4U41A

Map4k4 bound to inhibitor compound 1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
295
structure length
275
Chain Sequence
SSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEIKLEINMLKKYSHHRNIATYYGAFIKKSDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
total genus 82
structure length 275
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u41A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u41A01
1OL7A 4YJVA 5AUVA 3DNEA 1NXKA 4R6VA 4FYOA 5ACBC 3DQWA 5AV2A 1OL1A 3TIZA 1YDTE 2GDOA 3GUBA 1H26A 4CMUA 4IDVA 4PUZA 1YKRA 2XK8A 2Z7QA 3PLSA 1F5QA 4I23A 2C69A 2H8HA 5AV4A 1NT2A 3P7BA 3EKKA 3QZGA 4JRVA 2QHNA 5J1VA 3CPCA 2CKOA 4EH9A 3A62A 5EKNA 2UW0A 5E8SA 4FSWA 4PPAA 3IPHA 3JXWA 4YO4A 2VGPA 2Y6MA 3MVJA 2VO3A 2UW9A 1FVTA 2KULA 2OU7A 3TKIA 4O7NA 2XJ1A 1NA7A 3OMVA 2UZDA 3DV3A 3FPMA 1REKA 2C47A 3VBQA 3LFDA 2R0UA 3FMJA 4F0IA 4H3BA 2SRCA 4EOPA 2Y0AA 5KMKA 4NT4A 1YWVA 3OCGA 4G3CA 4BYIA 2A4LA 2HZ4A 4IXPA 1A9UA 2QD9A 2XYUA 1Q8TA 4FKPA 4CV9A 5JFSA 3EJ1A 2OZAA 4G31A 5F9EA 3EZRA 3FZPA 4YJTA 5LMAA 3RAWA 3ZFMA 2GNFA 5D1JA 3U4UA 5GIPE 4FK6A 2XKDA 3NYXA 3C0HA 3RZFA 2JDOA 3FZSA 4TTHB 2GNIA 2J50A 3QQHA 2Z8CA 2CGVA 3QQKA 4PTCA 3BPRA 2OF4A 3PIYA 4FUYA 4NH1A 3Q96A 4L52A 1G5SA 3DDPA 1JLUE 4L43A 2ITNA 4TYIA 4WNPA 5E8VA 1CKJA 4BZNA 2PPQA 2QG7A 5HVJA 2WTKC 1WBNA 3QWJA 4L01A 4TYEA 2WXVA 2YM8A 1UU3A 4W4VA 3PZEA 3VS2A 3Q04A 1I09A 3QCXA 4IJPA 1FINA 2JIUA 2RIOA 2XIKA 4H58A 4FVPA 4X3FB 4AG8A 3PVUA 4BDBA 3F2RA 4RVMA 4RJ6A 3R8MA 4BWXA 4EH7A 3R1SA 4LOPA 1E1VA 2ACXA 1WMKA 4QYHA 4DEEA 5BUJA 4FKQA 3WZEA 1U59A 4BVUA 4EWHA 2VTIA 2W1FA 2Y4PA 4FKVA 4XG6A 4AT3A 4HYSA 4DAWA 3LJ0A 2VTAA 3OZ6A 4XH6A 3A2CA 2NP8A 2BTSA 4BZDA 2CPKE 3P79A 2VTHA 1HOWA 4LI5A 4O0YA 4FV3A 5HNGA 1UV5A 5AR8A 5FWKK 3MV5A 4YZDA 1Y8YA 2C30A 2XM8A 4U41A 3QLFA 5DOSA 5HO8A 3II5A 5A4LA 4FE2A 4EKKA 5FTQA 2XKEA 3UO6A 3UG2A 4O86A 3V8TA 4TWPA 5ETFA 2YJSA 3RJCA 3GEQA 4XP3A 3VULA 5BYLA 4ANSA 3QBNA 2CMWA 2PZ5A 3WE8A 5BYYA 3RAIA 3P9JA 2PVMA 4GIIA 2QKRA 4YJNA 4DH8A 1IAJA 1F3MC 2BRNA 5EDPA 4NL0A 4RGJA 3EH9A 4G3GA 4O27B 4EHEA 2X8DA 3GBZA 3HYHA 4BI0A 4BBMA 3EQCA 5DR9A 4QP9A 4XYFA 4Z7GA 5HQ0A 3R8UA 3BWFA 4DG0E 2GQSA 3R9RA 2XCKA 4YBJA 4QMXA 3IG7A 3ET7A 4ITIA 5L8JA 3TL8A 1ZZ2A 3MFRA 5HLWA 1I44A 2YA9A 3LAUA 3Q4UA 5DT4A 3RP9A 2YDJA 4AW0A 5C1QB 3TACA 1P4FA 3I7CA 3ZUTA 1OIUA 3ORKA 4X2NA 3I4BA 2ZB1A 1H8FA 2OK1A 3OXTA 1S9JA 3R1NA 4DTKA 5C8KA 5LVNA 1Q99A 3BE9A 4FL1A 4QMVA 2JKKA 2W5AA 3P0MA 3ENHA 3S4QA 3WZJA 4CKIA 4K2RA 3CLYA 4KINA 3CQUA 2R64A 4FV1A 1SVEA 1SYKA 1XHAA 3DB6A 4P5QA 2JKQA 1IEPA 2YM5A 2C3JA 4QP6A 5BPYA 1XBAA 4FTUA 3DB8A 4RJ4A 4UMQA 5JZJA 3SG9A 4P2KA 3K5UA 4QTDA 3BZ3A 4F9WA 5CEPA 4EBWA 4FL2A 4RLLA 3FXXA 4DCAA 2J5EA 4Y5HA 5FEDA 3DZOA 4OBQA 4F9AA 4M0YA 4CZYB 4ZLOA 4XOYA 4M13A 1IR3A 4XV9A 1CDKA 3PUPA 4CLIA 4AA0A 4PDSA 3QD3A 5FGKA 5D7AA 3VRZA 5AR3A 3UZPA 3UBDA 5E91A 1ATPE 1ZYLA 3IONA 3OCSA 3R9DA 4BCFA 2VWIA 2OG8A 5AX9A 4G6OA 5DRBA 3RI1A 5JN2A 5AM6A 4BN1A 5I9UA 2C3LA 4J8MA 5T6KA 2BRMA 3ZLSA 3R71A 1M17A 1PF8A 3BYVA 3PWYA 5CF5A 1M2RA 3TEIA 2WB8A 3ELJA 3LXKA 4FK3A 5LWNA 1JSUA 2W5BA 3BYMA 2H6DA 2VTOA 2WTIA 3ZCLA 4IADA 2RG6A 3FQSA 2QVSE 1W0XC 1YI6A 3W18A 4E6AA 3ODYX 3SXSA 3R21A 3UMWA 3IGOA 5E4HA 4UX9A 3ORZA 2ZMDA 3S95A 3COHA 4EH4A 3SOAA 5T68A 4M69A 3S00A 4E93A 3BX5A 4OTRA 2WTVA 4UXLA 3SW4A 1P14A 3NZ0A 1WBTA 2UW6A 2W9ZB 4O7TA 4K18A 4MH7A 4YLJA 3Q32A 4BCOA 1AGWA 4PRJA 4RT7A 4U79A 4NUSA 5DEWA 1YDSE 2W1GA 1WVXA 2XJ2A 5CI6A 5EOLA 2XBAA 3KK9A 4KRDA 5TKDA 5AUUA 4U3ZA 3NVMB 4C37A 1SNXA 2B4SB 3TZ8A 4X21A 3VBTA 4RIOA 2PE2A 3QD2B 1OECA 3MY0A 3BU6A 2VNWA 4TY1A 4A07A 4BF2A 4XP2A 4U97A 3QUDA 4JQ8A 4KRCA 3HEGA 5TF9A 2XNOA 5J9LA 3I6WA 5CWZA 4IM2A 3QHWA 4FNYA 4RWIA 3MPMA 4IZ5A 2JDVA 3I5ZA 3O8PA 5EFQA 2J0KA 5EI8A 3PDTA 3TDVA 2C5YA 2WIPA 3VF8A 2VWXA 4N4SA 4D5HA 2UZUE 3F3UA 4OT6A 4GSBA 4D4RA 2ZV8A 3DK3A 3CC6A 4DFZE 4FTCA 1JVPP 1OIQA 3O96A 3KGAA 2V5QA 3P78A 3QU0A 3REPA 3ZDUA 2BCJA 3CGOA 2OJJA 1YWRA 3CTJA 4MVFA 3VO3A 4MD9E 3DJ5A 1MQ4A 3SX9A 2CKPA 5JFXA 2GMXA 4ZSAA 1DAYA 2RFSA 2PMOX 4RFZA 2VO0A 4BRXA 4X7QA 5F94A 5EK7A 2WO6A 4RA4A 3QTSA 3MN3A 4BGGA 2XIXA 4CVAA 2QQ7A 3IGGA 2WMSA 3IECA 4FOBA 1R78A 2PSQA 4L3PA 3W1FA 2X7OA 3PA5A 4QP4A 4EYJA 4YHJA 1OL6A 3CEKA 4FX3A 2FVDA 2WGJA 3NR9A 4P5ZA 5HI2A 1QMZA 2ITQA 4O7WA 3PPJA 5GZAA 5IKWA 3RPOA 1UNLA 3OW3A 2RF9A 4RBLA 1W84A 4I6HA 3RWPA 4C38A 3DAKA 2P2IA 4BTJA 4EK6A 4FKWA 4LFIA 2XIYA 3G9LX 4I24A 5CS6A 3MY5A 5KZ0A 3BI6A 4FG7A 5HG5A 3D7TA 4YC3A 3SW7A 4JJRA 5D7VA 4RA5A 3ALNA 1LEZA 4LM5A 2JKOA 4IX5A 3KXGA 5M09A 2ERZE 4IEBA 2Z02A 4IVBA 4BDJA 3FLYA 3QTXA 4E4XA 3MJ1A 5L2QA 4L68A 3M42A 4B4LA 2CJMA 2PVKA 3QKLA 4UMUA 3UQCA 4O0TA 4QNYA 5CEKA 3U55A 5AUTA 4EQMA 1ZOHA 4GUBA 2QOCA 3PE1A 3F5UA 3GI3A 2JDTA 3GC7A 1SM2A 3C0IA 2X1NA 4NFNA 3QYWA 3RM7A 3O7LB 3E8CA 5E8XA 4DH7A 1XQZA 3FZTA 4K33A 3NS9A 1ZYDA 4NEUA 3UOKA 3SOCA 3FI8A 4ZTQA 3Q4CA 3VS3A 2GQRA 3C0GA 4I22A 3H9RA 2OI4X 1H1SA 4FKLA 4EUUA 4O7YA 5IQGA 4RX8A 5HU9A 4EORA 4QYYA 2CGXA 2WOTA 4X2GA 4NWMA 1XBCA 4GUEA 2GHGA 3A7HA 3LFFA 4GJ3A 1PJKA 5AR7A 5E1EA 