 3EQFA 5IQGA 2UZTA 2XM9A 3R30A 4EEVA 2PUPA 3H9OA 4IAYA 5AR4A 2GS7A 3QLFA 2PK9A 1Q5KA 4AOIA 4ENXA 3HAMA 3QD2B 4GVAA 4C4JA 2ZJWA 5BVFA 5JSMA 5M09A 4FNWA 3Q4ZA 2WNTA 3LFEA 2BTSA 5HU9A 3MTLA 1O6KA 2PY3A 3QALE 2QI8A 4N6ZA 4ZZNA 3BWJA 3EN9A 5HI2A 3DBEA 4N0SA 3AC2A 4CFXA 4DH1A 4DITA 1NVSA 3KMUA 3KL8A 4FTIA 2UW6A 3KFAA 3QXOA 1WVWA 4R78A 3BU3A 4YZMA 2CN8A 1OUYA 3H0ZA 5I3OA 2R4BA 3VBVA 5EYDA 5KMLA 3LXKA 2WU6A 3DXPA 4JI9A 3ALOA 4IM2A 3RVGA 4C38A 4KKEA 3UIMA 5TR6A 2NO3A 3U6HA 3DNDA 4EK5A 2X8DA 3R83A 3S3IA 4FICA 5CEQA 3BYVA 1W84A 3CGOA 5IA4A 3PG3A 4IXPA 4RVTA 5L2WA 5HX8A 4HVIA 3NUYA 2YIRA 4IVBA 5G6VA 3UVPA 5AV1A 1H1SA 4RIYA 1XBCA 3F61A 4YJTA 2UW0A 1IA9A 4DN5A 2PVHA 4D1SA 5E9EA 3P7BA 3LQ3A 4XLIA 3MWUA 4RWKA 3POZA 4XH6A 4DEAA 4I94A 4EK3A 3OHTA 2E9PA 4IWPA 4RIXA 3EWHA 4ACMA 5E8TA 3D94A 4FIHA 4I23A 4TWCA 4BCPA 3BLRA 3QZGA 4WRSA 4GCJA 1XHAA 4DGGA 4IZ5A 3TACA 2W1EA 3Q32A 5C01A 4W9WA 1QPCA 2YERA 3WF9A 1Y8YA 1OVEA 4MNEB 3A2CA 5A4LA 4FTAA 4NJ3A 5DG5A 3W2PA 4PMPA 4FL3A 5EHYA 3PJCA 3LXNA 4NW6A 1V0BA 3FMEA 4O22A 3COMA 2XNOA 4FV9A 5LCKA 1OL6A 4MKCA 4BC6A 4FSTA 3FI2A 2H6DA 3D15A 3K5UA 4QMYA 4FV0A 4RIWA 3D2KA 2XIZA 4DTKA 1XH4A 4BCJA 2C1BA 3TJDA 4OAVB 1NVRA 4EUUA 2I7QA 4YTFA 3LFNA 4N57A 1SVGA 3AC1A 5T3QA 1YXUA 4JS8A 4OTPA 3AMAA 4RJ5A 2BAKA 3LCDA 3PY3A 3Q52A 3NUNA 1QPJA 4KB8A 1PXJA 4I6QA 2XKFA 1NVQA 4ENYA 2OW3A 5AUWA 5JFXA 3SXRA 5KCVA 2B9FA 5AEPA 4TWOA 5JFVA 3SW7A 3L9NA 1H1PA 2UZEA 4NUSA 2BILB 3U4UA 4WBOA 4KBCA 5HVJA 2BHHA 2J0JA 4N6YA 4FUXA 3CXWA 4NTTA 3W8LA 4EORA 4BN1A 2R3OA 1H1QA 4FE2A 4I0TA 3BYMA 2VWZA 5AR8A 4ZTQA 2PZ5A 3TKHA 2A4LA 4M15A 4APPA 5EHLA 4BDEA 1OITA 3ATTA 3HAVA 3OC1A 1IA8A 3Q3BA 3PRFA 2XF0A 3S2PA 2PVLA 4WKQA 5DEYA 3BBWA 4DCEA 4BGGA 4Q9ZA 5DYJA 4YU2A 1WMKA 4L42A 2Z7SA 4F09A 4J71A 4BKYA 1A9UA 3EFLA 2AUHA 4YNEA 5FBOA 2P4IA 2OXXA 5DNRA 1CTPE 3AC4A 2WPAA 3ID6C 3EKNA 3PA4A 4FL1A 3JY0A 2H9VA 2ZM1A 3O7LB 3EJ1A 3R00A 5IQCA 2LGCA 2PE2A 2BFYA 5ANGA 3GCSA 4X0MA 4M3QA 4QP8A 1IEPA 5GJFA 3E62A 4CT2A 4ITJA 2PULA 3FMLA 4AZVA 1Y8GA 4E6QA 3RK7A 2QNJA 4C3FA 2ITQA 5AUXA 5AUTA 4XG4A 4M69B 3P78A 1P4FA 3U4WA 1B39A 2UW7A 3D0EA 3CY2A 2C30A 2NRYA 4EOPA 5AX9A 2UW3A 4X2FA 2OK1A 4PTEA 4IZ7A 3CTHA 3QKLA 3OCGA 2JIIA 5KX8A 3DDQA 4XBRA 5EYKA 5C8KA 4DEBA 5J87A 4QNYA 3F2NA 3BYUA 3TNWA 3OFMA 4C34A 3AC8A 2XBAA 4OAUC 4RX8A 5JZNA 3V5PA 5A4CA 4C2VA 5C27A 1IAJA 1PMVA 4MQ2A 4B8MA 5F1ZA 3SKCA 3F9NA 3V01A 3PLAE 1DM2A 2X2MA 3F7WA 4O1OA 4YO6A 1OECA 4E5WA 4L01A 1CDKA 5IH5A 5M44A 4GFGA 3UDBA 3IECA 4EK8A 3IW4A 2X39A 4II5A 5FBNC 2WTKB 3FZSA 5E8XA 3ORLA 3NYOA 3T9IA 4BICA 3GBZA 2B1PA 3L8PA 4Y8DA 2BRBA 2WGJA 4KIQA 3QU0A 2X6EA 5HD4A 2VWYA 4XP3A 5CU6A 3ORKA 4V0GA 3FLWA 4DG3E 5CEOA 4XG2A 4ANQA 3QTWA 5AP6A 2BCJA 3JVRA 3RHKA 4D2WA 4IACA 3VNTA 3V5QA 1PF8A 1PHKA 2A27A 2FYSA 5EW8A 4BCQA 4FKGA 4E1ZA 2YJSA 4F08A 4X2NA 4EH7A 1SMHA 4R1VA 3NVMB 4PMTA 2V62A 1JKKA 2BUJA 4JR3A 4C02A 4JJRA 4MBIA 3HRCA 4KIOA 3Q4TA 4Y95A 4BBEA 4R7HA 2CNVA 2W1CA 1Q97A 3ALNA 4ZAUA 4CV8A 2V5QA 3N9XA 2C0IA 5IEYA 2W5HA 3PVUA 2RG6A 4IMYA 4M69A 3ZC5A 3CPCA 1OIUA 4CFNA 4Y5QA 3R63A 4S30A 2YWVA 2OJ9A 2HOGA 4X3FA 5CY3A 3VBXA 1H0WA 4U42A 5HG8A 3I6UA 5ACKA 3NUXA 3P08A 5B2LA 5DGZA 3HUBA 3E64A 3TZ9A 1HCKA 3IGGA 4S33A 3KQ7A 2XBJA 4I1ZA 5L6WL 2WTDA 3ZFXA 5TKDA 4UXLA 3R1YA 2OXYA 2ZDTA 2VTNA 2XIXA 3QTSA 4FKJA 4GRBA 3QZHA 4IX5A 1CM8A 2F2UA 4AN3A 3LFQA 1ZY5A 4C37A 1E9HA 2GTMA 4CTBA 1Q8YA 4D58A 4BCKA 4U81A 3MVHA 4I5PA 2WAJA 3VQHA 5BMSA 3E8NA 3BYOA 2YIQA 2YM5A 2XZSA 3GQIA 4FX3A 4NM0A 4YBJA 5AP5A 5AR5A 3F5PA 4TL0A 4C58A 1OPKA 4FGRA 2PZYA 3IPHA 3PPKA 1HCLA 2BROA 4CLIA 1M17A 3I0QA 3D7TB 4IDVA 4X3FB 4O0TA 3AC3A 3Q9XA 1F3MC 4CQGA 2HY0A 1KOAA 4FSQA 4RJ6A 2XCKA 3EZVA 3VUHA 5EDQA 4FTKA 4QQTA 5A9UA 1YHVA 4IX6A 5JRQA 4E8AA 2XRUA 4EOSA 5B7VA 4ZK5A 2JIVA 3F6XA 4GU9A 1Z5MA 2VUWA 5J9YA 1YXXA 3EYGA 3ELJA 4FKLA 4J98A 3W2CA 3DZOA 3PWDA 4XG3A 1Y91A 4AN2A 4QMQA 5HTCA 1SYKA 4B6LA 3LJ2A 1W82A 4G3FA 5HCZA 3WARA 4RA5A 4K33A 3IDBA 3VF8A 3ZH8A 2OICA 3KMMA 2YDKA 4EC9A 4AGCA 4FV1A 2XH5A 4FL2A 3NCGA 4CLJA 4XMOA 3MFTA 2J6MA 2E2BA 3ZSGA 4R7BA 5HBHA 2QR8A 3DT1A 4MXAA 4G5PA 5FRIA 3O50A 4ANBA 4G3CA 3DAKA 3C51A 4NCTA 2PVMA 5BX0A 2O0UA 3RP9A 3SG9A 2OJFE 1FMOE 2F49A 3QYWA 4DH8A 5IQEA 3LQ8A 2W1FA 1H25A 1KV1A 4W9XA 3FI3A 2BRHA 2XK9A 3C0GA 3HA8A 2Y9QA 4FIEA 3HLLA 4RJ7A 4U8ZA 4M13A 3TUDA 5CI7A 2Y7JA 4FG8A 2RL5A 4FIFA 4UY9A 3TM0A 4J95A 2GNJA 5FUTA 4FZDB 2QVSE 2UVZA 5M08A 5E8YA 4CYIA 2XEZA 4QP4A 2AYPA 2PYWA 3EQIA 4JBPA 2G9XA 1RQQA 2YZAA 4EHEA 3ZMMA 5A4EA 2UVYA 2R3NA 2O5KA 3CGFA 4WHZA 4M0YA 5A4TA 3R8PA 3AD6A 4TXCA 3BELA 4R6VA 4BGQA 5AP1A 4I6FA 4GU6A 4ZTSA 2GMXA 4DFBA 4AOJA 3P23A 3CJGA 3EFKA 4CGAA 5HE1A 