4U41A

Map4k4 bound to inhibitor compound 1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
295
structure length
275
Chain Sequence
SSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEIKLEINMLKKYSHHRNIATYYGAFIKKSDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 275
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u41A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u41A01
3DBCA 4FKWA 3W55A 2F9GA 3D5UA 3PY3A 2OJFE 1YI6A 2F7ZE 4FTRA 2XJ0A 3PG3A 4ITHA 4RIYA 4D4RA 4CKIA 4OUCA 3S0OA 3E3PA 5J9LA 5BVKA 1RE8A 1B38A 4L3JA 2EXMA 2ONLA 4P5QA 2OJJA 5HO8A 4FEXA 2CKEA 1Y6BA 3M11A 4L01A 5HTIA 3LLTA 1SYKA 4FE2A 1H0WA 4C3FA 5KMOA 2A2AA 3FUPA 2GS7A 3LM5A 3ALOA 3P78A 1GIHA 2HXLA 2QC6A 4W4XA 5EI2A 2ITTA 2UW6A 2WMBA 4NJ3A 4O0VA 3D15A 3RJCA 5ANIA 3MA3A 3VS4A 4MBIA 4D28A 2P33A 4PDSA 1GAGA 1KV2A 3B8RA 4AN9A 3HAVA 4O7TA 3AGMA 3OS3A 3NNXA 4D4SA 4BDGA 3PA5A 4H3PA 1ZWSA 4BBFA 1S9IA 2W5BA 4IJ9A 4E20A 5H8GA 2Z02A 2GU8A 5IEVA 2Q83A 2VRXA 3OG7A 2C0OA 1Q4LA 4ERKA 2GNLA 2CLXA 2QLUA 5EYMA 1O6KA 1ZYDA 4X6QC 3DKFA 4V04A 2CGXA 3JY9A 4CKRA 5HVYA 4XBUA 4PNKA 4GT3A 3PSDA 2XH5A 3P79A 2PZYA 4W8DA 3ZBFA 2R7IA 3ZEPA 4FKUA 3ZLSA 4KD1A 5L3AA 5EHOA 2VX0A 1Q61A 2C3JA 4AT5A 3RPRA 4JBQA 3CD3A 4TN6A 5B2MA 3F88A 4YJVA 2IWIA 3F5GA 2YAKA 3FYJX 4AGUA 4ENYA 3T9IA 3ORLA 3C4XA 2C4GA 4O84A 4BCGA 2VTLA 3QFVA 1ERKA 3S2PA 4FA2A 5BX0A 3LJ1A 5K4IA 2YCQA 4IB1A 5CF8A 4RMZA 4LFIA 4LOPA 2IJMA 4C7TA 3ITZA 4GG7A 4IX5A 5JGAA 3T8OA 4JR3A 4LUDA 3NIEA 1MRVA 4FUYA 4NKAA 3R8UA 3HAMA 2XUUA 1YXXA 2GFSA 4PTEA 2YM3A 1IA8A 3PIYA 4ZJVA 2REIA 4CT1A 2JBOA 3GGFA 3ANRA 4YC6A 2F4JA 2HZ0A 4XG4A 1GIJA 1FVVA 2AUHA 3RAIA 3QA8A 4IAZA 3D14A 4G34A 4LGDA 3CKXA 5E8VA 2WTKB 2GQRA 3PE2A 5KE0A 2IG7A 2QOFA 3FXXA 5JFSA 5CZIA 3QQJA 3I5NA 4GK4A 4NK9A 4U9AA 1TVOA 4NIFB 3O50A 3SKCA 1T46A 4GL9A 4DE4A 4ANBA 3KULA 5M09A 2VNWA 4P5ZA 1P4FA 4OAUC 3NYNA 4QTBA 4KAOA 4U3YA 4CFWA 2YDKA 4MF0A 1W82A 4UBAA 2V55A 3ZUTA 2VTRA 1UNHA 4RIOA 1ZOGA 3GBZA 4LMNA 4FUXA 2YHVA 4O6EA 4DT9A 4IVDA 5I9XA 4DTAA 5L6OA 4MXZA 4RIWB 5FTQA 3AT4A 1SNUA 1XHAA 2IPXA 3SVVA 2XKCA 3CP9A 3MSSA 3A8WA 4EBVA 4XG3A 2VWBA 4DT8A 3R1YA 3C0IA 1LP4A 3UC3A 5TF9A 3G0EA 1LPUA 3QRTA 2VWIA 1VZOA 5DR9A 3Q9YA 1FBNA 4JVGA 4F7JA 3PJCA 4EH3A 1IEPA 3DNDA 2CNUA 3E7OA 4XCUA 2O64A 2WU6A 4RJ8A 3W2QA 1LUFA 5FUTA 3QTWA 5CSHA 3R9HA 3MESA 1RW8A 1OL6A 5M4FA 4CFNA 2XCHA 2QOBA 3GC8A 1YOLA 4QP2A 2YITA 1M17A 3P7BA 5DBXA 1TKIA 3FMHA 4OGRA 2QD9A 4X7QA 4XNEA 2FA2A 2QQ7A 4HPUE 1YRPA 3FKOA 5CT0A 3CXWA 3VUIA 3A8XA 1J91A 4MTAA 4LUEA 5JKGA 4XG7A 3G90X 5DHJA 5EM8A 4HYUA 3FAAA 4HW7A 4G5JA 2WAJA 4XOYA 4F9BA 2UVXA 4TYGA 2ITYA 3R2YA 2RSVA 4EONA 2XK3A 4EWHA 3QZIA 2X9EA 4C61A 3UOLA 3S95A 3Q32A 3QZGA 4YP8A 5IZFA 1UWJA 1YQJA 4GMYA 3R8VA 5HE0A 3F69A 1DI9A 2C6OA 3Q9XA 3U9CA 1FQ1B 3M1SA 4ITJA 5A46A 4QQCA 1WFCA 4FOCA 1ZARA 4DEBA 5A4LA 4JXFA 5AP1A 4BDKA 4KIKB 3NUNA 5M51A 3ATTA 3NPCA 4HCUA 4Q5EA 5C27A 2I0HA 4BF2A 2P2HA 3DQXA 4LRJA 2GS2A 3BHYA 2R3JA 3AC4A 3PVGA 2CKQA 4HVIA 1E9HA 3VAPA 2G01A 3ZS5A 4G31A 5G1XA 3E64A 5AV1A 2UVZA 3AC3A 4CFUA 3MIYA 4E5BA 3IECA 5BNJA 3CCNA 4RX9A 2BDWA 4XV9A 4BBMA 3WI6A 4IJPA 4U0IA 2VGOA 3R22A 4J8MA 3TNHA 5IG1A 3H30A 3LFAA 3F82A 1URCA 2R3IA 2QOQA 3EYGA 4PRJA 1I44A 3QF9A 3Q6UA 5LQFA 2ZV9A 2YIQA 3TDWA 1HOWA 2FB8A 2HXQA 3LJ2A 5CF5A 5IQAA 3UE4A 4MAOA 2BZKB 5IMXA 1GNGA 3MIAA 3LCOA 4UXQA 2JKMA 2IZSA 2OFUA 2XRUA 2DUVA 3D4QA 3R73A 3FZTA 4FK6A 5DI1A 3VS2A 1NVRA 1YHVA 3RPSA 3BYMA 3EL8A 3ID6C 3Q04A 3DBQA 4F1MA 1EH4A 4ARKA 2XK4A 4FT7A 5LMAA 4A9RA 1RJBA 1H01A 2IZTA 5ACBC 4ZMEA 1IASA 3KCKA 2VGPA 3V6RA 5AP0A 2OH0E 5J7HA 2PVMA 5CVGA 4UY9A 4BWPA 2EXEA 2JFMA 4KINA 4WUAA 4DEAA 4FZDB 5L2SA 4FL1A 3TN8A 3VBXA 4C38A 2PULA 4D2WA 4IX6A 4JT3A 4BI1A 4EC8A 4EOOA 3KQ7A 3QHRA 5FTOA 2OBJA 3AMAA 3QQUA 4IWOA 4UWBA 2CSNA 5EI6A 3ZH8A 4WD5A 2WMQA 4EQUA 4DH8A 3PRFA 4XG2A 2PZRA 4WSYA 2OKRA 3FKLA 3LFFA 5D41A 4R7IA 3VIDA 3SRVA 2W9FB 3PA3A 4Y8DA 3ZOSA 3UTOA 2IZRA 4Z16A 4I20A 2Y6OA 4R7BA 2O3PA 2GSFA 4PTCA 3EN6A 4QP3A 4OT5A 5I0BA 4DH5A 3D0EA 4ASDA 4CMOA 2RFEA 3R9RA 3PP0A 4B99A 3VS5A 2IW8A 3MH3A 5E8ZA 3R9NA 3I6UA 3U51A 3MGYA 2F49A 4I4EA 4JL9A 2WFYA 2YM8A 2XNBA 1K2PA 4I41A 2JDTA 4ZTRA 1DS5A 4AU8A 1OIRA 4ZEGA 4AG8A 3U6JA 1ZYLA 2JDSA 4RA5A 2VTPA 3UG2A 1QCFA 2WPAA 4DGGA 2I0VA 2C0IA 2C6TA 2VWYA 4RQVA 5HCZA 2B7AA 3QXOA 1DM2A 2VUWA 3KMWA 5H9BA 4A9YA 4AN3A 2W1EA 5AV0A 4D0WA 2YM7A 4OTWA 2QOCA 3C0HA 3JXWA 3R21A 3AT3A 4MKCA 5CTPA 3OVVA 1H26A 4EHGA 3MVJA 3UYSA 2W1DA 3KXMA 3BWFA 2VD5A 5CAQA 2XYUA 3CTHA 4KRCA 4WBBB 4LOOA 1UU7A 4AE9A 3LOKA 4XV2A 3F61A 4IH8A 5E8YA 5HKMA 3FMKA 5BVFA 5GZAA 4KSPA 1ZZLA 2OJGA 2J50A 2WELA 4BTKA 4IFCA 5HX6A 3TUBA 2P0CA 1AQ1A 1WVWA 3G51A 5J5SA 3V8WA 4YU2A 2C6KA 4AX8A 4O7VA 4LRMA 5LARA 4ZIMA 3D5XA 2WKMA 2B9FA 3IOPA 3F3UA 2QOIA 5CAVA 3C50A 4WNMA 3VS0A 3K54A 4YLKA 2PU8A 2RL5A 4E73A 3IS5A 3ZLXA 4LRKA 5DRDA 3QRIA 5CS6A 3TKHA 3R8PA 2PSQA 3V5QA 4BTFA 5EKNA 4YHTA 4FZFB 1IG1A 3H9RA 3KY2A 3BV2A 5KCVA 3SOAA 2E9PA 4L44A 5ACKA 4AFEA 1F3MC 3AGLA 3VBVA 4FG9A 2PMLX 2WZJA 4UZDA 4BCOA 3DB6A 3H9FA 3DBFA 2XIYA 