3EQPA 1G8SA 4TYHB 4IVDA 5AR5A 3PJ8A 2QU5A 2QODA 3QWKA 3BCEA 2LGCA 4G5JA 3LM0A 4ZJIA 5CASA 4V01A 1LUFA 4FTJA 1YDRE 5HNBA 1K2PA 4C4JA 2X2KA 2Y4IC 3FE3A 4PDPA 1UWHA 5CEQA 3DBEA 3TCPA 5FRIA 3ZRMA 4GU6A 4YU2A 4MD7E 4BCKA 1H1WA 1ZAOA 2XNNA 3R83A 1Y8GA 4FTAA 3VNTA 2BAKA 3ORIA 1NVRA 4GU9A 4RMZA 2VNYA 3Q2MA 4YBKA 4JG7A 4F63A 2BRBA 3Q9WA 1XJDA 4A4XA 4GJ2A 2XBJA 1UU9A 4A4LA 4L67A 3GP0A 3GGFA 5IA0A 4LV5A 3Q2JA 2IJMA 3BLHA 4QMNA 3DOGA 5AV1A 1OBDA 4DN5A 3LFSA 2C6OA 4XRJA 5CAQA 5JGBA 5HD7A 5B0XA 4Q2AA 2W1DA 4R3PA 2XNBA 2GNJA 4AZFA 3FI2A 3QRIA 5F1ZA 2VTJA 4WIHA 2BZHB 3D9VA 3PPKA 3C4EA 4YURA 5IA5A 4YP8A 3UZTA 5AIKA 5CEIA 3UODA 4RIWB 2UZVA 2Y8OA 5BVOA 3HV5A 3LCSA 1UA2A 3U8WA 1OKYA 5LMKC 2WQNA 2A27A 4BYJA 4BCHA 4ANNA 4CFUA 3VUDA 2CHLA 2YIYA 5LQFA 2YLFA 4NZWB 2ESMA 2R7IA 4OLIA 2GNHA 5EW8A 5CSHA 2YDKA 4DFNA 5DRDA 1J1CA 3IOPA 4E8AA 3A99A 4MQ2A 3L9LA 3DKFA 4G17A 5DNRA 5DG5A 1XR1A 3SRVB 4CCBA 2QR8A 2I7QA 2R3LA 5AADA 3UJGA 3K3JA 4JAJA 2BDFA 3DCVA 4IW0A 1PXLA 4DA5A 2OSCA 3VHKA 1PXJA 2IG7A 5A54A 4RC3A 5GHVA 2VTLA 4RVTA 4FSQA 4UMPA 2QR7A 2DYLA 2IZSA 3R02A 4KIKA 5HE2A 5D11A 4C59A 1BMKA 5H8BA 2W1CA 2CCIA 3V5PA 4ZTMA 1CSNA 2VTMA 3OFMA 2OLCA 1R1WA 4QTCA 1U54A 4HYUA 4FSNA 4WUAA 3ORXA 5AP1A 1SVGA 3W32A 4IWOA 5HBHA 2OH0E 3OWLA 4O0WA 3PWDA 4J99A 2XRUA 3MSSA 1JWHA 2QO7A 5DA3A 4ACHA 3LJ1A 4AU8A 3ORTA 4GFOA 3R73A 3H0ZA 3POOA 5I9WA 1IRKA 1LEWA 3QCQA 5FEEA 5CU2A 4YJOA 3F5XA 4C3RA 4D2TA 4O1PA 4AUAA 4E6CA 4CXAA 2HW7A 2X2MA 4YNEA 4IZ7A 3DFAA 5DIAA 1Q3WA 2C0IA 1YOLA 1FVVA 1J91A 2P3GX 3E62A 3HDMA 3Q60A 1LPUA 4U7ZA 3VRYA 1JSVA 3PXZA 3LLAA 5DYJA 4FIHA 1OITA 2GHLA 2G9XA 3ZU7A 5GIOE 3LXLA 4D2PA 4XG4A 4X2JA 4IM0A 2BFXA 3NDMA 1XH8A 3MA3A 3NYVA 4PPBA 4BIBA 3K5VA 5IEXA 2EB3A 4NK9A 2WQOA 1QL6A 5LMKA 1PXIA 2XIZA 2H96A 4YNOA 2NNWB 3OY3A 2XF0A 3UC3A 1KSWA 3UNKA 3FQHA 1IAHA 4S31A 4GL9A 1OGUA 2GS2A 3KN5A 3DXQA 2CGUA 1ZXEA 4MTAA 3WF9A 3TZ9A 5DFPA 2Y4IB 3ZH8A 2GNGA 3UG1A 4OW8A 3R30A 4O96A 5DHJA 2CDZA 3OUNB 4PNIA 3O17A 2PE1A 4M12A 5CLPA 2GHMA 3WBLA 4G2FA 4F6WA 1H1QA 4AW2A 5AWMA 2I0HA 2XEYA 2XS0A 2P2HA 4QTAA 4DCEA 4F64A 5EH0A 3LCTA 3LQ5A 4WUNA 3SQQA 5L8LA 3MWUA 2VTPA 1PY5A 3FZOA 3G9NA 4TPTA 4ARKA 2CKQA 3MW1A 3DFCB 5HTCA 3KXXA 2BKKA 2ZVAA 4NM3A 1W8CA 4BWPA 3KN6A 3GCPA 4QNAA 3R2YA 4TZRA 4KNBA 5HE0A 4V0GA 4CD0A 5LWMA 5GJGA 3BGZA 2X8IA 2GPHA 4IM3A 4WNMA 4U42A 3KXNA 3BKBA 4AE6A 4WSQA 2X39A 3BGQA 2I0YA 4WNKA 5ANIA 4EOQA 3F7WA 4C02A 3DKOA 1KE8A 4FZDB 1T46A 4XRLA 3MFSA 5M07A 3PSCA 1M52A 4BCPA 3ACKA 2VX3A 4AOTA 1ZMWA 2HK5A 4U3YA 4EL9A 1J1BA 2C0TA 3IW6A 4OR5A 3A4OX 5HIDA 3QGYA 5AV0A 3DA6A 2C5NA 4I93A 4WSYA 3JR1A 2WTWA 2BAJA 1Y91A 2HELA 3I0QA 1RE8A 2BMCA 4RX7A 2UW3A 2ONLA 4CZTA 5CF8A 1GNGA 1XH4A 4D9TA 2VO6A 3QD0A 3W2SA 5CT7A 4HGSA 5C4KA 2QI8A 3TKHA 4FKUA 4H3PA 3BV2A 4J96A 1PMNA 2JGZA 2GTNA 4ZAUA 4YTCA 1U5QA 4JDIA 2PL0A 5EYKA 4BGHA 3RPRA 1RQQA 3QTIA 5B2KA 4MXAA 4PQNA 5CNNA 5FTGA 1BLXA 3AD4A 4KBCA 5K0KA 4R5SA 4D28A 4U5JA 3N9XA 4NKSA 5LVMA 3R7UA 4HGLA 4NIFA 3U6HA 3VS5A 3BYSA 2EXEA 3PZHA 5K3YA 3SVVA 1RW8A 4Y73A 3CPBA 5IDNA 4AT5A 1Q3DA 5HG9A 4O0VA 2QOOA 3SAYA 3DJ7A 4A9UA 2OXYA 2VN9A 3E87A 4MKCA 1B39A 5E8WA 4EOLA 3BBTB 4W4XA 3OP5A 1JBPE 4MNEA 3ANQA 4C7TA 5L6PA 2X6EA 3A60A 2WQEA 2WEVA 2WKMA 4K0YA 5HOAA 3D15A 3E3PA 5BMMA 4I4EA 2WOUA 3HRFA 3HMMA 3W2PA 4C33A 5M55A 4NW6A 2B9JA 3GCSA 4LMUA 3TNWA 2ZDTA 1QPEA 4MF1A 1SNUA 3Q52A 5H9BA 4FNZA 4HVHA 4RQVA 4WT6A 3RPYA 4DGOA 2BAQA 4C8BA 4DFYA 4ZZOA 2CNQA 3AT3A 5HLPA 4F65A 3ZC5A 3MTLA 1JAMA 5AV3A 3ZMMA 4QQCA 3UIXA 3RINA 4FT0A 3F3TA 1M7NA 2Z7RA 3DTCA 1PMEA 3BHHA 4FV5A 4L6QA 1YXXA 2PWLA 4ZP5A 4UV0A 2B1PA 4R7IA 4EHZA 4LRJA 3ZDIA 4B8LA 4E5BA 4DTBA 3SV0A 2PULA 2HOGA 4LRMA 5KE0A 5IU2A 4O7ZA 4GV1A 1JKTA 2GU8A 4FV2A 5TE0A 2PYWA 4FEWA 5I5ZA 3NW6A 5EHLA 2ETRA 3KFAA 1T45A 2R3QA 3E8NA 2HW6A 3FMMA 4V05A 4BI2A 5GNKA 3BE2A 3F2AA 3T3VA 3FHRA 4UXQA 3SHEA 3VW8A 3WZUA 4HPUE 4IQ6A 2I0VA 3CY3A 4D2SA 4RIXA 2WPAA 3ORPA 3PY1A 5F95A 2HIWA 3ZZEA 5B2LA 1J7LA 4CRLA 4UZDA 2GFSA 2PMIA 3OROA 3V51A 3MDYA 3WIGA 1H28A 2OFVA 2B9IA 3M11A 3OG7A 3RGFA 4BB4A 4RZWA 3EIDA 3CCNA 2XRWA 3NW7A 4O0SA 4TL0A 4DT8A 2BRHA 2F7EE 4H1JA 4KD1A 3VS0A 2CCHA 4D4SA 2ZDUA 4J53A 4R8QA 4F7JA 3WZDA 3KRXA 2VWZA 3MH3A 1H00A 4BR3A 4M3QA 3GB2A 2G15A 4ORKA 3RM6A 2A2AA 2QCSA 4CYIA 3LQ8A 3Q4TA 3V3VA 4QMUA 5FUTA 3QL8A 4BDEA 3KULB 3FLNC 4O7SA 3OTUA 3V01A 1SMHA 2PUPA 3W16A 2XB7A 4K11A 3E88A 2VZ6A 3VC4A 2W7XA 2G01A 4NW5A 3EFLA 2JFMA 4B0GA 4EOIA 3TV4A 1APME 3TUCA 2ZV9A 4FIGA 5IQIA 3FMDA 3V5TA 5C27A 3NUAA 3LFEA 5KMJA 4GKIA 4DE4A 3LMIA 4KA3A 2IVVA 5HEZA 2C6LA 3ZTXA 1BL7A 3MIAA 2BALA 4I20A 3NCGA 3WYYA 4F1TA 5HNIX 4BGQA 2W4OA 5BVKA 4A9RA 4HZRA 4XLVA 3MFTA 5FDXA 3IK3A 5CAUA 4YJQA 2PVHA 1QCFA 4ALUA 4BDHA 5K4JA 4RWJA 2W05A 3GCUA 5DMZA 1YHVA 2YN8A 1GIJA 3GU7A 3CSVA 5CSXA 5JKGA 4FKSA 5FD2A 5J7HA 1BX6A 5EM6A 4AW5A 2YEXA 1UU7A 2VWVA 4FIFA 3EFWA 3QKMA 5HZNA 3RHKA 4C2WA 4DG2E 4ZJVA 4UBAA 4G6NA 2OFUA 3C7QA 1ZOEA 3CJFA 4FYNA 4TNDA 4IWPA 4S33A 4CSVA 1MQBA 4H36A 4QP3A 5A4TA 3KRRA 3ZHPC 1FQ1B 3KMWA 1VZOA 3CKXA 3R6XA 4L46A 4O21A 2FSMX 3TTIA 4DBXA 