2YN8A

Ephb4 kinase domain inhibitor complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
281
structure length
253
Chain Sequence
b'KEIDVSYVKIEEVIGAGEFGEVCRGRLKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQIVSALDKMIRNPASLKIVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Stability and Solubility Engineering of the Ephb4 Tyrosine Kinase Catalytic Domain Using a Rationally Designed Synthetic Library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 253
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yn8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yn8A01
1OKVA 4HGTA 3E8NA 3QTIA 4G6NA 2CLXA 2WEVA 4BZOA 5JEBA 3CGFA 3T9IA 2WMRA 3OC1A 3TNWA 5AAEA 3GBZA 1F5QA 2C0TA 1GZKA 3S4QA 3TNIA 3ZLSA 1VZOA 4O0YA 5AM7A 2VO0A 4DT8A 3TV7A 5A4LA 5L2WA 3DU8A 4LL0A 3ZZEA 2GS2A 3TNQB 1QMZA 3D7TB 5T6KA 3DKCA 2YZLA 4A9YA 4NW6A 5DEWA 4RVMA 1NXKA 5CSWA 4S31A 5AUXA 3VBYA 4UXLA 4IM3A 2W05A 4EKKA 3I81A 3FAAA 3R7YA 4XYFA 3E3PA 4IAIA 4UWCA 2WFYA 4EJNA 3LOKA 4CKRA 2X81A 2IO6A 3ORNA 4BTKA 2YCSA 5CSXA 2W9ZB 2BMCA 2W99B 3MFUA 2WMAA 5EOBA 4BHNA 5CNOA 3MH2A 5ANOA 2VTPA 4YJTA 2X4FA 3FE3A 1H25A 1B38A 4MD9E 5JRQA 1VEBA 4NW5A 1OL1A 1ZYDA 2J4ZA 1J7UA 3FMNA 5EW8A 4QMXA 1YXVA 5CVGA 4MF1A 4AGUA 4O7TA 3OS3A 4IHPA 3AMBA 3W33A 4O0RA 5FWKK 2WOTA 3BGPA 5HESA 2Y9QA 2ZM1A 3VBVA 3QLFA 4GCJA 4Q9ZA 2QOLA 1M2RA 3LIJA 3OUNB 4KIOA 4L9IA 4M3QA 4J96A 4XCUA 4UMPA 4TL0A 3EZRA 3HUBA 4QP3A 3LM0A 3M42A 2XBAA 4J99A 5FBNC 2HXLA 3ZFXA 3TG1A 4TKSA 4XP3A 5AUYA 3P23A 5KHWA 2YHVA 1PXPA 4ZTLA 4I21A 3V51A 1REJA 1YHWA 4CLIA 3KXMA 2GMXA 1UU8A 4TN6A 3CTJA 4AG8A 2C3IB 4XV3A 1SVGA 4HNFA 2I0HA 4XG8A 1XQZA 1ZAOA 2C1AA 5F20A 5GZ9A 2A1AB 2XJ2A 3M1SA 3O0GA 3EN7A 2ITYA 2OF2A 5AR5A 3A8XA 3ORIA 2QU5A 4IWDA 2W5HA 2C6EA 4AE6A 3Q9YA 4AGCA 4HVSA 3DCVA 4FEVA 3PZHA 4EBVA 3FLNC 3DBEA 4JS8A 4BIEA 4EH2A 2QOFA 3R71A 4F08A 2EU9A 3E64A 3NYXA 3Q6WA 4DH1A 4MYGA 4MX9A 1M2QA 4RX7A 2OZAB 3PP0A 3EYHA 1BKXA 3DJ5A 4MXCA 4BF2A 5I9WA 5KE0A 5DR9A 2F57A 4JBPA 4DHFA 4DC2A 3LCSA 5CXHA 3WZEA 2PVRA 2X9FA 4HPTE 4AU8A 4E6CA 3BYMA 4GV1A 4ACHA 3QTQA 4B9DA 3HX4A 4ZJJA 4C58A 5KMNA 3AOXA 3V6RA 3T3VA 2UZUE 3KVWA 4M0YA 4LUEA 4O7RA 4TWOA 2OFVA 3WIKA 4QP1A 4JBQA 3GC7A 4Y72A 3VO3A 4IB0A 2CHLA 3G15A 4YSMA 3RPOA 3MY5A 1OB3A 1YOJA 2BRBA 2FSOX 3A4PA 3P08A 5CYIA 4QTBA 2QQ7A 4U81A 2FH9A 3UVPA 2BZIB 2RFEA 5E8YA 4C3FA 4DFXE 3KN5A 3ORKA 3OT8A 5FQDC 2PUIA 5KKRC 1YQJA 4MF0A 3KMUA 4Z9LA 4UWYA 2YCQA 2ONLA 1OIUA 5CVFA 3QTRA 4ANQA 3EQPA 2I6LA 4O21A 3KRXA 4V04A 3CD8A 3G0FA 3NAXA 4OTPA 3SV0A 2WU7A 4X0MA 5TR6A 4MXYA 4YPSA 3RM6A 4BFMA 1UNHA 3B8QA 2R3LA 3A2CA 3W8LA 4IB1A 2BROA 3Q9XA 4AN2A 2CCHA 3KRJA 4AXAA 2XNNA 4CRLA 4WNKA 1PMNA 4RT7A 5HGIA 3LW0A 1R39A 4C61A 4U3YA 5JKGA 4K18A 3UGCA 5CEKA 2PUUA 4I3ZA 2OJIA 4BI0A 3PYYA 4GIIA 3CC6A 3WF9A 5CZIA 2VTAA 2FA2A 2R3KA 3VC4A 3ZU7A 3UP7A 1FMKA 4D55A 2J5FA 3EQBA 4MBLA 2X0GA 4KIKB 1FVVA 5IG1A 2EVAA 4TPTA 2HZNA 4IX5A 4ANLA 3GOPA 3S3IA 3UC3A 2XK8A 4R3PA 3PSBA 2R7IA 4XP0A 5DT4A 2HY81 3FKNA 2I0EA 2YIRA 5J7BA 3NIZA 4ACDA 4EHEA 4KBKA 5AUVA 3FLZA 5BVWA 2VU3A 4S2ZA 4QTDA 4XP2A 2BHEA 2C30A 4FTUA 3SC1A 2IG7A 3QKLA 4DBXA 4LV8A 2GS6A 2R0IA 2W4KA 4MNEA 3V5WA 3VF8A 3FMHA 4RZWA 5L6OA 2F7EE 4E6DA 4XG3A 3VJNA 4CLJA 4R7HA 4ALWA 4FEQA 1W0XC 4OGRA 3SG8A 2XNOA 3IGGA 4DEDA 4EL9A 5KMKA 2PVKA 4M69B 4FSRA 3VF9A 1QL6A 3AC2A 4EOJA 4YO4A 1CM8A 3DAEA 2WMBA 4CFUA 2C5YA 4HYUA 1CDKA 2HW7A 3G90X 4G16A 5KBQA 4HZSA 3EFLA 5ANEA 3PPJA 2ZM3A 5AV2A 5HE3A 5D12A 5EHLA 2BRMA 3PWDA 2OIDA 4DLJA 1KV2A 4HGSA 2A27A 2FSMX 3BV2A 4JLCA 1SVHA 5JFWA 4MTAA 4TRLA 5LVOA 3U6HA 4MQ2A 3R22A 4TY1A 4DEAA 4EJ7A 3I7BA 4C4IA 5EYKA 3FXWA 3QRIA 4DTBA 4IAKA 1BLXA 4RLLA 2PZIA 5EDPA 4F9CA 1H0WA 4RWKA 3LZBA 1OL2A 2C5VA 3I4BA 2Q0BA 4CFMA 1KE7A 4BKJA 4RLKA 4F7NA 3O96A 4L52A 1YWRA 3KEXA 2QO7A 5JGDA 2IZUA 4GSBA 1ND4A 4G34A 1ZRZA 4UY9A 2H34A 2PVFA 3HV4A 4AW5A 2C68A 3MA3A 1ZMWA 4NM5A 3VAPA 4D9UA 1ZARA 2ESMA 4CV9A 4N57A 4RIWA 2JBOA 4BR3A 2UZNA 5CEIA 3NRMA 4FSQA 4HYIA 5CANA 4FI1A 3TCPA 1UNLA 3IW6A 4GH2A 3R8MA 3TUBA 1OBDA 4IZ7A 1CKJA 4G3FA 4G5PA 4NH1A 5L6WL 5GJFA 2IPXA 4JBVA 3OFMA 3GEQA 3OOMA 3ALOA 4NTSA 4YPDA 3E63A 3OWJA 1WAKA 5AV1A 3RZFA 4PL3A 2PE0A 2JIIA 4MH7A 3BQRA 4DITA 3WF5A 3C4WA 4AA5A 1UKHA 5DHJA 5HZNA 3N4UA 2KTYA 3CPCA 4RX5A 3MY0A 1ZY4A 3E93A 4I6HA 2YWVA 2WOUA 3FY2A 4FF8A 3QKKA 4DCAA 2JDOA 1URWA 2YJRA 3PP1A 4EORA 2J51A 3MPTA 4NCTC 4RX8A 4BCFA 3TUCA 4ZMEA 3QA0A 4NJ3A 3EL8A 4FG8A 5J95A 4AZVA 2ITOA 5HE1A 3UNJA 5JQ8A 3KVXA 2J7TA 3Q4CA 4Y46A 4C62A 5KX8A 1P4FA 3F66A 4Z16A 2VO3A 2WTJA 3FQEA 3ZBFA 4ONAA 5HNBA 5FEQA 4EH5A 3LCDA 1OZ1A 3GC8A 4JDHA 4JRNA 4OUCA 4W9WA 3E7OA 4ALUA 4IJPA 4OR5A 5IA0A 3DY7A 5EW3A 3SD0A 4B6LA 3UOKA 3VUTA 2PMIA 4U7ZA 2BVAA 3LXNA 5H9BA 3DBDA 1G5SA 1U59A 3CJGA 4DEGA 2RIOA 4E5BA 3VHEA 4IQ6A 4RJ4A 3PJ8A 4FMQA 1YVJA 4O7ZA 2HZ0A 5DRDA 4O1PA 3QQKA 5DE2A 4H1MA 4OBQA 4BICA 4BCOA 5HVKA 4YTFA 3EYGA 1ZYLA 5DWRA 4EHZA 3THBA 2HAKA 3DOGA 3SW4A 2O5KA 2PMNX 3H0YA 2YIQA 5CT7A 4RA5A 1JKLA 4TXCA 2J5EA 3RCDA 2YJSA 3KQ7A 5C01A 3UDBA 5HTIA 3SGCA 4IWOA 1SNUA 2XK6A 2Z2WA 4GIHA 4GMYA 4CCBA 1H00A 