2F7XE 5IPJA 5ITAA 4H3PA 2IN6A 4Q2AA 1UU7A 3ACKA 3DLZA 2YIYA 4XRJA 3SOCA 3V04A 3TDWA 3EL8A 5GIPE 4K11A 2XCHA 4KBAA 4O0UA 3KF4A 2ZMCA 3R8LA 3FMJA 4I3ZA 4QT1A 3QTXA 4D5HA 3PY1A 2IW6A 5DBXA 2YLEA 4D4VA 2G2FA 5A54A 5B2MA 2BHEA 2IVTA 4RBLA 3UVRA 4ZP5A 4MCVA 2Y4IB 5FDXA 3LM0A 5HCYA 4AGWA 3ZSHA 3BI6A 3MFRA 5AR2A 4TN6A 2CDZA 5J9ZA 4ZTHA 4E20A 4FODA 2PVJA 1UNLA 3O8PA 3FPQA 5L6PA 2WQBA 1JKLA 3UVQA 4FV4A 4J8NA 2CPKE 4HPTE 4XOZA 5EH0A 1PYXA 4OTWA 5HVYA 5LVNA 4LRMA 2WEVA 4C4GA 2CNUA 4XYFA 2BPMA 4Q9SA 4R5SA 3ANQA 1X8BA 4E4LA 1SVEA 5EK7A 4E6DA 3LJ0A 5HTBA 1OL1A 3OMVA 4OTGA 4MXZA 5IMEA 5CQWA 4EOMA 5CAUA 1U5QA 1PKDA 5EYMA 1STCE 5C8MA 4QPAA 4FA2A 1T46A 5HNIX 4J96A 4BDJA 4UMPA 4TNBA 3LFAA 4DH5A 2C3IB 2RFNA 4R3RA 4ASEA 4TYIA 5KKRB 2FA2A 5J5SA 3VUKA 4L68A 1BMKA 3FKLA 3KY2A 2X81A 3KN5A 4RRVA 2OWBA 4X2JA 3LCKA 3WIGA 4O82A 5LMBA 2VGPA 4BDDA 3PVBA 3DKFA 3JY9A 4AT3A 5CSXA 3DQWA 3OROA 4PWNA 1KE7A 3OWLA 1H01A 3LOKA 3PLSA 3LFBA 3HDMA 4ZSLA 3PJ3A 2OFVA 3FQSA 3Q9YA 4PF4A 2HK5A 3BGZA 3R8UA 3C0IA 5JRSA 5A4QA 5HLWA 5HG9A 3LPBA 1Q8UA 2OIQA 4M97A 5HCXA 4IWQA 1H00A 4F70A 2BTRA 3BEGA 4AZFA 4Z7HA 3C50A 2ITOA 4ACGA 2NNWB 4QTBA 2PE0A 1FVRA 3KRRA 4D1ZA 2QCSA 3QLGA 1OKVA 2QG5A 5GZ8A 3DBCA 3Q96A 2QKWB 1OUKA 4JG7A 4P5ZA 5E8UA 3ZO3A 2JAVA 3GB2A 3FC2A 3D5WA 4WSQA 4YTCA 3FHIA 2G01A 3EB0A 1YWVA 5CZHA 3VO3A 4KIPA 5E92A 2QHMA 3LMIA 4G3EA 3MGYA 3ACJA 3M42A 3QZIA 5GJGA 2WHBA 2WKMA 3GEQA 2ERKA 2OGVA 3MIAA 3TV4A 4QTAA 1VEBA 5JN2A 3QTUA 1YXTA 1RE8A 2R3KA 3KK9A 4DA5A 4BTJA 4AT5A 4BDGA 1OIYA 4FZFB 4XG6A 2CKQA 1XO2B 2UW4A 2WQMA 5JZJA 4KRDA 3OBGA 5ANIA 4U79A 5AJQA 2WU7A 2JBPA 1ZARA 3R7IA 3RINA 4ZSAA 3TI1A 2WTWA 4QNAA 1OPLA 1WBVA 3MS9A 2RSVA 4FT0A 5L6OA 5C1QB 5BYLA 4WNKA 2V7AA 4G9CA 2CMWA 3PA3A 3QXPA 4KD1A 5AUUA 5KMIA 4RIWB 3F5XA 3JVSA 4PNIA 3VF9A 4F9YA 3I6WA 3FQEA 4BIDA 4FEVA 4O7SA 5LQFA 3QWKA 5HG7A 2VTMA 4FNZA 5IQIA 3SAYA 3R2YA 1GIJA 3R7VA 3R1QA 4ANSA 2WEIA 3OOGA 4AU8A 5KMJA 2QR7A 3HA6A 4HGSA 2ZVAA 1PJKA 4Z3VA 3QRIA 3L1SA 3ZONA 2JDOA 5CAOA 4Z16A 2QURA 1UU9A 3R04A 4H3QA 4AW2A 4CQEA 4EQMA 1UV5A 3U6JA 1J7LA 3G0FA 3QQKA 2QO9A 4YJSA 3KULA 2XNEA 3BIZA 2OSCA 3SV0A 2ETRA 5IDPA 3AOXA 4O0XA 3UNZA 3DY7A 3H0YA 4M8TA 3DQXA 2YA9A 4BTFA 2XRWA 4GK3A 5JK3A 3ZRKA 1E1XA 1M2RA 5K0KA 3UJGA 3C7QA 5HNGA 3DOGA 5CT0A 2XNPA 3FZRA 3RI1A 5FLFA 4TNDA 2GNIA 4HYHA 1IASA 2JDRA 3QTZA 4LMNA 3E5AA 3UG2A 3G5DA 4C36A 3U55A 3VBTA 2JGZA 3R6XA 5DMZA 4LGHA 4RT7A 2W4KA 5IA3A 3SOAA 3A99A 3MVMA 3QHWA 4HJOA 2C5YA 2VTPA 3NW7A 2HWOA 5IA2A 1ZAOA 4PDOA 2YM7A 4ZMEA 2XIKA 2QLUA 3ZM4A 2JDVA 1UU3A 4IWOA 1YOJA 5IQAA 4FT3A 2X8IA 4MQ1A 1LP4A 4L44A 4LGDA 5E4HA 4YJRA 2R3IA 3FPMA 3Q2MA 5L2IA 1LEWA 2UZBA 2EXEA 4MXXA 3WOWA 3PSBA 2ZB1A 4A9UA 2VGOA 5K5XA 2C1AA 3GCPA 3HZTA 4LOQA 3S00A 4Z7GA 4IM0A 4FKRA 4KA3A 3IW5A 2YWPA 3FEGA 3MPAA 3CBLA 5HLPA 2BKKA 3OY3A 4MXOA 4HYIA 4NSTA 4QTCA 4DEIA 1O6LA 4WOVA 3ZBXA 3MI9A 2OXDA 3MBLA 3MIYA 4FKQA 3A4OX 4I92A 4P90A 4TTHB 3BU5A 3PXQA 4FG9A 3R9HA 4DE4A 5AP7A 1GJOA 2I0HA 2RFEA 1FGIA 3G51A 3OXZA 3QX4A 4TY1A 3GOKA 1M2QA 3F3ZA 3G9NA 3NR9A 5AAFA 4ZTRA 2BZIB 4RJ3A 3UOHA 4FIGA 2VTOA 4LL5A 4JX7A 3MPMA 2C6IA 1CKPA 4PTCA 3A62A 3QTQA 1ZZ2A 5A6NA 3WIKA 3ET7A 4CSVA 4L3JA 4ZY4A 4YUQA 3OZ6A 4QMLA 1UNHA 5HOAA 2WZJA 5KHXA 1Q61A 4I5MA 4EZ5A 5HO7A 2WIPA 3JS2A 4LUEA 1KSWA 2CKEA 4ZLZA 4ERKA 3G0EA 5CT7A 4A4LA 4R7IA 2G2HA 1UA2A 3UYSA 3CD8A 4D1XA 4KABA 3OBJA 2UW5A 2VWXA 3CKWA 3G90X 4MXYA 5M4CA 4JG6A 5FG8A 5CF5A 4FTNA 2WTCA 1NW1A 4MNFA 5KBQA 3CSVA 5EI8A 5BQ0A 2R64A 3HV4A 3QAME 3P86A 4BHZA 4PPAA 5EQEA 4ARKA 5AP3A 5CF4A 3GCUA 4GYGA 1RDQE 3C4EA 5KMNA 4EQCA 4BKZA 2XB7A 1YXSA 1YHSA 4HZSA 1G3NA 1MQBA 2HWPA 2R3HA 4HVGA 2WB8A 3BRBA 2ESMA 3OOMA 3UYTA 5DPVA 4RZWA 4LV5A 4F6SA 4L43A 4EYMA 5EM6A 1WBPA 4J1RA 2B7AA 2YABA 4GK2A 3TIZA 3ZS5A 5HVKA 5IUHA 4O86A 2BKZA 4UYNA 3GCQA 2XNMA 4OW8A 3EQRA 3FXWA 3P9JA 1B38A 3OUNB 3RAHA 4ZLYA 2X1NA 1H1WA 1R39A 3QC9A 1OL7A 3BV3A 3V5JA 2CGVA 2FH9A 3PG1A 2EXMA 4RC3A 4L45A 2UV2A 5CU0A 5ETCA 4M0ZA 5AAEA 1J1CA 4YZDA 3LVPA 2OO8X 4PL3A 5FTGA 3ZUVA 4RX7A 4BDHA 3FMKA 4IC8A 4WUAA 3B8RA 3D5XA 2C6MA 3IK3A 4W8EA 1UNGA 4LMUA 3FSKA 3NIZA 4FT9A 5DR2A 4EKLA 4PDYA 2X2LA 4WA9A 3BYSA 5EKNA 4IB3A 5EM5A 3OD6X 4NU1A 2VWWA 1OB3A 2B55A 3AMYA 4IANA 4FTCA 1MRYA 4RQKA 4K9YA 1Q62A 5CAPA 5AIRA 3LMHA 3OWJA 1K9AA 2X8EA 3OW3A 4RLKA 2BRGA 3LIJA 2W9FB 3CE3A 2YCSA 5KNJA 2ETKA 2J0IA 1OBGA 3RZFA 5CEPA 4W4XA 4IJ9A 5HE0A 5TOZA 4DTAA 3F7ZA 3DBFA 2IG7A 3HMIA 3R9OA 3E3BX 5FDPA 4YC6A 3HMOA 2C0OA 1YOMA 4LRJA 4YZCA 4IAIA 1Q99A 2HXQA 4PUZA 5L8JA 3W2SA 4CMOA 5BPYA 5CWZA 1VYZA 4PMSA 4QD6A 4AQCA 3CD3A 1PMNA 3RPVA 5KMOA 1A06A 5EYCA 3V3VA 2ONLA 2JD5A 1I44A 4BI2A 4IEBA 4XP2A 