4L7SA 1H07A 1JSTA 2ERKA 2GFCA 1TVOA 2VU3A 4F99A 4USEA 4GIHA 4HCTA 3SXFA 4LUEA 4JDKA 4ZSGA 1ZARA 3TIYA 4ITJA 3HLLA 4YHFA 3MVLA 5AP2A 4AQCA 4IE9A 5HE3A 3P86A 2CLQA 2IN6A 3DK6A 5E7RA 4JBPA 3NAXA 4JQ7A 2Z2WA 4GS6A 5EM5A 2X0GA 1KOAA 4FSMA 5LCKA 3ZONA 3U87A 2OZAB 3W33A 2YDIA 4HJOA 2XCHA 4O83A 4KAOA 4IFGA 2AUHA 3EL8A 1ZYJA 2AC3A 3PJ1A 4JIKA 3F6XA 3HX4A 4RIYA 3ZRLA 1AD5A 5KBRA 3W8QA 4C3FA 3ERKA 3LKMA 2F57A 3AC2A 2ZYBA 4MXZA 3FWQA 4I3ZA 4ACDA 4DT9A 2QOKA 1QPDA 4BCMA 5JZNA 3Q6UA 3ZS5A 4BL1A 3KVXA 4DFUA 1YRPA 2BDWA 3BIZA 4FIJA 4M67A 1WAKA 3F9NA 4FF8A 4QYEA 3BQCA 2X9FA 3F7ZA 2UW4A 5EKOA 3WIKA 2VTTA 4HOKA 4QMLA 5FM3A 4AAAA 3GOPA 4QQ5A 3NNUA 3VQUA 1GAGA 4MAOA 4DGLC 4D2VA 4R7HA 4FZFB 5A14A 3C4CA 3LCKA 3E63A 2CN8A 2B55A 3HRCA 4QTBA 2A19B 5LMBA 4D5KA 4E20A 3JUHA 2R3MA 5FQDC 4U6RA 4OTIA 5AP5A 5TO8A 3B8QA 4MEDA 4W4YA 3V6SA 3ZEWA 4GMYA 4KIPA 1E1XA 2YHVA 2VGOA 4DEDA 2PMNX 4GYGA 4WNOA 4BC6A 5TT7A 5I9YA 4ZS0A 4TNBA 2IWIA 5HIBA 5AAEA 2JFLA 1V0BA 1V0OA 3H9OA 5GJFA 2HXLA 3UIMA 3SD0A 2QURA 3ZBXA 1YHWA 3DQXA 3HAVA 1H1RA 2P0CA 3VS6A 4DEHA 4DBNA 4E73A 1YXSA 4M0ZA 4JIAA 4Q5EA 1QPJA 2BIYA 3HMPA 4MWIA 4U40A 5HE1A 3ZM4A 4PDOA 2ITVA 5E8UA 3VBYA 1XH5A 4C4IA 4ZZNA 1UKHA 5I9VA 2XK4A 4NCTA 4UWCA 4TYGA 3W2QA 4QMMA 5EG3A 2C6IA 5D41A 3ZOSA 2ITWA 3EFKA 2WAJA 5AM7A 3O7LD 4ZY4A 5DN3A 5HVYA 3NVKI 4XJ0A 1BI8A 4BCJA 3TN8A 4R7BA 4LL0A 3ZSIA 3NIEA 4PL3A 4QPMA 4YZMA 4AGCA 4KIOA 2UZNA 4GFMA 4DTAA 3R28A 5FBOA 4FKIA 3THBA 1OUKA 3OOGA 4IX4A 3Q9ZA 3UIBA 4DEGA 3ID6C 3R7GA 4ANMA 2IZTA 1KE6A 2W99B 3FC2A 4HNIA 3MESA 3WF8A 4KIQA 4QMYA 4YSMA 4WG5A 3E64A 4JX7A 4K8AA 4L44A 3H10A 5HHWA 5D12A 3U54A 4D9UA 2UW7A 3BHTA 4RG0A 2WTKB 4DFXE 1FVRA 5HO6A 2YZLA 1MRYA 4KWPA 1Z9XA 2UW8A 3D83A 3TI1A 1K3AA 1YWNA 4PMPA 2F4JA 3UDBA 3E92A 2CN5A 2QOLA 3COIA 1PKGA 2FO0A 3R7YA 4ANQA 4QYFA 5FDPA 4D1SA 2NRYA 5CENA 3VF9A 3OY1A 3RHXA 4DFLA 4DLJA 1MRVA 2ETKA 2UZLA 4N57A 2UVYA 4A4OA 5DT0A 4EK5A 3FKLA 4O84A 3LMGA 4D0XA 4DYMA 4QQTA 3MI9A 4G16A 4IACA 3E7VA 4FGBA 4WRSA 2FA2A 3DPKA 4X6QC 4CCUA 4R77A 4YC8A 2VWYA 4IAIA 1B38A 5IH6A 1L8TA 5L2SA 2B52A 5C8MA 1ZRZA 4U8ZA 3PE2A 1O6YA 5EM8A 2BKZA 4F0GA 1CTPE 5IQHA 3NAYA 4F7LA 5LCJA 5G1XA 2PTKA 2VTRA 2WQBA 3QRJA 3AXWA 4FC0A 5L2TA 2P4IA 3NX8A 4PWNA 2YAKA 2PVJA 2XA4A 4FV8A 5EYMA 2QKWB 4M69B 4C0TA 4XLIA 3T9TA 3IOKA 2W1IA 1H25A 3NPCA 2OKRA 4HVSA 2UZOA 4IBMA 4F09A 5CEOA 4TXCA 4UWYA 3KXHA 2ITPA 1Q8UA 2ZV2A 4LOOA 3O0GA 4IAZA 4I41A 4I6QA 4C35A 3OW4A 5E92A 5IMEA 3EN9A 4D2RA 2UVZA 5KCVA 2YLEA 4YTFA 3TG1A 4I6BA 2W1EA 3I1AA 3T8OA 4GK4A 3UO4A 2RG5A 3UOHA 4D55A 3BYOA 4O81A 2WMUA 3NUPA 3I79A 4HZSA 4AW1A 4K9YA 4L9IA 4C61A 3D2IA 4FKTA 3LM5A 3D94A 1G8AA 1OBGA 4IVCA 4RFMA 5C8NA 4PL5A 3LXPA 2ZV7A 5HIEA 2JAMA 4AFJA 4E6DA 5H3QA 4FUXA 3VN9A 4ZZMA 2REIA 2YAAA 2JIVA 4H3QA 4ITHA 3N51A 4YR8A 3DXPA 2YIRA 4D4YA 2C6EA 4AA4A 2GNLA 3MVMA 4EH2A 5CYIA 4DGNA 4EZ5A 2QOHA 2AC5A 1YVJA 3MGYA 4BCQA 4MXYA 5B2MA 3SA0A 4IANA 5HICA 3TNIA 4E5AX 3OBGA 4FICA 1GY3A 1VYZA 3QKKA 5K0XA 4U43A 3WF7A 2RGPA 2EB2A 4H05A 1KUTA 5I3RA 1NVSA 3U4WA 3BHYA 3NRMA 1VYWA 2B53A 2W0JA 3LHJA 4YJUA 4RJ7A 4ASXA 4CRSA 2OW3A 4NM0A 3F88A 3VUKA 2XEZA 2OIDA 4OTHA 3UOLA 5CANA 4JXFA 3AT4A 3NYNA 5DVRA 1WBSA 2HCKA 4EK3A 3VJOA 2HENA 5HU3A 3JY9A 4OUCA 3AGLA 4ZMEA 2FGIA 2PVRA 4FKOA 4JR3A 1XH6A 4FV0A 4MX9A 3R22A 1Z57A 3Q6WA 4I5HA 4EBVA 3FSKA 5IDPA 3HMNA 4FTMA 3AC4A 3FL5A 4USDA 4JRNA 2I40A 3F2NA 5D9HA 4XHKB 5TR6A 3QRKA 4FL3A 4FBXA 4H39A 1GJOA 5C9CA 5CSPA 2R3JA 3E3BX 4BKJA 2QU6A 3U9CA 3SXRA 1G3NA 4AACA 5I9ZA 4E1ZA 3D7TB 3HGKA 4C2VA 2B0QA 4FSYA 1VEBA 4FV9A 3C4WA 2XNGA 3E8DA 4AN3A 4ERWA 3LJ2A 2BDJA 2QOIA 4IB0A 3OD6X 4YPDA 4IZAA 3OHTA 3RMFA 2G2IA 4NJDA 2GS6A 4FTNA 1FOTA 2C1AA 2XP2A 4PX6A 5J5TA 5KNJA 1H0WA 4YZ9A 4IC7A 1KV1A 2WMRA 2UW5A 4KB8A 3Q5ZA 3RPSA 5CAVA 1B6CB 3PG3A 4CQGA 4F1OA 4EH5A 3PVBA 1ZOGA 5E8YA 5IQEA 3R7IA 3WF6A 1XBBA 3WILA 4ZSJA 4ZLZA 4UYAA 4RX9A 3Q53A 4ZTNA 5I4NA 3CKWA 3NUNA 4RJ3A 3UVRA 3UQFA 3ALOA 4TW9A 1PMUA 2B9FA 2F9GA 3GU4A 3O8UA 4OTGA 5JK3A 3A7GA 2P33A 3CR0A 1S9IA 4EH6A 4EQUA 4F08A 3QXOA 3KK8A 1YOJA 4L3JA 5ETAA 3VQHA 2P55A 3ZO3A 3HV7A 4QMTA 2IVUA 2GCDA 2J0MB 4GT3A 2Y6OA 3R9HA 4FEXA 2E9UA 4M68A 2IPXA 4ACCA 2BILB 2FSLX 4USFA 5DE2A 2DQ7X 3D4QA 3TWJA 4QP2A 1STCE 5AP4A 2VUWA 5H8EA 3FXWA 2Q0BA 5DGZA 5CI7A 4B8MA 3OC1A 4BTFA 3OVVA 5KBQA 3UPZA 4E4NA 3EZVA 3SG8A 2I1MA 3PY0A 5IQCA 3E7OA 3HUCA 5EQYA 4ZJJA 3RNIA 3FXZA 5CQUA 3A61A 4JT3A 2O8YA 4TWNA 5CAOA 4HGTA 2UZWE 2C1BA 2CGWA 4NM5A 4WO5A 5KHWA 3TJDA 4L45A 2J0JA 4DGMA 2QOBA 4QPAA 3PRIA 4F9YA 4U44A 4HYIA 4C4GA 1J3HA 1PYXA 3ROYA 3L9PA 4EJNA 3LVPA 5ITAA 4O2PA 4ALVA 1YXTA 4BICA 2QO9A 3MA6A 5CF6A 2BZIB 4FA2A 4O6EA 2EXMA 3LFBA 3K3IA 3FV8A 4EOOA 5A3XA 5CSVA 5IA4A 4UMTA 1WVYA 4FTRA 3DBDA 2XK7A 4EH3A 1Q41A 2C6MA 4BY9E 4XOZA 4OBOA 3ITZA 3PLAE 3LZBA 4U81A 1YQJA 1LR4A 4P7EA 3W2OA 5B7VA 5K4IA 1YHSA 4FZ6A 3R9NA 2RL5A 3K54A 4GVAA 4MD8E 5CU4A 1OPKA 4I1ZA 4LRKA 5CZIA 3BWJA 3LXNA 3G2FA 2BHHA 3PFQA 4DGGA 2Z7SA 3L9MA 3KA0A 3KXZA 4J52A 4FEUA 3ENMA 4P90A 4WD5A 4Q5HA 4EKLA 5LXMA 3ORMA 5J79A 4LGHA 2R2PA 1PRYA 2X2LA 2ONLC 