2IZRA 4P5QA 2XRUA 4CFVA 4FKUA 5AR7A 4I0TA 4E4MA 4G9CA 2VWIA 5M44A 4KBAA 2W96B 3VQHA 4ITJA 4AOTA 2IZTA 2OJFE 5EM8A 2B9JA 4JG7A 4KSPA 3O7LB 3OY1A 4MAOA 3R1NA 4IC8A 4GU6A 1PXLA 2HCKA 4FNXA 4OW8A 4YC3A 4ASDA 2PMLX 3F3VA 2ZV9A 1M52A 1OI9A 1GIHA 4FYOA 5KCVA 5IZFA 3UO5A 3BHUA 4OAVB 4R7BA 3KN6A 1H1QA 2OH4A 4B99A 2JC6A 2CPKE 2X39A 4TWNA 2IJMA 4RVKA 5EM6A 5AA8A 2W0JA 2Y4IB 2Y4PA 3BX5A 3FMDA 5A14A 5FXSA 4C38A 4EC8A 5K0KA 2XYUA 5CLPA 3QD3A 2VAGA 2YM6A 2NRUA 5AP3A 3MPAA 3E88A 4DF3A 2O0UA 4FNYA 3F7ZA 1PXOA 3DT1A 2H96A 1Y6BA 3LFFA 3Q04A 2YM4A 4Q5HA 2NRYA 3RZBA 4AAAA 4CMTA 4FKOA 4AT3A 4M14A 4AN9A 4AT5A 4QP4A 4ZS4A 1NW1A 4RIYB 2OXDA 4IVBA 4JAJA 4FNWA 2QR8A 2WB8A 3UOHA 1PXNA 3F3TA 3QQUA 2YCRA 4RZVA 4F99A 2VN9A 4N6ZA 4D2TA 3P9JA 2CDZA 3EFJA 5B2KA 1V0BA 5E4HA 5M51A 4D1ZA 2AC3A 3DXPA 2ETMA 4FSYA 3RCJA 4D2PA 4ANNA 3G0EA 4U6RA 5FRIA 1FVRA 2OH0E 4BDDA 2YFXA 3EN5A 5FBOA 5F1ZA 4R3RA 2X2KA 3R9RA 3QA8A 3UMXA 4CQGA 2RGPA 3F5GA 4EK4A 5E8VA 3UO6A 3KXXA 1YRPA 3BWJA 3DK6A 3H9FA 4RC2A 2VX3A 5AR3A 4APPA 5A4CA 3KRRA 4YJSA 3NCGA 2OW3A 5CU0A 2PZYA 3VN9A 5IU2A 4YURA 4BKYA 3CIKA 2HWOA 4QMOA 4JQEA 2C6KA 1BMKA 3KF4A 4AT4A 1VJYA 5LARA 5CEMA 4W9XA 4ZSGA 5IDNA 4MNEB 2BIKB 4OT5A 5CF5A 5LWNA 4PP9A 2UZVA 2CN8A 3W2RA 5I9VA 3Q9WA 4D58A 4F1OA 3ZMMA 3TTJA 1T45A 2GQGA 3GC9A 4KRCA 4WO5A 3ROYA 4EC9A 3U4UA 5GIOE 5I3OA 5IEYA 5DN3A 1J1CA 4IADA 3KCFA 2OJGA 3LQ8A 5BVNA 4ZY4A 3U4WA 3IDCA 2WEIA 2FYSA 3N51A 4FT0A 3BBWA 3FV8A 3NAYA 2YM8A 3QFVA 2NPQA 5AFVA 5L8KA 4U45A 4WG5A 3NW5A 2UVYA 3TDWA 3QRTA 5CAPA 4C2VA 4WHZA 4V0GA 4BGGA 4AOJA 3FZSA 1SVEA 5AX3A 5CSHA 4QMSA 4TW9A 1XBBA 5FUTA 4X2FA 4DG2E 5IH4A 1UU7A 2V0DA 1H24A 4K6ZA 3OT3A 4FKSA 3ZLXA 4C8BA 1W98A 1FGKA 3M11A 2BDFA 1JWHA 3LXKA 4WOVA 1SZMA 3BEAA 3CQWA 3ZRMA 5GJDA 4XG7A 4F63A 5KMJA 4GG7A 1O6KA 3WZUA 3QRKA 4XLVA 5AUWA 2Z8CA 2OJ9A 3TZ9A 2J0KA 4RVTA 3KULA 3T8OA 4JX3A 2JDRA 2BDJA 1MUOA 5DI1A 2Y7JA 1YDTE 2GNFA 2X7FA 3NUPA 3EWHA 3QU0A 4G1WA 4B0GA 1M17A 2W4JA 4DGMA 5IMXA 3O8TA 5CU4A 4USDA 2RFSA 4IB3A 3MJ2A 4LRMA 4W8DA 5DNRA 2FO0A 4C2WA 4RIWB 3CBLA 5IEXA 2DUVA 5JZNA 5A54A 5K5XA 1GIIA 4NKAA 2RF9A 2ITZA 3UPZA 4NTTA 3R04A 3R1SA 1UKIA 5IUHA 1A48A 1OIRA 3NR9A 3OTUA 4K1BA 1SNXA 5ACBC 3FC1X 5HOAA 3LFSA 4QMZA 5CY3A 4PMTA 2R3NA 4U42A 4KUJA 3KK8A 1LUFA 4E73A 3FZ1A 3QXOA 1CSNA 2W06A 3UJGA 3ZSGA 4FSWA 4DLIA 3GU7A 3G33A 2P2HA 3U51A 2XRWA 3EQFA 2YERA 4JR3A 2E9UA 4RMZA 5DA3A 4I5HA 1Q5KA 4ZOGA 3FWQA 4EH6A 3KL8A 2EB2A 5C9CA 3SOCA 4YJPA 3ET7A 3DPKA 5DT0A 2VV9A 2VTRA 4IVAA 4DAWA 2UW4A 2XM8A 1ZXEA 4BWPA 4AE9A 3C13A 2XB7A 5J8IA 4OTRA 4ASXA 3ANRA 3U87A 2B52A 5IEVA 3RWPA 4RQKA 1V0PA 2YLEA 3O51A 3IW4A 1K9AA 3FXXA 2GDOA 4UBAA 3LMGA 4UMUA 1XJDA 4Z3VA 3F5XA 4BCGA 4JAIA 1H08A 3UG1A 2Y4IC 4JRVA 1NT2A 5M4UA 2WTVA 4YNEA 3ZO1A 1JKSA 1HCKA 3FI8A 3FQHA 3QQGA 2ITXA 2ITWA 4IX6A 4YU2A 4XG2A 5HD4A 5J9LA 5FTGA 4FV5A 1QPCA 2ONLC 3K3JA 4BCPA 4FSUA 3NUAA 2XEYA 3ZCLA 4JJRA 2OFUA 5AR8A 5HU9A 2DYLA 2W1EA 3PJ1A 3TKUA 4EBWA 3EQHA 3EQRA 3G5DA 4MWHA 4QMWA 1ZMVA 5AIKA 2C6LA 4IMYA 3SA0A 3R00A 1R3CA 3OEZA 3MW1A 3QWJA 3ZUTA 4LYNA 2XMYA 1KSWA 1A9UA 3DS6A 3L9PA 5AV0A 3MJ1A 4P2KA 5FGKA 3U9NA 3AG9A 2WQNA 4GK3A 3DBFA 2IVSA 3UNKA 1Q3WA 3RMFA 3PVGA 5CSPA 2ITUA 2C3JA 3ORLA 4ID7A 4XRJA 5ETFA 1JKTA 3KMMA 5BMSA 2BUJA 2XUUA 4I93A 4EOSA 4FX3A 4XLIA 3RWQA 4AZFA 3TI1A 1XO2B 3AGLA 3JXWA 2JFMA 3R8LA 5E8ZA 4E93A 2CNVA 4I4EA 4RFYA 4N4SA 5BYYA 3CD3A 4BDFA 4BHZA 5L4QA 5HD7A 4BVUA 3K3IA 2HY0A 2BFYA 5ANJA 3RALA 5I9XA 3D5VA 3HP2A 4FKWA 1FOTA 4MHAA 4YHFA 5AP0A 4YJVA 1PYXA 4QP8A 1GY3A 2YDJA 3BIZA 1YI4A 4I5CA 3DBCA 1UNGA 3BGZA 3R7UA 3MYGA 3BI6A 2WTIA 4FG7A 3IKAA 4U5JA 5I9UA 5LMBA 4ZSAA 4GU9A 1SYKA 5H8EA 4U79A 5HBHA 2VX1A 4GRBA 2FSTX 3O7LD 3HZTA 4O83A 5D1JA 4FZDB 1QPEA 3ENMA 4AFJA 4I6QA 5AA9A 4ZZMA 3HAMA 3LPBA 4FKPA 4UYNA 1UWJA 4AS0A 5TKDA 3F82A 4CKJA 2C47A 4CV8A 2WXVA 5FEEA 4F0GA 4XG4A 2PVNA 4I6BA 1LR4A 1DAWA 3VWAA 5E8TA 2UZBA 5IH6A 4NFMA 3I5ZA 2WQBA 5HO6A 4O7VA 3HUCA 4D28A 3WYXA 4NEUA 1KOBA 3MS9A 3OXTA 2CMWA 2X4ZA 1OIYA 4FEWA 3GT8A 4P5ZA 3WI6A 2F4JA 1ZOEA 4IM0A 4F6UA 4O0XA 1FMOE 3DXNA 3ZO4A 5FTQA 1Y91A 5IA1A 4TT7A 3U6JA 1I09A 4ZJIA 5C8KA 2ITQA 4XNEA 5AUTA 3FMKA 5TT7A 2UW5A 3E8EA 1ZZ2A 3OEFX 2X1NA 3QQHA 4OLIA 2YM5A 3BLRA 4ANOA 5FLFA 5IQBA 4JDIA 2XBJA 1NY3A 1K2PA 1STCE 4FT9A 3RGFA 4WNOA 2VWVA 1U54A 5AV4A 4YUQA 5KBRA 2B0QA 5EK7A 5EQEA 3HRCA 4I1ZA 5JN2A 4RQVA 4LRJA 4HPUE 3QYWA 1YDRE 2WHBA 4RWIA 4TZRA 2O63A 3V5PA 4AZEA 2B1PA 3F3ZA 4XOYA 2B9IA 5DEYA 2PL0A 4BTFA 4E4NA 3KMWA 3BHHA 4PNIA 5M4FA 3PIZA 1ZYJA 4BCIA 4R8QA 4BDAA 3IW7A 2Z7SA 4EOLA 1WVXA 4ACMA 3QGYA 2XZSA 4FTIA 4IAAA 2XIXA 2QOKA 4J53A 2QVSE 2WMXA 3EJ1A 4PY1A 5JGAA 3R01A 3O50A 3RP9A 1H27A 3PTGA 4ZTMA 5D41A 3ZO3A 3SVVA 4PNKA 4FEXA 3OBJA 3KULB 4LMNA 4WBBB 3LE6A 2ERZE 1IRKA 3PFQA 3NUYA 4NL0A 5JZJA 3AT2A 3DNDA 4FTAA 4AW0A 5CAQA 4KAOA 5FTOA 1JSUA 1E1VA 1F0QA 1IAJA 5CAOA 2VUWA 3L1SA 4L45A 3T3UA 1E9HA 1GZ8A 1X8BA 3DV3A 2BFXA 3GCVA 4QYEA 4RX9A 5D11A 4YTIA 4A9TA 3I5NA 5IDPA 4FVRA 5LJJA 3ZRLA 2EXEA 2J50A 5J9ZA 2W1ZA 3PVUA 4TYJA 3RK7A 3HLLA 3L9NA 1Z57A 1WBTA 2DS1A 3LCOA 2YM3A 4JT3A 2BCJA 4C0TA 2ZDUA 