3MFSA 1KSWA 1X8BA 3UNJA 4GKHA 5DEYA 3V5LA 2Y0AA 2WQNA 2NO3A 3F5UA 3LQ8A 1MUOA 3PLSA 4F7SA 3VUDA 4RFYA 2A4LA 5HD4A 4EQCA 2BKZA 2R0IA 4MNEB 3VS6A 1MRYA 2RFNA 5CVHA 3QCXA 3RPOA 5A6OA 3UG1A 3SW7A 1XR1A 1M7QA 3H10A 5KNJA 3DAJA 4LGGA 2A1AB 3OC1A 4DF3A 3NDMA 3QA0A 4ANLA 4FV1A 2W5HA 1YDRE 2X7FA 5FDXA 1H1SA 3K3JA 3EJ1A 4V0GB 4I6QA 2B9IA 4XBRA 3WF6A 4R3RA 5HBEA 3ZCLA 4FTLA 2VWVA 3TI1A 2G2IA 1Q97A 3W8LA 4H36A 3LCKA 3EN5A 4Y46A 5ANJA 5IUIA 3MA6A 3VQUA 4FV9A 3R9OA 3LM0A 2VWWA 4UEUA 3DK3A 4GT5A 2ZV8A 2Z7SA 4U6RA 4QP1A 4FIGA 4FTKA 2W4KA 3IW6A 3QYWA 5IQBA 2IW6A 3EN9A 4CYJA 5CF4A 4PQNA 3BE9A 5AV3A 4A9TA 2PVRA 4GFMA 3WARA 4Q9ZA 4BIDA 4F9AA 4UYNA 2FYSA 3TTIA 4DTKA 5CSPA 5LJJA 1A9UA 3EFJA 3L1SA 3KK8A 1GY3A 4ZS0A 3FZOA 5HD7A 3TV6A 2OLCA 5HEZA 3OCSA 4WIHA 3TM0A 4NSTA 2YAAA 4CYIA 4TYHA 3UIBA 2V7AA 4YBJA 4K77A 2QODA 3MW1A 3BELA 1JAMA 4FV7A 3UVRA 3QXPA 4QMZA 2ZYBA 4FBXA 4YJNA 4APPA 4F1OA 3UO5A 3NR9A 1PYXA 2WMRA 4EZ7A 2J0MB 1JVPP 4K33A 3OOGA 2BILB 5GJGA 3VUMA 3GU5A 4LV5A 5A6NA 3VULA 2XNEA 3ORZA 4BC6A 3BV3A 4FC0A 2JIVA 4DBXA 1ZYCA 4YZ9A 5DWRA 2B9JA 2PVNA 4LI5A 1URWA 3OT3A 5HU9A 2HY81 3CBLA 2ZM3A 3PJ8A 4Y83A 5M4IA 3LZBA 4PMTA 2ITNA 4L46A 4TZRA 4A9UA 3PUPA 4CEGA 4MD7E 2WQEA 3GQIA 5KMMA 3LXPA 2E9NA 1VR2A 4D5KA 3Q6WA 4G9CA 4FV6A 2FH9A 3SLSA 3HRBA 4ZTMA 4L52A 1WBPA 3UIXA 3FV8A 3VHKA 1CMKE 1Q5KA 2H34A 3DKOA 4MF1A 5HLNA 3DA6A 1GZKA 1Q3WA 2IVVA 2VWUA 3PXQA 5IUHA 3HX4A 3UMXA 3FHIA 2BTRA 4NEUA 4NM3A 4X3JA 3LMGA 4X6RA 3NAYA 4XV1A 2FGIA 3BYUA 3HDNA 3NUYA 4HVSA 3SX9A 3KRXA 2V5QA 4FSRA 3LPBA 5K0XA 2PUPA 4MEDA 5FXRA 2SRCA 2X9FA 3ENMA 4M97A 3ZLYA 4U42A 4P2KA 4FT0A 1ZOEA 2CCHA 1ND4A 3QQFA 5J87A 2Z7RA 4BY9E 3HKOA 4N4SA 2OW3A 4USDA 5CWZA 4QYGA 3P0MA 5L2IA 2XKFA 4RC3A 3KXHA 1H1PA 2WTIA 3GXLA 3MH1A 4G17A 4MCVA 4RPVA 3WIKA 2BFXA 2FUMA 4E6AA 4N70A 4ID7A 2E2BA 2ITZA 4ZTHA 3DBEA 1S9JA 2C6IA 3ORXA 4JIAA 1NA7A 4IWDA 2OFVA 3QLGA 3QTXA 2OF4A 4OTHA 1R3CA 4TYEA 4BCKA 3I0QA 3R7UA 3DDPA 4YZCA 2QG5A 2VO0A 3QQHA 4J99A 2WQOA 3HMMA 5AUVA 1OIUA 1Q41A 3CEKA 4HGSA 4HYIA 3F2RA 2QOOA 5IQIA 4IE9A 5HTBA 3MY0A 3F3WA 2W05A 1JSUA 3QQLA 4R8QA 5CXZA 4FTJA 4FV8A 4C62A 1W84A 5JGDA 4FTCA 2R3LA 4FZAB 3RTPA 5F4NA 4EI4A 4GKIA 3Q4ZA 4ZK5A 1YDSE 3SG8A 3S00A 4QTDA 4JG7A 4DBNA 4F6WA 4QMXA 3U4WA 2X6DA 3VC4A 3WE4A 4AA4A 4OBPA 3Q52A 4CRSA 4BDFA 2WMTA 5LVLA 4EYMA 3O8UA 3COKA 3A2CA 5CY3A 3HECA 3RK5A 5FBNC 4DITA 5FQDC 5JFXA 1OZ1A 5AFVA 3VHEA 3HV4A 3M42A 3BU6A 5HG5A 3G9NA 1G8SA 3AXWA 5J95A 4BDHA 4YURA 4KUJA 1IA9A 2R2PA 4G1WA 4GUBA 3AG9A 5CALA 3ZDIA 2OJIA 3KRLA 1ZY4A 2RKUA 3KEXA 3R7VA 4ASEA 3ZSHA 4CV8A 4Z7HA 1UVRA 2IZUA 2J6MA 3ELJA 4EOQA 4YGAA 2WD1A 5EDQA 4LYNA 3E62A 4E1ZA 4W4YA 3HMPA 3KRWA 5EYCA 4QTCA 3GC9A 2QHMA 3E3BX 4EYJA 4PP7A 1OITA 3AOXA 3NUPA 4OW8A 4J97A 5CU2A 4RBLA 3TKUA 4AGWA 3VRYA 4EORA 4NM7A 5JMSA 3R6XA 2IO6A 3GC7A 3BYSA 4YBKA 1W7HA 3OW4A 5ANKA 3QUEA 4AOJA 4ZY6A 3M2WA 4EH7A 4XP3A 1Q62A 4TXCA 2QR7A 2PL0A 4DFYA 2VO6A 1XBAA 4MWIA 3WBLA 3EQCA 4RWIA 1ZOHA 1U54A 4M68A 3WE8A 4HNIA 3F3ZA 4TT7A 5AMNA 3ULZA 3FC1X 3E7VA 3II5A 1BL7A 1OL7A 1OPKA 2ESMA 4O7ZA 2Y4PA 3FQEA 3BU5A 3ORNA 4IACA 2J2IB 4AT4A 2NP8A 3BI6A 3KC3A 1XH6A 1UKIA 2FSLX 4JOAA 4M12A 2VTMA 3ZXZA 3TXOA 5L8LA 3NVKI 3I7CA 1YI3A 2WOTA 3RK7A 4II5A 3CQUA 3ACKA 2B53A 2JC6A 3UBDA 4FEWA 4RA4A 3I0OA 1BKXA 4O0YA 1G5SA 5FLFA 3BPRA 3DPKA 5L2TA 4R1VA 1R78A 5AUYA 3LLAA 4IAKA 3P23A 2ZMCA 4XOZA 5L2WA 3HUBA 4YO6A 4DN5A 4KWPA 2AC3A 4EOSA 1KE9A 3PPZA 2JDOA 2HK5A 3OEZA 3ZFXA 3MV5A 1XBCA 3DK7A 5J1WA 2JIIA 2CNVA 3FMJA 3BLRA 4XP2A 5DE2A 3ZTXA 4C58A 3ET7A 3MVLA 2YM6A 3GCSA 4UWYA 4YLJA 5ETFA 3NMUF 4DEDA 4OBQA 4S33A 3UO6A 4WHZA 4L3LA 3F66A 1JNKA 3GVUA 3NUXA 2C1BA 4Y72A 3FLQA 2BRMA 3QLFA 4BKYA 4RX8A 2EB3A 4JQEA 3VBTA 3UYTA 2HZNA 2ITUA 2YFXA 3MFUA 2X6EA 4FKRA 4R3PA 2W17A 4ANNA 5AR3A 5LWMA 2XIRA 4CLIA 2C47A 1F0QA 2BRBA 3FLSA 4F7LA 3U4UA 5A54A 3AC5A 5TO8A 3RPVA 4GUEA 4DG2E 4FK3A 4D4YA 3OFMA 2VO7A 5E1EA 2XK6A 1PMVA 4BDBA 3FSFA 4JJRA 4BI2A 2P4IA 3FC2A 3HRFA 4D5HA 4IM2A 4AW2A 2J5FA 3KRJA 3R30A 2JFLA 3F3VA 2XIXA 4IVAA 4U81A 4X2JA 4HCTA 3LHJA 4X2NA 4AUAA 3VRZA 4C34A 1G8AA 3LFCA 3RK9A 4H58A 1H07A 1NVSA 2C6LA 2BHHA 3RGFA 1GIIA 4RRVA 3CIKA 3VS7A 4U43A 2WO6A 1XH8A 2YA9A 3ALNA 2BZIB 3E8CA 4LM5A 4PTGA 4F09A 4NH1A 2I7QA 1QPJA 3NS9A 3P08A 3AD6A 4UB7A 2XA4A 2LAVA 4L6QA 4K9YA 3BQCA 3Q9ZA 5B2LA 2BRGA 5DT0A 2AC5A 1ZMUA 3CGFA 4Q5HA 5JQ5A 5AJQA 1WBSA 5JRQA 3OTVA 4U8ZA 3GOKA 2XBAA 2FSTX 3SD0A 1H8FA 3QYZA 4TW9A 2VWZA 5DNRA 2UV2A 1ATPE 2GS6A 4WUNA 2J0KA 4QMUA 3SG9A 3DB8A 3EYHA 3LFDA 5EOLA 4F9YA 2QOKA 3D5VA 3JPVA 3GFEA 4XS2A 5K5XA 2VWXA 3PJ1A 4OTGA 3CSVA 5LVMA 3PWYA 1Q8YA 3ZO2A 4EOLA 4QP9A 1ZXEA 5CXHA 4U7ZA 3UQFA 4CTBA 4L7FA 4HGLA 4XJ0A 3RAHA 2I1MA 4YTHA 2PMIA 4QPAA 5F9EA 3FQHA 4O2ZA 1H00A 4YC3A 3WZJA 5DG5A 1NY3A 4PDYA 3R2BA 5K4JA 5AUZA 4GH2A 5A4QA 4U80A 4HCVA 4I6BA 3UOHA 3MB7A 3FWQA 3P86A 3Q9WA 2BHEA 3FLWA 4HYHA 4P90A 3ANQA 4YZDA 4F0GA 4YJPA 4C4GA 4FV4A 1I09A 3MPTA 4PY1A 2BZJA 5AUXA 1J3HA 2HELA 5KMLA 1P2AA 2UZTA 2G15A 4WG4A 2B9HA 3MDYA 4G2FA 3CD8A 2WGJA 3LVPA 4RGJA 4DEEA 4CMTA 3I81A 1V0OA 4XLVA 