4FTQA 4J95A 4AT4A 4Y85A 3V5JA 4MNFA 1YI4A 2YM7A 3FL4A 3VS4A 4A9TA 2OWBA 4HCVA 2X7FA 5E1SA 5HD4A 5IEVA 2O0UA 5LVPA 5JEBA 3GVUA 4FSUA 3MB6A 2WTJA 4D4VA 4EEVA 3AC1A 3F69A 5CVHA 4C3PA 4EOKA 2BPMA 4DEBA 1IG1A 4IIRA 4YC6A 5HBJA 5ICPA 2EU9A 3TUDA 4O7LA 5JRSA 4Y83A 4M97A 2ZM1A 3VJNA 4F7NA 2RFDA 2DWBA 4ERKA 4PDYA 2OJGA 4NU1A 3GXLA 4WHZA 3NMUF 2WU7A 3RNYA 1XH7A 3KF7A 3B2WA 4RC4A 4X2FA 2FB8A 4KIKB 4MBLA 3U6JA 2XYNA 1ZYCA 3DJ6A 3LPBA 4IAKA 2H34A 4OTFA 4ZIMA 4APCA 5FXRA 4GT5A 4NSTA 3RAHA 3TXOA 1U54B 3A8XA 4GK2A 5A9UA 4BWKA 4KSPA 3LCOA 3OUKA 3D7ZA 3OBJA 4XV1A 3L8XA 4HYHA 1SVHA 3BYUA 3DKGA 2WMTA 4J7BA 2OICA 3G15A 4G3EA 4EOSA 3ZEPA 1IASA 3CJGA 3CIKA 3HV6A 3NNVA 3PYYA 2ZJWA 5IQBA 4A06A 3QALE 2W1HA 4FZ7A 4AN9A 4HGEA 3N4UA 3D5VA 5F4NA 4MF0A 5ANDA 5HORA 4ONAA 2YM6A 2G2FA 5CXZA 2C0OA 2R3OA 1OI9A 3DGKA 3ORNA 3FI4A 4JBOA 4L3LA 4NKAA 4FNXA 1XH9A 4ZSEA 3M2WA 1JNKA 5E90A 2JDRA 3DT1A 2XK3A 3ZSGA 4D1ZA 2R3RA 4QT1A 4ZTHA 5EDRA 1H1PA 4BCNA 1M2QA 4AWIA 4UYNA 5M53A 4G9RA 4XBRA 5CF4A 3V5WA 4ZY6A 3BELA 2EUFB 3AOXA 2E9OA 3IW7A 3MBLA 3WARA 4QOXA 1Y57A 4XG3A 4CV8A 4MK0A 2I0EA 3L9NA 4HVIA 5KHXA 3FPQA 4LV8A 4C62A 5AP6A 5T3QA 3EYHA 4APPA 3KL8A 4I5PA 5CNOA 5CSWA 5E9EA 2CKEA 4U0IA 4KS7A 4XG8A 5C01A 1R3CA 4JBQA 3T9IA 3VUTA 4C4HA 4FTIA 1YXVA 2YM3A 4GH2A 3LFQA 3Q3BA 4MXXA 3R04A 1BL6A 3DY7A 4JVGA 5CALA 1WVWA 3OT8A 4LOQA 4YJSA 1U46A 4C57A 5L2IA 1AQ1A 3E93A 5DEYA 2VWBA 1ZWSA 4YZCA 2IW9A 1ZMVA 3QZFA 1Q62A 4UWBA 3EOCA 3GFEA 3BHUA 4GEOA 2A0CX 2OXXA 3QAME 1ZMUA 3BEGA 1WZYA 4ENYA 2H9VA 4GCJA 4S2ZA 2YWVA 3U51A 2XK6A 2WELA 4DH5A 3UVQA 4EK4A 4S34A 2GS7A 1UKIA 2BR1A 4ASZA 3EMGA 3ZSHA 5IMXA 5IQFA 2PVLA 4V0GB 4Y72A 4Y8DA 1P2AA 3I6UA 3QZHA 3QQUA 3FKNA 2E9VA 4R5YA 4EC9A 3ULZA 4AZEA 4DEIA 3HAMA 1WBPA 2QC6A 1BKXA 1FMKA 1WBOA 4IB1A 5CT0A 3KKVA 4MBJA 5ANEA 4ANLA 2C6DA 4FVQA 3PSBA 3RAKA 3UIUA 2OXDA 4Z9LA 2PZPA 4FSRA 3LIJA 3L8SA 4QP1A 5HLNA 4AA5A 4BCGA 5IZFA 4EWQA 4FTLA 4KBAA 3P08A 4Y95A 5DPVA 3D0EA 3UOJA 2UUEA 2WMAA 3HUBA 3RALA 4PTGA 4X0MA 2HWOA 2KTYA 1MRUA 4OGRA 4R3CA 5BVNA 3EB0A 5K5XA 2WMWA 2WU6A 4ZTSA 3IDCA 1FGKA 2VV9A 2YCSA 2YWPA 4RJ5A 3DNDA 4BKZA 3BU5A 4YLLA 3GU5A 3ZLWA 2NPQA 4F1MA 5LVLA 5KMIA 4IJ9A 2ITYA 4YO6A 1M2PA 4G3FA 1P4OA 3G6HA 4FT7A 4F9BA 1R0PA 2XMYA 4IAYA 4NIFB 1XKKA 3PJ3A 4KABA 3F3VA 1OL5A 2VWUA 3OS3A 5CVGA 3ZO4A 2FUMA 4LMNA 5JH6A 3CBLA 4ASEA 4TWOA 4LL5A 5IA3A 3NEWA 3FJQE 2WIHA 3C4XA 3NUUA 5BVWA 2OF2A 3UNZA 4AZTA 4WG4A 2ZOQA 4QRCA 2CNUA 3DZQA 4FG8A 1CKPA 3FZRA 2PZYA 4MNEB 5BNJA 3TUBA 5TOZA 4FSTA 3P4KA 4OTWA 4F6SA 1CM8A 2XK9A 2PZIA 4WBBB 1PXMA 2F7ZE 2R3PA 3OCTA 4LQMA 2RKUA 4R1VA 4BDFA 1V1KA 1H08A 3HMOA 5KMOA 2J4ZA 3GOKA 4AX8A 3PSDA 2YFXA 4OBPA 1KWPA 1WBWA 2QLQA 1OZ1A 4X3FA 5IISA 5KZIA 5L3AA 5HO7A 2JITA 2WNTA 1ERKA 4FODA 3AMAA 4NM7A 3FLSA 4IZYA 1DI8A 2XKCA 4CMTA 4K6ZA 2WMBA 5HGIA 3BV3A 1O6LA 3RVGA 4QP8A 4A9YA 3P1AA 5DR2A 3C5IA 4EZ3A 3QTQA 4IAAA 2B54A 5LARA 4PV0A 3VBVA 4G9CA 4BCIA 2Q0NA 1OL2A 4W4WA 1YI3A 2OO8X 4BZOA 5M44A 4UB7A 5EYCA 2V22A 5LVOA 1W83A 5AX3A 5ETIA 4CFNA 2OH4A 2HZ0A 5IUGA 4HW7A 1A48A 5CQWA 3RBWA 4EHVA 4BI1A 4I5CA 1OKWA 3DU8A 4ZLYA 3Q9XA 2UVXA 4ZSLA 3G6GA 5J7BA 3QTUA 5JQ8A 3BEAA 4QD6A 3P7AA 5BUIA 3S0OA 4GYIA 2NRUA 3QQLA 1ZLTA 4S32A 4XV2A 5IUIA 2X9EA 3OWJA 3W55A 4EUTA 2ITOA 4EHGA 3VS1A 3WYXA 4S30A 3AC8A 3VS7A 1F0QA 1TQPA 1M7QA 2HAKA 3LFNA 4RIXB 4W9WA 4ID7A 4A7CA 4O2ZA 2JBOA 2GTMA 3DLSA 4KS8A 3WOWA 1W98A 4IMYA 3DBQA 4RJ8A 5CEMA 5AP7A 4ZMFA 3IW4A 4ALWA 4M7IA 4KSQA 4RSSA 4N6ZA 2R3GA 3CS9A 4JAIA 4CGAA 3UC4A 5FBNC 4O0XA 5JGAA 4QMOA 1OUYA 2ZAZA 3V5QA 1Q61A 2W96B 3QFVA 4BBEA 5HTIA 1Y6BA 4BBFA 2X7GA 4OT5A 3GT8A 4QMWA 4U45A 3POZA 2C6TA 1VR2A 1REJA 4FT5A 2J0IA 2YITA 4PMMA 4D0WA 5J9YA 4NCTC 1PXOA 5I3OA 4B7TA 3NUSA 1JQHA 5AA9A 4ZTLA 3BBWA 1H27A 4UALA 4YTHA 5M08A 5CU3A 3ZUVA 2ZMCA 4FTKA 4TWCA 1DS5A 4V04A 4ZS4A 2XUUA 4W8DA 5FP5A 5FXSA 1H24A 3C9WA 2OBJA 3KY2A 4DINA 1Q8YA 2J51A 4C58A 5F20A 3D14A 3VVHA 4IWQA 4Y5QA 4O22A 5JGDA 3MYGA 1VJYA 4O1OA 1L3RE 4RRVA 3MH0A 5AIRA 1W82A 3FBVA 4YLKA 5AUXA 2OIBA 4I0RA 4CTCA 3N4TA 4IAFA 4AGDA 5FEQA 5L6OA 3UGCA 4MCVA 2W4JA 4QMQA 3UZRA 3A7FA 4PTEA 4L53A 3KVWA 3QCSA 1JOWB 5A46A 4WKQA 4XUFA 2X8EA 3V8SA 4CNHA 5JFVA 4L00A 2R3NA 3QUEA 4HPTE 1XWSA 2IZUA 4Z16A 3TM0A 2RFNA 3RCJA 3I5NA 2WMXA 2Z7LA 3E5AA 3PVGA 5JMSA 2PVYA 4J98A 3R1QA 3HP2A 4LUDA 4LGGA 2CSNA 3T3UA 5A6NA 1PXNA 5KKRC 4Z55A 4GT4A 3SGCA 5D10A 4H1MA 2PMLX 2O3PA 3HNGA 3VUIA 4ANOA 4FSZA 2QONA 3RK5A 5JFWA 3R00A 4J8NA 3S2PA 2BUJA 3U9NA 2ITZA 2R4BA 2V7OA 5JT2A 4FGRA 2C5XA 2IW6A 4AZVA 4W9XA 2PU8A 3MY1A 2ZM4A 5HVKA 5M4UA 1U4DA 5AR2A 2HYYA 5IA2A 4DFBA 4XV3A 1FPUA 3PIZA 4WA9A 2BFYA 1URWA 3WE4A 1BI7A 1WBVA 3FY0A 4L8MA 4FI1A 2JBPA 3EQGA 4JDHA 1PHKA 2GSFA 5AP3A 1CKIA 2G1TA 3FY2A 3PJCA 4JG6A 4BHNA 1R39A 3CE3A 2X6DA 2O65A 4M8TA 5M4CA 2YM4A 3AGMA 3LFCA 3M1SA 3R7VA 4RIYB 3VAPA 1W7HA 2W5HA 3F5PA 3EN7A 3P23A 5ACKA 3ZLYA 5DR6A 4EONA 4E5WA 1H0VA 3W10A 1JPAA 2RSVA 3FMLA 5KUPA 4FR4A 1GZOA 4R3RA 5GJDA 4Z3VA 3UP2A 4E26A 2BIKB 3TDWA 4MHAA 3TT0A 4AOJA 2VTQA 1H01A 1RDQE 3VHEA 4UEUA 5L6WL 2IO6A 2XM9A 3F61A 3HZTA 