3P7CA 4S2ZA 4CV9A 4XS2A 4L3PA 4YBKA 3OY1A 3PA5A 3B2WA 3PJ8A 4PP9A 3C1XA 2G1TA 5CNNA 4CRLA 5L3AA 4QMVA 4DGOA 1S9IA 4HPUE 1PRYA 3RPSA 4BDBA 5AUYA 4FZ6A 3TXOA 4F4PA 4J99A 1APME 4BCGA 3A8WA 1GZOA 4YJUA 4GV1A 3VRZA 5J9LA 4AZSA 1OGUA 4TWNA 2WXVA 4ZS0A 1MUOA 3NW5A 2VTIA 3HV6A 3FBVA 1BX6A 4L46A 2YDJA 4JDKA 3L9PA 3TTJA 3QZFA 3B2TA 3L8XA 1GNGA 3QUPA 4XHKB 3CY3A 1PXOA 2FSTX 2HW6A 2WMQA 3T8OA 4U41A 4QRCA 2C6DA 4JG8A 1BL7A 4RIXB 1YI4A 4NM5A 1FOTA 2J5FA 2X7GA 3NNUA 3GUBA 4FGBA 4O2ZA 5CALA 4JDHA 2J0KA 5DRBA 4G3GA 4L9IA 1PXNA 4U97A 3EHAA 4FG7A 5HD7A 3R22A 4R3PA 3A61A 4YR8A 1AQ1A 3VS7A 5HQ0A 2B9HA 3MY1A 4UWYA 4NEUA 3OP5A 1PYEA 3KRLA 3ZLYA 2OI4X 1OIRA 1XH9A 1R1WA 4QMWA 4YLJA 3R8MA 4CCBA 1XH8A 1JNKA 3G6HA 3IOKA 5E8ZA 5IF1A 3AC5A 4QP3A 3V8TA 3H10A 3W33A 4QQ5A 3AT3A 4X6RA 3QKMA 2XUUA 1PY5A 3HV5A 5I9VA 3RHXA 4F7SA 5M4FA 3ETAA 3G9LX 3MJ2A 4FYOA 2JFLA 4FZ7A 5IZFA 3UO4A 4BI1A 2KULA 2P2IA 3DFAA 3O51A 2QO7A 1LUFA 3E8DA 3FMNA 3THBA 4BVUA 2BAQA 3ROYA 5CASA 2C6EA 3H9RA 2B9IA 2VO7A 2R2PA 3MH0A 3CTJA 3NIEA 3UIXA 1E1VA 2WMRA 4K8AA 2XKEA 4XUFA 2O8YA 2C6OA 1YDSE 2QOCA 4UXQA 4KIKB 4BTKA 3CP9A 2PU8A 4I4FA 1M14A 4R3CA 3W2QA 3ORPA 3WI6A 4D4SA 1OKWA 4GK4A 3U8WA 4DLJA 5ETFA 2HXLA 4FTLA 4EZ3A 2EVAA 4OTFA 3WE8A 5KBRA 3AD5A 4CMTA 5IISA 1U59A 3NMUF 5GJDA 5CSPA 4G34A 3HVCA 4ZXTA 4AN9A 5H8EA 4RFZA 5CZIA 1W98A 4D55A 1J91A 4DCAA 4F9AA 1JKTA 2W1HA 2ITNA 2FO0A 3MH2A 2PMNX 3QQHA 5DFPA 2HZ0A 3PDTA 3FMHA 4EHVA 2CCIA 2Q0BA 3QTRA 3C9WA 2AC5A 3I7CA 5AP4A 3SQQA 1PMEA 3DU8A 2C3JA 5HKMA 4RIYB 4FNXA 5A3XA 5BYZA 4PMMA 4UEUA 3FY0A 2C4GA 4F7JA 1R0EA 5BVEA 4RFMA 2ZV2A 3LZBA 4D4RA 3PVGA 4HYSA 3VUGA 1FVVA 5L2TA 2F7EE 5J1VA 2VTSA 5AWMA 3KB7A 3CC6A 2YN8A 3OWKA 4HVHA 3PE2A 5K0XA 5CANA 4FV3A 3BZ3A 2WOTA 4O0YA 4CXAA 5J7BA 2ZAZA 4EWQA 3ITZA 4GKHA 2QD9A 5K4JA 3FZTA 3EFWA 2XK8A 4FKTA 4EJNA 2NRUA 4TRLA 4YPDA 5KUPA 4PL4A 1IRKA 2A19B 2RIOA 3A7IA 1WBSA 1XH5A 2IZTA 4O38A 4XJ0A 3S95A 4AOTA 2HCKA 1PKGA 2FVDA 3LM5A 4FK3A 4BHNA 3AXWA 2JC6A 3IKAA 2F7ZE 2I0YA 4L7FA 3GFWA 4E26A 4NW5A 2I0EA 1QPEA 2IO6A 3IGOA 4AT4A 3E92A 3TDVA 2J0LA 3NPCA 4MWIA 2GQRA 2QC6A 1IAHA 2JEDA 4HOKA 3ULZA 2Q0NA 4HVSA 5BVWA 3UMWA 5F94A 2GS2A 2BAJA 1JSUA 2Y4IC 3BLHA 5DVRA 5HE3A 3R1SA 3RAIA 5AIKA 5AM6A 4N70A 4KKHA 3ORZA 1JBPE 3FJQE 3HMNA 2FSOX 3WZDA 4QP7A 3EYHA 2Z7RA 4IB1A 4ACDA 3SG8A 4E6AA 2XM8A 3OEZA 2F4JA 4TYGA 4Y83A 1OIQA 5HU3A 4GG7A 4RVKA 4LL0A 5H2UA 3DTCA 4OBQA 3ZZEA 2QKRA 2Y0AA 4WG3A 3WZKA 4ANMA 4BR3A 2UZDA 2C6LA 2WTVA 3VRYA 1U54B 2FSLX 3FLQA 4AAAA 3MVLA 2VO6A 3KMWA 4XNEA 4QPSA 4R5YA 4DBNA 3NUSA 5JGDA 3PZEA 5D41A 4FV2A 3N4TA 3BE9A 3KRXA 2GNFA 4YC3A 5D1JA 1Q4LA 2H8HA 4IBMA 4FT7A 3K5VA 2E9NA 3EL7A 3FWQA 5AR3A 2CSNA 4RJ4A 4ZSGA 3EFJA 4BGHA 5CVGA 1QCFA 5HIDA 4JBOA 4A9YA 4DFNA 4BFMA 1YKRA 3Q04A 2OJIA 5HO6A 2CHLA 2UZNA 2GS6A 4IIRA 2V55A 3VW6A 5HEZA 4C4IA 5I9ZA 4IADA 4J53A 3FZOA 4E5BA 2P55A 4B0GA 4EJ7A 2B9JA 4GW8A 4Y72A 4WBBB 3NS9A 3W2RA 3FY2A 1P14A 3M2WA 4GVJA 4HYUA 4NZWB 4FTOA 5DT4A 5JFWA 5EQYA 4BCFA 2QU6A 3KCFA 3HP2A 5EM7A 4F0FA 3PZHA 2XS0A 5HIEA 3N4VA 5IEXA 3WZJA 1NXKA 2QO2A 4OTIA 1KV2A 3ZXTA 3E88A 4KWPA 3FC1X 2OZAB 2PMOX 2X9FA 5FM2A 4AZWA 3LXPA 5ACBC 2I6LA 1O9UA 2XKDA 4BDCA 3LXLA 3C4WA 3VWAA 4BRXA 2R3FA 4FV6A 2FSMX 3P5KA 3NYXA 2CLXA 2QQ7A 2YACA 2E9OA 4I5HA 3D9VA 4U7ZA 3LMGA 3LCSA 3PFQA 3AD4A 3NAXA 4YZNA 4H3BA 4I0RA 4HVDA 4M84A 4FVRA 4BYJA 2YM4A 1OPJA 2BIKB 3D5VA 3PPJA 4QP6A 3QD0A 4UMTA 4D2SA 3I81A 4C7TA 2W4OA 4KUJA 4JRVA 4IZYA 1WAKA 3FXZA 5DN3A 3TNHA 1P2AA 5HO8A 4C3PA 2J9MA 4PRJA 4IB5A 5L2QA 4WRGA 5EI6A 2YHVA 3U87A 5E7RA 3RPYA 3M11A 5M53A 5GIOE 3LFDA 4MBLA 5DWRA 3ZCLA 5I4NA 3RTPA 4DHFA 3R9RA 3CKXA 3SDJA 3I4BA 5ANEA 3UP2A 4F99A 4JAJA 5DLSA 5C03A 4K2RA 5B2KA 2W0JA 1URWA 3M1SA 4X7QA 3UMXA 2IW8A 3LHJA 4EYJA 4I21A 4O0VA 3F3WA 3GOPA 4F63A 3FLZA 2CKOA 3D7ZA 2GNLA 4RWLA 3IS5A 1XWSA 5KZIA 5AA8A 5EW9A 4TYHB 4ERWA 3GXLA 4L7SA 2J50A 4YJQA 3NYVA 5DE2A 5HHWA 3GC7A 3UIBA 4A7CA 3R9DA 3EQPA 5BVNA 5LCJA 3TUCA 1XR1A 3EIDA 1KOBA 2C3KA 3VBQA 4YSJA 1DI8A 3UE4A 2R5TA 4K6ZA 5FD2A 5K4IA 3GC0A 4EHGA 2IJMA 1BI8A 1GY3A 1ZYSA 4ITHA 2BZKB 2YIWA 4M12A 4QMTA 3UBDA 5D7VA 4TKSA 3DCVA 3OVVA 4GIHA 4Q5HA 3AT4A 2HY81 3F5GA 4GH2A 3T9TA 4F1TA 2R0UA 2C6TA 2VWIA 4YJVA 3C4XA 2VU3A 4EK4A 3D83A 3SHEA 3W1FA 3GU5A 2ERZE 3KC3A 2ITUA 4X3FC 4RMZA 2YFXA 3ULIA 4D9TA 2REIA 4YMJA 5IEVA 3HP5A 3DS6A 2IVSA 4PY1A 3VUDA 5CEIA 3RK9A 5A6OA 2RGPA 2WMSA 3VN9A 3BGPA 3OTVA 3RCDA 1SNXA 2GFSA 3WZUA 5I9WA 3MV5A 2W1IA 4GUEA 4YTHA 3MH1A 5CX9A 3VBYA 2PMIA 3BLQA 5ETIA 4AF3A 3GVUA 3HMPA 4LUDA 4BIBA 5GZ9A 2C5NA 2OZAA 3SA0A 1K3AA 3Q6WA 1W0XC 5CSVA 2PE1A 4NFMA 4D2RA 4NKSA 5TO8A 3UQCA 3NNXA 3HEGA 2O63A 5C26A 3BHVA 3R7OA 