3TJDA 3I6WA 4E93A 3ZM4A 4FT3A 2IW9A 3UP7A 4U40A 2OGVA 3C4ZA 3IW4A 3LE6A 2CGVA 4FF8A 3QWKA 4JDHA 3FDNA 3KL8A 4WNOA 5EW9A 5H2UA 3BBWA 5L8JA 3NX8A 5T68A 4EH2A 4FZ7A 2R4BA 5J9ZA 1LEWA 4OTDA 4AOIA 3NYOA 5DT4A 3VBQA 5JN2A 4JNWA 3I60A 2E9VA 3F7ZA 4CFMA 5EI8A 2UZOA 5EDRA 2WHBA 4KIPA 4RZVA 5CASA 1PHKA 5LOHA 2CDZA 4H1JA 3WOWA 3QBNA 3QCYA 4RSSA 3HV3A 2GQGA 3UPXA 5AEPA 4JAIA 3S1HA 5JZNA 3RI1A 2EB2A 5CEOA 2QKWB 1AGWA 4MWHA 5K5NA 2ETRA 3GT8A 2OZOA 2ERKA 4YC8A 5AR7A 4FKOA 4CRLA 3FHRA 3E88A 4A4XA 4NM0A 3AC2A 3W10A 4AF3A 4YNEA 5FXSA 5HQ0A 3FMDA 4QMMA 2NRUA 4ANMA 4GU9A 4BCHA 3HV5A 1YHSA 3LCSA 4P4CA 1W98A 4R6VA 4XLIA 3SW4A 2OSCA 3AC1A 3A7IA 4ZSLA 4CXAA 1RQQA 4AE6A 2HAKA 4DFNA 3T3UA 2QG7A 3C7QA 4FSZA 1STCE 5GIPE 5IPJA 3N51A 3MPMA 5TE0A 4B7TA 1H1WA 3FLYA 5JEBA 3V5TA 4D58A 3KXZA 5B2KA 5AUUA 4W9XA 4NM5A 4ALWA 1VYZA 2PY3A 4LG4A 5AIKA 4QMNA 2B54A 2HOGA 2ITVA 2W1IA 4M0ZA 4FSYA 4NTTA 4J95A 4ANOA 4EK3A 3CY2A 3F5PA 4GVJA 3ORMA 2UW4A 4IBMA 3VUGA 4YJUA 4IX3A 5HVJA 5KKRB 1TQMA 3Q60A 2YN8A 2XCKA 3DGKA 4HGEA 4XHKB 2YIWA 3AT2A 3VF9A 4DFBA 3WZEA 3EN4A 4I1ZA 3U8WA 2VTJA 2RF9A 4O21A 4DEGA 3D7TA 4RVMA 3RZBA 4L8MA 3R8MA 1FVTA 2WIPA 2XRWA 3Q53A 4C36A 3DZQA 4UMRA 4TWPA 5BYYA 4FSWA 4Y73A 3WZDA 2ZOQA 4FKGA 4XH6A 2UZUE 2QI8A 1QPCA 3DY7A 5J8IA 3TNPC 1T45A 3OWLA 4USEA 5AX9A 1Q3DA 3ORTA 2VTHA 4TY1A 3QD2B 5D7AA 3TV4A 3TEIA 4YO4A 2BAKA 2GNIA 2ERZE 3EZVA 3F3TA 1BLXA 4QYHA 5HG8A 3GB2A 3DNEA 4A06A 2HWOA 5DH3A 2VV9A 1P14A 2QCSA 5HNBA 4YSMA 4FV3A 3ZO3A 2XBJA 5AA9A 3OXIA 2UZBA 2UUEA 4I5MA 4C0TA 4BZNA 4C4FA 5EHLA 4ZSJA 5A4EA 4O96A 2Z60A 4AN2A 4AS0A 5L2QA 3FYKX 2UW0A 2O65A 4ZTQA 3DTWA 4Y5QA 3VUKA 4EBWA 2R3OA 4CFFA 2VN9A 2HW6A 3DFCB 2RFSA 3COHA 5LVNA 2VTAA 4FEQA 3MFTA 3QU0A 3UVPA 3EQRA 3OHTA 5EYKA 2Y4IB 5L8KA 2VX1A 2GHMA 2X39A 3A99A 4DHFA 4IZYA 5JFVA 1OL5A 4MQ2A 4RFZA 4BICA 2X7GA 2A19B 3DS6A 3ROCA 2A0CX 3Q3BA 1JQHA 3PPJA 2PZPA 3CQWA 5AUWA 4O0TA 2B1PA 1ZYJA 3P5KA 4GS6A 1V1KA 3NEWA 4MXXA 4EQMA 3IW8A 4RJ3A 5M57A 4YUQA 4EJNA 3R63A 5HIEA 4BR3A 2R3NA 2P55A 3H9OA 3A7JA 5GNKA 3KXGA 4L00A 4NT4A 1Q8UA 3HP5A 1YDTE 3I79A 4YMJA 4R3CA 4CZTA 4L68A 2XJ1A 3CJFA 3ZUVA 5I3OA 2J7TA 5B7VA 4IB3A 1MRUA 2YERA 2OZAB 3HNGA 4TYIA 3V3VA 5BUJA 5HIBA 1R0PA 2DS1A 3FPQA 4S34A 1F5QA 3QQKA 4BGGA 4C8BA 1XH4A 3JS2A 1SM2A 4IQ6A 1E1XA 3GUBA 5A3XA 3IDPA 5LCKA 5IA4A 4OR5A 5LMBA 5D11A 4D2VA 4KBKA 3LXNA 4R77A 2HZIA 3MN3A 1YHWA 5FWKK 4M14A 3V01A 3MJ2A 1PXKA 4FNXA 4UMUA 1SZMA 3UODA 4O1PA 1ZRZA 4O0SA 1U5QA 3CPBA 3KB7A 5LMKA 2V7OA 4PDPA 3DDQA 4ITIA 4NZWB 5HO6A 5KMKA 2CLQA 3KGAA 3QX4A 4FYOA 3NLBA 3ODYX 4ZJJA 3UNZA 2XF0A 5IH5A 4K0YA 4IIRA 5H3QA 2YIXA 4XRLA 3DU8A 1JKSA 1XQZA 3LXLA 5I3RA 3LMIA 1Y91A 1YVJA 4FTTA 3NUAA 4BDCA 3GCQA 5IA5A 4C2VA 4YR8A 4DGOA 2XKDA 1BUHA 2R3MA 2HCKA 3POOA 1AD5A 3U6IA 3BHUA 4KABA 3HA6A 4JX3A 2PUIA 3FZ1A 3MVMA 3Q4TA 3AMBA 4PPBA 3ZLWA 2P2IA 4I5PA 5IA3A 3MH2A 1XKKA 4XRJA 1BI7A 1ZMVA 5AR5A 2PHKA 2BALA 4Y85A 4YHJA 2HENA 4C4JA 4KS7A 1OL1A 4QQTA 1FPUA 2PVHA 5K3YA 4BHNA 3ROYA 4L42A 4HPTE 1M2RA 5FBOA 1JPAA 1M2PA 4PL4A 4I4FA 4WT6A 3ZZWA 5ETIA 4EH6A 4L7SA 4LV8A 3LFBA 2R7BA 3EFLA 3T9TA 2QLQA 3EKNA 3DFAA 3L8SA 4IZ7A 5I9UA 2C3KA 4N6ZA 3UPZA 5ANDA 3R8ZA 3DAKA 1H1RA 4RJ7A 4FKSA 4RIXB 4LQMA 3K5VA 4U44A 4XMOA 4TNDA 1JBPE 3TIYA 3W1FA 1PY5A 5BVOA 3G0FA 3UNKA 4BDDA 5IDPA 2DYLA 4NL0A 3MY1A 1YXTA 3QKKA 4E6QA 5KHXA 2WTCA 4ALUA 3C4EA 3HV7A 1FGKA 4IM3A 4S31A 4MBJA 2OK1A 3R04A 4PMSA 4O27B 4M15A 4NYEA 4AA5A 1YW2A 3MTLA 3ZC6A 4KBCA 4J1RA 5IKWA 5HG7A 4Q9SA 3I7BA 1Y57A 5KZIA 3L9NA 3WZUA 4NKSA 4BB4A 5DFPA 2YJRA 2G2FA 1WZYA 3QWJA 4YPDA 4NIFA 2UW8A 4WRGA 3W2RA 5LMKC 1MP8A 1Z5MA 3PPKA 4KKHA 3DOGA 3NW5A 2JKKA 4N0SA 4ZTLA 2WTDA 2C1AA 3QALE 3W32A 4HJOA 2BDFA 4ZJIA 3B2WA 2GCDA 4IZAA 2WXVA 1UU8A 1BX6A 3O8PA 4XG6A 4RIWA 4X21A 2BRHA 3QRKA 4IXPA 5C4LA 4O7LA 4F08A 4QP6A 5M06A 3WYYA 4BFMA 5KZ0A 3LMHA 2HZ4A 2O2UA 2WMSA 4JRNA 4KIQA 3NUUA 5EFQA 2XIZA 4MXCA 3Q5ZA 1M52A 2PUUA 3TL8A 2XM8A 3CC6A 3D94A 5CSXA 3D5WA 3VBWA 3PG1A 5A4TA 4O2PA 5E9EA 3E87A 4X2GA 5DRBA 2BVAA 4O81A 1U59A 4IC8A 3OP5A 4FIIA 2C69A 4FVPA 4PMPA 3UDBA 5AAEA 4QMQA 1WBVA 3TG1A 2CN8A 5E8UA 4X3FB 3OOMA 2VTIA 4IVBA 5C01A 1ZAOA 1JKTA 5JSMA 3RWQA 4GU6A 3RHXA 2XP2A 1A06A 1H1QA 4IAAA 5TR6A 4C33A 3DLZA 4XG9A 2ZB0A 4BGHA 4G6NA 4WOVA 3OF0A 5AM6A 3MTFA 4WA9A 2RG5A 1OGUA 4JIKA 3P7AA 2X8IA 2OO8X 4OTFA 3FL4A 4ZTSA 4EH5A 2C3LA 3O8TA 2E9OA 2PTKA 1PW2A 4DH3A 2ZV7A 2XNOA 4QT1A 4DFLA 4JR7A 2WTKC 2VNYA 3O2MA 3QUPA 3DJ6A 5AP7A 3H0YA 4AGDA 4O82A 4AA0A 3EIDA 1H24A 3PRIA 4YPSA 3W2SA 1J1BA 3RPYA 1BI8A 1MQ4A 1OKYA 5GJDA 3JYAA 5BMMA 4ASXA 4MK0A 4EK5A 4AZWA 4EOJA 3PWDA 4L43A 4XX9A 1PKDA 2W9ZB 1Q8TA 4ONAA 4AW0A 3R00A 2X2MA 5HESA 4FT9A 3LFSA 5DPVA 4EWQA 4K18A 3FKNA 5B0XA 4AT3A 4LMUA 3FXZA 4CFVA 3L8XA 4WO5A 3P7CA 1PYEA 2UZLA 3V5JA 1WBWA 2PPQA 4JDJA 4RIYB 4HZSA 5KMNA 3C9WA 4ZXTA 5HI2A 4DFZE 1L3RE 1YOJA 2R3GA 4E5WA 4J98A 3GCVA 3HLLA 3KRRA 4UN0C 1O9UA 5IEXA 1CTPE 4O0XA 3HYHA 5E8XA 3GU6A 3OY3A 5KKRC 5E92A 1QPDA 2W4OA 4AZEA 1OIQA 4BDIA 3MYGA 1GZOA 3PSCA 4QP7A 2C5XA 4QMSA 2GDOA 2WMXA 4A4LA 1KOBA 4YZMA 1UA2A 