4EWQA 4F4PA 2IWIA 1GZOA 4FV9A 4H3PA 4L46A 3IOKA 4AFEA 2PE1A 4X2KA 3HVCA 3WYYA 2C6MA 4V01A 4BBEA 3HNGA 4EZ5A 2F7XE 1ZLTA 4M66A 3OCGA 4YJNA 3ZTXA 4CT2A 5D10A 3DKOA 4EK6A 1CKPA 3Q2JA 4AGWA 3C0GA 3QUDA 2X8DA 1W83A 5DOSA 1YHSA 1OPKA 3QQJA 1B39A 3QTUA 4QD6A 4FTNA 3CLYA 3PSDA 3G6GA 2IZSA 4KBCA 3KXHA 4YHTA 5L3AA 5BYLA 4J71A 2C0IA 3I1AA 5JSMA 3MB7A 1QPJA 4XUFA 3WF7A 4F7LA 2ETRA 5AX9A 1P5EA 5D7VA 1H8FA 5A46A 2OI4X 3POOA 4XMOA 3VS3A 4PP7A 5IISA 4CFFA 1ZOHA 2QG5A 5ETCA 3LFEA 3NNUA 3DDQA 1BL6A 4P4CA 3H9RA 3NNVA 2BRGA 4Q5EA 4WIHA 3DDPA 4CFWA 3UVQA 5CU3A 2B55A 3R02A 4EUUA 2QOCA 5AP6A 1JAMA 2ZOQA 2VWZA 3D9VA 5FP6A 4DG0E 2VTLA 2EB3A 5A4TA 2R9SA 3IW5A 3FBVA 3MA6A 2B4SB 4O0VA 4L6QA 5B2MA 2BR1A 4NJDA 3VUIA 3IW8A 3O8UA 4K33A 4YO6A 5E8SA 2QOIA 1BI8A 4KIQA 5AP7A 1S9JA 4A4LA 1OL6A 3QUPA 2GNJA 3K5VA 3BELA 5L2QA 2XNMA 3OROA 4HVIA 3OCSA 1R0PA 4BDHA 4QMNA 4YSJA 1VYWA 5CNNA 1JBPE 2XEZA 3V3VA 1OVEA 4IAZA 3DTCA 2BHHA 3GVUA 5LMAA 4IZAA 4BDJA 4FNZA 4U43A 4H1JA 3AQVA 1W8CA 3VS4A 4CYIA 4GT5A 4LFIA 3BE2A 3G2FA 1E1XA 5C03A 2P0CA 4TNBA 1YI3A 4E8AA 1P2AA 3SW7A 3OXIA 1YXSA 4GT3A 4A9RA 4ZTRA 3JUHA 5HTCA 4ORKA 5FDXA 3CY3A 3RK9A 4D4VA 3ORPA 4PV0A 4O86A 4CGAA 4XH6A 3UQCA 2HENA 5AR2A 3QD0A 2YIWA 3B8RA 4HYSA 3I60A 3VBWA 3V5LA 5L2IA 1XKKA 5CX9A 4C3RA 1FGIA 4CSVA 5ACKA 3RHKA 5IQHA 3C4ZA 1PMVA 5AIRA 3C5UA 5F94A 4QTCA 5C8NA 3PY3A 4L00A 3AGMA 2YISA 2UUEA 1O9UA 2GFCA 2XS0A 1EH4A 2Z60A 3ORZA 3QQLA 3FXZA 4BGHA 4E3CA 4CFNA 5BVKA 3W1FA 1U5RA 4K11A 2Z7RA 4EH3A 1GOLA 4ZTHA 3OP5A 4BZNA 4ZZNA 3P86A 3Q52A 1JLUE 2O8YA 2R7BA 3MSSA 4NIFA 4L42A 3RPRA 4WG3A 5A9UA 3O23A 3P0MA 4RFMA 3D7ZA 3D83A 1OUYA 5FM2A 5D7AA 4S32A 3EOCA 4FGBA 3TM0A 2VWBA 3K5UA 3MFTA 5K9IA 5BUEA 4ZZOA 2CGUA 4F6SA 3R2YA 4XX9A 2JGZA 3LMIA 4PDSA 4JQ8A 4QTEA 3D4QA 4FV0A 5L8LA 4I5MA 2WMVA 3DZQA 2GHMA 4FZFB 3S0OA 3QD2B 4XV1A 3WF8A 1ZWSA 4CMOA 3CTHA 4U9AA 2BTRA 3QUEA 3I7CA 3QX4A 3VUDA 5DT3A 3VS2A 2UW8A 4D2RA 4EQMA 2XYNA 1PMUA 4QPMA 2BPMA 1FBNA 2XNGA 5KMMA 1G8SA 4OTGA 3GU4A 3OXZA 5HHWA 2PVLA 2R4BA 4H3QA 3IONA 5E90A 3OWPA 3TJCA 5I5ZA 2G2FA 4XV2A 3WE4A 3EKNA 3D15A 3IK3A 3BHYA 4WD5A 5G6VA 5DIAA 4RC4A 4GYIA 4Y73A 1BI7A 2QOBA 4EWHA 2R3PA 4F65A 2J0JA 4F9BA 2PMOX 4FTCA 4MKCA 2XM9A 4OT6A 1U54B 2R3QA 5FP5A 1CTPE 5H8GA 4PTCA 4KKEA 4A4OA 2WTKB 1OKWA 3DB8A 1OECA 3WIGA 3ERKA 3NUNA 3O17A 4XS2A 4ZLZA 4EH8A 3BEGA 1IR3A 3EFKA 2OIBA 3GXLA 3PA4A 5E7RA 5F4NA 5HEZA 5IQFA 3P4KA 5HG7A 2ZAZA 4WG4A 4DGOA 1Q8TA 4DG3E 5CU2A 3JR1A 4AWIA 1OITA 3NWWA 4AW1A 3O71A 2W1GA 3RAWA 2A2AA 4RC3A 5B0XA 3FSKA 2BRNA 3FHIA 4FV1A 2UW9A 1MP8A 3NLBA 1KV1A 3BV3A 4PWNA 4DGGA 2C6OA 4G9RA 3R7EA 4ZLYA 3UIXA 5A6OA 4QP9A 4R3CA 1Y8YA 3LFBA 2WIPA 3QYZA 2X8EA 3LQ5A 5C4KA 3WBLA 4ZSJA 3TZMA 1WMKA 2YLFA 3OHTA 4X3FA 2XIRA 4PDPA 3WILA 1L8TA 3UQFA 2VTTA 4PMPA 4I94A 1VR2A 2HIWA 1Y8GA 1UV5A 3R83A 4BKZA 5FDPA 3RHXA 3SXFA 2WTCA 3WARA 2XCKA 5CASA 5L8JA 2XIYA 4ANBA 3GB2A 3R73A 5JMSA 2C6TA 4D5KA 3IO7A 1NA7A 4RWJA 3QHWA 4FYNA 3PPZA 3N9XA 1RE8A 4G3GA 4RG0A 2WMSA 3EZVA 2V22A 4G17A 2WZJA 3GOKA 4FA2A 3A62A 3R9HA 1RJBA 2R3HA 4UYAA 4FTTA 2YDKA 4DEIA 4QMLA 5FXQA 2ZV7A 1R78A 3D14A 4ZMFA 3ULZA 2WNTA 1ATPE 3EQDA 4QYGA 4ASZA 5IMEA 3KGAA 3Q32A 5EKOA 4DN5A 3TACA 2GTNA 5EOLA 4HCUA 3VW8A 5LQFA 2R64A 1PXIA 3MVJA 3OOGA 4P90A 5K4IA 5IUIA 2QHMA 4I23A 1WZYA 2HW6A 3HMPA 3QC4A 4PL5A 3BYUA 5HLPA 2ETKA 5EQYA 2LAVA 3VS0A 4J52A 4KKHA 4O96A 4QMUA 3ODZX 2C4GA 5EHYA 4F9AA 2JBPA 4ZS0A 4M68A 3DKFA 3DK3A 1Z5MA 3KA0A 4KINA 2W17A 3UQGA 2A4LA 4YZNA 3NUUA 4XEYA 4IH8A 5ETAA 4K9YA 4F6WA 2PPQA 2PYWA 4AA4A 4I20A 5CVHA 5HCYA 3SOAA 4H39A 1AGWA 3OMVA 1J91A 1GIJA 4MXAA 3D2KA 4LOOA 4PPCA 4C57A 1MRUA 5DR2A 4ERKA 2PVJA 4WUAA 1MRVA 2WQEA 3W2QA 4FT7A 2ZB1A 2QOOA 3TIYA 4E6QA 3ZC5A 5HX8A 4WT6A 2WD1A 3F61A 2P33A 3OBGA 4E5WA 3UVRA 3V6SA 4UX9A 3HGKA 2WTDA 3B2WA 2ZDTA 4RFZA 1YHVA 2BAJA 2XKFA 3PSCA 4LOQA 4EZ7A 2HWPA 3COHA 3Q4ZA 4MD7E 4N70A 4FTQA 5F9EA 3PJCA 5HBEA 1J1BA 4RJ5A 4J98A 1WFCA 3GNIB 3VIDA 4G5JA 1Q41A 5HQ0A 4O7LA 2QODA 3K2LA 3G9LX 3AD4A 5HE2A 4D9TA 3DFAA 4C4FA 5KUPA 4S30A 3OW4A 4FL2A 1JOWB 5T3QA 2JKQA 4J8MA 3P5KA 3CSVA 5IA5A 3GFWA 3ACJA 3ANQA 5A6NA 1H1SA 2WGJA 4FIEA 3H9OA 4IW0A 5BVOA 4C33A 2CKEA 1U46A 2OGVA 3MTFA 4L43A 5EDRA 1WVWA 2ZVAA 2AUHA 3GQLA 3HL7A 4O81A 3FY0A 4DH8A 1GNGA 4CD0A 1IA8A 2EUFB 5IQIA 3KXGA 4UALA 3UBDA 3D5WA 4HZRA 1Q8WA 4ZLOA 2NP8A 4C02A 3SDJA 5I4NA 3DKGA 4JVGA 4UEUA 3LJ0A 4FC0A 4GK2A 4H3BA 4H05A 2OF4A 4MK0A 4IAYA 2VNYA 3DA6A 3VS6A 2YA9A 2W5BA 4NK9A 1NVSA 1TVOA 4QPSA 5AADA 2OK1A 3C50A 1M2PA 5HCZA 4GUBA 3ETAA 4X21A 3HKOA 3KXNA 3NPCA 1JQHA 4KSQA 4ANSA 2W1IA 3LVPA 2VTNA 3H30A 4NIFB 3QCQA 3L8PA 4R5SA 2R3IA 3V04A 2R3FA 3CR0A 4GJ3A 2SRCA 5IQGA 2WTKC 3QWKA 4CG9A 4C36A 3Q6UA 3QRJA 4C4EA 3VW6A 3OWLA 2XJ1A 3NX8A 3UG2A 4JXFA 4L7FA 4CT1A 4CVAA 2UZLA 2YDIA 4C4JA 3ZHPC 3AC8A 2B53A 4IAFA 4DTAA 5HBJA 3R30A 4IXPA 4GJ2A 2JDVA 3EIDA 3CQUA 1V1KA 4A4XA 2XK7A 2IVUA 2W1HA 1KE9A 2BKKA 4HVHA 2VWUA 2BDWA 2J6MA 2X9EA 3ZO2A 2REIA 3DK7A 3ZZWA 3UO4A 1BL7A 4TWPA 4DH5A 3Q5IA 3BWFA 3TZ8A 2GPHA 4EONA 3AC1A 3SX9A 3TTIA 2P55A 2Z7LA 4Z7GA 3PUPA 4PL4A 5EYMA 5CI7A 5CS6A 3ZBXA 2CLQA 