4O7ZA 2G15A 5JEBA 2Q83A 2W5AA 3NRMA 3GI3A 3BEAA 4XP0A 3OG7A 4WD5A 3NYNA 2GPHA 4I93A 5CU4A 2EUFB 3OT8A 5J79A 3G15A 3FLYA 2YCFA 3F82A 1XJDA 2XNGA 1YHWA 5BNJA 3TG1A 4IX3A 4AA0A 3DFCB 3QGWA 4O0SA 5TE0A 5HZNA 1GZNA 2BVAA 4O84A 2BZHB 4KS7A 4XV1A 3AGMA 4RVMA 2VO3A 3QHRA 4I6HA 4EOKA 1Q8ZA 3DB8A 2E9UA 2R7BA 4PPCA 5HESA 4RC4A 3MSSA 3FYKX 4GUBA 4QQCA 3D2IA 4ALVA 1ZOEA 2YJRA 5KKRC 3TTIA 4QYFA 4YHJA 3C5UA 3QFVA 3QL8A 1REJA 4UYAA 2W9ZB 1LPUA 1DAWA 5M4IA 3BV2A 3PXKA 3VS2A 4AACA 1JQHA 2WMUA 4ZJIA 3P0MA 3KGAA 2CJMA 4HNFA 3FI8A 3MFUA 3EOCA 4YZBA 4AW0A 2C69A 2QG7A 4MHAA 4EH5A 4NIFB 4BDKA 4DH7A 1VJYA 4CKRA 3HL7A 3R02A 3WZEA 4GIIA 2P2HA 3F3UA 3R73A 2G2IA 2J4ZA 3R7EA 4YNOA 3BCEA 4AFEA 1PXIA 3QCSA 2ONLC 2WMAA 3BBTB 3V8WA 2XIYA 4O91A 1ZWSA 3OXIA 3ORNA 4C3RA 2YLFA 2ZV9A 2YEXA 1CKIA 3QCQA 4NM3A 3E87A 4FYNA 4P4CA 4O7WA 2BR1A 4GYIA 2VRXA 4P2KA 3UC3A 2QOHA 4MAOA 2EB2A 4FKSA 5E91A 3KN6A 4AFJA 4PV0A 4J7BA 3VJOA 3Q9ZA 2ITXA 4GEOA 2J90A 3KU2A 3FE3A 4PPBA 4A07A 3ZBFA 3DXQA 1ZMVA 5F95A 1ZYCA 4ZIMA 1FVTA 4BZNA 4NJDA 3GU4A 4I24A 3DKGA 2WTKC 5FGKA 3NUPA 1Q8TA 4ZSEA 3KXXA 2A2AA 3KRJA 5EW3A 3FV8A 4FTJA 2GFCA 3IQ7A 4YC8A 4ID7A 3KXNA 4FKWA 3LFCA 3U54A 3T3VA 1IR3A 5FTQA 4HGEA 4Y73A 5EG3A 5AFVA 5IDNA 2FGIA 2XYUA 3G33A 2XIRA 3R7GA 2P3GX 4YJNA 3VS3A 1F0QA 3ZXZA 4C8BA 1B6CB 3GFEA 4OTQA 2VTTA 4CYJA 4E3CA 5KO1A 2X4ZA 1UVRA 3KXHA 3ZUTA 4JRNA 3NAYA 3CPBA 3GQLA 3RAWA 1JSVA 1SNUA 3P4KA 2C5XA 3GC9A 4U3ZA 3KXZA 2ITWA 4RZVA 3DAEA 5LMAA 3V6SA 2QOFA 3QQJA 3O96A 4UN0C 5E8VA 3QD4A 2JFMA 3TL8A 3ORTA 3DV3A 2X0GA 4FIIA 5ANDA 4FOBA 4QOXA 3KCKA 4LYNA 3TIYA 2F57A 3V5LA 4V0GB 1XH7A 1XKKA 3I1AA 3MA6A 1AD5A 2F2CB 3TZ7A 1U5RA 2JDSA 3MJ1A 3ZTXA 4C57A 1KUTA 1LEZA 3VS0A 3AMBA 4C2WA 2W05A 4FBXA 4A4XA 3Q4UA 2IW9A 1JPAA 5IQDA 4ANLA 3QQUA 2Z60A 5AP2A 4EQUA 2OG8A 2HZNA 3U9NA 2WMBA 2CGWA 4JDIA 1ZY4A 2YCQA 3FMDA 4ZZMA 2IPXA 4QTDA 5J8IA 4UBAA 4DTBA 1H08A 1ZOGA 3FZPA 4GJ3A 2UZVA 4IJPA 4DH3A 5LMKA 2XVDA 2ETMA 4A06A 4DG0E 1ND4A 3QQFA 2X6DA 4TT7A 1UKIA 4IQ6A 3CEKA 5CSHA 3UC4A 2QOKA 4IHPA 4FSNA 3U51A 5HLNA 3W16A 3RPOA 4QO9A 3HUCA 4JL9A 5BUIA 2QOOA 3QCYA 2PUIA 5BUEA 3N51A 3QA8A 3FKOA 4WT6A 3RZBA 3Q6UA 2CN5A 3KK8A 4RX5A 4IVAA 1ZLTA 4BY9E 1YRPA 5AR7A 4BCOA 4QMZA 3TWJA 5FEDA 3DNEA 3JUHA 3TKUA 4F6WA 2O2UA 4MBJA 4ZTMA 5LWNA 2O65A 4L8MA 3W55A 5HX6A 2W06A 3QA0A 2J0MB 2XNBA 3QRJA 2ITZA 2GQGA 4MH7A 4DEDA 1GZKA 3S0OA 3DZQA 2WIHA 3ORIA 4LV8A 5M4UA 5JKGA 2WFYA 4ZLOA 5M56A 4BBFA 4X2KA 1H26A 3CR0A 4TW9A 4JR7A 5AV3A 4EL9A 3NGAA 4TYJA 4QMOA 3WBLA 4ACHA 4H36A 3GENA 4C62A 4EI4A 1MRUA 2VNYA 4FV8A 4E4MA 3BWFA 1RW8A 1ZMWA 3LJ1A 1BKXA 4G16A 3HNGA 2J5EA 1JSTA 1JKSA 3ZZWA 3IDPA 2YAKA 1YOLA 4H39A 3F3VA 2C5OA 5FEQA 4I20A 4ZJJA 3WF6A 1XH6A 2B53A 2EWAA 1R3CA 2NPQA 5CF6A 3RPRA 3VQUA 4ASXA 3A7JA 3UO5A 3O71A 4A4OA 1PXLA 3O8TA 4BZOA 4DGNA 1H4LA 1H27A 3TKIA 4F1MA 3Q53A 5LVPA 2WOUA 2UW9A 1M7NA 1OM1A 3VW8A 4CFUA 3ZHPC 2B4SB 4M68A 3PJ1A 2WELA 3K3IA 5J1WA 4CG9A 3A60A 3R9NA 5CU2A 4ANNA 2CCHA 3EN6A 3FDNA 2YM8A 5FM3A 4AUAA 4DFZE 4F9WA 2QODA 3BGQA 5A14A 5HTIA 2IZUA 2PUUA 3LKMA 4K77A 2PZPA 3PIZA 2OJJA 3K54A 4UZDA 5M51A 4LOPA 5HORA 3QQGA 3LCTA 1YW2A 4FTUA 3ZEWA 4V05A 4HCVA 4UB7A 5BVKA 4YO4A 5LJJA 3LLAA 4OUCA 4BWXA 2PTKA 3SRVB 4O1PA 5EHOA 3TNIA 4B9DA 3UQFA 2PVRA 1SM2A 2R0IA 4UMQA 4G6LA 3POOA 2IVVA 3RBWA 4H1JA 4OBOA 4XV9A 4K0YA 4GSBA 4TZRA 4JLCA 3EQGA 3NNWA 4KKGA 2JBOA 5H8BA 4BWPA 4IB0A 5JT2A 4FTMA 4DC2A 4PNKA 2YISA 1G8SA 5C4LA 3D4QA 4U40A 3DK7A 3FI4A 3I5NA 4PDPA 3R7YA 3PE1A 4JNWA 4WUNA 1T45A 2FB8A 3NZ0A 4XEYA 3VS4A 4DEHA 4JQ8A 3EKKA 4S32A 2HYYA 4O27B 4U44A 4D5KA 4KRCA 4LOOA 4U6RA 3GT8A 3B8QA 3OT3A 2V7OA 3KF7A 4HW7A 3BE2A 1YXVA 2RF9A 4F0IA 2HZ4A 4BBMA 4USDA 3COKA 3QRUA 5L8KA 4O7LA 2Z7LA 1S9JA 4IE9A 4AG8A 5JGAA 1TQIA 2VTLA 4FK6A 4MD9E 5HBJA 3RKBA 4BTMA 4FSYA 3S1HA 4BL1A 4B99A 5IG1A 2ZV7A 2HIWA 3R1NA 4I41A 3DJ7A 1BLXA 4EZ7A 4L3LA 3RALA 3SD0A 3F2RA 3WF8A 3KRWA 4ACCA 1YWRA 4C35A 4A9TA 3EQDA 4U5JA 4E6CA 4W4WA 4F9CA 1UWJA 4U80A 1WBTA 4LQMA 5EDRA 1Y6BA 4DGMA 1W7HA 3QD3A 4NM7A 4FNYA 4IWDA 2XK4A 4QMSA 5KE0A 5ETAA 4EOOA 4X2GA 3TZ8A 4CMUA 3DLSA 1Q24A 2ACXA 4ALWA 2X9EA 3PPZA 3OW4A 4FV7A 4ANOA 3FL5A 2WMTA 3II5A 2C68A 3RM7A 2R7IA 3VVHA 1CMKE 2XEYA 4MNEA 3ZC6A 1YI6A 3HMMA 3ZEPA 5DR6A 1WBNA 4E5AX 2WTIA 2OIBA 2W1ZA 3ZUUA 4O83A 1OKZA 2BFXA 3F3TA 3ZLXA 3JR1A 3A7GA 2DYLA 5KMKA 3LFSA 3ENMA 4CKIA 2R3LA 3NNVA 4GT3A 3TJCA 4CT1A 4C0TA 4AA4A 3V5TA 1JWHA 3F88A 2UUEA 3VC4A 4AE6A 3KKVA 4C33A 2DUVA 4C4FA 1NA7A 3IONA 2PVNA 2QOLA 4IAZA 1SZMA 4WNPA 3ZRLA 4BYIA 5LOHA 3HYHA 4FF8A 5K9IA 4I6BA 5GNKA 2GSFA 4LM5A 2R3PA 3Q4CA 5F9EA 3GP0A 2GHMA 3Q9WA 3CS9A 3IG7A 4IAFA 3QF9A 4L00A 5HNBA 4GFOA 3HX4A 2YZLA 