3A4OX 2FO0A 1K9AA 1VJYA 3F7WA 4NCTC 4RJ4A 5EW3A 3MB6A 4AP7A 3EQIA 3EB0A 4K11A 2JBPA 3GU4A 4IAFA 3C0GA 3L9MA 2XIKA 4QYEA 1CKJA 4YZNA 4F64A 1VEBA 2EVAA 2BCJA 3SA0A 4GVAA 3TT0A 1UNLA 3QAME 3EZRA 4C4EA 3O51A 5F95A 2XNNA 3VWAA 4RWJA 4MH7A 2NNWB 4F9WA 5EM6A 5AWMA 4JDKA 3C1XA 4DGMA 4G9RA 3V51A 3PY0A 3PXFA 2E9UA 4KA3A 5CNNA 4BZDA 4FSMA 2JEDA 4ZOGA 5HORA 4AZTA 3TUDA 3PDTA 2PUNA 1OIYA 2R3QA 5HLPA 2BZHB 5CENA 4FL3A 4AWIA 4D2RA 3DQWA 3FEGA 1KV1A 2FSMX 5TOZA 4AFJA 2J5EA 5AIRA 3ZFMA 2HY0A 3L8VA 4H39A 3QD4A 4X2KA 3Q2JA 4BCMA 4EHVA 4KKEA 4D0XA 4UMPA 3L9LA 3BZ3A 4IAYA 3QL8A 4O6LA 5HG9A 2R5TA 2XM9A 1OVEA 4FKIA 3RINA 4H05A 4QMVA 2G2HA 4EHZA 1B39A 2PVJA 5CQWA 5L6PA 3IQ7A 3ATSA 3OTUA 3PVWA 2YISA 4GG5A 3JUHA 3NYXA 1SVHA 4RC2A 4MNFA 3ZO1A 3C4WA 5HZNA 3NRMA 3QTSA 3MBLA 4PPAA 5FG8A 5H8BA 3TDVA 4OBOA 2PZIA 4PL3A 4CG8A 5ANGA 1IRKA 4NFMA 3UP2A 1O6LA 4C35A 4FNYA 4EHEA 5DMZA 3QTRA 5HNGA 4F1TA 5C26A 4ACHA 3KULB 4K6ZA 3BGQA 4PL5A 4ZZMA 4FKQA 1DI8A 4KSQA 2XEZA 3VNTA 4G3CA 4QYFA 3PY1A 5GZ8A 2C3IB 2C6DA 5HE1A 2Z7QA 2ZMDA 4ZSAA 3ACJA 4M8TA 3NW7A 2J90A 3E93A 3WYXA 4AQCA 3KFAA 4JBPA 4X0MA 4R5SA 3NCZA 2VTTA 4O7SA 2ZDUA 4PF4A 3V6SA 3QRJA 3BYOA 1ZLTA 4G6OA 3DV3A 1DAYA 2BROA 5AP3A 5JK3A 4RC4A 4IADA 5L4QA 1M14A 4F63A 3NZ0A 4D4VA 1CSNA 4E3CA 3DXQA 2QU6A 4FG7A 3UQGA 3VUTA 3RAWA 3W2OA 4N57A 3LFQA 3TACA 4U41A 5EG3A 2OF2A 3LKMA 2C0TA 3VUHA 4L9IA 3HA8A 4AAAA 5BVNA 4ZZOA 4AZFA 4ENXA 2QONA 1UWHA 4BCNA 4H1MA 1M2QA 2ITQA 1K3AA 3D7TB 3EFKA 5HX8A 4RWLA 1OKWA 5E4HA 3RHKA 3E8EA 2F7XE 5D7VA 4U5JA 4DYMA 2XNGA 5E91A 3LJ0A 3TCPA 2R3KA 2XK8A 3A4PA 3EQBA 4W4WA 3OCGA 5I9YA 2B0QA 5FEQA 1H08A 2OXXA 3NGAA 3QCSA 3UJGA 4YSJA 3ZU7A 4U3ZA 4E4MA 5C1QB 4CVAA 4FEUA 4DA5A 3N4TA 4I0RA 3S4QA 3SAYA 4DFUA 1JSTA 1M7NA 3A7FA 5KMIA 1YWVA 1WCCA 5K0KA 3V5PA 5M07A 1APME 3IK3A 4FI1A 3GOPA 1KE6A 3EQGA 4RVLA 4FMQA 5FRIA 3ULIA 4ERWA 3F5XA 3DT1A 2WQBA 3A60A 4TPTA 3K2LA 4UWCA 3KF7A 5ETCA 3AMYA 4AW1A 4ZMFA 3FI2A 3PXZA 4HGTA 4J52A 1P5EA 2EU9A 2HYYA 3O96A 3MWUA 4FODA 3OEFX 1B6CB 4ANQA 1FVRA 3EMGA 4JBOA 4XV3A 4CCBA 3V8SA 4ZSGA 5D12A 5LVOA 4CQGA 3D7ZA 2X1NA 2X8DA 3U87A 5CANA 3B2TA 3FJQE 1R1WA 1XO2B 5AR2A 4PP9A 4QQJA 3BYVA 2VTNA 3QZFA 3ZM9A 3BEGA 4FOBA 5IQFA 2VTOA 4E6DA 4BKJA 2ZAZA 2W1ZA 3KCFA 4A4OA 2WTVA 4JS8A 3VJNA 3VJOA 3DXNA 2W1HA 2OWBA 3OD6X 2OICA 4G16A 4EH4A 3LQ5A 2GHGA 3R01A 3RMFA 5AR4A 4CZYB 3R02A 4F0IA 4ZLYA 2WEVA 5HOAA 2I6LA 3RM7A 4M0YA 3C5UA 3CTQA 3MVHA 2UZDA 4CCUA 3ZC5A 2BIYA 5GINE 2YDJA 2W1GA 4JDIA 3ORPA 4HOKA 3D2KA 4MBLA 1CDKA 2CGWA 2UZNA 3IDCA 1XH7A 3HDMA 5I4NA 2XB7A 3OW3A 3R28A 3FQSA 2JD5A 3PE1A 4EK4A 2BDJA 2C6MA 2UVYA 2JKOA 4BL1A 4FICA 4CZUA 5ITAA 3FLZA 3DBDA 4R5YA 2BFYA 3RKBA 3G5DA 3KXNA 3OY1A 3HMIA 2QU5A 4H3QA 3OBGA 1OBGA 1QL6A 2XNMA 3HRCA 2WMVA 5M55A 4C02A 2R64A 3AD4A 4MXYA 3RP9A 3OBJA 3BHVA 3CPCA 3GEQA 2H8HA 3OXZA 5CU6A 5DN3A 4KNBA 5IMEA 2X0GA 3FZSA 4E8AA 2UZEA 4QQ5A 2ITOA 5M53A 3KN5A 5CX9A 3ZRKA 3Q2MA 1PXJA 2ZVAA 4K2RA 2F2CB 4IX4A 4I24A 4FV2A 5T3QA 3KK9A 3SRVB 2GHLA 2PE1A 4LL0A 1J7IA 3K3IA 4HZRA 3VQHA 4EH8A 5KMJA 3W2PA 1U46A 1ZZ2A 4FTOA 3EKKA 5BYZA 4NFNA 1E1VA 5BUEA 1GOLA 2C6EA 2UZVA 4J96A 5D10A 2I40A 4QMTA 3HP2A 5CEQA 4QMYA 4F9CA 3UC4A 3UGCA 4E6CA 4BCJA 2C5YA 2BKKA 2Z2WA 5IQCA 3ZEWA 5HGIA 2BMCA 4X3FC 2W7XA 2Y7JA 4V05A 4ACCA 3KREA 2YM4A 2X8EA 3MPAA 5IQHA 4E4XA 4M13A 2A27A 1Y8YA 4YHFA 3ZFYA 5GHVA 4PMMA 4BCQA 5CAUA 2YZAA 3DLSA 4BIBA 1Q99A 4FTMA 2YLEA 3E5AA 4CD0A 4BN1A 3A61A 3NCGA 3PZHA 3GP0A 3LIJA 5TT7A 1DAWA 2WB8A 3WF5A 2BAQA 4UX9A 4JLCA 5KBRA 2I0EA 4QNAA 1R39A 2ZM1A 1FGIA 2CN5A 3CR0A 3Q4CA 4MQ1A 3SXRA 2O5KA 5I9WA 4RLKA 5KUPA 4FTIA 3C51A 4QPMA 2JDVA 4LGHA 4WKQA 2XYNA 3N4VA 2GMXA 4FKJA 3HEGA 1CM8A 3BEAA 2IVTA 1WBOA 4FSTA 3BGZA 3G6GA 3R7OA 4G6LA 3UIUA 4QTEA 3FL5A 5DIAA 3TKIA 1CKIA 4NW5A 3OCBA 3A7GA 3PXKA 4YNOA 5DR6A 3UMWA 5AV4A 3TNIA 4GFGA 3EWHA 3FZRA 3VBYA 1Z57A 4GCJA 3R1QA 3TZ9A 5CNOA 4DINA 4TTHB 2JITA 5JRSA 3KKVA 2X2KA 4TRLA 4MHAA 2OXYA 4OAVB 3QCQA 4U97A 3FY0A 5BQ0A 4D9UA 4WG3A 4EH9A 3THBA 5J79A 4M3QA 2ONLC 4QMOA 3RALA 1J1CA 4UZHA 2CNQA 3R83A 4PUZA 4QP8A 5CI7A 4JG8A 4B6LA 2QO9A 5HNIX 3IGOA 2GTMA 3BCEA 3PP1A 3BRBA 3FE3A 2WOUA 1PXMA 1HCKA 2XMYA 3E8DA 3QTIA 3O23A 3P9JA 4NTSA 4PV0A 4IM0A 2PZ5A 5LWNA 5EOBA 4F70A 1R0EA 2AYPA 2IVSA 3LXKA 4Y95A 1H0VA 5AP2A 5IQGA 1WBTA 2CMWA 3ZYAA 3ORKA 3EOCA 4GJ2A 2W06A 3H4JA 5H8EA 4DG0E 2CPKE 3BWJA 3IW5A 1TQIA 3ETAA 1FMKA 1PXIA 2YJSA 5CI6A 3G2FA 3R1SA 3EQPA 3SXSA 5A14A 3DXPA 3NNVA 2PVFA 4F99A 4WSQA 2O63A 4BDAA 4O0RA 4W8EA 3EQHA 4DFXE 1NW1A 2XKEA 1MQBA 4F0FA 5CEKA 4GK3A 5J1VA 3CQEA 3PXRA 3ZSIA 1OB3A 5EKOA 5K9IA 2EUFB 3E8NA 2X2LA 3GFWA 2DQ7X 4NUSA 3OWKA 4QP4A 3RCDA 1J7LA 2OJ9A 4D55A 2WMWA 3OT8A 3QC4A 4EK6A 4RVTA 4ZLZA 3KN6A 3GENA 2BPMA 2RFDA 4JQ8A 4QTAA 4HNFA 4FKTA 4AXAA 4ZLOA 1UKHA 2BR1A 5E7RA 1WMKA 1XWSA 4QMWA 2QVSE 2NRYA 2R3HA 4H3BA 4KBAA 3UOKA 3VW8A 4AACA 3QTZA 3CJGA 5EQPA 2QR8A 3C4CA 4O7NA 5AADA 1PF8A 3EFWA 4HYSA 2YM5A 3GQLA 3A7HA 4TYHB 5FEEA 1SMHA 4JBVA 3IOKA 2ZB1A 2QOLA 3U54A 4DTBA 3GNIB 4E26A 1W0XC 3P1AA 4I94A 5J5TA 1J7UA 1IAHA 3JY0A 4BCFA 3CS9A 