1OB3A 3ZYAA 3UPXA 3PXQA 5EQEA 3BQRA 3PXRA 5AUWA 2ITUA 5AUZA 5I0BA 3UTOA 5CVFA 2EXCX 4XP0A 1URCA 4E4MA 1UWJA 2ZB0A 2JKMA 4BTKA 4PMTA 4CFMA 3OWKA 3KB7A 3QHRA 3L8PA 3UP7A 2BRGA 2YERA 5EHYA 4IHPA 4N6YA 4QYGA 3FYJX 4IH8A 4PY1A 2HXQA 3H9FA 1GOLA 4CFFA 2PE0A 3PA3A 3EN4A 3QA8A 4UY9A 4BIDA 4GFGA 2BTRA 3QCYA 3AD6A 4ZXTA 2Q83A 3QX2A 2EWAA 4J71A 3MJ2A 2O5KA 3AC3A 3C4FA 3R8PA 3A8WA 3HRBA 4IB5A 1ZZLA 4XMOA 3QD4A 2PHKA 3CD3A 5FM2A 3G33A 4E6QA 4IX6A 4JI9A 3KMMA 2ETMA 2R0IA 3IS5A 3FMKA 2BHEA 4KKEA 4YZNA 4F4PA 2V55A 2F2CB 5I9XA 1PW2A 2R3KA 1Z5MA 3U6IA 2PY3A 2YJRA 3O2MA 4NFMA 5EDQA 1DM2A 3BLRA 4O82A 2X4ZA 4YZBA 4O91A 4ENXA 4EH8A 3QTZA 4MXCA 3FEGA 1TKIA 2RFEA 3FMEA 3CTQA 3V04A 3P5KA 5KO1A 3ZFXA 3QQFA 5BMSA 1X8BA 1GZKA 3UO5A 1KV2A 2BZKB 3FLZA 3G0FA 3QLGA 4OAUC 2E9PA 2C3KA 3F5GA 3ZO1A 3MIYA 4P4CA 3PP1A 2HY0A 2VAGA 4PP7A 4Y46A 4DF3A 3ZRKA 3JS2A 2C3IB 3GCQA 5ETCA 3R8LA 5M4IA 3B2TA 2DUVA 3ETAA 4IWDA 3GQLA 4I94A 4UN0C 3OEZA 3R1YA 1NY3A 3QGWA 5HCZA 3VUHA 4G5PA 3LQ3A 2FSTX 2W1ZA 3TNPC 3LE6A 4DG3E 3BGPA 4AP7A 3DAJA 4E4LA 3UQGA 3R7EA 3FKOA 2F7XE 3FMNA 4WOVA 1Q4LA 1P5EA 3KF4A 3H30A 2J9MA 1OVEA 3QZIA 5J1WA 3A7JA 2C4GA 1XO2B 4N0SA 1U5RA 2XNPA 4O7VA 4FKGA 3FSFA 1GZ8A 3EFJA 4TYHA 4XS2A 3ZO2A 5DH3A 5KKRB 5E8ZA 4DH3A 3EQFA 4JS8A 3G90X 3QXPA 3RK9A 1OM1A 1Q97A 2HWPA 2OJIA 3R63A 4YJRA 5E8TA 4ANBA 1Y6AA 3EKNA 3EQBA 4CG9A 3QRTA 1TQIA 4O6LA 4R1YA 5ANOA 5GZ9A 3ZXZA 5JQ5A 4JL9A 4BIEA 4DITA 4O38A 4CT2A 3DBCA 3BU3A 5G6VA 3GU8A 4DEAA 2YCRA 1MP8A 4M14A 3ROCA 5EQPA 3C4ZA 3QRUA 3PRFA 3R01A 4GVJA 4FEVA 4FKJA 4I0SA 3TNQB 3FLWA 2GQGA 3AD5A 3E8EA 2J5FA 2YCQA 2YIQA 3GC0A 3H0YA 3IQ7A 3LCDA 5HX6A 3IW5A 1YW2A 3QA0A 3PG1A 2DS1A 3AG9A 3ZXTA 1FBNA 3KXMA 4I21A 5HCYA 4ASDA 3UMXA 2Z60A 3OEFX 4AZSA 3DLZA 4JOAA 3PVWA 2JEDA 3LFAA 3MB7A 4FKRA 4ZY5A 3BHVA 4XNEA 3OF0A 3NUXA 2W17A 4WBOA 3PTGA 3NSZA 4FVRA 4X6RA 1BUHA 4GRBA 5BVEA 2NO3A 4TT7A 5DLSA 3RK7A 4BHZA 3V6RA 4D1XA 3KREA 3W8LA 2YCFA 1UU8A 3PXFA 4PL4A 1OKVA 2ITTA 3FUPA 3JVRA 4OTPA 5JRQA 4X3JA 2Y9QA 5KX8A 3HKOA 5CTPA 3FYKX 3FC1X 3FAAA 1DAWA 3DKCA 3KCKA 3MH2A 3EHAA 4YPSA 4ZEGA 3RPVA 3OXIA 2C68A 3RTPA 3V8WA 4F7SA 5GINE 5LOHA 4RIWA 1DI9A 2R3HA 4UZHA 3DAEA 4JR7A 5AUYA 1KE5A 3LOKA 4A9SA 3CQEA 4FNWA 1OKZA 2HZNA 3GC8A 3ZUUA 1Q8ZA 3AQVA 3C1XA 3MFUA 2IVSA 2F2UA 4K77A 5C26A 4RWKA 3TTJA 3VWAA 3VUMA 4DC2A 2XKFA 4O0RA 4OAVB 4JX3A 3FI3A 4LGDA 5ANGA 2O64A 3VBXA 3D5XA 4BDKA 4I6FA 1GIIA 3SRVA 4DHFA 1NW1A 2CLXA 5DI1A 4TN6A 2QOFA 3HDNA 2J2IB 3OCBA 5IUHA 3S1HA 1JKLA 4QMSA 3EQRA 4FV6A 5C03A 2HZIA 3NW5A 4WRGA 4X2KA 5HBEA 5J8IA 4EQCA 3JY0A 5AJQA 4WG3A 3L8VA 2JC6A 5AP0A 5IH4A 4RVLA 3BLQA 4TRLA 2I6LA 2WEIA 3AC5A 3IW8A 3ZM9A 3LW0A 4J1RA 4DLIA 3I60A 3DBFA 4RFYA 3NNXA 4G6LA 4YJPA 3B8RA 2C5OA 5AAFA 3SLSA 3TZMA 3WF5A 4CZUA 2ITXA 3UNJA 5KMMA 5EHOA 4MYGA 4AGUA 3FMHA 3KQ7A 3EL7A 2WTDA 4FMQA 2WMVA 3OTVA 2J6MA 2UZBA 3SDJA 3Q5IA 1QPCA 1PYEA 5BYZA 1UVRA 1OIRA 1PKDA 2YISA 3EN5A 3HA8A 4G1WA 4RWLA 5K5NA 5M51A 3NIZA 3WZKA 3ZZWA 4CTBA 5CXHA 2O2UA 5BVFA 2R9SA 3HVCA 1WCCA 1Q5KA 4I92A 3MS9A 1KE9A 2VD5A 3K2LA 3KEXA 4OTQA 4QMZA 3UVPA 3ZLXA 5IF1A 5IQAA 3JVSA 4PF4A 3W2CA 4R78A 3F3ZA 3QQGA 5FP6A 5HX8A 4MBIA 3R7OA 2WZJA 3CGFA 2IVTA 4FT3A 3QYZA 4JG8A 3HV3A 3OWPA 4ACGA 4AZWA 1OPJA 3ORLA 4CFWA 2PUNA 1PXPA 1YOMA 1YXUA 4XG2A 4F9CA 3N4VA 2W9FB 4RX5A 2V0DA 4I0TA 3G5DA 4AE9A 1O6KA 3QTRA 4BDCA 2IW8A 1KE7A 5FXQA 3CXWA 3IDBA 5J95A 4YTIA 2XH5A 2WQMA 4QQJA 2QO2A 3TZ7A 2X4FA 5M56A 5EI6A 3QF9A 3WI6A 4CLJA 2PK9A 2XNMA 4M15A 4F6UA 5J87A 4NJ3A 2WTCA 4IC8A 4AXAA 3R2BA 4FV7A 4B6LA 3KC3A 4ZOGA 4RC2A 3TJCA 3ATTA 3NUYA 5AFVA 5AEPA 2VTSA 1CMKE 5IA1A 2VRXA 5DT3A 4RVKA 3HV4A 3FLQA 4HVDA 2V62A 2PUIA 1V0PA 3PXKA 5AAGA 2UZEA 4EYMA 4Z7HA 1RJBA 1GZNA 5AA8A 3R0TA 2J0LA 3NLBA 3NYOA 3EQHA 3UYSA 3ZC6A 3AMBA 3NGAA 5HG8A 2YACA 5A4CA 4OTDA 3NWWA 5M06A 3PA4A 3D5WA 4GKHA 3QQJA 2OJ9A 4Q9ZA 5M4FA 2EVAA 2XIRA 2XZSA 1WFCA 1M14A 3MTFA 4IX3A 4NYEA 4PNKA 2R3IA 2PUUA 4JLCA 4RQKA 2JAVA 1K9AA 4XG9A 4NTSA 4QO9A 4TYJA 3TV6A 3DDQA 5J9ZA 3PJ2A 5AR4A 4MWHA 4FOCA 1ZYSA 4EK8A 4XEYA 3KRJA 5KMLA 5EM7A 3VW6A 3C50A 4FG9A 5AMNA 3I81A 3PPZA 2IZRA 4G3DA 4CYJA 2E9NA 3CD8A 4CKRA 4QTEA 4YHTA 4D58A 2VX1A 4GK3A 3UE4A 3AT2A 4C4EA 5DWRA 4XX9A 4CQEA 3F66A 3DK7A 4HVGA 3H3CA 4CT1A 4MXOA 3Q9YA 1R0EA 3NNWA 4B99A 3D5UA 5A6OA 5IG1A 4CFXA 5J5SA 4U80A 4IDTA 4FV4A 4YUQA 1IA9A 2QLUA 3COMA 2UZTA 2BZJA 4YMJA 2UV2A 4PPCA 3DXNA 3FZ1A 3IDPA 3VIDA 3H4JA 2J90A 1OPLA 3QTWA 4PP9A 2PVFA 4FT9A 3HECA 4B9DA 2WMQA 4YGAA 4ZTRA 4FTTA 3ACJA 3GU6A 4QPSA 4I5MA 3LMHA 4AOIA 4AF3A 4KKGA 5BX0A 5ANKA 1JKSA 4CG8A 4AGWA 3PP0A 3CY2A 1GIHA 4AFEA 5CY3A 4HCUA 2JIIA 4ZK5A 4F70A 4CKJA 4ACMA 2O63A 2VO7A 3EQDA 1FGIA 3DTWA 2VWWA 3G0EA 5HKMA 5IQDA 5CAPA 3GFWA 1J7UA 4CMOA 5BQ0A 5EI2A 2F49A 4C4FA 3ODZX 4CEGA 4DH1A 2XVDA 5GZ8A 2OJFE 3OT3A 5EW9A 4EC8A 2C5VA 1EH4A 2YZAA 4EZ7A 3QUPA 3KU2A 4BDDA 3QC9A 2JLDA 4RLKA 5HTBA 2R5TA 4G34A 2YIWA 1BYGA 2PZRA 3HMIA 3G51A 3HA6A 4IB3A 4RZVA 5CU0A 5L2WA 4F0FA 5HCXA 5IH5A 2VTNA 4MQ1A 1Q24A 5LJJA 1NVQA 3MH1A 3V5LA 2FYSA 3O50A 4KBKA 4KKHA 4JQEA 5EW3A 3C51A 1OIYA 3EYGA 