3QKKA 3PVWA 3SXFA 4CFVA 2KTYA 1PW2A 3BX5A 4F64A 2CNQA 5IA1A 4WNOA 4DT9A 5ANKA 3PSDA 4J52A 4U0IA 4BI0A 4FMQA 4X6QC 5CU3A 4EOLA 4FIJA 4EC8A 5JQ8A 2QOBA 2WQOA 4GMYA 4M66A 4I22A 4D0WA 4GT4A 5FP5A 1V0PA 3UIUA 4EWHA 2X4FA 1JOWB 4QMUA 3COIA 3C13A 3ENHA 4JBQA 4EOJA 1FMKA 3FKNA 3EN4A 4BWKA 3KXGA 4Z9LA 2OBJA 4O21A 4NTSA 4QYEA 4YTIA 4BDFA 4E7WA 4XV2A 4H58A 4YLLA 3ORMA 5FQDC 3CQEA 5BUJA 2WQNA 4J97A 3PY0A 4QMXA 5G1XA 4IZAA 3QRKA 4Q5EA 5E1SA 3VUIA 4BF2A 1MP8A 2VN9A 5BYYA 4O7TA 1YDTE 4OLIA 4IM3A 5E8WA 5IUIA 5J5TA 2BDFA 3ODZX 4L67A 4MK0A 3MB7A 4UWBA 5K3YA 4F9BA 4JIKA 1G5SA 1Q8WA 2IZRA 4A9SA 4KINA 2X7FA 3DBQA 3HDNA 5CQUA 3HV7A 3F5UA 5KZ0A 4APCA 4BDAA 4EH3A 2DS1A 3JPVA 2BIYA 4IAKA 3NSZA 4D0XA 3OWPA 3L9MA 4YLKA 3H4JA 2VAGA 3WF7A 5I3RA 3N4UA 2ZM3A 3MTFA 3OCSA 3UPXA 5LWMA 3BHUA 3ODYX 5FEEA 1GAGA 2VWUA 4FSRA 2XYNA 1BL6A 3GU7A 4OBPA 5H8GA 5HGIA 4EH8A 5JGBA 4RSSA 3F2AA 5AMNA 2C3LA 3L9LA 2C0TA 3GGFA 3DK6A 3QWJA 2VTJA 2XNNA 4PL5A 4RJ8A 4BCIA 2QOIA 3O0GA 4ITIA 3MH3A 3BQRA 5M55A 4DGLC 2R3RA 1M52A 5DRDA 3IW7A 4BZDA 3EQBA 2P33A 5EFQA 4DFYA 4NL0A 2ZB0A 4HCUA 4QYGA 3VS5A 2OZOA 4FEUA 5L2SA 4OT5A 3CTQA 3K2LA 4JT3A 4KAOA 2AC3A 4BKJA 2R3MA 5D11A 2OU7A 4PP7A 3EQCA 2BRMA 3SRVA 1H28A 4K18A 4B8LA 3SGCA 1H07A 4RIOA 5CLPA 4XG7A 4EONA 1A48A 5IQFA 4O6EA 4UV0A 4M7IA 2FUMA 1ZMUA 5ANOA 4FEWA 1U46A 3JXWA 5CXHA 5CEMA 5GZAA 3PXRA 3SLSA 3ROCA 4F6UA 5AAGA 1YQJA 4XOYA 3SC1A 1Z57A 3E63A 1F5QA 5CAQA 1WCCA 4NK9A 2WTJA 1PXPA 4MWHA 2V0DA 3LFFA 3LCOA 1V1KA 3DJ5A 4RFYA 3GU6A 5AM7A 3ZLSA 3D14A 4FTQA 5JH6A 5CVFA 1JAMA 2WMXA 5DA3A 2YAAA 4I5CA 4F7LA 4AZEA 3OUKA 3ZSIA 4B7TA 1H24A 1U4DA 2QLQA 3P1AA 3PWYA 4BCHA 3A4PA 4ZY5A 4V04A 4DT8A 3REPA 1OKYA 3OS3A 1VZOA 3ZDUA 4DAWA 4I0SA 3V5WA 2GDOA 3DAJA 3MW1A 2J7TA 2YM3A 2P0CA 3PUPA 4FKUA 3U9CA 2Y6OA 1XBBA 2J2IB 2OH4A 3W32A 5M07A 4CFFA 2VTAA 4O0WA 2JKQA 4FT5A 2R3QA 4AGDA 3EN7A 4JX3A 4ORKA 5DT0A 2JIUA 3G6GA 5FTOA 4F0GA 1CSNA 3NUAA 3SVVA 4QPMA 4EUTA 4CEGA 2A1AB 2QOQA 3TNPC 3MY5A 4HNIA 1I09A 2RG5A 2PVYA 1NY3A 2RKUA 2HELA 4XG9A 1ZXEA 4HGTA 2UZUE 2O3PA 3O23A 4G1WA 2X2KA 4O7VA 3HRBA 4W4VA 2OKRA 3VAPA 4CFWA 1URCA 2ITYA 4NIFA 3E8EA 5JFSA 4EHZA 2B52A 3CIKA 3PIXA 2XK6A 2Y4PA 4G2FA 2XJ2A 3LW0A 3P79A 3MPTA 4XBUA 2EXCX 3OF0A 5EQPA 2VTQA 2R3JA 5DHJA 1M7QA 2BMCA 3PXZA 4KS8A 2ITTA 5F4NA 3RM6A 3OEFX 4GKIA 3LQ5A 3V6RA 5HIBA 3ATSA 4RWIA 4R77A 4AGUA 3JYAA 3IDCA 2C47A 4YGAA 3GCVA 4P5QA 3UP7A 3ZLWA 1ZYDA 2VO0A 2HW7A 4RPVA 4ZTLA 3R0TA 3EMGA 4LG4A 5CTPA 3UQGA 2VX3A 3AGLA 2JAMA 3GNIB 3MN3A 3KXMA 3WILA 1J1BA 3C4FA 1DAYA 1JVPP 1XQZA 1HOWA 1TQPA 1H8FA 3W8QA 3CCNA 4CNHA 4QMNA 4IVCA 4TPTA 3G2FA 3LLTA 4FTRA 4QYYA 3DGKA 2CGUA 4G6OA 4HCTA 5E90A 3QTIA 3C0HA 4PX6A 4FV5A 4RG0A 3NWWA 4UALA 4OR5A 4TYEA 5FXSA 2CGXA 3VULA 2YM6A 3FL4A 1TKIA 3PYYA 1GIHA 3COHA 3RNIA 4AWIA 4KNBA 4C61A 2I0VA 1RJBA 2E9VA 3UNKA 3PSCA 2HZIA 4ZJVA 4O96A 4F1OA 4QP1A 3K3JA 1AGWA 3AQVA 5AP0A 2Z8CA 4IW0A 2B54A 3T3UA 1YDRE 4GG5A 2W99B 4C4EA 1L8TA 4ASZA 3UZTA 2IZSA 2PHKA 4CKJA 5IQHA 4FVQA 4GL9A 4F65A 1OBDA 5AV2A 4S34A 3WF5A 4CG8A 4O2PA 4FR4A 3O7LD 4AS0A 3EN5A 5AV4A 4CTCA 4USEA 4NFNA 4G3DA 3W18A 3OXTA 2JDTA 3RWQA 1QL6A 5L4QA 1IG1A 4JQ7A 3O8UA 4OT6A 2I1MA 5D10A 4EH4A 3ZFYA 3NVKI 1EH4A 1WBWA 5IU2A 3DA6A 3L8SA 4YPSA 1J7IA 4IFCA 1ATPE 4UMRA 4WIHA 3BU6A 2GU8A 4G31A 3Q5ZA 4DINA 4EH2A 4Y5HA 5H3QA 2UW8A 2WD1A 4D4YA 3MESA 2Y6MA 2JKOA 1W83A 1DS5A 2BDWA 2EB3A 4YHFA 1FBNA 3QCXA 5FXQA 2GTNA 3A8XA 1YI3A 4TYHA 4WNMA 2YCRA 3PTGA 4MD8E 4DYMA 4AP7A 3QUDA 2PZRA 2VX1A 4WO5A 1MRVA 5CI6A 5I0BA 3PXYA 1Q41A 2VNWA 4DG2E 5IQBA 1U54A 5IMXA 4KSQA 5C9CA 4AW1A 4Y85A 3ZU7A 4W4YA 4OTHA 3E3PA 3IO7A 5DH3A 4CZYB 4FC0A 4FVPA 5CYIA 4FEXA 1Q3DA 3R71A 3QUEA 1OI9A 5DEWA 3A7HA 2VV9A 4G5JA 1WVXA 1G8AA 2B0QA 2R3GA 5ANJA 4ZEGA 3KVWA 3LAUA 4JQEA 5HE2A 5DI1A 1XBAA 3NDMA 4P7EA 1VR2A 1BYGA 4CZUA 1ZOHA 3UGCA 4EKKA 2YDIA 2XKCA 4JXFA 3VHKA 4ZMFA 1ZRZA 2PZIA 4PQNA 2R9SA 3VUTA 4IC7A 3QC4A 3W2OA 3FZ1A 4M67A 3U6IA 3UZRA 3QBNA 4E73A 4UZHA 3UZPA 1WFCA 4MTAA 3BPRA 4JVGA 1J3HA 3I7BA 2PWLA 3EQHA 5I9YA 4V01A 2JKKA 3V51A 3TV7A 5T68A 4FOCA 5FP6A 2F9GA 3ERKA 4CD0A 4QYHA 2BZJA 5F20A 5EI2A 3QRTA 5L8LA 2PPQA 1KE8A 2OF4A 1MQ4A 3DK3A 4UX9A 1GOLA 2VZ6A 4DFUA 3D7TA 3MA3A 3QQLA 3DPKA 2GNHA 1L3RE 3ANRA 5IA0A 3RJCA 5AA9A 3E93A 2W1GA 4ZTNA 3PP0A 4QTEA 3IOPA 5M57A 1REKA 3DXNA 3ZO2A 3SW4A 4JAIA 3SXSA 4O7YA 1Y57A 1LR4A 4KBKA 5IA5A 3BHYA 5EOBA 1V0OA 3R8ZA 3CQUA 1ZYJA 3FQHA 4EOQA 5CEKA 5KHWA 2XJ0A 2XP2A 3MY0A 4EOIA 2GQSA 4U9AA 4MYGA 3V8SA 3MDYA 2H34A 3VIDA 2BDJA 4DF3A 4USFA 3ZFMA 4MF1A 4R8QA 2UZOA 4O6LA 2ZDUA 4S31A 3I5ZA 4EBVA 1M2PA 5D12A 3HGKA 2O64A 4JBVA 4NT4A 4FEQA 4RGJA 3D5UA 4U45A 5TT7A 5EM8A 3ZO1A 5IH6A 4XCUA 5M06A 1OMWA 1O6YA 3RK5A 3MVJA 5CENA 2Y8OA 1TVOA 2VWVA 4JDJA 2RFDA 3R8VA 2XA4A 1WZYA 2QHNA 4QMPA 5CNOA 4ZOGA 4AZTA 2OLCA 2VTHA 4NKAA 2VX0A