5M08A 2YLFA 3FXWA 2Z8CA 3ZO4A 1IAJA 3AQVA 4C4IA 1H4LA 4DH7A 2R0UA 3CE3A 2XS0A 4GIHA 1OPLA 4FL2A 5DVRA 3E92A 1YXSA 4AOTA 2PK9A 3D2IA 3RWPA 2WTWA 4R1YA 4CSVA 5M44A 2YEXA 4M69A 1BL6A 1GZNA 4AW5A 2GNHA 4FIJA 3IONA 4ALVA 5BVDA 3ZDUA 1O6YA 4CLJA 4W4VA 2QO2A 4I3ZA 2QO7A 2Q0BA 2ZDTA 4C57A 5HIDA 5JH6A 3F2NA 5IA2A 4BWKA 1L8TA 3VS1A 5TKDA 4OTIA 2JAVA 2ITPA 2UW3A 3BE2A 4MVFA 4BIEA 4E4LA 4QPSA 2O8YA 2PVLA 2RGPA 3BKBA 3NUSA 4IWPA 4UALA 3WILA 3CKWA 4NJDA 3I4BA 4JI9A 4FSUA 3TZ7A 1HCLA 4M66A 4EOPA 2XJ2A 4O86A 2P3GX 3IG7A 3RCJA 2YABA 2UZWE 3N9XA 4TYJA 3U6HA 2BTSA 3DZOA 3DAEA 3OROA 3I1AA 4RQKA 4Y5HA 5L6WL 5AAFA 3EL7A 3NYVA 3RNIA 5I5ZA 5IUGA 4WNPA 4DEIA 4FR4A 4RZWA 3W33A 2VAGA 3OCTA 3HUCA 4I23A 4YJOA 5CSWA 5CEIA 5C8NA 2B55A 3QGYA 1VYWA 3QD0A 3NNWA 3R7EA 2XEYA 3DTCA 4FTUA 4GFOA 5E8TA 3F6XA 4QD6A 3G15A 5EW8A 1H28A 3GCPA 2Y9QA 4XUFA 1OUKA 3QGWA 2JIUA 1KUTA 4NU1A 1QMZA 5CSVA 4YLLA 2R3PA 2V0DA 3KMUA 2JAMA 2RG6A 3TZMA 3UOJA 3IO7A 5EK7A 4IC7A 3VF8A 3CTJA 5C8KA 2DWBA 2W5AA 3QRUA 3RZFA 2V22A 5GJFA 5FM3A 4CGAA 4GSBA 2X81A 3DJ7A 4N6YA 5AV2A 2CKOA 4GJ3A 4I0TA 5C03A 4C59A 3D83A 2YIRA 1PXNA 4ASZA 5IDNA 3OWPA 4FYNA 4FIFA 3G6HA 3SHEA 4OTPA 5BPYA 3AC8A 2UW7A 1XH9A 1ZY5A 1ZYSA 4IW0A 4S2ZA 2CCIA 5CLPA 3RM6A 2WTJA 1Q24A 1JLUE 2C5OA 3BHHA 3SGCA 2WMUA 2XNPA 4K8AA 1NT2A 4U79A 4G3EA 4C3PA 4EOIA 4JRVA 4TKSA 5E8SA 1W8CA 4DLIA 3DKCA 4EKLA 3LFNA 4L67A 2R3RA 3K5UA 5HTCA 3IPHA 3KVXA 4O91A 5CU4A 2J9MA 1OKVA 5M56A 4ORKA 5CT7A 1OI9A 2R3FA 5FEDA 2EWAA 1PMNA 4G5PA 3C13A 5CEPA 2Y8OA 2W99B 3PIZA 4X2FA 2PMNX 5IA0A 4BHZA 4JAJA 1WBNA 4R7HA 2X4ZA 1UU3A 4AZSA 4BWXA 4YJSA 4BGQA 1JKKA 1KE8A 4J8NA 4V01A 3U55A 4BDEA 4O83A 4IB0A 4M84A 3QTUA 3G9LX 3R0TA 4YTFA 2BRNA 5HBJA 3T3VA 3LCTA 4XYFA 3SQQA 4ACGA 4DC2A 4D1XA 4RG0A 3VO3A 3W8QA 4KKGA 1KE7A 2OH4A 1JWHA 4WBOA 2F2UA 1YI4A 5CYIA 5DLSA 4QNYA 4DAWA 4YJQA 5GZ9A 2ZM4A 2YACA 3TNQB 4DEHA 3FSKA 4S32A 1XH5A 4QRCA 2YDIA 4QOXA 2FSOX 3BHTA 3R71A 1U54B 4IEBA 2ZV2A 4P7EA 4ZAUA 3ENHA 5LVPA 3EHAA 3SDJA 2XK7A 3BLHA 1P4OA 3KU2A 2BAJA 5BYLA 4EL9A 1YXUA 4FT5A 5HCYA 4IFGA 2ACXA 2XZSA 5M4CA 4J53A 5DOSA 3KXXA 2LGCA 3QKLA 4JX7A 4EZ3A 5JT2A 5EDPA 4DG3E 3L9PA 2JKQA 2HWPA 2YCFA 4WNKA 2VZ6A 5HBHA 1IR3A 2VTSA 3IKAA 5E8WA 3NSZA 3LAUA 3O17A 4F6UA 3COMA 3ORIA 3PIXA 4PWNA 4G3FA 1GZ8A 1OPJA 4DCAA 4D1ZA 1PMUA 4ACDA 3ERKA 5C9CA 4TNBA 3TJCA 1ZMWA 3RAKA 3TV7A 1V0PA 4OTRA 3RNYA 1U5RA 3ZMMA 5JZJA 2BIKB 5DEWA 4YTCA 2B4SB 2J0IA 2YZLA 4LOQA 3ZXTA 3EQDA 1WVXA 4NCTA 5HO7A 2WQMA 3MI9A 3PA4A 4OTQA 2W1CA 1RDQE 2PWLA 3PZEA 4FTQA 3QHWA 4OLIA 4EK8A 3NW6A 3QKMA 4GEOA 4K1BA 4L3PA 4E4NA 3ZHPC 5AM7A 4E5AX 1KWPA 3D9VA 3QX2A 4BCPA 4O7RA 4IMYA 3IGGA 3ZBXA 4G3GA 5IF1A 2KTYA 3MJ1A 3F9NA 4IHPA 5F1ZA 5HE3A 4HVHA 2J4ZA 2V62A 5CEMA 1OECA 2IN6A 4FIEA 1PKGA 5EHYA 5EQEA 1FINA 2X4FA 4Q2AA 3FMEA 3LQ3A 2Y6MA 3UZPA 3OUNB 5FTGA 2H9VA 4EUUA 1OKZA 4PNIA 3MS9A 4EC9A 4B9DA 2PVKA 2XVDA 2W96B 3FBVA 4FTNA 3NAXA 2OXDA 1PXPA 4IANA 4EKKA 1KOAA 3OMVA 1UNGA 4KIKA 4ZY4A 5BUIA 5DYJA 2YWVA 4KIOA 2OIBA 5DR2A 2CHLA 2GPHA 4RLLA 4XP0A 4APCA 5IU2A 4EUTA 5A9UA 1OL2A 4Z3VA 5FXQA 3JVSA 5BMSA 1JSVA 4BYIA 3OWJA 3WF9A 2C30A 2H6DA 5D1JA 5J7BA 3LFEA 3FY2A 1FOTA 4G3DA 3N4UA 2C5NA 2G1TA 3ZZEA 2VTQA 5AX3A 4E7WA 3W18A 2W0JA 3C4FA 4A7CA 3DKGA 5HLWA 3FZPA 3ZRMA 4R78A 5KX8A 3PLAE 2KULA 4ZSEA 4FSNA 2W1FA 2WMAA 2JGZA 1H27A 2WU7A 4KRDA 3RVGA 2I0YA 3FI4A 5FP5A 4L45A 4DGLC 2JLDA 4C37A 4FNWA 4IDTA 2OIDA 2J0JA 5J9YA 4FG8A 2VU3A 4I21A 4I5CA 4FSQA 3RBWA 4FEVA 1Y6AA 4GT4A 1UU9A 2BUJA 4XG8A 3FMLA 1W83A 4FGBA 2JDRA 5LXMA 2W4JA 1GJOA 4KS8A 5DA3A 4U45A 4WRSA 2ZJWA 4F7NA 4GYIA 5HU3A 4KB8A 5CAPA 4USFA 1TQPA 3BU3A 3DK6A 3QQGA 5AAGA 1QPEA 3IW7A 4PPCA 3IDBA 5ICPA 3C5IA 3V5WA 4MD8E 5FM2A 4O38A 4EEVA 3OXTA 5IEYA 5HICA 4ZTNA 3KF4A 5HCXA 1PJKA 3HVCA 4TL0A 3PTGA 3PJ3A 4FKLA 5I9ZA 2EXCX 3PFQA 1SVGA 3HL7A 3SC1A 4RFMA 3CLYA 3GI3A 2OZAA 1Q8WA 3LCDA 4CG9A 3BBTB 2C68A 3Q5IA 4FNZA 5EYDA 3TUCA 4Z9LA 3OUKA 5F20A 3VN9A 2NPQA 1OUYA 4D2PA 1Z9XA 5CQUA 3TZ8A 3NIZA 3UZTA 2OG8A 4QYYA 4FVRA 3FI8A 4FTAA 3I5ZA 4BI0A 4Z7GA 3PJ2A 3HZTA 5AA8A 3GU8A 4FZ6A 1H25A 1YXVA 4D2SA 5HHWA 4C4HA 3MH0A 5LCJA 2F7EE 3H3CA 3KVWA 3QUDA 1JKLA 5G6VA 5IH4A 1A48A 4RJ5A 2HIWA 5FD2A 2VX3A 4LL5A 2PE0A 1KE5A 1LEZA 2PMOX 3JVRA 3QZHA 3UIMA 3O7LB 4GYGA 4I6HA 3VS3A 4B4LA 4ZY5A 5JFWA 4CTCA 2UW9A 4IWQA 4UXLA 1FMOE 4M67A 4CT2A 4D1SA 1SNXA 3FMMA 2CJMA 3ODZX 3ZUUA 5FP6A 3HMNA 3TIZA 4GV1A 4DCEA 5EM5A 2QNJA 2F57A 2WEIA 4I6FA 2QHNA 4JQ7A 3EN7A 4EJ7A 3BIZA 2Q0NA 4UYAA 3DCVA 5AR8A 5JGBA 4F65A 4D9TA 5T6KA 2PE2A 2Y4IC 3NWWA 4GIIA 3GCUA 4GK2A 4JG6A 4B8LA 1REKA 5KO1A 5KBQA 4Z55A 4ACMA 4BRXA 2PYWA 5EQYA 4WG5A 2X7OA 1NVQA 4O1OA 1V0BA 3FPMA 4TWNA 1NXKA 4FX3A 4MXAA 5AP5A 5FGKA 2PVYA 3HV6A 2J51A 1LR4A 4A9SA 1REJA 4FKPA 5M4UA 3LW0A 2ETKA 4IVCA 2B52A 4NWMA 4I22A 5EM7A 3PVUA 5F94A 4CNHA 5CVFA 3AD5A 4HVDA 1BYGA 2R9SA 4HVGA 2GNFA 4ZZNA 4MXOA 4YJTA 4GRBA 4CV9A 3E63A 3VW6A 3WF7A 2J0LA 4IAIA 4RIXA 4A07A 3BQRA 3R7GA 4TWCA 4FIHA 3COIA 2C5VA 5JQ8A 4CFXA 3NVMB 3S3IA 5HE2A 3UVQA 2QKRA 3PXYA 5BVWA 1U4DA 3QC9A 1Q8ZA 4O0UA 1XBBA 2ITXA 4UMQA 