1Q8UA 4BCNA 3QZHA 3W16A 2YM7A 4BDEA 4S33A 3COIA 3QL8A 2B54A 3UZTA 3WZKA 2OBJA 3C0HA 3H4JA 3HMIA 2PULA 1Q24A 2OXYA 2PVYA 5HO7A 3C4FA 3U8WA 4QMYA 4E26A 4J95A 4HW7A 4Z7HA 4EH9A 5B2LA 2OG8A 2B7AA 3VBQA 1MQBA 4FOBA 2I40A 1WCCA 2Y8OA 2WQMA 3OD6X 3W55A 1H1PA 4YR8A 5M56A 1XBAA 4DFLA 4FV7A 4GVAA 2HZIA 1NVQA 3IG7A 5CEOA 2XA4A 4DGNA 4DFYA 5C8MA 1PF8A 4HOKA 3MIYA 5DVRA 3GP0A 4M8TA 4JDKA 4IWQA 3HA6A 1PRYA 2J0MB 4YC8A 1Y6AA 3REPA 4TYHA 4D2WA 3FHRA 5BQ0A 3CCNA 3R7OA 5CEQA 3QHRA 5M06A 3UNZA 3GGFA 4ENYA 2ITVA 1ZMUA 2VWWA 3LM5A 3NIEA 4MQ1A 4L67A 4QMMA 2R3OA 2J2IB 1U4DA 5BVDA 5BYZA 5CI6A 5E9EA 3HECA 3NNXA 4LGGA 3D5UA 1KWPA 3R7GA 4IEBA 3ZXTA 3R8PA 4GW8A 3GCSA 2BILB 4KABA 3NVMB 4GEOA 2F2CB 4X3FB 1XH9A 2C3KA 4BIDA 2O3PA 4L3PA 4MBJA 2C1BA 2WO6A 3C4CA 4IM2A 4FV4A 4JIKA 1HCLA 3BHTA 4IZ5A 3ZONA 4BDGA 4CNHA 5J7HA 1WBWA 4ALVA 3SQQA 4W4XA 3RINA 4ASEA 3VS5A 1DI8A 3BPRA 3PVBA 5BMMA 4AGDA 2VTIA 3QZFA 3CY2A 4EQUA 4IACA 3DJ7A 4B8MA 4F1TA 4WRSA 2X6DA 2Y6MA 5LCJA 4USFA 3BKBA 5CZHA 2QNJA 4QNAA 5FD2A 4GKHA 4IX4A 4FICA 4MBIA 3PE2A 3I79A 3LCKA 3U9CA 1WBVA 4FKTA 3W2SA 1OPJA 4AW2A 1H0VA 5AWMA 3FZOA 4CG8A 4QQ5A 5AUUA 5K5NA 2ZJWA 3ZDUA 2QOQA 4IB5A 3F5PA 4EK3A 3GU6A 2X2LA 4FZ6A 5I3RA 3MH3A 5G1XA 3FMMA 2X2MA 2ZB0A 3P7BA 3BU6A 1T46A 3OCBA 4CMUA 3CQEA 4F70A 2CSNA 4QRCA 3MESA 2OZOA 3CKWA 3PIYA 2JITA 3GCUA 1W82A 4IVCA 1YDSE 2CN5A 4BDKA 3ID6C 4LG4A 2BZJA 2ZV2A 4U41A 2KULA 3DAJA 3O8PA 5AP2A 5H3QA 4D0WA 2JDTA 2O65A 3FSFA 3HRFA 5HO8A 4D5HA 3BE9A 4BI1A 1M14A 1W7HA 2I0VA 2P4IA 3DAKA 4NM7A 5TOZA 2OLCA 3C5IA 4RJ8A 5CTPA 5H2UA 4E5AX 3IQ7A 2RFDA 5HKMA 3GCQA 4JR7A 3W2PA 5F95A 3MB6A 3ORMA 4X6QC 3UE4A 2FSLX 3L8VA 4LV5A 2XK3A 5HICA 5KMIA 4OBOA 3ORXA 3KFAA 5AAFA 3A7FA 5HTBA 3TV4A 4BTJA 5DBXA 3FLWA 2XVDA 1TQIA 3MVMA 3UIUA 4BCKA 3R9OA 4YMJA 3ZH8A 3ATSA 4FG9A 1DI9A 3QKMA 5CF4A 3NCZA 3BGQA 1S9IA 1APME 1DAYA 3PLAE 3LCTA 3RBWA 4IDVA 1OKZA 2QCSA 4M84A 4RIXA 3QTSA 2GQSA 4LMUA 1OL7A 5IPJA 3FYKX 2C3LA 2W4OA 3LFCA 4BDBA 3QX2A 2QU6A 4R6VA 4U97A 4CFXA 3CE3A 5BNJA 3QZGA 4L3LA 2GCDA 4FUYA 4RWLA 4C3PA 4EYMA 4F9WA 5BPYA 5CAVA 4F1MA 1LEWA 5JT2A 5KO1A 3Q9ZA 3KRWA 3F3WA 3RPVA 1OUKA 3F3UA 3KC3A 4QT1A 5DH3A 3V5QA 3N4TA 5LWMA 2YAKA 3RTPA 4O2PA 2J0LA 1XH8A 3EL7A 2X6EA 3L8XA 4UWBA 3ZEPA 3FLSA 4OTDA 3VJOA 1XHAA 3PPKA 4KD1A 4Y5QA 4YJRA 3FMJA 2C6DA 2OJJA 5FM3A 2ZMCA 4IX3A 2WMTA 4DT9A 4O1OA 4TYIA 5EI8A 5IQAA 4LQMA 1H07A 1B6CB 1R1WA 4NU1A 3R8UA 3UODA 3OTVA 4MXOA 4FIJA 3HMNA 4QMTA 4W4YA 4W4VA 4NM3A 2UZEA 3PY0A 3AXWA 4IFCA 4N0SA 3FI3A 1V0OA 1URCA 3PG3A 4G3EA 4YGAA 5EM5A 3AC4A 4WUNA 4YJOA 4BCMA 2VWYA 3E62A 4U3ZA 2UVXA 2GNLA 3R7VA 3LAUA 1DM2A 2BKZA 3MPMA 4DH3A 4Y5HA 1PJKA 3TN8A 5LVNA 1UWHA 5CT0A 3CGOA 1JPAA 3CJFA 1SMHA 1PXKA 2JAMA 3LLTA 5ITAA 4JOAA 5HIEA 4QQTA 5J79A 4LOPA 2H8HA 2W1DA 5EW9A 4BRXA 2I7QA 5HU3A 3BYOA 1XR1A 4GUEA 4ACCA 4DA5A 1BUHA 4AZTA 3VS7A 5HG9A 3Q2MA 4BC6A 4UV0A 3ZLYA 5IA3A 4YZMA 2IW9A 4BIBA 4FTLA 5HLNA 4L01A 4EOMA 5JQ5A 4XJ0A 4CXAA 5A3XA 1FPUA 4J8NA 3MVLA 4FGRA 3NUXA 1MRYA 1DS5A 3GUBA 5IA4A 4V0GB 3BU5A 4XOZA 1CMKE 2YITA 3OY3A 3K54A 4G2FA 3KF7A 2F49A 3QLGA 3OF0A 2G15A 4WSQA 5EQPA 2R3RA 2VO6A 2PK9A 3I0OA 3QTWA 2PY3A 3FKOA 4GVJA 5EYDA 5LVMA 2CNUA 1RW8A 1JSVA 3TNHA 3GENA 4X3FC 4WKQA 4YHJA 5EI2A 4RRVA 2CGXA 3AD6A 3F2AA 2BIYA 5CF6A 2A0CX 3MFRA 4C35A 3OG7A 2WELA 3GI3A 2XK9A 2ZYBA 4YNOA 3E92A 4X6RA 2PVMA 2ITPA 4BY9E 2GHLA 4X3JA 4ZIMA 4G6OA 4JQ7A 3QD4A 4FKQA 4EH4A 2P3GX 3QALE 4C34A 4IANA 3EKKA 1WVYA 2PTKA 3PRIA 4FZ7A 5HG8A 2ACXA 3PIXA 4CZTA 3QBNA 4WNMA 2UVZA 3MH1A 3TUDA 3SKCA 1F3MC 4AN3A 3V01A 2X8IA 4PPAA 4TYHB 5J9YA 4GL9A 1YXUA 3AT4A 3JS2A 3UIBA 4FTMA 3VUMA 2B9FA 5CQWA 2PZ5A 4DGLC 4EOIA 3F69A 3C51A 2JDSA 2HK5A 2CJMA 4CZUA 2GNHA 4NYEA 4GFMA 3RVGA 5IQEA 4DEEA 5HE0A 4FT3A 2P2IA 5ANGA 5FEDA 5L6PA 4RSSA 4FIIA 3NEWA 3KREA 3PE1A 4FSZA 1XWSA 4O6EA 4B8LA 2EWAA 2FUMA 4X2JA 4AOIA 5LMKA 4FSNA 5KMLA 5HI2A 3ZOSA 5TO8A 3QCSA 5EH0A 1QPDA 4D4RA 3WE8A 5IQDA 1G8AA 1CKIA 1REKA 2YIXA 4J1RA 4UZDA 5K3YA 3QGWA 3RM7A 5AP1A 3IDBA 3AD5A 4FE2A 3DLZA 3A61A 3GCPA 5AMNA 4Q9SA 4AZSA 1XH6A 4BL1A 3TDVA 3CEKA 2JIVA 1H28A 3ROCA 4LM5A 3HMOA 1GZNA 3QAME 3VBTA 4EUTA 4BN1A 4H36A 4X2NA 4IFGA 2V55A 1LP4A 5J5SA 2PHKA 2XH5A 4O91A 3KXZA 4ARKA 3JVSA 4UB7A 4CQEA 3TIZA 5KZIA 4WBOA 4DCEA 3EFWA 3EH9A 3VBXA 3ZFMA 4APCA 3AMYA 5J1VA 2YIYA 3PXQA 5GJGA 3TJDA 2F2UA 1Q62A 4K77A 3FI4A 4ZXTA 3RKBA 1PXMA 5HG5A 5K4JA 4RIOA 2E2BA 5K0XA 4PQNA 5JH6A 2CKOA 1PYEA 5EI6A 5FXRA 4DH7A 4DEBA 2WIHA 4ZTNA 4MXXA 4W4WA 5GZ8A 2H9VA 3PVWA 3FPMA 1K3AA 4QNYA 3OW3A 4QYFA 2QLUA 2BTSA 4OAUC 5BUIA 3R63A 2E9VA 4LUDA 4F0FA 5EKNA 1H26A 2BZHB 1PXJA 2LGCA 1H4LA 3ZRKA 4EI4A 4FBXA 1GJOA 1PKDA 2ERKA 5DG5A 4KNBA 3IECA 3CTQA 4YBKA 3EHAA 2QG7A 3P78A 4HNIA 4Y83A 4TYEA 4ZY5A 5AJQA 3B2TA 3MFSA 3R7IA 3A99A 5M55A 2NO3A 3FL4A 3RK5A 2QD9A 3POZA 2QI8A 4NSTA 5EM7A 2GQRA 3DQWA 5CF8A 4IC7A 4YLLA 3FZPA 4CTBA 5JK3A 3PXKA 4RIYA 3ULIA 1ZYSA 3HDNA 4NT4A 1KUTA 3LJ1A 4EYJA 4S34A 4RIXB 4ZSLA 2YACA 3IGOA 3JY9A 3F88A 3MWUA 3MBLA 2RL5A 3W32A 4Q2AA 2PWLA 3W18A 4O2ZA 3C0IA 4I4FA 3RI1A 2WMUA 3HDMA 4EHGA 5HNIX 3D5XA 2X7OA 2VNWA 2C5XA 3H0ZA 3RNYA 