chains in the Genus database with same CATH superfamily
4ASDA 3RGFA 2VD5A 3NW6A 1QPDA 2OIDA 3R01A 5IKWA 4X3JA 3H9FA 2ZMDA 2V22A 2VTRA 1NT2A 4FI1A 4FUYA 3FXXA 4GT5A 5EKOA 1UKHA 2GCDA 3OCBA 4YJOA 4LRKA 3DKCA 1ST0A 3TCPA 1KWPA 3BHTA 1BUHA 2UVXA 1KE5A 3SX9A 3KA0A 5D7AA 4FSUA 2H96A 4L52A 4MEDA 5J95A 3RMFA 3I79A 3ZRMA 4D28A 4IH8A 2JKMA 3E7OA 4AXAA 4I4EA 3A7FA 3VS6A 1J7UA 4XLVA 1Q3WA 2GNGA 4CZTA 4O81A 3F69A 3R21A 1H1RA 2OH0E 3UODA 3FUPA 3UOLA 3O2MA 2HAKA 1P5EA 2EU9A 3TZMA 4RA4A 3TEIA 2Z7QA 3IW8A 3ZOSA 3CJFA 4XX9A 3CQWA 5IH4A 3NEWA 3TT0A 3EH9A 4EH6A 1YVJA 4RLLA 3P7AA 4IAAA 2C6KA 2BRNA 3DTWA 2Z2WA 5ICPA 1H0VA 1OZ1A 3CLYA 4E93A 3WE4A 3BQCA 3UOJA 1P4OA 3H30A 4W8DA 4DLIA 4F7NA 3FAAA 5AADA 4QP2A 2IWIA 4UWCA 1YWNA 4MVFA 3RCJA 5CAVA 3HRFA 5IUGA 5JMSA 2W4JA 4K1BA 1FINA 5HBEA 2XJ1A 4L53A 2YITA 4AA5A 3UG1A 3UO6A 1Y6AA 3KEXA 3VHEA 1FQ1B 3OTUA 4ZY6A 2W17A 2X7OA 2PVKA 5CS6A 2XK7A 2JITA 5CVHA 3OCTA 3QYZA 4AE9A 2W1DA 3TV6A 5K5NA 1K2PA 3Q60A 4QMMA 5LVLA 5DOSA 5E1EA 4CFMA 4D9UA 2ZYBA 4IDTA 3WYXA 3RNYA 3KREA 4DBXA 5AUZA 3ZO4A 3O17A 3DKOA 4GJ2A 4ONAA 4RX9A 4ALUA 3HKOA 2A0CX 3Q2JA 3VUMA 2ZV8A 3VJNA 3LE6A 2DWBA 4DEEA 4DFLA 3R28A 4H05A 2GHLA 4E4NA 2Z02A 4YURA 3ORXA 4NCTC 3UNJA 3E8CA 3KVXA 2ITPA 1KE9A 3C4CA 3NUUA 4XG8A 3DJ6A 4OTDA 5AUVA 4BCNA 5FXRA 5BVOA 4G6NA 2OJGA 5C8NA 1PXKA 4YZ9A 1SVHA 5DR9A 1UU8A 4FKOA 5CSWA 5FWKK 4E4XA 3QX2A 4RC2A 4KIKA 4RQVA 3VS1A 4L6QA 1ZYLA 3NCZA 4IX4A 2XK3A 3PP1A 4QQJA 2PVFA 3NX8A 2W96B 4FSZA 4WG5A 4YJPA 2NP8A 2UZWE 4WSYA 4CRSA 4FZAB 2I40A 1CKJA 3MB6A 2JLDA 4UMUA 4JIAA 4FKVA 4NYEA 2PUNA 3EZRA 1ZZLA 4PTGA 3VBWA 3TUBA 4O0RA 5I9UA 4BIEA 1W8CA 4RVLA 1KE6A 4N4SA 5A46A 2ZM4A 3ZM9A 4Y46A 5JQ5A 4GS6A 5LMKC 4ZS4A 4LFIA 1FGKA 3R2BA 4G9RA 5J7HA 4TWPA 5B0XA 2SRCA 4OGRA 4BB4A 5BMMA 1GIIA 1DI9A 2WO6A 3L8VA 4FTTA 4BDIA 3NLBA 4FSMA 1R0PA 2W7XA 4FSWA 5H9BA 4AW5A 5LXMA 3H3CA 5HICA 4DFXE 4I6LA 4HZRA 3MFSA 4BCMA 3DB6A 5DT3A 3MYGA 2VWBA 4KSPA 1OL5A 5GHVA 4CCUA 4EBWA 5E8SA 3QGYA 1QMZA 3ZYAA 5I9XA 5LVOA 2RFSA 1GZ8A 4ZZOA 2GHGA 1UWHA 3GU8A 3TNQB 3RAKA 3UPZA 4WG4A 2WMWA 3AG9A 3Q5IA 2YIXA 1JLUE 1WBOA 5GINE 4LI5A 5AX3A 5BVDA 5T6KA 5HG5A 3E7VA 4M14A 3DBDA 4FKPA 4RWJA 3C4ZA 5D9HA 3PXFA 1PXMA 3TN8A 2UZLA 2ITVA 1FPUA 3W10A 4LGGA 4MD7E 2IVUA 4DEGA 4MX9A 4EK6A 4FKIA 2QONA 3S4QA 1BI7A 4YP8A 3PIYA 1VYWA 4XV3A 5EOLA 5AV0A 4EH9A 3C5IA 3FLSA 2WQEA 4Z55A 4C59A 4IFGA 4QP9A 5DIAA 2CLQA 5EDPA 1OGYA 2OFUA 4R1YA 4JOAA 2CKPA 3HECA 3TYKA 3F66A 3WYYA 2LAVA 2BALA 3HV3A 2C5VA 3AT2A 1R78A 3FMMA 3IW6A 3PRIA 1ERKA 4J8MA 4YSMA 4D2VA 4D2PA 5CXZA 5KMMA 4O7NA 3FSFA 2WMVA 1TQMA 2PSQA 2QU5A 4G17A 4NH1A 4B4LA 4O7RA 2HENA 2OF2A 4MF0A 4U3YA 3I0OA 5CF8A 3BHHA 4CVAA 2DQ7X 5LARA 1PMUA 3I60A 2PMLX 4D2TA 4H1MA 5I5ZA 1Z9XA 3UTOA 4IVDA 3PJ2A 4HGLA 4YHTA 5C4KA 3DDPA 3KULB 3FYJX 3BKBA 3RWPA 4GFMA 1OL2A 3GC8A 4A9RA 4C4HA 4MXCA 3FLNC 4PDSA 5TF9A 1G8KA 4OTRA 4AX8A 2PL0A 4XRLA 5LVMA 2ZOQA 4U43A 3UOKA 3FHRA 3ZDIA 2W5BA 3R7UA 1WVYA 2XMYA 4X21A 4NWMA 4ZSJA 2J51A 3EQFA 5IQGA 2UZTA 2XM9A 3R30A 4EEVA 2PUPA 3H9OA 4IAYA 5AR4A 2GS7A 3QLFA 2PK9A 1Q5KA 4AOIA 4ENXA 3HAMA 3QD2B 4GVAA 4C4JA 4FJVA 2ZJWA 5BVFA 5JSMA 5M09A 4FNWA 3Q4ZA 2WNTA 3LFEA 2BTSA 5HU9A 3MTLA 1O6KA 2PY3A 3QALE 2QI8A 4N6ZA 4ZZNA 3BWJA 3EN9A 5HI2A 3DBEA 4N0SA 3AC2A 4CFXA 4DH1A 4DITA 1NVSA 4AAYA 3KMUA 3KL8A 4FTIA 2UW6A 3KFAA 3QXOA 1WVWA 4R78A 3BU3A 4YZMA 2CN8A 1OUYA 3H0ZA 5I3OA 2R4BA 3VBVA 5EYDA 5KMLA 3LXKA 2WU6A 3DXPA 4JI9A 3ALOA 4IM2A 3RVGA 4C38A 4KKEA 3UIMA 5TR6A 2NO3A 3U6HA 3DNDA 4EK5A 2X8DA 3R83A 3S3IA 4FICA 5CEQA 3BYVA 1W84A 3CGOA 5IA4A 3PG3A 4IXPA 4RVTA 5L2WA 4DHIB 5HX8A 4HVIA 3NUYA 2YIRA 4IVBA 5G6VA 3UVPA 5AV1A 1H1SA 4RIYA 1XBCA 3F61A 4YJTA 2UW0A 1IA9A 4DN5A 2PVHA 4D1SA 5E9EA 3P7BA 3LQ3A 4XLIA 3MWUA 4RWKA 3POZA 4XH6A 4DEAA 4I94A 4EK3A 3OHTA 2E9PA 4IWPA 4RIXA 3EWHA 4ACMA 5E8TA 3D94A 4FIHA 4I23A 4TWCA 4BCPA 3BLRA 3QZGA 4WRSA 4GCJA 1XHAA 4DGGA 4IZ5A 3TACA 2W1EA 3Q32A 5C01A 4W9WA 1QPCA 2YERA 3WF9A 3W0PA 1Y8YA 1OVEA 4MNEB 3A2CA 5A4LA 4FTAA 4NJ3A 5DG5A 3W2PA 4PMPA 4FL3A 5EHYA 3PJCA 3LXNA 4NW6A 1V0BA 3FMEA 4O22A 3COMA 2XNOA 4FV9A 5LCKA 1OL6A 4MKCA 4BC6A 4FSTA 3FI2A 2H6DA 3D15A 3K5UA 4QMYA 4FV0A 4RIWA 3D2KA 2XIZA 4DTKA 1XH4A 4BCJA 2C1BA 3TJDA 4OAVB 1NVRA 4EUUA 2I7QA 4YTFA 3LFNA 4N57A 1SVGA 3AC1A 5T3QA 1YXUA 4JS8A 4OTPA 3AMAA 4RJ5A 2BAKA 3LCDA 3PY3A 3Q52A 3NUNA 1QPJA 4KB8A 1PXJA 4I6QA 2XKFA 1NVQA 4ENYA 2OW3A 5AUWA 5JFXA 3SXRA 5KCVA 2B9FA 5AEPA 4TWOA 5JFVA 3SW7A 3L9NA 1H1PA 2UZEA 4NUSA 2BILB 3U4UA 4WBOA 4KBCA 5HVJA 