3ZSGA 4C2WA 4I92A 4L53A 4RWKA 5E1SA 5CU3A 3UO4A 1OMWA 4BVUA 4DLJA 5AUTA 2QOHA 4ZS4A 4F6SA 4O0WA 4MD9E 1Y8GA 4PDOA 1UV5A 2YIYA 4BDJA 2CGUA 1BMKA 3EQFA 5D9HA 5IISA 4I93A 5IH6A 2ETMA 4UMTA 4BBEA 5ANOA 2FVDA 3TTJA 3HMOA 5KHWA 4QMLA 3O7LD 2WNTA 5GIOE 3A62A 3TWJA 4I5HA 3CGOA 4J7BA 4RVKA 3KA0A 3WF8A 4UV0A 2UW5A 3F2AA 4FKVA 4BTJA 3Q4UA 3BX5A 1YWNA 3R8LA 4EZ5A 4MNEA 2OU7A 3PSBA 5E90A 4BZOA 1YOMA 3BLQA 3POZA 3PYYA 5HVKA 3L8PA 3HGKA 1SVEA 5IQEA 4FV0A 2YCRA 3GC0A 3Q96A 3REPA 4BTMA 4YTIA 3R7IA 4O7YA 3P4KA 3DJ5A 5IA1A 4F4PA 4CKJA 2IVUA 5CU0A 2WIHA 4IDVA 4M7IA 1PXOA 4V0GA 4RX5A 4O7WA 3JR1A 3V04A 3W2CA 2YWPA 4FGRA 3R7YA 4YJRA 3FMNA 5AP6A 4IB5A 3PVBA 4QO9A 5CZHA 4X3FA 5EH0A 5C8MA 4GW8A 5DT3A 4BCIA 5DGZA 3FLNC 2CKPA 3V8TA 3KMMA 1YKRA 4PX6A 3R9DA 1XJDA 4ZP5A 1JOWB 3BGPA 2G9XA 4EOKA 1OBDA 1WVYA 1YWRA 2GNJA 2GFCA 3CY3A 2Z7LA 1G3NA 3GU7A 4YZBA 4ANSA 4M69B 3SOCA 4I0SA 5ANEA 4TWOA 2H96A 2XK9A 1PMEA 3MFRA 3NNUA 4QMPA 5ETAA 3TNWA 4AZVA 4C3RA 4D2TA 4DH1A 2QURA 4IZ5A 4AGCA 4DGNA 5I9VA 2GNGA 2YCSA 4MX9A 4RX7A 3UQCA 1PRYA 1PXLA 4J71A 3G33A 4S30A 3UZRA 4XEYA 1WAKA 2VO3A 5IQDA 4B8MA 2GQSA 3O0GA 4CMUA 2GTNA 3U9NA 5C4KA 4EOMA 3QD3A 4NW6A 2ITWA 4O22A 5CF6A 3OZ6A 3R1NA 3QTQA 5CAOA 4BYJA 2HW7A 1OM1A 4FVQA 4FV5A 4RT7A 2RIOA 3W16A 3SV0A 4OT6A 3EH9A 4W9WA 3H0ZA 4RJ6A 4BKZA 3MY5A 4B0GA 3FI3A 2O0UA 2OIQA 3WZKA 4CQEA 3SXFA 3O71A 4MYGA 5FDPA 5BVEA 3ZRLA 5AP4A 5A4CA 3VVHA 3WIGA 2OI4X 3B8QA 1CKPA 3ZONA
chains in the Genus database with same CATH superfamily
3DBCA 4FKWA 3W55A 2F9GA 3D5UA 3PY3A 2OJFE 1YI6A 2F7ZE 4FTRA 2XJ0A 3PG3A 4ITHA 4RIYA 4D4RA 4CKIA 4OUCA 3S0OA 3E3PA 5J9LA 5BVKA 1RE8A 1B38A 4L3JA 2EXMA 2ONLA 4P5QA 2OJJA 5HO8A 4FEXA 2CKEA 1Y6BA 3M11A 4L01A 5HTIA 3LLTA 1SYKA 4FE2A 4F78A 1H0WA 4C3FA 5KMOA 2A2AA 3FUPA 2GS7A 3LM5A 3ALOA 3P78A 1GIHA 2HXLA 2QC6A 4W4XA 5EI2A 2ITTA 2UW6A 2WMBA 4NJ3A 4O0VA 3D15A 3RJCA 5ANIA 3MA3A 3VS4A 4MBIA 4D28A 2P33A 4PDSA 1GAGA 1KV2A 3B8RA 4AN9A 3HAVA 4O7TA 3AGMA 3OS3A 3NNXA 4D4SA 4BDGA 3PA5A 4H3PA 1ZWSA 4BBFA 1S9IA 2W5BA 4IJ9A 4E20A 5H8GA 2Z02A 2GU8A 5IEVA 2Q83A 2VRXA 3OG7A 2C0OA 1Q4LA 4ERKA 2GNLA 2CLXA 2QLUA 5EYMA 1O6KA 1ZYDA 4X6QC 3DKFA 4V04A 2CGXA 3JY9A 4CKRA 5HVYA 4XBUA 4PNKA 4GT3A 3PSDA 2XH5A 3P79A 2PZYA 4W8DA 3ZBFA 2R7IA 3ZEPA 4FKUA 3ZLSA 4KD1A 5L3AA 5EHOA 2VX0A 1Q61A 2C3JA 4AT5A 3RPRA 4JBQA 3CD3A 4TN6A 5B2MA 3F88A 4YJVA 2IWIA 3F5GA 2YAKA 3FYJX 4AGUA 4ENYA 3T9IA 3ORLA 3C4XA 2C4GA 4O84A 4BCGA 2VTLA 3QFVA 1ERKA 3S2PA 4FA2A 5BX0A 3LJ1A 5K4IA 2YCQA 4IB1A 5CF8A 4RMZA 4LFIA 4LOPA 2IJMA 4C7TA 3ITZA 4GG7A 4IX5A 5JGAA 3T8OA 4JR3A 4LUDA 3NIEA 1MRVA 4FUYA 4NKAA 3R8UA 3HAMA 2XUUA 1YXXA 2GFSA 4PTEA 2YM3A 1IA8A 3PIYA 4ZJVA 2REIA 4CT1A 2JBOA 3GGFA 3ANRA 4YC6A 2F4JA 2HZ0A 4DDIA 4XG4A 1GIJA 1FVVA 2AUHA 3RAIA 3QA8A 4IAZA 3D14A 4G34A 4LGDA 3CKXA 5E8VA 2WTKB 2GQRA 3PE2A 5KE0A 2IG7A 2QOFA 3FXXA 5JFSA 5CZIA 3QQJA 3I5NA 4GK4A 4NK9A 4U9AA 1TVOA 4NIFB 3O50A 3SKCA 1T46A 4GL9A 4DE4A 4ANBA 3KULA 5M09A 2VNWA 4P5ZA 1P4FA 4OAUC 3NYNA 4QTBA 4KAOA 4U3YA 4CFWA 2YDKA 4MF0A 1W82A 4UBAA 2V55A 3ZUTA 2VTRA 1UNHA 4RIOA 1ZOGA 3GBZA 4LMNA 4FUXA 2YHVA 4O6EA 4DT9A 4IVDA 5I9XA 4DTAA 5L6OA 4MXZA 4RIWB 5FTQA 3AT4A 1SNUA 1XHAA 2IPXA 3SVVA 2XKCA 3CP9A 3MSSA 3A8WA 4EBVA 4XG3A 2VWBA 4DT8A 3R1YA 3C0IA 1LP4A 3UC3A 5TF9A 3G0EA 1LPUA 3QRTA 2VWIA 3UDSA 1VZOA 5DR9A 3Q9YA 1FBNA 4JVGA 4F7JA 3PJCA 4EH3A 1IEPA 3DNDA 2CNUA 3E7OA 4XCUA 2O64A 2WU6A 4RJ8A 3W2QA 1LUFA 5FUTA 3QTWA 5CSHA 3R9HA 3MESA 1RW8A 1OL6A 5M4FA 4CFNA 2XCHA 2QOBA 3GC8A 1YOLA 4QP2A 2YITA 1M17A 3P7BA 5DBXA 1TKIA 3FMHA 4OGRA 2QD9A 4X7QA 4XNEA 2FA2A 2QQ7A 4HPUE 1YRPA 3FKOA 5CT0A 3CXWA 3VUIA 3A8XA 1J91A 4MTAA 4LUEA 5JKGA 4XG7A 3G90X 5DHJA 5EM8A 4HYUA 3FAAA 4HW7A 4G5JA 2WAJA 4XOYA 4F9BA 2UVXA 4TYGA 2ITYA 3R2YA 2RSVA 4EONA 2XK3A 4EWHA 3QZIA 4FJVA 2X9EA 4C61A 3NFGB 3UOLA 3S95A 3Q32A 3QZGA 4YP8A 5IZFA 1UWJA 1YQJA 4GMYA 3R8VA 5HE0A 3F69A 1DI9A 2C6OA 3Q9XA 3U9CA 1FQ1B 3M1SA 4ITJA 5A46A 4QQCA 1WFCA 4FOCA 1ZARA 4DEBA 5A4LA 4JXFA 5AP1A 4BDKA 4KIKB 3NUNA 5M51A 3ATTA 3NPCA 4HCUA 4Q5EA 5C27A 2I0HA 4BF2A 2P2HA 3DQXA 4LRJA 2GS2A 3BHYA 2R3JA 3AC4A 3PVGA 2CKQA 4HVIA 1E9HA 3VAPA 2G01A 3ZS5A 4G31A 5G1XA 3E64A 4O4DA 5AV1A 2UVZA 3AC3A 4CFUA 3MIYA 4E5BA 3IECA 5BNJA 2AQXA 3CCNA 2BDWA 4RX9A 4XV9A 4BBMA 3WI6A 4IJPA 4U0IA 3TMOA 2VGOA 3R22A 2ZFYA 4J8MA 3TNHA 5IG1A 3H30A 3LFAA 3F82A 1URCA 2R3IA 2QOQA 3EYGA 4QEBA 4PRJA 1I44A 3QF9A 3Q6UA 5LQFA 2ZV9A 2YIQA 3TDWA 1HOWA 2FB8A 2HXQA 3LJ2A 5CF5A 5IQAA 3UE4A 4MAOA 2BZKB 5IMXA 1GNGA 3MIAA 3LCOA 4UXQA 2JKMA 2IZSA 2OFUA 2XRUA 2DUVA 3D4QA 3R73A 3FZTA 4FK6A 5DI1A 3VS2A 1NVRA 1YHVA 3RPSA 3BYMA 3EL8A 3ID6C 3Q04A 3DBQA 4F1MA 1EH4A 4ARKA 2XK4A 4FT7A 5LMAA 4A9RA 1RJBA 1H01A 2IZTA 5ACBC 4ZMEA 1IASA 3KCKA 2VGPA 3V6RA 5AP0A 2OH0E 5J7HA 2PVMA 5CVGA 4UY9A 4BWPA 2EXEA 2JFMA 4KINA 4WUAA 4DEAA 4FZDB 5L2SA 4FL1A 3TN8A 3VBXA 4C38A 2PULA 4D2WA 4IX6A 4JT3A 4BI1A 4EC8A 4EOOA 3KQ7A 3QHRA 5FTOA 2OBJA 3PFYA 3AMAA 3QQUA 4IWOA 4UWBA 2CSNA 5EI6A 3ZH8A 4WD5A 2WMQA 4EQUA 4DH8A 3PRFA 4XG2A 2PZRA 4WSYA 2OKRA 3FKLA 3LFFA 5D41A 4R7IA 