4AS0A 5L4QA 2QNJA 2CNVA 3F3WA 3ZFYA 3D2KA 4QP7A 1FMOE 3OXZA 3PIXA 3C5UA 4XCUA 4CFVA 4E7WA 5A4EA 2QG5A 4BTMA 3O71A 4XBUA 5A4QA 1E9HA 4QMPA 5H8GA 3R8VA 3GC9A 4C34A 5EOBA 3RWQA 3RCDA 1O9UA 4X3FC 4EOMA 3VUGA 4FIEA 2FSOX 2A1AB 2OZOA 3QX4A 4M66A 1UNHA 5CU6A 3DS6A 4IFCA 4RPVA 3GQIA 5CX9A 5FTOA 3ATSA 2OGVA 4JBVA 4YSJA 3TNHA 4GG7A 2C6KA 4JDJA 2BROA 3FDNA 3ZBFA 3KMUA 3P7CA 1TQMA 4TKSA 3PY3A 5JSMA 1ZY4A 2FH9A 4LG4A 3O23A 2HY81 2BVAA 1H4LA 2JDSA 3O8TA 4FEQA 3KRLA 4XG7A 3C13A 2X81A 3GCVA 3KRWA 4BFMA 3RZBA 5K9IA 4II5A 3MPAA 5M57A 2PVNA 2WFYA 4GW8A 2G2HA 1LP4A 4UMRA 3GNIB 3CQWA 2QOQA 4GG5A 4M84A 3KCFA 2R7BA 5KMNA 3LLTA 2ZM3A 1ND4A 3FQEA 4I4FA 3EN6A 3MVHA 4HNFA 1PXKA 4EJ7A 4E3CA 1HCLA 1ZY5A 4K1BA 2B7AA 4D2WA 4L42A 4JNWA 2Y7JA 3ANRA 3TKUA 1UNGA 1SZMA 4NTTA 4FZAB 4Q9SA 3A4PA 4BDGA 2W4KA 3HL7A 2B9HA 3IO7A 3COKA 3I7BA 1OMWA 4IVAA 1J7IA 5HG7A 3UYTA 4AN2A 2AYPA 5EYDA 5HESA 4W8EA 4C36A 3S3IA 5IEYA 2WHBA 4EOJA 4N70A 3CTHA 1MUOA 2WD1A 4BDAA 3BRBA 3KULA 3OOMA 3EWHA 4L7FA 4LYNA 5FLFA 3SC1A 2QHMA 3FHIA 4FIIA 3R9OA 3SKCA 5CZHA 1Q8WA 3MPTA 2R3FA 4PMSA 5BUEA 1PMVA 2LAVA 1KOBA 2E2BA 4O0UA 3IKAA 3TV7A 3I0OA 2W06A 3F82A 3Q4ZA 3QC4A 2XJ0A 4BKYA 4U9AA 5IPJA 1JKKA 4J97A 1HCKA 4EI4A 4FTOA 5BVDA 3GENA 5C4LA 2V7AA 3AMYA 2YIXA 5DBXA 4O7RA 2OIQA 3A7IA 3O51A 3ULIA 4BDIA 3VBWA 3JPVA 1A06A 2VX0A 2XNEA 5H2UA 3RKBA 3L1SA 2JD5A 3EQIA 3R8ZA 4KUJA 2YABA 3PXYA 3HP5A 5FG8A 5ANJA 3NCZA 3CP9A 5L8KA 2J7TA 3JYAA 3W2RA 1IA8A
chains in the Genus database with same CATH superfamily
1OL7A 4YJVA 5AUVA 3DNEA 3BL9A 1NXKA 4R6VA 4FYOA 5ACBC 3DQWA 5AV2A 1OL1A 3TIZA 1YDTE 2GDOA 2X0OA 1H26A 3GUBA 4CMUA 4IDVA 4PUZA 1YKRA 2XK8A 2Z7QA 3PLSA 1F5QA 4I23A 2C69A 2H8HA 5AV4A 1NT2A 3P7BA 3EKKA 3QZGA 4JRVA 2QHNA 5J1VA 3CPCA 2CKOA 4EH9A 3A62A 5EKNA 2UW0A 5E8SA 4FSWA 4PPAA 3IPHA 3JXWA 4YO4A 2VGPA 2Y6MA 3MVJA 2VO3A 2UW9A 1FVTA 2KULA 2OU7A 3TKIA 4O7NA 2XJ1A 1NA7A 3OMVA 2UZDA 3DV3A 3FPMA 1REKA 2C47A 3VBQA 3LFDA 2R0UA 3FMJA 4F0IA 4H3BA 2SRCA 4EOPA 2Y0AA 5KMKA 4NT4A 1YWVA 3OCGA 4G3CA 4BYIA 2A4LA 2HZ4A 4IXPA 1A9UA 2QD9A 2XYUA 1Q8TA 4FKPA 4CV9A 5JFSA 3EJ1A 2OZAA 4G31A 5F9EA 3EZRA 3FZPA 4YJTA 5LMAA 3RAWA 3ZFMA 2GNFA 5D1JA 3U4UA 5GIPE 4FK6A 2XARA 2XKDA 3NYXA 3C0HA 3RZFA 2JDOA 3FZSA 4TTHB 2GNIA 2J50A 3QQHA 2Z8CA 2CGVA 3QQKA 4PTCA 3BPRA 2OF4A 3PIYA 4FUYA 4NH1A 3Q96A 4L52A 1G5SA 3DDPA 1JLUE 4L43A 2ITNA 4TYIA 4WNPA 5E8VA 1CKJA 4BZNA 2PPQA 2QG7A 5HVJA 3UDZA 2WTKC 1WBNA 3QWJA 4L01A 4TYEA 1TFFA 2WXVA 2YM8A 1UU3A 4W4VA 3PZEA 3VS2A 3Q04A 1I09A 3QCXA 4IJPA 1FINA 2JIUA 2RIOA 2XIKA 4H58A 4FVPA 4X3FB 4AG8A 3PVUA 4BDBA 3F2RA 4RVMA 4RJ6A 3R8MA 4BWXA 4EH7A 3R1SA 4LOPA 1E1VA 2ACXA 1WMKA 4QYHA 4DEEA 5BUJA 4FKQA 3WZEA 1U59A 4BVUA 4EWHA 2VTIA 2W1FA 2Y4PA 4FKVA 4XG6A 4AT3A 4HYSA 4DAWA 3LJ0A 2VTAA 3OZ6A 4O4CA 4XH6A 3A2CA 2NP8A 2BTSA 4BZDA 2CPKE 3P79A 2VTHA 1HOWA 4LI5A 4O0YA 4FV3A 5HNGA 1UV5A 5AR8A 5FWKK 3MV5A 4YZDA 1Y8YA 2C30A 2XM8A 4U41A 3QLFA 5DOSA 5HO8A 3II5A 5A4LA 4FE2A 4EKKA 5FTQA 2XKEA 3UO6A 3UG2A 4O86A 3V8TA 4TWPA 5ETFA 2YJSA 3RJCA 3GEQA 4XP3A 3VULA 5BYLA 4ANSA 3QBNA 2CMWA 2PZ5A 3WE8A 5BYYA 3RAIA 3P9JA 2PVMA 4GIIA 2QKRA 4YJNA 4DH8A 1IAJA 1F3MC 2BRNA 5EDPA 4NL0A 4RGJA 3EH9A 4G3GA 4O27B 4EHEA 2X8DA 3GBZA 3HYHA 4BI0A 4BBMA 3EQCA 5DR9A 4QP9A 4XYFA 4Z7GA 5HQ0A 3R8UA 3BWFA 4DG0E 2GQSA 3R9RA 2XCKA 4YBJA 4QMXA 3IG7A 3ET7A 4ITIA 5L8JA 3TL8A 1ZZ2A 3MFRA 5HLWA 1I44A 2YA9A 3LAUA 3Q4UA 5DT4A 3RP9A 2YDJA 4AW0A 5C1QB 3TACA 1P4FA 3I7CA 3ZUTA 1OIUA 3ORKA 4X2NA 3I4BA 2ZB1A 1H8FA 2OK1A 3OXTA 1S9JA 3R1NA 4DTKA 5C8KA 5LVNA 1Q99A 3BE9A 4FL1A 4QMVA 2JKKA 2W5AA 3TYKA 3P0MA 3ENHA 3S4QA 3WZJA 4CKIA 4K2RA 3CLYA 4KINA 3CQUA 2R64A 4FV1A 1SVEA 1SYKA 1XHAA 3DB6A 4P5QA 2JKQA 1IEPA 2YM5A 2C3JA 4QP6A 5BPYA 1XBAA 4FTUA 3DB8A 4RJ4A 4UMQA 5JZJA 3SG9A 4P2KA 3K5UA 4QTDA 3BZ3A 4F9WA 5CEPA 4F78A 4EBWA 4FL2A 4RLLA 3FXXA 4DCAA 2J5EA 4Y5HA 5FEDA 3DZOA 4OBQA 4F9AA 4M0YA 4CZYB 4ZLOA 4XOYA 4M13A 1IR3A 4XV9A 1CDKA 3PUPA 4CLIA 4AA0A 4PDSA 3QD3A 5FGKA 5D7AA 3VRZA 5AR3A 3UZPA 3UBDA 5E91A 1ATPE 1ZYLA 3IONA 3OCSA 3R9DA 4BCFA 2VWIA 2OG8A 5AX9A 4G6OA 5DRBA 3RI1A 5JN2A 5AM6A 4BN1A 5I9UA 2C3LA 4J8MA 5T6KA 2BRMA 3ZLSA 3W0QA 3R71A 1M17A 1PF8A 3BYVA 3PWYA 5CF5A 1M2RA 3TEIA 2WB8A 3ELJA 3LXKA 4FK3A 5LWNA 1JSUA 2W5BA 3BYMA 2H6DA 2VTOA 2WTIA 3ZCLA 4IADA 2RG6A 3FQSA 2QVSE 1W0XC 1YI6A 3W18A 4E6AA 3ODYX 3SXSA 3R21A 3UMWA 3IGOA 5E4HA 4UX9A 3ORZA 2ZMDA 3S95A 3COHA 4EH4A 3SOAA 5T68A 4M69A 3S00A 4E93A 3BX5A 4OTRA 2WTVA 4UXLA 3SW4A 1P14A 3NZ0A 1WBTA 2UW6A 2W9ZB 4O7TA 4K18A 4MH7A 4YLJA 3Q32A 4BCOA 1AGWA 4PRJA 4RT7A 4U79A 4NUSA 5DEWA 1YDSE 2W1GA 1WVXA 2XJ2A 5CI6A 5EOLA 2XBAA 3KK9A 4KRDA 5TKDA 5AUUA 4U3ZA 3NVMB 4C37A 1SNXA 2B4SB 3TZ8A 4X21A 3VBTA 4RIOA 2PE2A 3QD2B 1OECA 3MY0A 3BU6A 2VNWA 4TY1A 4A07A 4BF2A 4XP2A 4U97A 3QUDA 4JQ8A 4KRCA 3HEGA 5TF9A 2XNOA 5J9LA 3I6WA 5CWZA 4IM2A 3QHWA 4FNYA 4RWIA 3MPMA 4IZ5A 2JDVA 3I5ZA 3O8PA 5EFQA 2J0KA 5EI8A 3PDTA 3TDVA 2C5YA 2WIPA 3VF8A 2VWXA 4N4SA 4D5HA 2UZUE 3F3UA 4OT6A 4GSBA 4D4RA 2ZV8A 3DK3A 3CC6A 4DFZE 4FTCA 1JVPP 1OIQA 3O96A 3KGAA 2V5QA 3P78A 3QU0A 