2BHHA 2J0JA 4N6YA 4FUXA 3CXWA 4NTTA 3W8LA 4EORA 4BN1A 2R3OA 1H1QA 4FE2A 4I0TA 3BYMA 2VWZA 5AR8A 4ZTQA 2PZ5A 3TKHA 2A4LA 4M15A 4APPA 5EHLA 4BDEA 1OITA 3ATTA 3HAVA 3OC1A 1IA8A 3Q3BA 3PRFA 2XF0A 3S2PA 2PVLA 4WKQA 5DEYA 3BBWA 4DCEA 4BGGA 4Q9ZA 5DYJA 4YU2A 1WMKA 4L42A 2Z7SA 4F09A 4J71A 4BKYA 1A9UA 3EFLA 2AQXA 2AUHA 4YNEA 5FBOA 2P4IA 2OXXA 5DNRA 1CTPE 3AC4A 2WPAA 3ID6C 3EKNA 3PA4A 4FL1A 3JY0A 2H9VA 2ZM1A 3O7LB 3EJ1A 3R00A 5IQCA 2LGCA 2PE2A 2BFYA 5ANGA 3GCSA 4X0MA 4M3QA 4QP8A 1IEPA 5GJFA 3E62A 4CT2A 4ITJA 2PULA 3FMLA 4AZVA 1Y8GA 4E6QA 3RK7A 2QNJA 4C3FA 2ITQA 5AUXA 5AUTA 3BLAA 4XG4A 4M69B 3P78A 1P4FA 3U4WA 1B39A 2UW7A 3D0EA 3CY2A 2C30A 2NRYA 4EOPA 5AX9A 2UW3A 4X2FA 2OK1A 4PTEA 4IZ7A 3CTHA 3QKLA 3OCGA 2JIIA 5KX8A 3DDQA 4XBRA 5EYKA 5C8KA 4DEBA 5J87A 4QNYA 3F2NA 3BYUA 3TNWA 3OFMA 4C34A 3AC8A 2XBAA 4OAUC 4RX8A 5JZNA 3V5PA 5A4CA 4C2VA 5C27A 1IAJA 1PMVA 4MQ2A 4B8MA 5F1ZA 3SKCA 3F9NA 3V01A 3PLAE 1DM2A 2X2MA 3F7WA 4O1OA 4YO6A 1OECA 4E5WA 4L01A 1CDKA 5IH5A 5M44A 4GFGA 3UDBA 3IECA 4EK8A 3IW4A 2X39A 4II5A 5FBNC 2WTKB 3FZSA 5E8XA 3ORLA 3NYOA 3T9IA 4BICA 3GBZA 2B1PA 3L8PA 4Y8DA 2BRBA 2WGJA 4KIQA 3QU0A 2X6EA 5HD4A 2VWYA 4XP3A 5CU6A 3ORKA 4V0GA 3FLWA 4DG3E 5CEOA 4XG2A 4ANQA 3QTWA 5AP6A 2BCJA 3JVRA 3RHKA 4D2WA 4IACA 3VNTA 3V5QA 1PF8A 1PHKA 2A27A 2FYSA 5EW8A 4BCQA 4FKGA 4E1ZA 2YJSA 4F08A 4X2NA 4EH7A 1SMHA 4R1VA 3NVMB 4PMTA 2V62A 1JKKA 2BUJA 4JR3A 4C02A 4JJRA 4MBIA 3HRCA 4KIOA 3W0RA 3Q4TA 4Y95A 4BBEA 4R7HA 2CNVA 2W1CA 1Q97A 3ALNA 4ZAUA 4CV8A 2V5QA 3N9XA 2C0IA 5IEYA 2W5HA 3PVUA 2RG6A 4IMYA 4M69A 3ZC5A 3CPCA 1OIUA 4CFNA 4Y5QA 3R63A 4S30A 2YWVA 2OJ9A 2HOGA 4X3FA 5CY3A 3VBXA 1H0WA 4U42A 5HG8A 3I6UA 5ACKA 3NUXA 3P08A 5B2LA 5DGZA 3HUBA 3E64A 3TZ9A 4AXCA 1HCKA 3IGGA 4S33A 3KQ7A 2XBJA 4I1ZA 5L6WL 2WTDA 3ZFXA 5TKDA 4UXLA 3R1YA 2OXYA 2ZDTA 2VTNA 2XIXA 3QTSA 4FKJA 4GRBA 3QZHA 2XAOA 4IX5A 1CM8A 2F2UA 4AN3A 3LFQA 1ZY5A 4C37A 1E9HA 2GTMA 4CTBA 1Q8YA 4D58A 4BCKA 4U81A 3UDTA 3MVHA 4I5PA 2WAJA 3VQHA 5BMSA 3E8NA 3BYOA 2YIQA 2YM5A 2XZSA 3GQIA 4FX3A 4NM0A 4YBJA 5AP5A 5AR5A 3F5PA 4TL0A 4C58A 1OPKA 4FGRA 2PZYA 3IPHA 3PPKA 1HCLA 2BROA 4CLIA 1M17A 3I0QA 3D7TB 4IDVA 4X3FB 4O0TA 3AC3A 3Q9XA 1F3MC 4CQGA 2HY0A 1KOAA 4FSQA 4RJ6A 2XCKA 3EZVA 3VUHA 5EDQA 4FTKA 4QQTA 5A9UA 1YHVA 3BL7A 4IX6A 5JRQA 4E8AA 2XRUA 4EOSA 5B7VA 4ZK5A 2JIVA 3F6XA 4GU9A 1Z5MA 2VUWA 5J9YA 1YXXA 3EYGA 3ELJA 4FKLA 4J98A 3W2CA 3DZOA 3PWDA 4XG3A 1Y91A 4AN2A 4QMQA 5HTCA 1SYKA 4B6LA 3LJ2A 1W82A 4G3FA 5HCZA 3WARA 4RA5A 4K33A 3IDBA 3VF8A 3ZH8A 2OICA 3KMMA 2YDKA 4EC9A 4AGCA 3NFGB 4FV1A 2XH5A 4FL2A 3NCGA 4CLJA 4XMOA 3MFTA 2J6MA 2E2BA 3ZSGA 4R7BA 5HBHA 2QR8A 3DT1A 4MXAA 4G5PA 5FRIA 3O50A 4ANBA 4G3CA 3DAKA 3C51A 4NCTA 2PVMA 5BX0A 2O0UA 3RP9A 3SG9A 2OJFE 1FMOE 2F49A 3QYWA 4DH8A 5IQEA 3LQ8A 2W1FA 1H25A 1KV1A 4W9XA 3FI3A 2BRHA 2XK9A 3C0GA 3HA8A 2Y9QA 4FIEA 3HLLA 4RJ7A 4U8ZA 4M13A 3TUDA 5CI7A 2Y7JA 4FG8A 2RL5A 4FIFA 4UY9A 3TM0A 4J95A 2GNJA 5FUTA 4FZDB 2QVSE 2UVZA 4MUQA 5M08A 5E8YA 4CYIA 2XEZA 4QP4A 2AYPA 2PYWA 3EQIA 4JBPA 2G9XA 1RQQA 2YZAA 4EHEA 3ZMMA 5A4EA 2UVYA 2R3NA 2O5KA 3CGFA 4WHZA 4M0YA 5A4TA 3R8PA 3AD6A 4TXCA 3BELA 4R6VA 4BGQA 5AP1A 4I6FA 4GU6A 4ZTSA 2GMXA 4DFBA 4AOJA 3P23A 3CJGA 3EFKA 4CGAA 5HE1A 2F7XE 5IPJA 5ITAA 4H3PA 2IN6A 4Q2AA 1UU7A 3ACKA 3DLZA 2YIYA 4XRJA 3SOCA 3V04A 3TDWA 3EL8A 5GIPE 4K11A 2XCHA 4KBAA 4O0UA 3KF4A 2ZMCA 3R8LA 3FMJA 4I3ZA 4QT1A 3QTXA 4D5HA 3PY1A 2IW6A 5DBXA 2YLEA 4D4VA 2G2FA 5A54A 3P5JC 5B2MA 2BHEA 2IVTA 4RBLA 3UVRA 4ZP5A 4MCVA 2Y4IB 5FDXA 3LM0A 5HCYA 4AGWA 3ZSHA 3BI6A 3MFRA 5AR2A 4TN6A 2CDZA 5J9ZA 4ZTHA 4E20A 3AKJA 4FODA 2PVJA 1UNLA 3O8PA 3FPQA 5L6PA 2WQBA 1JKLA 3UVQA 1XMLA 4FV4A 4J8NA 2CPKE 4HPTE 4XOZA 4O4FA 1PYXA 4OTWA 5EH0A 5HVYA 5LVNA 4LRMA 2WEVA 4C4GA 2CNUA 4XYFA 2BPMA 4Q9SA 4R5SA 3ANQA 1X8BA 4E4LA 1SVEA 5EK7A 4E6DA 3LJ0A 5HTBA 1OL1A 3OMVA 4OTGA 4MXZA 5IMEA 5CQWA 4EOMA 5CAUA 1U5QA 1PKDA 5EYMA 1STCE 5C8MA 4QPAA 4JMQA 4FA2A 1T46A 5HNIX 4J96A 4BDJA 4UMPA 4TNBA 3LFAA 4DH5A 2C3IB 2RFNA 4R3RA 4ASEA 4TYIA 5KKRB 2FA2A 5J5SA 3VUKA 4L68A 1BMKA 2XARA 3FKLA 3KY2A 2X81A 3KN5A 4RRVA 2OWBA 4X2JA 3LCKA 4O4EA 3WIGA 4O82A 5LMBA 2VGPA 4BDDA 3PVBA 3DKFA 3JY9A 4AT3A 5CSXA 3DQWA 3OROA 4PWNA 1KE7A 3OWLA 1H01A 3LOKA 3PLSA 3LFBA 3HDMA 4ZSLA 3PJ3A 2OFVA 3FQSA 3Q9YA 4PF4A 2HK5A 3BGZA 3R8UA 3C0IA 5JRSA 5A4QA 5HLWA 5HG9A 3LPBA 1Q8UA 2OIQA 4M97A 5HCXA 4IWQA 1H00A 4F70A 2BTRA 3BEGA 4AZFA 4Z7HA 3C50A 2ITOA 4ACGA 2NNWB 4QTBA 2PE0A 1FVRA 3KRRA 4D1ZA 2QCSA 3QLGA 1OKVA 2QG5A 5GZ8A 3DBCA 3Q96A 2QKWB 1OUKA 4JG7A 4P5ZA 5E8UA 3ZO3A 2JAVA 3GB2A 3FC2A 3D5WA 4WSQA 4YTCA 3FHIA 2G01A 3EB0A 1YWVA 5CZHA 3VO3A 4KIPA 5E92A 2QHMA 3LMIA 4G3EA 3MGYA 