3VIDA 3BLAA 3SRVA 2W9FB 3PA3A 4Y8DA 3ZOSA 3UTOA 2IZRA 4Z16A 4I20A 2Y6OA 4R7BA 2O3PA 2GSFA 4PTCA 3EN6A 4QP3A 2XAOA 4OT5A 5I0BA 4DH5A 3D0EA 4ASDA 4CMOA 2RFEA 3R9RA 3PP0A 4B99A 3VS5A 2IW8A 3MH3A 5E8ZA 3R9NA 3I6UA 3U51A 3MGYA 2F49A 4I4EA 4JL9A 2WFYA 1XMLA 2YM8A 2XNBA 1K2PA 4I41A 2JDTA 4ZTRA 1DS5A 4AU8A 1OIRA 4ZEGA 4AG8A 3U6JA 1ZYLA 2JDSA 4RA5A 2VTPA 3UG2A 1QCFA 2WPAA 4DGGA 2I0VA 2C0IA 2C6TA 2VWYA 4RQVA 5HCZA 2B7AA 3QXOA 1DM2A 2VUWA 3KMWA 5H9BA 4A9YA 4AN3A 2W1EA 5AV0A 4D0WA 2YM7A 4OTWA 2QOCA 3C0HA 3JXWA 3R21A 3AT3A 4MKCA 2XAMA 3O5AA 5CTPA 3OVVA 1H26A 4EHGA 3MVJA 3UYSA 2W1DA 3KXMA 3BWFA 2VD5A 5CAQA 2XYUA 3CTHA 4KRCA 4WBBB 4LOOA 1UU7A 4AE9A 3LOKA 4XV2A 3F61A 4IH8A 5E8YA 5HKMA 3FMKA 5BVFA 5GZAA 4KSPA 1ZZLA 2OJGA 2J50A 2WELA 4BTKA 4IFCA 5HX6A 3TUBA 2P0CA 3W0NA 1AQ1A 1WVWA 3G51A 5J5SA 3V8WA 4YU2A 2C6KA 4AX8A 4O7VA 4LRMA 5LARA 4ZIMA 3D5XA 2WKMA 2B9FA 3IOPA 3F3UA 2QOIA 5CAVA 3C50A 4WNMA 3VS0A 3K54A 4YLKA 2PU8A 2RL5A 4E73A 3IS5A 3ZLXA 4AXFA 4LRKA 5DRDA 3QRIA 5CS6A 3TKHA 3R8PA 2PSQA 3V5QA 4BTFA 5EKNA 4YHTA 4FZFB 1IG1A 3H9RA 3KY2A 3BV2A 5KCVA 3SOAA 2E9PA 4L44A 5ACKA 4AFEA 1F3MC 3AGLA 3VBVA 4FG9A 2PMLX 2WZJA 4UZDA 4BCOA 3DB6A 3H9FA 3DBFA 2XIYA 3MFSA 1KSWA 1X8BA 3UNJA 4GKHA 5DEYA 3V5LA 2Y0AA 2WQNA 2NO3A 3F5UA 3LQ8A 1MUOA 3PLSA 4F7SA 3VUDA 4RFYA 2A4LA 5HD4A 4EQCA 2BKZA 2R0IA 4MNEB 3VS6A 1MRYA 2RFNA 5CVHA 3QCXA 3RPOA 5A6OA 3UG1A 3SW7A 1XR1A 1M7QA 3H10A 5KNJA 3DAJA 4LGGA 2A1AB 3OC1A 4DF3A 3NDMA 3QA0A 4ANLA 4FV1A 2W5HA 1YDRE 2X7FA 5FDXA 1H1SA 3K3JA 3EJ1A 4V0GB 4I6QA 2B9IA 4XBRA 3WF6A 4R3RA 5HBEA 3ZCLA 4FTLA 2VWVA 3TI1A 2G2IA 1Q97A 3W8LA 4H36A 3LCKA 3EN5A 4Y46A 5ANJA 5IUIA 3MA6A 3VQUA 4FV9A 3R9OA 3LM0A 2VWWA 4UEUA 3DK3A 4GT5A 2ZV8A 2Z7SA 4U6RA 4QP1A 4FIGA 4FTKA 2W4KA 3IW6A 3QYWA 5IQBA 2IW6A 3EN9A 4CYJA 3UDZA 5CF4A 4PQNA 3BE9A 5AV3A 4A9TA 2PVRA 4GFMA 3WARA 4Q9ZA 4BIDA 4F9AA 4UYNA 2FYSA 3TTIA 4DTKA 5CSPA 5LJJA 1A9UA 3EFJA 3L1SA 3KK8A 1GY3A 4ZS0A 3FZOA 5HD7A 3TV6A 2OLCA 2XALA 5HEZA 3OCSA 4WIHA 3TM0A 4NSTA 2YAAA 4CYIA 4TYHA 3UIBA 2V7AA 4YBJA 4K77A 2QODA 3MW1A 3BELA 1JAMA 4FV7A 3UVRA 3QXPA 4QMZA 2ZYBA 4FBXA 4YJNA 4APPA 4F1OA 3UO5A 3NR9A 1PYXA 2WMRA 4EZ7A 2J0MB 1JVPP 4K33A 3OOGA 2BILB 5GJGA 3VUMA 3GU5A 4LV5A 5A6NA 3VULA 2XNEA 3ORZA 4BC6A 3BV3A 4FC0A 2JIVA 4DBXA 1ZYCA 4YZ9A 5DWRA 2B9JA 2PVNA 4LI5A 1URWA 3OT3A 5HU9A 2HY81 3CBLA 2ZM3A 3PJ8A 4Y83A 5M4IA 3LZBA 4PMTA 2ITNA 4L46A 4TZRA 4A9UA 3PUPA 4CEGA 4MD7E 2WQEA 3GQIA 5KMMA 3LXPA 2E9NA 1VR2A 4D5KA 3Q6WA 4G9CA 4FV6A 2FH9A 3SLSA 3HRBA 4ZTMA 4L52A 1WBPA 3UIXA 3FV8A 3VHKA 1CMKE 1Q5KA 2H34A 3DKOA 4MF1A 5HLNA 3DA6A 1GZKA 1Q3WA 2IVVA 2VWUA 3PXQA 5IUHA 3HX4A 3UMXA 3FHIA 2BTRA 4NEUA 4NM3A 4X3JA 3LMGA 4X6RA 3NAYA 4XV1A 2FGIA 3BYUA 3HDNA 3NUYA 4HVSA 3SX9A 3KRXA 2V5QA 4FSRA 3LPBA 5K0XA 2PUPA 4MEDA 5FXRA 2SRCA 2X9FA 3ENMA 4M97A 3ZLYA 4U42A 4P2KA 4FT0A 1ZOEA 2CCHA 1ND4A 3QQFA 5J87A 2Z7RA 4BY9E 3HKOA 4N4SA 2OW3A 4USDA 5CWZA 4QYGA 3P0MA 5L2IA 2XKFA 4RC3A 3KXHA 1H1PA 2WTIA 3GXLA 3MH1A 4G17A 4MCVA 4RPVA 3WIKA 2BFXA 2FUMA 4E6AA 4N70A 4ID7A 2E2BA 2ITZA 4ZTHA 3DBEA 1S9JA 2C6IA 3ORXA 4JIAA 1NA7A 4IWDA 2OFVA 3QLGA 3QTXA 2OF4A 4OTHA 1R3CA 4TYEA 4BCKA 3I0QA 3R7UA 3DDPA 4YZCA 2QG5A 2VO0A 3QQHA 4J99A 2WQOA 3HMMA 5AUVA 1OIUA 1Q41A 3CEKA 4HGSA 4HYIA 3F2RA 2QOOA 1TFFA 4IE9A 5HTBA 3MY0A 3F3WA 2W05A 5IQIA 1JSUA 3QQLA 4R8QA 5CXZA 4FTJA 4FV8A 4C62A 1W84A 5JGDA 4FTCA 2R3LA 4FZAB 3RTPA 5F4NA 4EI4A 4GKIA 3Q4ZA 4ZK5A 1YDSE 3SG8A 3S00A 4QTDA 4JG7A 4DBNA 4F6WA 4QMXA 3U4WA 2X6DA 3VC4A 3WE4A 4AA4A 4OBPA 3Q52A 4CRSA 4BDFA 2WMTA 5LVLA 4EYMA 3O8UA 3COKA 3A2CA 5CY3A 3HECA 3RK5A 5FBNC 4DITA 5FQDC 5JFXA 1OZ1A 5AFVA 3VHEA 3HV4A 3M42A 3BU6A 5HG5A 3G9NA 1G8SA 3AXWA 5J95A 4BDHA 4YURA 4KUJA 1IA9A 2R2PA 4G1WA 4GUBA 3AG9A 5CALA 3ZDIA 2OJIA 3KRLA 1ZY4A 2RKUA 3KEXA 3R7VA 4ASEA 3ZSHA 4CV8A 4Z7HA 1UVRA 4LDTA 2IZUA 2J6MA 3ELJA 4EOQA 4YGAA 2WD1A 5EDQA 4LYNA 3E62A 4E1ZA 4W4YA 3HMPA 3KRWA 5EYCA 4QTCA 3GC9A 2QHMA 3E3BX 4EYJA 4PP7A 4O4EA 1OITA 3AOXA 3NUPA 4OW8A 4J97A 5CU2A 4RBLA 3TKUA 4AGWA 3VRYA 4EORA 4NM7A 5JMSA 3R6XA 2IO6A 3GC7A 3BYSA 4YBKA 1W7HA 3OW4A 5ANKA 3QUEA 4AOJA 4ZY6A 3M2WA 4EH7A 4XP3A 1Q62A 4TXCA 2QR7A 2PL0A 4DFYA 2VO6A 1XBAA 4MWIA 3WBLA 3EQCA 4RWIA 1ZOHA 1U54A 4M68A 3WE8A 4HNIA 3F3ZA 4TT7A 5AMNA 3ULZA 3FC1X 3E7VA 3II5A 1BL7A 1OL7A 1OPKA 2ESMA 4O7ZA 2Y4PA 3FQEA 3BU5A 3ORNA 4IACA 2J2IB 4AT4A 2NP8A 3BI6A 3KC3A 2X0PA 1XH6A 1UKIA 2FSLX 4JOAA 4M12A 2VTMA 3ZXZA 3TXOA 5L8LA 3NVKI 3I7CA 1YI3A 2WOTA 3RK7A 4II5A 3CQUA 3ACKA 2B53A 2JC6A 3UBDA 4FEWA 4RA4A 3I0OA 1BKXA 4O0YA 1G5SA 5FLFA 3BPRA 3DPKA 5L2TA 4R1VA 1R78A 5AUYA 3LLAA 4IAKA 3P23A 2ZMCA 4XOZA 5L2WA 3HUBA 2AEGA 4YO6A 4DN5A 4KWPA 2AC3A 4EOSA 1KE9A 3PPZA 2JDOA 2HK5A 3OEZA 3ZFXA 3MV5A 1XBCA 3DK7A 5J1WA 2JIIA 2CNVA 3FMJA 3BLRA 4XP2A 5DE2A 3ZTXA 4C58A 3ET7A 4DDGA 3MVLA 2YM6A 3GCSA 4UWYA 4YLJA 5ETFA 3NMUF 4DEDA 4OBQA 4S33A 3UO6A 4WHZA 4L3LA 3F66A 1JNKA 3GVUA 3NUXA 2C1BA 4Y72A 3FLQA 2BRMA 3QLFA 4BKYA 4RX8A 2EB3A 4JQEA 3AKJA 3VBTA 3UYTA 2HZNA 2ITUA 2YFXA 3MFUA 2X6EA 4FKRA 4R3PA 2W17A 4ANNA 5AR3A 5LWMA 