4DE4A 4I41A 4C4HA 2ZMDA 4FVQA 5JFXA 1XBCA 3FYJX 4O6LA 3OCTA 4RJ3A 3LLAA 2UW3A 3TKIA 5E1SA 4YBJA 5IH5A 4RGJA 1KE8A 4XRLA 2VO7A 5J87A 3ZUVA 1IEPA 3PXRA 3P1AA 4PMSA 5ANIA 2WMQA 3HV5A 3PG1A 4YC6A 4PF4A 3W2OA 2VTMA 2VRXA 3BLQA 4FKJA 4L68A 2GS7A 3DLSA 4AUAA 2HELA 3LJ2A 3QXPA 4Y95A 4DYMA 2VGOA 2QC6A 4U40A 3ZYAA 4XBUA 4EOKA 3CPBA 4FIHA 2RSVA 3QCYA 4FV2A 1XH5A 1PY5A 3D2IA 4KB8A 3BU3A 1O6LA 1YWNA 5E8XA 4FR4A 3DQXA 4LGDA 4R1VA 3MTLA 4BYJA 4B4LA 4ZSEA 4FV8A 4BYIA 2JKMA 3DNEA 4GS6A 4V05A 4TNDA 3VUKA 3Q4UA 2VWXA 4IVDA 2R2PA 3VRYA 4ZJVA 4FTJA 2DQ7X 5GIPE 2IN6A 2VTSA 2EXCX 2DWBA 4PUZA 1UU9A 4E6AA 1O6YA 4F0IA 3LKMA 4YTHA 4XV9A 4L3JA 2UW7A 5J1WA 4O0SA 5AR4A 2VTQA 4HVGA 3P79A 2PVHA 4IJ9A 3RJCA 2Y0AA 2OXXA 2ITTA 3R0TA 3W8QA 2PUNA 3E8CA 3ZC6A 3MH0A 2O64A 4XG9A 3VVHA 4YJQA 2PZRA 1KOAA 4EZ3A 1OGUA 3PWYA 4RA4A 1WBPA 5C4LA 3FQSA 5HX6A 3SXRA 3F5UA 4FKGA 4RVLA 2IW8A 4UMRA 5HVJA 2G1TA 3R9DA 2RKUA 4IZYA 3CXWA 3HRBA 4OTIA 1WBSA 4EK8A 3GU8A 3SRVA 4J97A 4YLJA 1YXTA 5GZAA 2I0YA 3DBQA 5CAUA 2XNPA 4NKSA 2W9FB 5CENA 2C6IA 1GAGA 3PXFA 1JKKA 1TQPA 2ZV8A 4F7SA 5B7VA 4O22A 3R8ZA 3R1QA 4CZYB 3VUHA 3EN6A 4BBFA 4HCVA 1ZYCA 5LVPA 2CKQA 3NNWA 4LL5A 3O2MA 4UMQA 4I0SA 1FINA 4BB4A 3F6XA 3VUGA 1H1RA 3WZJA 5M53A 4TTHB 3WF6A 2GSFA 4FSTA 3JPVA 3ZUUA 2WPAA 5KNJA 3NMUF 2ITNA 3U6IA 2C5NA 3HAVA 3HMMA 4BBMA 5DMZA 5IUGA 5L2TA 4O7WA 1ZY5A 2V7OA 3EN9A 3F2NA 5TE0A 2BALA 2WTWA 3Q5ZA 5TF9A 3ZSHA 3VHKA 4A07A 3IDPA 2C5OA 4FL3A 3FPQA 3RAIA 1PKGA 3VS1A 4BCHA 2WMWA 2GU8A 3KKVA 4HJOA 1VYZA 4O0WA 4MVFA 3FLYA 1YKRA 4OTHA 5GINE 4G6LA 2C0OA 2FGIA 3II5A 4OTQA 4F7JA 3BBTB 3BQCA 4LI5A 4QQJA 3ELJA 2Q0NA 3TZ7A 3SAYA 4ZK5A 2QLQA 4O82A 1ERKA 1OMWA 4QMVA 1Y57A 2W7XA 4RJ7A 3RPYA 2GFSA 1OBGA 5DFPA 3I0QA 4I92A 2H6DA 4LGHA 1P14A 3EN4A 3ATTA 4I6FA 4EOQA 4DFUA 3SXSA 4J7BA 4FKLA 4RJ6A 3I6WA 2YAAA 3FC2A 4II5A 4RBLA 3NVKI 1G3NA 2G2HA 5KZ0A 3UPXA 1UVRA 4DFBA 4U80A 4EHVA 3QRUA 3A7GA 4FTOA 4A06A 3DB6A 4ZTSA 2JAVA 1AD5A 4BWXA 1IAHA 5I9YA 2R3MA 3F9NA 3MGYA 3ZM9A 1Q61A 3MVHA 3QQFA 4JDJA 3MY1A 4AACA 4PMMA 1L3RE 4D0XA 3G9NA 3LXPA 4P7EA 5JFSA 3BYVA 2FB8A 2XF0A 2JKOA 3G6HA 3UOLA 3Q96A 1FVTA 1IA9A 3MIAA 3U55A 4AZWA 4MCVA 4R1YA 3PA5A 4D2VA 3HP5A 4K8AA 4M97A 4Y85A 1PW2A 2QHNA 2BAKA 3S00A 5ANKA 2UW0A 1PHKA 5EHOA 3GC0A 5DR6A 4BWKA 4D1XA 4QP7A 4XHKB 3KK9A 2PUPA 3BLHA 3JY0A 3OVVA 2X7GA 4PRJA 5KMOA 5L2SA 2JIUA 4A9SA 4FTRA 5EYCA 4CEGA 2QO9A 3C1XA 4KS7A 3QC9A 5M4IA 5DYJA 3A7IA 5IA2A 3R6XA 2G01A 3L9MA 4KA3A 2YCFA 2R0UA 3V8TA 4EH7A 2GHGA 3IPHA 3HV3A 3Q4TA 5GHVA 2UW6A 3HEGA 4YZBA 2F7ZE 4NWMA 4FIFA 2OWBA 4FT5A 4KKGA 4DBNA 4YJUA 4BCJA 1Q4LA 3BRBA 5DGZA 3ZM4A 5HNGA 5CEPA 3W2CA 3MN3A 4NUSA 2B9HA 3R21A 1OPLA 2WAJA 2XKDA 4ITIA 1XH4A 4FKRA 3RPSA 2E9OA 2VZ6A 2HOGA 4L44A 3UC4A 4ACGA 3A8WA 5CSVA 4ZAUA 3WZDA 5EG3A 5CWZA 4O7SA 5DLSA 4EKLA 3TL8A 4HGEA 4PPBA 2XK4A 3PLSA 2G9XA 1Q97A 1TKIA 5JRSA 4UMTA 5J5TA 3HA8A 2JEDA 1J3HA 2PE2A 4CYJA 3S1HA 2XNEA 1PMEA 4BDIA 2BAQA 2XNBA 4DFNA 4R78A 2UV2A 4KRDA 4MEDA 4O38A 3ZXZA 4A9UA 2IVVA 1RQQA 1W84A 2GTMA 3NSZA 2W1FA 3CKXA 4A7CA 3I6UA 4W8EA 3WOWA 2QOHA 1TQMA 2OKRA 3QZIA 4KIPA 1J7IA 1Q3DA 2YEXA 1YWVA 3RAHA 3TKHA 4D4YA 5M4CA 3V5JA 3M2WA 5LOHA 3BHVA 5I9ZA 4BZDA 2QO2A 5ETIA 5AM6A 5CXZA 3NW6A 1LPUA 3E8DA 4JI9A 2UZWE 3C4EA 1IASA 1OKYA 3IOPA 4LRKA 5CALA 1H1WA 3TNPC 3PDTA 3TV6A 4FEUA 2QKRA 4DTKA 1OIQA 2E9NA 5IQCA 5HLWA 3EMGA 3FJQE 1JVPP 3RNIA 4C4GA 3L8SA 2RG5A 2OIQA 1SM2A 2YN8A 4WRGA 5LVLA 4DFZE 3A7JA 5BX0A 5JGBA 3ZDIA 2WQOA 3DJ6A 4TWCA 3Q60A 4GFOA 5T68A 1I44A 4L53A 4QTAA 3LFNA 5ICPA 2JFLA 2I1MA 4UN0C 3D7TA 4IDTA 4JIAA 4CCUA 2CGWA 4AX8A 4YZDA 1KE5A 4AA0A 4FV3A 3DGKA 4G3CA 3AC5A 3TEIA 3TWJA 4BI2A 3L9LA 3C7QA 4IWPA 3NGAA 3AMAA 5HIDA 1NVRA 3LHJA 4U44A 3NYOA 4BTMA 5LXMA 5GNKA 4HGLA 3NS9A 3KB7A 3V5TA 4FKVA 4QOXA 3DXQA 3NDMA 3PA3A 4IIRA 4MWIA 1Q8ZA 4O27B 1M7NA 4IE9A 4FV6A 4I0RA 3IS5A 5EDQA 3D0EA 4B7TA 3D94A 1KE6A 2XCHA 4I22A 3VRZA 5A4QA 4TYGA 2A19B 2YZAA 1AQ1A 3GU5A 4GK4A 4AQCA 2UZOA 3NYNA 4YP8A 3TT0A 4E20A 4X7QA 4D4SA 1U5QA 1WBOA 4M0ZA 4AP7A 2YWPA 4FUXA 2HXQA 3ZS5A 3UZRA 5AEPA 2PZPA 3SRVB 4F64A 3LMHA 3MV5A 1OL5A 3ENHA 3LQ3A 5CQUA 2XKCA 2RG6A 3EQCA 1WBNA 2FVDA 2YABA 3DFCB 3FLQA 1XH7A 4FSMA 4JNWA 4NZWB 3R1YA 3W10A 2J90A 5LMKC 3Q53A 1R0EA 5E92A 2BZKB 3F7WA 5AUZA 4M67A 3R8VA 4M13A 5AAGA 4Y8DA 3OWKA 4G31A 3P7CA 1QCFA 2VTJA 3DTWA 4FK6A 5JFVA 2CGVA 2IW6A 2GNIA 3COMA 4ITHA 5E8WA 3UIMA 3UYSA 1Q8YA 1JNKA 4ERWA 1M7QA 3FL5A 3HYHA 5BUJA 4O7NA 5M07A 4BCQA 3NYVA 4M7IA 4QMPA 2UZTA 4F9YA 4U0IA 2XIZA 5FG8A 3R2BA 4O0UA 4YLKA 3C4XA 4E7WA 3OUKA 2OU7A 4R77A 3PJ3A 3A60A 4I24A 4GG5A 5HORA 3R28A 1YI6A 2W1CA 3NW7A 2JLDA 4XG6A 1ZOGA 3CS9A 4YZ9A 2V5QA 2HYYA 2W5AA 5AP4A 5H8BA 3ZLWA 4C37A 4QMQA 2OSCA 3PY1A 3SLSA 4E4LA 4Z55A 4XBRA 4HCTA 2HZ4A 4H58A 4D2SA 3PJ2A 4E4XA 2OZAA 4QYHA 3E7VA 5HCXA 3TXOA 3EB0A 2VX0A 3PZEA 1YW2A 4R7IA 3R9NA 2O2UA 4PTEA 1A06A 3S95A 1HOWA 3DZOA 4NCTA 4OTFA 3FDNA 3FZTA 3SHEA 4FL1A 4FVPA 4OTWA 3VQUA 4EEVA 5C26A 2ZM4A 2Q83A 2BRHA 1UU3A 1ZZLA 2Z7QA 4JX7A 3UTOA 4KS8A 4WA9A 3HV7A 5HIBA 4QP2A 2J0IA 4ZTQA 4EK5A 1YOLA 2EXMA 4WNPA 4EOOA 2XIKA 5M08A 3KRLA 3ZEWA 