3ACJA 3M42A 3QZIA 5GJGA 2WHBA 2WKMA 3GEQA 2ERKA 2OGVA 3MIAA 3TV4A 4QTAA 1VEBA 5JN2A 3QTUA 1YXTA 1RE8A 2R3KA 3KK9A 4DA5A 4BTJA 4AT5A 4BDGA 1OIYA 4FZFB 4XG6A 2CKQA 1XO2B 2UW4A 2WQMA 5JZJA 4KRDA 3OBGA 5ANIA 4U79A 5AJQA 2WU7A 2JBPA 1ZARA 3R7IA 3RINA 4ZSAA 3TI1A 2WTWA 4QNAA 1OPLA 1WBVA 3MS9A 2RSVA 4FT0A 5L6OA 5C1QB 5BYLA 4WNKA 2V7AA 4G9CA 2CMWA 3PA3A 3QXPA 4KD1A 5AUUA 5KMIA 4RIWB 3F5XA 3JVSA 4PNIA 3VF9A 4F9YA 3I6WA 3FQEA 4BIDA 4FEVA 4O7SA 5LQFA 3QWKA 5HG7A 2VTMA 4FNZA 5IQIA 3SAYA 3R2YA 1GIJA 3R7VA 1TFFA 3R1QA 4ANSA 2WEIA 3OOGA 4AU8A 5KMJA 2AEGA 2QR7A 3HA6A 4HGSA 2ZVAA 1PJKA 4Z3VA 3QRIA 3L1SA 3ZONA 2JDOA 5CAOA 4Z16A 2QURA 1UU9A 3R04A 4H3QA 4AW2A 4CQEA 4EQMA 1UV5A 3U6JA 1J7LA 3G0FA 3QQKA 2QO9A 4YJSA 3KULA 2XNEA 3BIZA 2OSCA 3SV0A 2ETRA 5IDPA 3AOXA 4O0XA 3UNZA 3DY7A 3H0YA 4M8TA 3DQXA 2YA9A 4BTFA 2XRWA 4GK3A 5JK3A 3ZRKA 1E1XA 1M2RA 5K0KA 3UJGA 3C7QA 5HNGA 3DOGA 5CT0A 2XNPA 3FZRA 3RI1A 5FLFA 4TNDA 2GNIA 4HYHA 1IASA 2JDRA 3QTZA 4LMNA 3E5AA 3UG2A 3G5DA 4C36A 3U55A 4O4CA 2JGZA 3VBTA 3R6XA 5DMZA 4LGHA 4RT7A 2W4KA 5IA3A 3SOAA 3A99A 3MVMA 3QHWA 4HJOA 2C5YA 2VTPA 3NW7A 2HWOA 5IA2A 1ZAOA 4PDOA 2YM7A 2XAMA 2XIKA 2QLUA 3ZM4A 2JDVA 1UU3A 4ZMEA 4IWOA 1YOJA 5IQAA 4FT3A 2X8IA 4MQ1A 1LP4A 4L44A 4LGDA 5E4HA 4YJRA 2R3IA 3FPMA 3Q2MA 5L2IA 4BJJB 1LEWA 2UZBA 2EXEA 4MXXA 3WOWA 3PSBA 2ZB1A 4A9UA 2VGOA 5K5XA 2C1AA 3GCPA 3HZTA 4LOQA 3S00A 4Z7GA 4IM0A 4FKRA 4KA3A 3IW5A 2YWPA 2IF8A 3FEGA 3MPAA 3CBLA 5HLPA 2BKKA 3OY3A 4MXOA 4HYIA 4NSTA 4QTCA 4DEIA 1O6LA 4WOVA 3ZBXA 3MI9A 2OXDA 3MBLA 3MIYA 4FKQA 3A4OX 4I92A 4P90A 4TTHB 3BU5A 3PXQA 4FG9A 3R9HA 4DE4A 5AP7A 1GJOA 2I0HA 2RFEA 1FGIA 3G51A 3OXZA 3QX4A 4TY1A 3GOKA 1M2QA 3F3ZA 3G9NA 3NR9A 5AAFA 4ZTRA 2BZIB 4RJ3A 3UOHA 4FIGA 2VTOA 4LL5A 4JX7A 3MPMA 2C6IA 1CKPA 4PTCA 3A62A 3QTQA 1ZZ2A 5A6NA 3WIKA 3ET7A 4CSVA 4L3JA 4ZY4A 4YUQA 3OZ6A 4QMLA 1UNHA 5HOAA 2WZJA 5KHXA 1Q61A 4I5MA 4EZ5A 5HO7A 2WIPA 3JS2A 4LUEA 1KSWA 2CKEA 4ZLZA 3VONA 4ERKA 3G0EA 5CT7A 4A4LA 4R7IA 2G2HA 1UA2A 3UYSA 3CD8A 4D1XA 4KABA 3OBJA 2UW5A 2VWXA 3CKWA 3G90X 4MXYA 5M4CA 4JG6A 5FG8A 5CF5A 4FTNA 2WTCA 1NW1A 4MNFA 5KBQA 3CSVA 5EI8A 5BQ0A 2R64A 3HV4A 3QAME 3P86A 4BHZA 4PPAA 5EQEA 4ARKA 5AP3A 5CF4A 3GCUA 4GYGA 1RDQE 3C4EA 5KMNA 4EQCA 4BKZA 2XB7A 3W0OA 1YXSA 1YHSA 4HZSA 1G3NA 1MQBA 2HWPA 2R3HA 4HVGA 2WB8A 3BRBA 4O4DA 2ESMA 3OOMA 3UYTA 5DPVA 4RZWA 4LV5A 4F6SA 4L43A 4EYMA 5EM6A 1WBPA 4J1RA 2B7AA 2YABA 4GK2A 3TIZA 3ZS5A 5HVKA 5IUHA 3ML1A 4O86A 2BKZA 4UYNA 3GCQA 2XNMA 4OW8A 3EQRA 3FXWA 3P9JA 1B38A 3OUNB 3RAHA 4ZLYA 2X1NA 1H1WA 1R39A 3QC9A 1OL7A 3BV3A 3V5JA 2CGVA 2FH9A 3PG1A 2EXMA 4RC3A 4L45A 2UV2A 5CU0A 5ETCA 4M0ZA 5AAEA 1J1CA 4YZDA 3LVPA 2OO8X 4PL3A 5FTGA 3ZUVA 4RX7A 4BDHA 3FMKA 3NFFB 4IC8A 4WUAA 3B8RA 3D5XA 2C6MA 3IK3A 4W8EA 1UNGA 4LMUA 3FSKA 3NIZA 4FT9A 5DR2A 4EKLA 4PDYA 2X2LA 4WA9A 3BYSA 5EKNA 4IB3A 5EM5A 3OD6X 4NU1A 2VWWA 1OB3A 2B55A 3AMYA 4IANA 4FTCA 1MRYA 4RQKA 4K9YA 1Q62A 5CAPA 5AIRA 3LMHA 3OWJA 1K9AA 2X8EA 3OW3A 4RLKA 2BRGA 3LIJA 2W9FB 3CE3A 2YCSA 5KNJA 2ETKA 2J0IA 1OBGA 3RZFA 5CEPA 4W4XA 4IJ9A 5HE0A 5TOZA 4DTAA 3F7ZA 3DBFA 2IG7A 3HMIA 3R9OA 3E3BX 5FDPA 4YC6A 3HMOA 2C0OA 1YOMA 4LRJA 4YZCA 4IAIA 1Q99A 2HXQA 4PUZA 5L8JA 3W2SA 4CMOA 5BPYA 5CWZA 1VYZA 4PMSA 4QD6A 4AQCA 3CD3A 1PMNA 3RPVA 5KMOA 1A06A 5EYCA 3V3VA 2ONLA 2JD5A 1I44A 4BI2A 4IEBA 4XP2A 3P7CA 4S2ZA 4CV9A 4XS2A 4L3PA 4YBKA 3OY1A 3PA5A 3B2WA 3PJ8A 4PP9A 3C1XA 2G1TA 5CNNA 4CRLA 5L3AA 4QMVA 4DGOA 1S9IA 4HPUE 1PRYA 3RPSA 4BDBA 5AUYA 4FZ6A 3TXOA 4F4PA 4J99A 1APME 4BCGA 3A8WA 1GZOA 4YJUA 4GV1A 3VRZA 5J9LA 4AZSA 1OGUA 4TWNA 2WXVA 4ZS0A 1MUOA 3NW5A 2VTIA 3HV6A 3FBVA 1BX6A 4L46A 2YDJA 4JDKA 3L9PA 3TTJA 3QZFA 3B2TA 3L8XA 1GNGA 3QUPA 4XHKB 3CY3A 1PXOA 2FSTX 2HW6A 2WMQA 3T8OA 4U41A 4QRCA 2C6DA 4JG8A 1BL7A 4RIXB 1YI4A 4NM5A 1FOTA 2J5FA 2X7GA 3NNUA 3GUBA 4FGBA 4O2ZA 5CALA 4JDHA 2J0KA 5DRBA 4G3GA 4L9IA 1PXNA 4U97A 3EHAA 4FG7A 5HD7A 3R22A 4R3PA 3A61A 4YR8A 1AQ1A 3VS7A 5HQ0A 2B9HA 3MY1A 4UWYA 4NEUA 3OP5A 1PYEA 3KRLA 3ZLYA 2OI4X 1OIRA 1XH9A 1R1WA 4QMWA 4YLJA 3R8MA 4CCBA 1XH8A 1JNKA 3G6HA 3IOKA 5E8ZA 5IF1A 3AC5A 4QP3A 3V8TA 4QEBA 3H10A 3W33A 4QQ5A 3AT3A 4X6RA 3QKMA 2XUUA 1PY5A 3HV5A 5I9VA 1ST4A 3RHXA 4F7SA 5M4FA 3ETAA 3G9LX 3MJ2A 4FYOA 2JFLA 4FZ7A 5IZFA 3UO4A 4BI1A 2KULA 2P2IA 3DFAA 3PUFC 3O51A 2QO7A 1LUFA 3E8DA 3FMNA 3THBA 4BVUA 2BAQA 3ROYA 5CASA 2C6EA 3H9RA 2B9IA 2VO7A 2R2PA 3MH0A 3CTJA 3NIEA 4LDTA 3UIXA 1E1VA 2WMRA 4K8AA 2XKEA 4XUFA 2O8YA 2C6OA 1YDSE 2QOCA 4UXQA 4KIKB 4BTKA 3CP9A 2PU8A 4I4FA 1M14A 4R3CA 3W2QA 3ORPA 3WI6A 4D4SA 1OKWA 4GK4A 3U8WA 4DLJA 5ETFA 2HXLA 4FTLA 4EZ3A 2EVAA 4OTFA 3WE8A 5KBRA 3AD5A 4CMTA 5IISA 1U59A 3NMUF 5GJD