2XIRA 4CLIA 4MUQA 2C47A 1F0QA 2BRBA 3FLSA 4F7LA 3U4UA 5A54A 3AC5A 5TO8A 1TZDA 3RPVA 4GUEA 4DG2E 4FK3A 4D4YA 3OFMA 2VO7A 5E1EA 2XK6A 1PMVA 4BDBA 3FSFA 4JJRA 4BI2A 2P4IA 3FC2A 3HRFA 4D5HA 4IM2A 4AW2A 2J5FA 3KRJA 3R30A 2JFLA 3F3VA 2XIXA 4IVAA 4U81A 4X2JA 4HCTA 3LHJA 4X2NA 4AUAA 3VRZA 4C34A 1G8AA 3LFCA 3RK9A 4H58A 1H07A 4DHJA 1NVSA 2C6LA 2BHHA 3RGFA 1GIIA 4RRVA 3CIKA 3VS7A 4U43A 2WO6A 1XH8A 2YA9A 3ALNA 2BZIB 3E8CA 4LM5A 4PTGA 4F09A 4NH1A 2I7QA 1QPJA 3NS9A 3P08A 3AD6A 4UB7A 2XA4A 2LAVA 4L6QA 4K9YA 3BQCA 3Q9ZA 5B2LA 2BRGA 5DT0A 2AC5A 4AAYA 1ZMUA 3CGFA 4Q5HA 5JQ5A 5AJQA 1WBSA 5JRQA 3OTVA 4U8ZA 3GOKA 2XBAA 2FSTX 3SD0A 1H8FA 3QYZA 4TW9A 2VWZA 5DNRA 2UV2A 1ATPE 2GS6A 4WUNA 2J0KA 4QMUA 3SG9A 3DB8A 3EYHA 3LFDA 5EOLA 4F9YA 2QOKA 3D5VA 3JPVA 3GFEA 4XS2A 5K5XA 2VWXA 3PJ1A 4OTGA 3CSVA 5LVMA 3PWYA 1Q8YA 3ZO2A 4EOLA 4QP9A 1ZXEA 5CXHA 4U7ZA 3UQFA 4CTBA 4L7FA 3VONA 4HGLA 4XJ0A 3RAHA 2I1MA 4YTHA 2PMIA 4QPAA 5F9EA 3FQHA 4O2ZA 1H00A 4YC3A 3WZJA 5DG5A 1NY3A 4PDYA 3R2BA 5K4JA 5AUZA 4GH2A 5A4QA 4U80A 4HCVA 4I6BA 3UOHA 3MB7A 3FWQA 3P86A 3Q9WA 2BHEA 3FLWA 4HYHA 4P90A 3ANQA 4YZDA 4F0GA 4YJPA 4C4GA 4FV4A 1I09A 3MPTA 4PY1A 2BZJA 5AUXA 1J3HA 2HELA 5KMLA 1P2AA 2UZTA 2G15A 4WG4A 2B9HA 3MDYA 4G2FA 3CD8A 2WGJA 3LVPA 4RGJA 4DEEA 4CMTA 3I81A 1V0OA 4O4FA 4XLVA 3I6WA 3TJDA 4E93A 3ZM4A 4FT3A 2IW9A 3UP7A 4U40A 2OGVA 3C4ZA 3IW4A 3LE6A 2CGVA 4FF8A 3QWKA 4JDHA 3FDNA 3KL8A 4WNOA 5EW9A 5H2UA 3BBWA 5L8JA 3NX8A 5T68A 4EH2A 1XMMA 4FZ7A 2R4BA 5J9ZA 1LEWA 4OTDA 4AOIA 3NYOA 5DT4A 3VBQA 5JN2A 4JNWA 3I60A 2E9VA 3F7ZA 4CFMA 5EI8A 2UZOA 5EDRA 2WHBA 4KIPA 4RZVA 5CASA 1PHKA 5LOHA 2CDZA 4H1JA 3WOWA 3QBNA 3QCYA 4RSSA 3HV3A 2GQGA 3UPXA 5AEPA 4JAIA 3S1HA 5JZNA 3RI1A 2EB2A 5CEOA 2QKWB 1AGWA 4MWHA 5K5NA 2ETRA 3GT8A 2OZOA 2ERKA 4YC8A 5AR7A 4FKOA 4CRLA 3FHRA 3E88A 4A4XA 4NM0A 3AC2A 3W10A 4AF3A 4YNEA 5FXSA 5HQ0A 3FMDA 4QMMA 2NRUA 4ANMA 4GU9A 4BCHA 3HV5A 1YHSA 3LCSA 4P4CA 1W98A 4R6VA 4XLIA 3SW4A 2OSCA 3AC1A 3A7IA 4ZSLA 4CXAA 1RQQA 4AE6A 2HAKA 4DFNA 3T3UA 2QG7A 3C7QA 4FSZA 1STCE 5GIPE 5IPJA 3N51A 3MPMA 5TE0A 4B7TA 1H1WA 3FLYA 5JEBA 3V5TA 4D58A 3KXZA 5B2KA 5AUUA 4W9XA 4NM5A 4ALWA 1VYZA 2PY3A 4LG4A 5AIKA 4QMNA 2B54A 2HOGA 2ITVA 2W1IA 4M0ZA 4FSYA 4NTTA 4J95A 4ANOA 4EK3A 3CY2A 3F5PA 4GVJA 3ORMA 2UW4A 4IBMA 3VUGA 4YJUA 4IX3A 5HVJA 5KKRB 1TQMA 3Q60A 2YN8A 2XCKA 3DGKA 4HGEA 4XHKB 2YIWA 3AT2A 3VF9A 4DFBA 3WZEA 3EN4A 4I1ZA 5BV3A 3U8WA 2VTJA 2RF9A 4O21A 4DEGA 3D7TA 4RVMA 3RZBA 4L8MA 3R8MA 1FVTA 2WIPA 2XRWA 3Q53A 4C36A 3DZQA 4UMRA 4TWPA 5BYYA 4FSWA 4Y73A 3WZDA 2ZOQA 4FKGA 4XH6A 2UZUE 2QI8A 1QPCA 3DY7A 5J8IA 3TNPC 1T45A 3OWLA 4USEA 5AX9A 1Q3DA 3ORTA 2VTHA 4TY1A 3QD2B 5D7AA 3TV4A 2XANA 3TEIA 2NYAA 4YO4A 2BAKA 2GNIA 2ERZE 3EZVA 3F3TA 1BLXA 4QYHA 5HG8A 3GB2A 3DNEA 4A06A 2HWOA 5DH3A 2VV9A 1P14A 2QCSA 5HNBA 4YSMA 4FV3A 3ZO3A 2XBJA 5AA9A 3OXIA 2UZBA 3W0QA 2A98A 2UUEA 4I5MA 4C0TA 4BZNA 4C4FA 5EHLA 4ZSJA 5A4EA 4I6LA 4O96A 2Z60A 4AN2A 4AS0A 5L2QA 3FYKX 2UW0A 2O65A 4ZTQA 3DTWA 4Y5QA 3VUKA 4EBWA 2R3OA 4CFFA 4DHIB 2VN9A 2HW6A 3DFCB 2RFSA 3COHA 5LVNA 2VTAA 4FEQA 3MFTA 3QU0A 3UVPA 3EQRA 3OHTA 5EYKA 2Y4IB 5L8KA 2VX1A 2GHMA 2X39A 3A99A 4DHFA 4IZYA 5JFVA 1OL5A 4MQ2A 4RFZA 4BICA 2X7GA 2A19B 3DS6A 3ROCA 1OGYA 2A0CX 3Q3BA 1JQHA 3PPJA 2PZPA 3CQWA 5AUWA 4O0TA 2B1PA 1ZYJA 3P5KA 4GS6A 1V1KA 3NEWA 4MXXA 3BL7A 4EQMA 3IW8A 4RJ3A 5M57A 4YUQA 4EJNA 3R63A 5HIEA 4BR3A 2R3NA 2P55A 3H9OA 3A7JA 5GNKA 3KXGA 4L00A 4NT4A 1Q8UA 3HP5A 1YDTE 3I79A 4YMJA 4R3CA 4CZTA 4L68A 2XJ1A 3CJFA 3ZUVA 5I3OA 2J7TA 5B7VA 4IB3A 1MRUA 2YERA 2OZAB 3HNGA 4TYIA 3V3VA 5BUJA 5HIBA 1R0PA 2DS1A 3FPQA 4S34A 1F5QA 3QQKA 4BGGA 4C8BA 1XH4A 3JS2A 1SM2A 4IQ6A 1E1XA 3GUBA 5A3XA 3IDPA 5LCKA 5IA4A 4OR5A 5LMBA 5D11A 4D2VA 4KBKA 3LXNA 4R77A 2HZIA 3MN3A 1YHWA 5FWKK 4M14A 3V01A 3MJ2A 1PXKA 4FNXA 4UMUA 1SZMA 3UODA 4O1PA 1ZRZA 4O0SA 1U5QA 3CPBA 3KB7A 5LMKA 2V7OA 4PDPA 3DDQA 4ITIA 4NZWB 5HO6A 5KMKA 2CLQA 3KGAA 3QX4A 4FYOA 3NLBA 3ODYX 4ZJJA 3UNZA 2XF0A 5IH5A 4K0YA 4IIRA 5H3QA 2YIXA 4XRLA 3DU8A 1JKSA 1XQZA 3LXLA 5I3RA 3LMIA 1Y91A 1YVJA 4FTTA 3P5JC 3NUAA 4BDCA 3GCQA 5IA5A 4C2VA 4YR8A 4DGOA 2XKDA 1BUHA 2R3MA 2HCKA 3POOA 1AD5A 3U6IA 3BHUA 4KABA 3HA6A 4JX3A 2PUIA 3FZ1A 3MVMA 3Q4TA 3AMBA 4PPBA 3ZLWA 2P2IA 4I5PA 5IA3A 3MH2A 1XKKA 4XRJA 1BI7A 1ZMVA 5AR5A 2PHKA 2BALA 4Y85A 4YHJA 2HENA 4C4JA 4KS7A 1OL1A 4QQTA 1FPUA 2PVHA 5K3YA 4BHNA 3ROYA 4L42A 4HPTE 1M2RA 5FBOA 1JPAA 1M2PA 4PL4A 4I4FA 4WT6A 3ZZWA 5ETIA 4EH6A 4L7SA 4LV8A 3LFBA 2R7BA 3EFLA 3T9TA 2QLQA 3EKNA 3DFAA 3L8SA 4IZ7A 5I9UA 2C3KA 4N6ZA 3UPZA 5ANDA 3R8ZA 3DAKA 1H1RA 4RJ7A 4FKSA 4RIXB 4LQMA 3K5VA 4U44A 4XMOA 4TNDA 1JBPE 3TIYA 3W1FA 1PY5A 5BVOA 3G0FA 3UNKA 4BDDA 5IDPA 2DYLA 4NL0A 3MY1A 1YXTA 3QKKA 4E6QA 5KHXA 2WTCA 4ALUA 3C4EA 3HV7A 1FGKA 4IM3A 4S31A 3TYKA 4MBJA 2OK1A 3R04A 4PMSA 4O27B 4M15A 4NYEA 4AA5A 1YW2A 3MTLA 3ZC6A 4KBCA 4J1RA 5IKWA 5HG7A 4Q9SA 3I7BA 1Y57A 5KZIA 3L9NA 3WZUA 4NKSA 4BB4A 5DFPA 2YJRA 2G2FA 1WZYA 3QWJA 4YPDA 4NIFA 2UW8A 4WRGA 3W2RA 5LMKC 1MP8A 1Z5MA 3PPKA 4KKHA 3DOGA 3NW5A 2JKKA 4N0SA 4ZTLA 2WTDA 2C1AA 3QALE