3REPA 3ZDUA 2BCJA 3CGOA 2OJJA 1YWRA 3CTJA 4MVFA 3VO3A 4MD9E 3DJ5A 1MQ4A 3SX9A 2CKPA 5JFXA 2GMXA 4ZSAA 1DAYA 2RFSA 2PMOX 4RFZA 1XMMA 2VO0A 4BRXA 3W0OA 4X7QA 5F94A 5EK7A 2WO6A 4RA4A 3QTSA 3MN3A 4BGGA 2XIXA 4CVAA 2QQ7A 3IGGA 2WMSA 3IECA 4FOBA 1R78A 2PSQA 4L3PA 3W1FA 2X7OA 3PA5A 4QP4A 4EYJA 4YHJA 1OL6A 3CEKA 4FX3A 2FVDA 2WGJA 3NR9A 4P5ZA 5HI2A 1QMZA 2ITQA 4O7WA 3PPJA 5GZAA 5IKWA 3RPOA 1UNLA 3OW3A 3VONA 2RF9A 4RBLA 1W84A 4I6HA 3RWPA 4C38A 3DAKA 2P2IA 4BTJA 4EK6A 4FKWA 4LFIA 2XIYA 3G9LX 4I24A 5CS6A 3MY5A 5KZ0A 3BI6A 4FG7A 5HG5A 3D7TA 4YC3A 3SW7A 4JJRA 5D7VA 4RA5A 3ALNA 1LEZA 4LM5A 3W0NA 2JKOA 4IX5A 3KXGA 5M09A 2ERZE 4IEBA 2Z02A 4IVBA 4BDJA 3FLYA 3QTXA 4E4XA 3MJ1A 5L2QA 4L68A 3M42A 4B4LA 2CJMA 2PVKA 3QKLA 4UMUA 3UQCA 4O0TA 4QNYA 5CEKA 3UDTA 3U55A 5AUTA 4EQMA 1ZOHA 4GUBA 2QOCA 3PE1A 3F5UA 3GI3A 2JDTA 4FJVA 3GC7A 5BV3A 1SM2A 3C0IA 2X1NA 4NFNA 3QYWA 3RM7A 3O7LB 4AXFA 3E8CA 5E8XA 4DH7A 1XQZA 3FZTA 4K33A 3NS9A 1ZYDA 4NEUA 3UOKA 3SOCA 3FI8A 4ZTQA 3Q4CA 3VS3A 2GQRA 3C0GA 4I22A 3H9RA 2OI4X 1H1SA 4FKLA 4EUUA 4O7YA 5IQGA 4RX8A 5HU9A 4EORA 2IF8A 4QYYA 2CGXA 2WOTA 4X2GA 4NWMA 1XBCA 4GUEA 2GHGA 3A7HA 3LFFA 4GJ3A 1PJKA 5AR7A 5E1EA 3EQPA 1G8SA 4TYHB 4IVDA 5AR5A 1ST0A 3PJ8A 2QU5A 2QODA 3QWKA 3BCEA 2LGCA 4G5JA 3LM0A 4ZJIA 5CASA 4V01A 1LUFA 4FTJA 1YDRE 5HNBA 1K2PA 4C4JA 2X2KA 2Y4IC 3FE3A 4PDPA 1UWHA 5CEQA 3DBEA 3TCPA 5FRIA 3ZRMA 4GU6A 4YU2A 4MD7E 4BCKA 1H1WA 1ZAOA 2XNNA 3R83A 1Y8GA 4FTAA 3VNTA 2BAKA 3ORIA 1NVRA 4GU9A 4AQKA 4RMZA 2VNYA 3Q2MA 4YBKA 4JG7A 4F63A 2BRBA 3Q9WA 1XJDA 4A4XA 4GJ2A 2XBJA 1UU9A 4A4LA 4L67A 3GP0A 3GGFA 5IA0A 4LV5A 3Q2JA 2IJMA 3BLHA 4QMNA 3DOGA 5AV1A 1OBDA 4DN5A 3LFSA 2C6OA 4XRJA 5CAQA 5JGBA 5HD7A 5B0XA 4Q2AA 2W1DA 4R3PA 2XNBA 2GNJA 4AZFA 3FI2A 3QRIA 5F1ZA 2VTJA 4WIHA 2BZHB 3D9VA 3PPKA 2XALA 3C4EA 4YURA 5IA5A 4YP8A 3UZTA 5AIKA 5CEIA 3UODA 4RIWB 2UZVA 2Y8OA 5BVOA 3HV5A 3LCSA 1UA2A 3U8WA 1OKYA 5LMKC 2WQNA 2A27A 4BYJA 4BCHA 4ANNA 4CFUA 3VUDA 2CHLA 2YIYA 5LQFA 2YLFA 4NZWB 2ESMA 2R7IA 4OLIA 2GNHA 5EW8A 5CSHA 2YDKA 4DFNA 5DRDA 1J1CA 3IOPA 4E8AA 3A99A 4MQ2A 3L9LA 3DKFA 4G17A 5DNRA 5DG5A 1XR1A 3SRVB 4CCBA 2QR8A 2I7QA 2R3LA 5AADA 3UJGA 3K3JA 4JAJA 2BDFA 3DCVA 4IW0A 1PXLA 4DA5A 2OSCA 3VHKA 1PXJA 2IG7A 5A54A 4RC3A 5GHVA 2VTLA 4RVTA 4FSQA 4UMPA 2QR7A 2DYLA 2IZSA 3R02A 4KIKA 5HE2A 5D11A 4C59A 1BMKA 5H8BA 2W1CA 2CCIA 3V5PA 4ZTMA 1CSNA 2VTMA 3OFMA 2OLCA 1R1WA 4QTCA 1U54A 4HYUA 4FSNA 4WUAA 3ORXA 5AP1A 3W0MA 1SVGA 3W32A 4IWOA 5HBHA 2OH0E 3OWLA 4O0WA 3PWDA 4J99A 2XRUA 3MSSA 1JWHA 2QO7A 5DA3A 4ACHA 3LJ1A 4AU8A 3ORTA 4GFOA 3R73A 3H0ZA 3POOA 5I9WA 1IRKA 1LEWA 3QCQA 5FEEA 5CU2A 4YJOA 3F5XA 4C3RA 4D2TA 4O1PA 4AUAA 4E6CA 4CXAA 2HW7A 2X2MA 4YNEA 4IZ7A 3DFAA 5DIAA 1Q3WA 1W2FA 1YOLA 1FVVA 1J91A 2C0IA 2P3GX 3E62A 3HDMA 3Q60A 1LPUA 4U7ZA 3VRYA 1JSVA 3PXZA 3LLAA 5DYJA 4FIHA 1OITA 2GHLA 2G9XA 3ZU7A 5GIOE 3LXLA 4D2PA 4XG4A 4X2JA 4IM0A 2BFXA 3NDMA 3W0RA 1XH8A 3MA3A 3NYVA 4PPBA 4BIBA 3K5VA 5IEXA 2EB3A 4NK9A 2WQOA 1QL6A 5LMKA 1PXIA 2XIZA 2H96A 4YNOA 2NNWB 3OY3A 2XF0A 3UC3A 1KSWA 3UNKA 3FQHA 1IAHA 4S31A 4GL9A 1OGUA 2GS2A 3KN5A 1XMLA 3BLAA 3DXQA 2CGUA 1ZXEA 4MTAA 3WF9A 3TZ9A 5DFPA 2Y4IB 3ZH8A 2GNGA 3UG1A 4OW8A 3R30A 4O96A 5DHJA 2CDZA 3OUNB 4PNIA 3O17A 2PE1A 4M12A 5CLPA 2GHMA 3WBLA 4G2FA 4F6WA 1H1QA 4AW2A 5AWMA 2I0HA 2XEYA 2XS0A 2P2HA 4QTAA 4DCEA 4F64A 5EH0A 3LCTA 3LQ5A 4WUNA 4QDVA 3SQQA 5L8LA 3MWUA 2VTPA 1PY5A 3FZOA 3G9NA 4TPTA 4ARKA 2CKQA 3MW1A 3DFCB 5HTCA 3KXXA 2BKKA 2ZVAA 4NM3A 1W8CA 4BWPA 3KN6A 3GCPA 4QNAA 3R2YA 4TZRA 4KNBA 5HE0A 4V0GA 4CD0A 5LWMA 5GJGA 3BGZA 2X8IA 2GPHA 4IM3A 4WNMA 4U42A 3KXNA 3BKBA 4AE6A 4WSQA 2X39A 3BGQA 2I0YA 4WNKA 5ANIA 4EOQA 3F7WA 4C02A 3DKOA 1KE8A 4FZDB 1T46A 4XRLA 3MFSA 5M07A 4O4BB 3PSCA 1M52A 4BCPA 3ACKA 2VX3A 4AOTA 1ZMWA 2HK5A 4U3YA 4EL9A 1J1BA 2C0TA 3IW6A 4OR5A 3A4OX 5HIDA 3O5AA 3QGYA 5AV0A 3DA6A 2C5NA 4I93A 4WSYA 3JR1A 2WTWA 2BAJA 1Y91A 2HELA 3I0QA 1RE8A 2BMCA 4RX7A 2UW3A 2ONLA 4CZTA 5CF8A 1GNGA 1XH4A 4D9TA 2VO6A 3QD0A 3W2SA 5CT7A 4HGSA 5C4KA 2QI8A 3TKHA 4FKUA 4H3PA 3BV2A 4J96A 3TMOA 1PMNA 2JGZA 2GTNA 4ZAUA 4YTCA 1U5QA 4JDIA 2PL0A 5EYKA 4BGHA 3RPRA 3BL7A 1RQQA 3QTIA 5B2KA 4MXAA 4PQNA 5CNNA 5FTGA 1BLXA 3AD4A 4KBCA 5K0KA 4R5SA 4D28A 4U5JA 3N9XA 4NKSA 5LVMA 3R7UA 4DHIB 4HGLA 4NIFA 3U6HA 3VS5A 3BYSA 2EXEA 3PZHA 5K3YA 3SVVA 1RW8A 4Y73A 3CPBA 5IDNA 1G8JA 4AT5A 1Q3DA 5HG9A 4O0VA 2QOOA 3SAYA 3DJ7A 4A9UA 2OXYA 2VN9A 3E87A 4MKCA 1B39A 5E8WA 4EOLA 3BBTB 4W4XA 3OP5A 1JBPE 4MNEA 3ANQA 4C7TA 5L6PA 2X6EA 3A60A 2WQEA 2WEVA 2WKMA 4K0YA 5HOAA 3D15A 3E3PA 5BMMA 4I4EA 2WOUA 3HRFA 3HMMA 3W2PA 4C33A 5M55A 4NW6A 2B9JA 3GCSA 4LMUA 3TNWA 2ZDTA 1QPEA 4MF1A 1SNUA 3Q52A 5H9BA 4FNZA 4HVHA 4RQVA 4WT6A 3RPYA 4DGOA 2BAQA 4C8BA 4DFYA 4ZZOA 2CNQA 3AT3A 5HLPA 4F65A 3ZC5A 3MTLA 1JAMA 5AV3A 3ZMMA 4QQCA 3UIXA 3RINA 4FT0A 3F3TA 1M7NA 2Z7RA 3DTCA 1PMEA 4O4FA 3BHHA 4FV5A 4L6QA 1YXXA 2PWLA 4ZP5A 4UV0A 2B1PA 4R7IA 4EHZA 4LRJA 3ZDIA 4B8LA 4E5BA 4DTBA 3SV0A 2PULA 2HOGA 4LRMA 5KE0A 5IU2A 4O7ZA 4GV1A 1JKTA 2GU8A 4FV2A 5TE0A 2PYWA 4FEWA 5I5ZA 3NW6A 5EHLA 2ETRA 3KFAA 