2VTHA 2C69A 3FZRA 4HVDA 5DPVA 3FMLA 5EFQA 4FKIA 4NM0A 4EOPA 4GT4A 5M57A 2JD5A 4G3DA 3RAKA 3V8SA 2R3JA 4UXQA 3F2RA 2XP2A 2R3GA 2QR7A 2UZDA 2QKWB 4QPAA 4K2RA 3N4VA 1YXXA 2OICA 3E3BX 4JBOA 4QYYA 4I5PA 4JG6A 2G2IA 3A7HA 3T9TA 4DINA 2VTOA 3GFEA 3LXLA 4IBMA 3PRFA 1UA2A 4FODA 5BVFA 2PU8A 3U54A 2IVTA 5E8UA 5LCKA 5C27A 4O0TA 3HV6A 4HYHA 1BX6A 2XJ0A 4FOCA 4QQCA 5IF1A 4OBPA 3ITZA 3NZ0A 4N6YA 3S2PA 4X2GA 4GFGA 4ZY6A 2E9PA 4PTGA 2CNQA 4M15A 4ENXA 3SG9A 4BDCA 4GYGA 3JVRA 4AF3A 4L8MA 2CKPA 4QO9A 1P4OA 4USEA 2NNWB 3LFQA 4QP6A 4KWPA 3QCXA 3EQIA 4FTKA 1J7LA 4C7TA 3AT3A 4PX6A 4O7YA 4WSYA 4CKIA 4O84A 4YZCA 4MD8E 2AYPA 4NFNA 4GKIA 3LFDA 3GQIA 1YOMA 3MDYA 1MQ4A 1Z9XA 3VNTA 5C1QB 5AV3A 3FKLA 4KIKA 4MNFA 3VULA 5A4EA 3E5AA 3BYSA 3G51A 3A4OX 3COKA 3QTZA 4ZEGA 5IKWA 5BVEA 3UZPA 3MI9A 5CU6A 5DRBA 3FEGA 2XKEA 2R5TA 5E91A 5AP5A 3AC3A 4CTCA 3EQGA 2PSQA 4MXZA 4ZP5A 5D9HA 3E87A 3UYTA 3KCKA 3NUSA 3ODYX 4D1SA 2WKMA 4R5YA 4FIGA 4JL9A 3P7AA 3UMWA 3JYAA 4RPVA 4PDOA 2VD5A 5KKRB 5I0BA 2RFNA 4FK3A 2J9MA 3H10A 3ACKA 3CP9A 3Q3BA 3FUPA 4K0YA 4EQCA 3BCEA 1OM1A 4U8ZA 2Y6OA 2V7AA 1FQ1B 1JSTA 3KY2A 3V8WA 5KHXA 3OZ6A 2GNGA 1Q99A 5M09A 3ORTA 5ANDA 2V62A 3H3CA 4ANMA 5HVYA 3BZ3A 2QONA 4M69A 4L7SA 2Z02A 3ZSIA 2AC5A 4CRSA 4F09A 3PXZA 4M12A 4PDYA 3KU2A 4E1ZA 3FI2A 4BGQA 2F9GA 3FMEA 1BYGA 3ALNA 3QF9A 3LFAA 1RDQE 3QTXA 2JKKA 4UZHA 2QURA 3ZFYA 5E1EA 2OO8X 1IG1A 1LEZA 4C59A 3C9WA 3UOJA 4YTCA 3PXYA 1H01A 4DEHA 2WU6A 2CCIA 3UP2A 4JG8A 2VGPA 4FZAB
chains in the Genus database with same CATH superfamily
1OKVA 4HGTA 3E8NA 3QTIA 4G6NA 2CLXA 2WEVA 4BZOA 5JEBA 3CGFA 3T9IA 2WMRA 3OC1A 3TNWA 5AAEA 3GBZA 1F5QA 2C0TA 1GZKA 3S4QA 3TNIA 3ZLSA 1VZOA 4O0YA 5AM7A 2VO0A 4DT8A 3TV7A 5A4LA 3NFGB 5L2WA 3DU8A 4LL0A 3ZZEA 2GS2A 3TNQB 1QMZA 3D7TB 5T6KA 3DKCA 2YZLA 4A9YA 4NW6A 5DEWA 4RVMA 1NXKA 5CSWA 4S31A 5AUXA 3VBYA 4UXLA 4IM3A 2W05A 4EKKA 3I81A 3FAAA 3R7YA 4XYFA 3E3PA 4IAIA 4UWCA 2WFYA 4EJNA 3LOKA 4CKRA 2X81A 2IO6A 3ORNA 4BTKA 2YCSA 5CSXA 2W9ZB 2BMCA 2W99B 3MFUA 2WMAA 5EOBA 4BHNA 5CNOA 3MH2A 5ANOA 2VTPA 4YJTA 2X4FA 3FE3A 2IEWA 1H25A 1B38A 4MD9E 5JRQA 1VEBA 4NW5A 1OL1A 1ZYDA 2J4ZA 1J7UA 3FMNA 5EW8A 4FRFA 1YXVA 4QMXA 4MF1A 5CVGA 4AGUA 3OS3A 4IHPA 4O7TA 3AMBA 3W33A 4O0RA 5FWKK 2WOTA 3BGPA 5HESA 2Y9QA 2ZM1A 3VBVA 3QLFA 4GCJA 4Q9ZA 2QOLA 1M2RA 3LIJA 3OUNB 4KIOA 4L9IA 4M3QA 4J96A 4XCUA 4UMPA 4TL0A 3EZRA 3HUBA 4QP3A 3LM0A 3M42A 2XBAA 4J99A 5FBNC 2HXLA 3ZFXA 3TG1A 4TKSA 4XP3A 5AUYA 3P23A 5KHWA 2YHVA 1PXPA 4ZTLA 4I21A 3V51A 1REJA 1YHWA 4CLIA 3KXMA 2GMXA 1UU8A 4TN6A 3CTJA 4AG8A 2C3IB 4XV3A 1SVGA 4HNFA 2I0HA 4XG8A 1XQZA 1ZAOA 2C1AA 5F20A 5GZ9A 2A1AB 2XJ2A 3M1SA 3O0GA 3EN7A 2ITYA 2OF2A 5AR5A 3A8XA 3ORIA 2QU5A 4IWDA 2W5HA 2C6EA 4AE6A 3Q9YA 4AGCA 4HVSA 3DCVA 4FEVA 3PZHA 4EBVA 3FLNC 3DBEA 4JS8A 4BIEA 4EH2A 2QOFA 3R71A 4F08A 2EU9A 1VLRA 3E64A 3NYXA 3Q6WA 4DH1A 4MYGA 4MX9A 1M2QA 4RX7A 2OZAB 3PP0A 3EYHA 1BKXA 3DJ5A 4MXCA 4BF2A 5I9WA 5KE0A 5DR9A 2F57A 4JBPA 4DHFA 4DC2A 3LCSA 5CXHA 3WZEA 2PVRA 2X9FA 4HPTE 4AU8A 4E6CA 3BYMA 4GV1A 4ACHA 3QTQA 4B9DA 3HX4A 4ZJJA 4C58A 5KMNA 3AOXA 3V6RA 3T3VA 3UDSA 2UZUE 3KVWA 4M0YA 4LUEA 4O7RA 4TWOA 2OFVA 3WIKA 4QP1A 4JBQA 3GC7A 4Y72A 3VO3A 4O4EA 4IB0A 2CHLA 3G15A 4YSMA 4MUQA 3TYKA 3RPOA 3MY5A 1OB3A 1YOJA 2BRBA 2FSOX 3A4PA 3P08A 5CYIA 4QTBA 2QQ7A 4U81A 2FH9A 3UVPA 2BZIB 2RFEA 5E8YA 4C3FA 4DFXE 3KN5A 3ORKA 3OT8A 5FQDC 2PUIA 5KKRC 1YQJA 4MF0A 3KMUA 4Z9LA 4UWYA 2YCQA 2ONLA 1OIUA 5CVFA 3QTRA 4ANQA 3EQPA 1OGYA 2I6LA 4O21A 3KRXA 4V04A 3CD8A 3G0FA 3NAXA 4OTPA 3SV0A 2WU7A 4X0MA 5TR6A 4MXYA 4YPSA 3RM6A 4BFMA 1UNHA 3B8QA 2R3LA 3A2CA 3W8LA 4IB1A 2BROA 3Q9XA 4AN2A 2CCHA 3KRJA 4AXAA 2XNNA 4CRLA 4WNKA 1PMNA 4RT7A 5HGIA 3LW0A 1R39A 4C61A 4U3YA 5JKGA 4K18A 3UGCA 5CEKA 2PUUA 4I3ZA 2OJIA 4BI0A 3PYYA 4GIIA 3CC6A 3WF9A 5CZIA 2VTAA 2FA2A 2R3KA 3VC4A 3ZU7A 3UP7A 1FMKA 4D55A 2J5FA 3EQBA 4MBLA 2X0GA 4KIKB 1FVVA 5IG1A 2EVAA 4TPTA 2HZNA 4IX5A 4ANLA 3GOPA 3S3IA 3UC3A 2XK8A 4R3PA 3PSBA 2R7IA 4XP0A 5DT4A 2HY81 3FKNA 2I0EA 2YIRA 5J7BA 3NIZA 4ACDA 4EHEA 4KBKA 5AUVA 3FLZA 5BVWA 2VU3A 4S2ZA 4QTDA 4XP2A 2BHEA 2C30A 4FTUA 3SC1A 2IG7A 3QKLA 4DBXA 4LV8A 2GS6A 2R0IA 2W4KA 4MNEA 3V5WA 3VF8A 3FMHA 4RZWA 5L6OA 2F7EE 4E6DA 4XG3A 3VJNA 4CLJA 4R7HA 4ALWA 4FEQA 1W0XC 4OGRA 3SG8A 2XNOA 3IGGA 4DEDA 4EL9A 5KMKA 2PVKA 4M69B 2X0PA 4FSRA 3VF9A 1QL6A 3AC2A 4EOJA 4YO4A 1CM8A 3DAEA 2WMBA 4CFUA 2C5YA 4HYUA 1CDKA 2HW7A 3G90X 4G16A 5KBQA 4HZSA 3EFLA 5ANEA 3PPJA 2ZM3A 5AV2A 5HE3A 5D12A 5EHLA 2BRMA 3PWDA 2OIDA 4DLJA 1KV2A 4HGSA 2A27A 2FSMX 3BV2A 4JLCA 1SVHA 5JFWA 4MTAA 4TRLA 5LVOA 3U6HA 4MQ2A 3R22A 4TY1A 4DEAA 4EJ7A 3I7BA 4C4IA 5EYKA 3FXWA 3QRIA 4DTBA 4IAKA 1BLXA 4RLLA 2PZIA 5EDPA 4F9CA 1H0WA 4RWKA 3LZBA 1OL2A 2C5VA 3I4BA 2Q0BA 4CFMA 1KE7A 4BKJA 4RLKA 4F7NA 3O96A 4L52A 1YWRA 3KEXA 2QO7A 5JGDA 2IZUA 4GSBA 1ND4A 4G34A 1ZRZA 4AXFA 4UY9A 2H34A 2PVFA 3HV4A 4AW5A 2C68A 3MA3A 1ZMWA 4NM5A 3VAPA 4D9UA 1ZARA 2ESMA 4CV9A 4N57A 4RIWA 2JBOA 4BR3A 2UZNA 5CEIA 3NRMA 4FSQA 4HYIA 5CANA 4FI1A 3TCPA 1UNLA 3IW6A 4GH2A 3R8MA 3TUBA 1OBDA 4IZ7A 1CKJA 4G3FA 4G5PA 4NH1A 5L6WL 5GJFA 2IPXA 4JBVA 3OFMA 3GEQA 3OOMA 3ALOA 4NTSA 4YPDA 3E63A 3OWJA 1WAKA 5AV1A 3RZFA 4PL3A 2PE0A 2JIIA 4MH7A 3BQRA 4DITA 3WF5A 3C4WA 4AA5A 1UKHA 5DHJA 5HZNA 3N4UA 2KTYA 3CPCA 4RX5A 3MY0A 1ZY4A 3E93A 4I6HA 2YWVA 2WOUA 3FY2A 4FF8A 3QKKA 4DCAA 2JDOA 1URWA 2YJRA 3PP1A 4EORA 2J51A 3MPTA 4NCTC 4RX8A 4BCFA 3TUCA 4ZMEA 3QA0A 4NJ3A 3EL8A 4FG8A 5J95A 4AZVA 2ITOA 5HE1A 3UNJA 5JQ8A 3KVXA 2J7TA 3Q4CA 4Y46A 4C62A 5KX8A 3NFFB 1P4FA 3F66A 4Z16A 2VO3A 2WTJA 3FQEA 3ZBFA 4ONAA 5HNBA 5FEQA 4EH5A 3LCDA 1OZ1A 3GC8A 4JDHA 4JRNA 4OUCA 4W9WA 3E7OA 4ALUA 4IJPA 4OR5A 5IA0A 3DY7A 5EW3A 3SD0A 4B6LA 3UOKA 3VUTA 2PMIA 4U7ZA 2BVAA 3LXNA 5H9BA 3DBDA 1G5SA 1U59A 3CJGA 4DEGA 2RIOA 4E5BA 3VHEA 4IQ6A 4RJ4A 3PJ8A 4FMQA 1YVJA 4O7ZA 2HZ0A 5DRDA 4O1PA 3QQKA 5DE2A 4H1MA 4OBQA 4BICA 4BCOA 5HVKA 2XALA 4YTFA 3EYGA 1ZYLA 5DWRA 4EHZA 3THBA 2HAKA 3DOGA 3SW4A 2O5KA 2PMNX 3H0YA 2YIQA 5CT7A 4RA5A 1JKLA 4TXCA 2J5EA 3RCDA 2YJSA 3KQ7A 5C01A 3UDBA 5HTIA 3SGCA 4IWOA 1SNUA 2XK6A 2Z2WA 4GIHA 4GMYA 4CCBA 1H00A 2IZRA 4P5QA 2XRUA 4CFVA 4FKUA 5AR7A 4I0TA 4E4MA 4G9CA 2VWIA 5M44A 3UDZA 4KBAA 2W96B 3VQHA 4ITJA 4AOTA 2IZTA 2OJFE 5EM8A 2B9JA 4JG7A 4KSPA 3O7LB 3OY1A 4MAOA 3R1NA 4IC8A 4GU6A 1PXLA 2HCKA 4FNXA 4OW8A 4YC3A 4ASDA 2PMLX 3F3VA 2ZV9A 1M52A 1OI9A 1GIHA 4FYOA 5KCVA 3VONA 5IZFA 3UO5A 3BHUA 4OAVB 4R7BA 3KN6A 1H1QA 2OH4A 4B99A 2JC6A 2CPKE 2X39A 4TWNA 2IJMA 4RVKA 5EM6A 5AA8A 2W0JA 2Y4IB 2Y4PA 3BX5A 3FMDA 5A14A 5FXSA 4C38A 4EC8A 5K0KA 2XYUA 5CLPA 3QD3A 2VAGA 2YM6A 2NRUA 5AP3A 3MPAA 3BLAA 3E88A 4DF3A 2O0UA 4FNYA 3F7ZA 1PXOA 3DT1A 2H96A 1Y6BA 3LFFA 3Q04A 2YM4A 4Q5HA 2NRYA 3RZBA 4AAAA 4CMTA 4FKOA 4AT3A 4M14A 4AN9A 4AT5A 4QP4A 4ZS4A 1NW1A 4RIYB 2OXDA 4IVBA 4JAJA 4FNWA 2QR8A 2WB8A 3W0RA 3UOHA 1PXNA 3F3TA 3QQUA 2YCRA 4RZVA 4F99A 2VN9A 4N6ZA 4D2TA 3P9JA 2CDZA 3EFJA 5B2KA 1V0BA 5E4HA 5M51A 4D1ZA 2AC3A 3DXPA 2ETMA 4FSYA 3RCJA 4QEBA 4D2PA 4ANNA 3G0EA 4U6RA 5FRIA 4JMQA 1FVRA 2OH0E 4BDDA 2YFXA 3EN5A 5FBOA 5F1ZA 4R3RA 2X2KA 3R9RA 3QA8A 3UMXA 4CQGA 2RGPA 3F5GA 4EK4A 5E8VA 3UO6A 3KXXA 1YRPA 3BWJA 3DK6A 3H9FA 4RC2A 2VX3A 5AR3A 4APPA 2X0QA 3KRRA 4YJSA 3NCGA 2OW3A 5CU0A 2PZYA 3VN9A 5IU2A 4YURA 4BKYA 3CIKA 2HWOA 4QMOA 4JQEA 2C6KA 1BMKA 3KF4A 4AT4A 1VJYA 5LARA 5CEMA 4W9XA 4ZSGA 5IDNA 4MNEB 2BIKB 4OT5A 5CF5A 5LWNA 4PP9A 2UZVA 2CN8A 3W2RA 5I9VA 3Q9WA 4D58A 4F1OA 3ZMMA 3TTJA 1T45A 4O4BB 2GQGA 3GC9A 4KRCA 4WO5A 3ROYA 4EC9A 3U4UA 5GIOE 5I3OA 5IEYA 5DN3A 1J1CA 4IADA 3KCFA 2OJGA 3LQ8A 5BVNA 4ZY4A 3U4WA 3IDCA 2WEIA 2FYSA 3N51A 4FT0A 3BBWA 3FV8A 3NAYA 2YM8A 3QFVA 2NPQA 5AFVA 2XAMA 5L8KA 4U45A 4WG5A 3NW5A 2UVYA 3TDWA 3QRTA 5CAPA 4C2VA 4WHZA 4V0GA 4BGGA 4AOJA 3FZSA 1SVEA 5AX3A 5CSHA 4QMSA 4TW9A 1XBBA 5FUTA 4X2FA 4DG2E 5IH4A 1UU7A 2V0DA 1H24A 4K6ZA 3OT3A 2NYAA 4FKSA 3ZLXA 4C8BA 1W98A 1FGKA 3M11A 2BDFA 1JWHA 3LXKA 4WOVA 1SZMA 3BEAA 3CQWA 3ZRMA 5GJDA 4XG7A 4F63A 5KMJA 4GG7A 1O6KA 3WZUA 3QRKA 4XLVA 5AUWA 2Z8CA 2OJ9A 3TZ9A 2J0KA 4RVTA 3KULA 3T8OA 4JX3A 2JDRA 2BDJA 1MUOA 5DI1A 2Y7JA 1YDTE 2GNFA 2X7FA 3NUPA 3EWHA 3QU0A 4G1WA 4B0GA 1M17A 2W4JA 4DGMA 5IMXA 3O8TA 5CU4A 4USDA 2RFSA 4IB3A 3MJ2A 4LRMA 4W8DA 5DNRA 2FO0A 4C2WA 4RIWB 3CBLA 5IEXA 2DUVA 5JZNA 5A54A 5K5XA 1GIIA 4NKAA 2RF9A 2ITZA 3UPZA 4NTTA 3R04A 3R1SA 1UKIA 5IUHA 1A48A 1OIRA 3NR9A 3OTUA 4K1BA 1SNXA 5ACBC 3FC1X 5HOAA 3LFSA 4QMZA 5CY3A 4PMTA 2R3NA 4U42A 4KUJA 3KK8A 1LUFA 4E73A 3FZ1A 3QXOA 1CSNA 2W06A 3UJGA 3ZSGA 4FSWA 4DLIA 3GU7A 3G33A 2P2HA 3U51A 2XRWA 3EQFA 2YERA 4JR3A 2E9UA 4RMZA 5DA3A 4I5HA 1Q5KA 4ZOGA 3FWQA 4EH6A 3KL8A 2EB2A 5C9CA 3SOCA 4YJPA 3ET7A 3DPKA 5DT0A 1G8KA 2VV9A 2VTRA 4IVAA 4DAWA 2UW4A 2XM8A 1ZXEA 4BWPA 4AE9A 3C13A 2XB7A 5J8IA 4OTRA 4ASXA 3ANRA 3U87A 2B52A 5IEVA 3RWPA 4RQKA 1V0PA 2YLEA 3O51A 3IW4A 1K9AA 3FXXA 2GDOA 4UBAA 3LMGA 4UMUA 1XJDA 4Z3VA 3F5XA 4BCGA 4JAIA 1H08A 3UG1A 3O5AA 2Y4IC 4JRVA 4DDGA 1NT2A 5M4UA 2WTVA 4YNEA 3ZO1A 1JKSA 1HCKA 3FI8A 3FQHA 3QQGA 2ITXA 2ITWA 4IX6A 3BL7A 4YU2A 4XG2A 5HD4A 5J9LA 5FTGA 4FV5A 1QPCA 2ONLC 3K3JA 4BCPA 4FSUA 3NUAA 2XEYA 4BJJA 3ZCLA 4JJRA 2OFUA 5AR8A 5HU9A 2DYLA 2W1EA 3PJ1A 3TKUA 4EBWA 3EQHA 3EQRA 3G5DA 4MWHA 4QMWA 1ZMVA 5AIKA 2C6LA 4IMYA 4FJVA 3SA0A 3R00A 1R3CA 3OEZA 3MW1A 3QWJA 3ZUTA 4LYNA 2XMYA 1KSWA 1A9UA 3DS6A 3L9PA 5AV0A 3MJ1A 4P2KA 5FGKA 3U9NA 3AG9A 2WQNA 4GK3A 4DDIA 3DBFA 2IVSA 3UNKA 1Q3WA 3RMFA 3PVGA 5CSPA 2ITUA 2C3JA 3ORLA 4ID7A 4XRJA 5ETFA 1JKTA 3KMMA 5BMSA 2BUJA 2XUUA 4I93A 4EOSA 4FX3A 4XLIA 3RWQA 4AZFA 3TI1A 1XO2B 3AGLA 3JXWA 2JFMA 3R8LA 5E8ZA 4E93A 2CNVA 4I4EA 4RFYA 4N4SA 5BYYA 3CD3A 4BDFA 4BHZA 5L4QA 5HD7A 4BVUA 3K3IA 2HY0A 2BFYA 5ANJA 3RALA 5I9XA 3D5VA 3HP2A 4FKWA 1FOTA 4MHAA 4YHFA 5AP0A 3KIOC 4YJVA 1PYXA 4QP8A 1GY3A 2YDJA 3BIZA 1YI4A 4I5CA 3DBCA 1UNGA 3BGZA 3R7UA 3MYGA 3BI6A 2WTIA 4FG7A 3IKAA 4U5JA 5I9UA 5LMBA 4ZSAA 4GU9A 1SYKA 5H8EA 4U79A 5HBHA 2VX1A 4GRBA 2FSTX 3O7LD 3HZTA 4O83A 5D1JA 4FZDB 1QPEA 3ENMA 4AFJA 4I6QA 5AA9A 4ZZMA 3HAMA 3LPBA 4FKPA 4UYNA 1UWJA 4AS0A 5TKDA 3F82A 4CKJA 2C47A 4CV8A 2WXVA 5FEEA 4F0GA 4XG4A 2PVNA 4I6BA 1LR4A 1DAWA 3VWAA 5E8TA 2UZBA 5IH6A 4NFMA 3I5ZA 2WQBA 5HO6A 5A4CA 3HUCA 4D28A 4O7VA 3WYXA 4NEUA 1KOBA 3MS9A 