1T45A 2R3QA 3E8NA 2HW6A 3FMMA 4V05A 4BI2A 5GNKA 3BE2A 3F2AA 3T3VA 3FHRA 4UXQA 3SHEA 3VW8A 3WZUA 4HPUE 4IQ6A 2I0VA 3CY3A 4D2SA 4RIXA 2WPAA 3ORPA 3PY1A 5F95A 2HIWA 3ZZEA 5B2LA 1J7LA 4CRLA 4UZDA 2GFSA 2PMIA 3OROA 3V51A 3MDYA 3WIGA 1H28A 2OFVA 2B9IA 3M11A 3OG7A 3RGFA 4BB4A 4RZWA 3EIDA 3CCNA 2XRWA 3NW7A 4O0SA 4TL0A 4DT8A 2BRHA 2F7EE 4H1JA 4KD1A 3VS0A 2CCHA 4D4SA 2ZDUA 4J53A 4R8QA 4F7JA 3WZDA 3KRXA 2VWZA 3MH3A 1H00A 4BR3A 4M3QA 3GB2A 2G15A 4ORKA 3RM6A 2A2AA 2QCSA 4CYIA 3LQ8A 3Q4TA 3V3VA 4QMUA 5FUTA 3QL8A 4BDEA 3KULB 3FLNC 4O7SA 3OTUA 3V01A 1SMHA 2PUPA 3W16A 2XB7A 4K11A 3E88A 2VZ6A 3VC4A 2W7XA 2G01A 4NW5A 3EFLA 2JFMA 4B0GA 4EOIA 4DDGA 3TV4A 1APME 1TZDA 3TUCA 2ZV9A 4FIGA 5IQIA 3FMDA 3V5TA 5C27A 3NUAA 3LFEA 5KMJA 4GKIA 4DE4A 3LMIA 4KA3A 2IVVA 5HEZA 2C6LA 3ZTXA 1BL7A 3MIAA 2BALA 4I20A 3NCGA 3WYYA 4F1TA 5HNIX 4BGQA 1ST4A 2W4OA 5BVKA 4A9RA 4HZRA 4XLVA 3MFTA 5FDXA 3IK3A 5CAUA 4YJQA 2PVHA 1QCFA 4ALUA 4BDHA 5K4JA 4RWJA 2W05A 3GCUA 5DMZA 1YHVA 2YN8A 1GIJA 3GU7A 3CSVA 5CSXA 5JKGA 4FKSA 5FD2A 5J7HA 1BX6A 5EM6A 4AW5A 2YEXA 1UU7A 2VWVA 4FIFA 3EFWA 3QKMA 5HZNA 3RHKA 4C2WA 4AXDA 4DG2E 4ZJVA 4UBAA 4G6NA 2OFUA 3C7QA 1ZOEA 3CJFA 4FYNA 4TNDA 4IWPA 4S33A 4CSVA 1MQBA 4H36A 4QP3A 5A4TA 3KRRA 3ZHPC 1FQ1B 3KMWA 1VZOA 3CKXA 3R6XA 4L46A 4O21A 2FSMX 3TTIA 4DBXA 4L7SA 1H07A 1JSTA 2ERKA 2XAOA 2GFCA 1TVOA 2VU3A 4F99A 4USEA 4GIHA 4HCTA 3SXFA 4LUEA 4JDKA 4ZSGA 1ZARA 3TIYA 4ITJA 3HLLA 4YHFA 3MVLA 5AP2A 4AQCA 4IE9A 5HE3A 3P86A 2CLQA 2IN6A 3DK6A 5E7RA 4JBPA 3NAXA 4JQ7A 2Z2WA 4GS6A 5EM5A 2X0GA 1KOAA 4FSMA 5LCKA 3ZONA 3U87A 2OZAB 3W33A 2YDIA 4HJOA 2XCHA 4O83A 4KAOA 4IFGA 2AUHA 3EL8A 1ZYJA 2AC3A 3PJ1A 4JIKA 3F6XA 3HX4A 4RIYA 3ZRLA 1AD5A 5KBRA 3W8QA 4C3FA 3ERKA 3LKMA 2F57A 3AC2A 2ZYBA 4MXZA 3FWQA 4I3ZA 4ACDA 4DT9A 2QOKA 1QPDA 4BCMA 5JZNA 3Q6UA 3ZS5A 4BL1A 3KVXA 4DFUA 1YRPA 2BDWA 3BIZA 4FIJA 4M67A 1WAKA 4DHJA 3F9NA 4FF8A 4QYEA 3BQCA 2X9FA 3F7ZA 2UW4A 5EKOA 3WIKA 2VTTA 4HOKA 4QMLA 5FM3A 4AAAA 3GOPA 4QQ5A 3NNUA 3VQUA 1GAGA 4MAOA 4DGLC 4D2VA 4R7HA 4FZFB 5A14A 3C4CA 3LCKA 3E63A 2CN8A 2B55A 3HRCA 4QTBA 2A19B 5LMBA 4D5KA 4E20A 3JUHA 2R3MA 5FQDC 4U6RA 4OTIA 5AP5A 5TO8A 3B8QA 4MEDA 4W4YA 3V6SA 3ZEWA 4GMYA 4KIPA 1E1XA 2YHVA 2VGOA 4DEDA 2PMNX 4GYGA 4WNOA 4BC6A 5TT7A 5I9YA 4ZS0A 4TNBA 2IWIA 5HIBA 5AAEA 2JFLA 4BJJA 1V0BA 1V0OA 3H9OA 5GJFA 2HXLA 3UIMA 3SD0A 2QURA 3ZBXA 1YHWA 3DQXA 3HAVA 1H1RA 2P0CA 3VS6A 4DEHA 4DBNA 4E73A 1YXSA 4M0ZA 4JIAA 4Q5EA 1QPJA 2BIYA 3HMPA 4MWIA 4U40A 5HE1A 3ZM4A 4PDOA 2ITVA 5E8UA 3VBYA 1XH5A 4C4IA 4ZZNA 1UKHA 5I9VA 2XK4A 4NCTA 4UWCA 4TYGA 3W2QA 4QMMA 5EG3A 2C6IA 5D41A 3ZOSA 2ITWA 3EFKA 2WAJA 5AM7A 3O7LD 4ZY4A 5DN3A 5HVYA 3NVKI 4XJ0A 1BI8A 4BCJA 3TN8A 4R7BA 4LL0A 3ZSIA 3NIEA 4PL3A 4QPMA 4YZMA 4AGCA 4KIOA 2UZNA 4GFMA 4DTAA 3R28A 5FBOA 4FKIA 3THBA 1OUKA 3OOGA 4IX4A 3Q9ZA 3UIBA 4DEGA 3ID6C 3R7GA 4ANMA 2IZTA 1KE6A 2W99B 3FC2A 4HNIA 3MESA 3WF8A 4KIQA 4QMYA 4YSMA 4AXCA 4WG5A 3E64A 4JX7A 4K8AA 4L44A 3H10A 5HHWA 5D12A 3U54A 4D9UA 2UW7A 3BHTA 4RG0A 2WTKB 4DFXE 1FVRA 5HO6A 2YZLA 1MRYA 4KWPA 1Z9XA 2UW8A 3D83A 3TI1A 1K3AA 1YWNA 4PMPA 2F4JA 3UDBA 3E92A 2CN5A 2QOLA 3COIA 1PKGA 2FO0A 3R7YA 4ANQA 4QYFA 5FDPA 4D1SA 2NRYA 5CENA 3VF9A 4QDEA 3OY1A 3RHXA 4DFLA 4DLJA 1MRVA 2ETKA 2UZLA 4N57A 2UVYA 4A4OA 5DT0A 4EK5A 3FKLA 4O84A 3LMGA 4D0XA 4DYMA 4QQTA 3MI9A 4G16A 4IACA 2AEGA 3E7VA 4FGBA 4WRSA 2FA2A 3DPKA 4X6QC 4CCUA 4R77A 4YC8A 2VWYA 4IAIA 1B38A 5IH6A 1L8TA 5L2SA 2B52A 5C8MA 1ZRZA 4U8ZA 3PE2A 1O6YA 3W0SA 5EM8A 2BKZA 4F0GA 1CTPE 5IQHA 3NAYA 4F7LA 5LCJA 5G1XA 2PTKA 2VTRA 2WQBA 3QRJA 3AXWA 4FC0A 1OGYA 5L2TA 2P4IA 3NX8A 4PWNA 2YAKA 2PVJA 2XA4A 4FV8A 5EYMA 2QKWB 4M69B 4C0TA 4XLIA 3T9TA 3IOKA 2W1IA 1H25A 3NPCA 2OKRA 4HVSA 2UZOA 4IBMA 4F09A 5CEOA 4TXCA 4UWYA 3KXHA 2ITPA 1Q8UA 2ZV2A 4LOOA 3O0GA 4IAZA 4I41A 3NFFB 4I6QA 4C35A 3OW4A 5E92A 5IMEA 3EN9A 4D2RA 2UVZA 5KCVA 2YLEA 4YTFA 3TG1A 4I6BA 2W1EA 3I1AA 3T8OA 4GK4A 3UO4A 2RG5A 3UOHA 4D55A 3BYOA 4O81A 2WMUA 3NUPA 3I79A 4HZSA 4AW1A 4K9YA 4L9IA 4C61A 3D2IA 4FKTA 3LM5A 4MUQA 3D94A 1G8AA 1OBGA 4IVCA 4RFMA 5C8NA 4PL5A 3LXPA 2ZV7A 5HIEA 2JAMA 4AFJA 4E6DA 5H3QA 4FUXA 3VN9A 4ZZMA 2REIA 2YAAA 2JIVA 4H3QA 4ITHA 3N51A 4YR8A 3DXPA 2YIRA 4D4YA 2C6EA 4AA4A 2GNLA 3MVMA 4EH2A 5CYIA 4DGNA 4EZ5A 2QOHA 2AC5A 1YVJA 3MGYA 4BCQA 4MXYA 5B2MA 3SA0A 4IANA 5HICA 3TNIA 2ZFYA 4E5AX 3OBGA 4FICA 1GY3A 1VYZA 3QKKA 5K0XA 4U43A 3WF7A 2RGPA 2EB2A 4H05A 1KUTA 5I3RA 1NVSA 3U4WA 3BHYA 3NRMA 1VYWA 2B53A 2W0JA 3LHJA 4YJUA 4RJ7A 4ASXA 4CRSA 2OW3A 4NM0A 3F88A 3VUKA 2XEZA 2OIDA 4OTHA 3UOLA 5CANA 4JXFA 3AT4A 3NYNA 5DVRA 1WBSA 2HCKA 4EK3A 3VJOA 2HENA 5HU3A 3JY9A 4OUCA 3AGLA 4ZMEA 2FGIA 2PVRA 4FKOA 4JR3A 1XH6A 4FV0A 4MX9A 3R22A 1Z57A 3Q6WA 4I5HA 4EBVA 3FSKA 5IDPA 3HMNA 4FTMA 3AC4A 3FL5A 4USDA 4JRNA 2I40A 3F2NA 5D9HA 4XHKB 5TR6A 3QRKA 4FL3A 4FBXA 4H39A 1GJOA 5C9CA 5CSPA 2R3JA 3E3BX 4BKJA 2QU6A 3U9CA 3SXRA 1G3NA 4AACA 5I9ZA 4E1ZA 1G8KA 3D7TB 3HGKA 4C2VA 2B0QA 4FSYA 1VEBA 4FV9A 3C4WA 2XNGA 3E8DA 4AN3A 4ERWA 4AAYA 3LJ2A 2BDJA 2QOIA 4IB0A 3OD6X 4YPDA 4IZAA 3OHTA 3RMFA 2G2IA 4NJDA