3OXTA 2CMWA 2X4ZA 1OIYA 4FEWA 3GT8A 4P5ZA 3WI6A 2F4JA 1ZOEA 4IM0A 4F6UA 4O0XA 1FMOE 3DXNA 3ZO4A 5FTQA 1Y91A 5IA1A 4TT7A 3U6JA 1I09A 4ZJIA 5C8KA 2ITQA 4XNEA 5AUTA 3FMKA 5TT7A 2UW5A 3E8EA 1ZZ2A 3OEFX 2X1NA 3QQHA 4OLIA 2YM5A 3BLRA 4LV7A 4ANOA 5FLFA 5IQBA 4JDIA 2XBJA 1NY3A 1K2PA 1STCE 4FT9A 3RGFA 4WNOA 2VWVA 1U54A 5AV4A 4YUQA 5KBRA 2B0QA 5EK7A 5EQEA 3HRCA 4I1ZA 5JN2A 4RQVA 4LRJA 4HPUE 3QYWA 1YDRE 2WHBA 4RWIA 4TZRA 2O63A 4DHJA 3V5PA 4AZEA 2B1PA 3F3ZA 4XOYA 2B9IA 5DEYA 2PL0A 4BTFA 4E4NA 3KMWA 3BHHA 4PNIA 5M4FA 3PIZA 1ZYJA 4BCIA 4R8QA 4BDAA 3IW7A 2Z7SA 4EOLA 1WVXA 4ACMA 3QGYA 2XZSA 4FTIA 4IAAA 1TZDA 2XIXA 2QOKA 4J53A 2AEGA 2QVSE 2WMXA 3EJ1A 4PY1A 5JGAA 3R01A 3O50A 3RP9A 1H27A 3PTGA 4ZTMA 5D41A 3ZO3A 3SVVA 4PNKA 4FEXA 3OBJA 3KULB 4LMNA 4WBBB 3LE6A 2ERZE 1IRKA 3PFQA 3NUYA 4NL0A 5JZJA 3AT2A 3DNDA 4FTAA 4AW0A 5CAQA 4KAOA 5FTOA 1JSUA 1E1VA 1F0QA 1IAJA 5CAOA 2VUWA 3L1SA 4L45A 3T3UA 1E9HA 1GZ8A 1X8BA 3DV3A 2BFXA 3GCVA 4QYEA 4RX9A 5D11A 4YTIA 4A9TA 3I5NA 5IDPA 4FVRA 5LJJA 3ZRLA 2EXEA 2J50A 5J9ZA 2W1ZA 3PVUA 4TYJA 3RK7A 3HLLA 3L9NA 1Z57A 1WBTA 2DS1A 3LCOA 2YM3A 4JT3A 2BCJA 4C0TA 2ZDUA 4EWQA 4F4PA 2IWIA 1GZOA 4FV9A 4H3PA 4L46A 3IOKA 4AFEA 2PE1A 4X2KA 3HVCA 3WYYA 2C6MA 4V01A 4BBEA 3HNGA 4EZ5A 2F7XE 1ZLTA 4M66A 3OCGA 4YJNA 3ZTXA 4CT2A 5D10A 3DKOA 4EK6A 1CKPA 3Q2JA 4AGWA 3C0GA 3QUDA 2X8DA 1W83A 5DOSA 1YHSA 1OPKA 3QQJA 1B39A 3QTUA 4QD6A 4FTNA 3CLYA 3PSDA 3G6GA 2IZSA 4KBCA 3KXHA 4YHTA 5L3AA 5BYLA 4J71A 2C0IA 1W2FA 3I1AA 5JSMA 3MB7A 1QPJA 4AXDA 4XUFA 3WF7A 4F7LA 2ETRA 5AX9A 1P5EA 5D7VA 1H8FA 5A46A 2OI4X 3POOA 4XMOA 3VS3A 4PP7A 5IISA 4CFFA 1ZOHA 2QG5A 5ETCA 3LFEA 3NNUA 3DDQA 1BL6A 4P4CA 3H9RA 3NNVA 2BRGA 4Q5EA 4WIHA 3DDPA 4CFWA 3UVQA 5CU3A 2B55A 3R02A 4EUUA 2QOCA 5AP6A 1JAMA 2ZOQA 2VWZA 3D9VA 5FP6A 4DG0E 2VTLA 2EB3A 5A4TA 2R9SA 3IW5A 3FBVA 3MA6A 2B4SB 4O0VA 4L6QA 5B2MA 2BR1A 4NJDA 3VUIA 3IW8A 3O8UA 3AKKA 4K33A 4BJJB 4YO6A 5E8SA 2QOIA 1BI8A 4KIQA 5AP7A 1S9JA 4A4LA 1OL6A 3QUPA 2GNJA 3K5VA 3BELA 5L2QA 4AXCA 2XNMA 3OROA 4HVIA 3OCSA 1R0PA 4BDHA 4QMNA 4YSJA 1VYWA 5CNNA 1JBPE 2XEZA 3V3VA 1OVEA 4IAZA 3DTCA 2BHHA 3GVUA 5LMAA 4IZAA 4BDJA 4FNZA 4U43A 4H1JA 3AQVA 1W8CA 3VS4A 4CYIA 4GT5A 4LFIA 3BE2A 3G2FA 1E1XA 5C03A 2P0CA 4TNBA 1YI3A 4E8AA 1P2AA 3SW7A 3OXIA 1YXSA 4GT3A 4A9RA 4ZTRA 3JUHA 5HTCA 4ORKA 5FDXA 3CY3A 4O4CA 3RK9A 4D4VA 3ORPA 4PV0A 4O86A 4CGAA 4XH6A 3UQCA 2HENA 5AR2A 3QD0A 2YIWA 3B8RA 4HYSA 3I60A 3VBWA 3V5LA 5L2IA 3AKLA 1XKKA 5CX9A 4C3RA 1FGIA 4CSVA 5ACKA 3RHKA 5IQHA 3C4ZA 1PMVA 5AIRA 3C5UA 5F94A 4QTCA 5C8NA 3PY3A 4L00A 3AGMA 2YISA 2UUEA 1O9UA 2GFCA 2XS0A 1EH4A 2Z60A 3ORZA 3QQLA 3FXZA 4BGHA 4E3CA 4CFNA 5BVKA 3W1FA 1U5RA 4K11A 2Z7RA 4EH3A 1GOLA 4ZTHA 3OP5A 4BZNA 4ZZNA 4LDTA 3P86A 3Q52A 1JLUE 2O8YA 2R7BA 3MSSA 4NIFA 4L42A 3RPRA 4WG3A 5A9UA 3O23A 3P0MA 4RFMA 3D7ZA 3D83A 1OUYA 5FM2A 2XAOA 5D7AA 4S32A 3EOCA 4FGBA 3TM0A 2VWBA 3K5UA 3MFTA 5K9IA 5BUEA 4ZZOA 2CGUA 4F6SA 3R2YA 4XX9A 2JGZA 3LMIA 4PDSA 4JQ8A 4QTEA 3D4QA 4FV0A 5L8LA 4I5MA 2WMVA 3DZQA 2GHMA 4FZFB 3S0OA 3QD2B 4XV1A 3WF8A 1ZWSA 4CMOA 3CTHA 3W0QA 4U9AA 2BTRA 4F78A 3QUEA 3I7CA 3QX4A 3VUDA 5DT3A 3VS2A 2UW8A 4D2RA 4EQMA 2XYNA 1PMUA 4QPMA 2BPMA 1FBNA 2XNGA 5KMMA 1G8SA 4OTGA 3GU4A 3OXZA 3W0SA 5HHWA 2PVLA 2R4BA 4H3QA 3IONA 5E90A 3OWPA 3TJCA 5I5ZA 2G2FA 4XV2A 3WE4A 3EKNA 3D15A 3IK3A 3BHYA 4WD5A 5G6VA 5DIAA 4RC4A 4GYIA 4Y73A 1BI7A 2QOBA 4EWHA 2R3PA 4F65A 2J0JA 4F9BA 2PMOX 4FTCA 4MKCA 2XM9A 4OT6A 1U54B 2R3QA 5FP5A 1CTPE 5H8GA 4PTCA 4KKEA 4A4OA 4O4FA 2WTKB 1OKWA 3DB8A 1OECA 3WIGA 3ERKA 3NUNA 3O17A 4XS2A 4ZLZA 4EH8A 3BEGA 1IR3A 3EFKA 2OIBA 3GXLA 3PA4A 5E7RA 5F4NA 5HEZA 5IQFA 3P4KA 5HG7A 2ZAZA 4WG4A 4DGOA 1Q8TA 4DG3E 5CU2A 3JR1A 4AWIA 1OITA 3NWWA 4AW1A 3O71A 2W1GA 3RAWA 2A2AA 4RC3A 5B0XA 3FSKA 2BRNA 3FHIA 4FV1A 2UW9A 1MP8A 3NLBA 1KV1A 3BV3A 4PWNA 4DGGA 2C6OA 4G9RA 3R7EA 4ZLYA 2X0OA 3UIXA 5A6OA 4QP9A 4R3CA 1Y8YA 3LFBA 2WIPA 3QYZA 2X8EA 3LQ5A 5C4KA 3WBLA 4ZSJA 3TZMA 1WMKA 2YLFA 3OHTA 4X3FA 2XIRA 4PDPA 3WILA 1L8TA 3UQFA 2VTTA 4PMPA 4I94A 1VR2A 2HIWA 1Y8GA 1UV5A 3R83A 4BKZA 5FDPA 2XANA 3RHXA 3SXFA 2WTCA 3WARA 2XCKA 5CASA 5L8JA 2XIYA 4ANBA 3GB2A 3R73A 5JMSA 3W0OA 2C6TA 4D5KA 3IO7A 1NA7A 4RWJA 3QHWA 4FYNA 3PPZA 3N9XA 1RE8A 4G3GA 4RG0A 2WMSA 3EZVA 2V22A 4G17A 2WZJA 3GOKA 4FA2A 3A62A 3R9HA 1RJBA 2R3HA 4UYAA 4FTTA 2YDKA 4DEIA 4QMLA 5FXQA 2ZV7A 1R78A 3D14A 4ZMFA 3ULZA 2WNTA 1ATPE 3EQDA 4QYGA 4ASZA 5IMEA 3KGAA 3Q32A 5EKOA 4DN5A 3TACA 2GTNA 5EOLA 4HCUA 3VW8A 5LQFA 2R64A 1PXIA 3MVJA 3OOGA 1XMLA 4P90A 5K4IA 5IUIA 2QHMA 4I23A 1WZYA 2HW6A 3HMPA 3QC4A 4PL5A 3BYUA 5HLPA 2ETKA 4QDVA 5EQYA 2LAVA 3VS0A 4J52A 4KKHA 4O96A 4QMUA 3ODZX 2C4GA 5EHYA 4F9AA 2JBPA 4ZS0A 1ST4A 4M68A 3DKFA 3DK3A 1Z5MA 3KA0A 4KINA 2W17A 3UQGA 2A4LA 4YZNA 3NUUA 4XEYA 4IH8A 5ETAA 4K9YA 4F6WA 2PPQA 2PYWA 4AA4A 4I20A 5CVHA 5HCYA 3SOAA 4H39A 1AGWA 3OMVA 1J91A 1GIJA 4MXAA 3D2KA 4LOOA 4PPCA 4C57A 1MRUA 5DR2A 4ERKA 2PVJA 4WUAA 1MRVA 2WQEA 3W2QA 4FT7A 2ZB1A 2QOOA 3TIYA 4E6QA 3ZC5A 5HX8A 4WT6A 2WD1A 3F61A 2P33A 3OBGA 4E5WA 3UVRA 3V6SA 4UX9A 3HGKA 2WTDA 3B2WA 2ZDTA 4RFZA 1YHVA 2BAJA 2XKFA