2PVNA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
total genus 109
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvnA02
4IZYA 2YCFA 4ANOA 4A9UA 4JR7A 4ENXA 2QG5A 4JQEA 4XEYA 3R7VA 4A4XA 3TNQB 5F1ZA 3L8PA 2X2MA 3GB2A 4FSQA 4HVGA 3C4CA 2HAKA 2PZIA 1W98A 3AD4A 4C36A 3WI6A 5AUTA 5JFXA 1ZYDA 4MX9A 2VN9A 4RIYA 2B4SB 4EQMA 3DZQA 3KULB 4DEDA 4F6UA 5AV4A 2W1EA 3IPHA 2OJJA 3R6XA 3QUDA 4G3CA 4WRSA 5CT0A 4L44A 3QRKA 3TZ7A 4OR5A 4EQCA 3II5A 3POZA 4KKHA 3RK7A 4P7EA 4CFUA 3EN7A 2WMUA 2QHNA 4F7JA 3UP7A 3D14A 3L9NA 1OZ1A 3ZLSA 4BCQA 5IQDA 2E9UA 2HXLA 3FKOA 2O63A 3D5VA 3SXFA 3LJ0A 4I93A 5FRIA 5K9IA 2GSFA 4E6AA 3EQCA 3VULA 4AS0A 5DT4A 5EW9A 4CQGA 3OTUA 3WF5A 2X7OA 3PY0A 1WFCA 4KIOA 4YURA 3G2FA 4NJDA 5HORA 3QX4A 4O7NA 1OKWA 3RWPA 3RPOA 3QWJA 2ZYBA 2X81A 5AWMA 2OJIA 5IEXA 1CSNA 4AA0A 2H9VA 5BUIA 2XUUA 1Q5KA 3OT3A 1YDRE 3CTQA 1YWRA 4KRCA 3TKHA 2W0JA 1YWVA 3ENHA 3Q2MA 4DAWA 3KREA 1H1RA 2R3GA 2YZAA 2W9FB 4ZY5A 1DI8A 3HMIA 1QPCA 5HG8A 5AJQA 3PG3A 4FVQA 5AR7A 1LEZA 2UW0A 4LRJA 4TYHA 4AZFA 3F9NA 1OECA 1UKHA 4BZDA 2C0IA 5IQHA 4OTPA 3KXZA 2R0UA 2VNWA 3RNYA 4LUEA 4GH2A 5AMNA 3SV0A 2IPXA 5FBOA 4BHZA 4Z55A 2VTRA 4UEUA 3LE6A 4UMTA 5G6VA 2I1MA 4HVIA 2QOBA 2DWBA 5BNJA 1M14A 2IWIA 3VRYA 1OKYA 3G33A 2PVLA 3QCQA 1Q8ZA 4S30A 1UNLA 5AP7A 4F1OA 2P3GX 3R7IA 4X2KA 1ZOEA 3K2LA 4JJRA 4NSTA 4EHZA 4FKIA 3LXKA 4YPDA 4B4LA 3RPRA 4IVAA 3WIKA 4HPTE 2WZJA 2C5VA 3P7BA 2C6LA 4JS8A 1U54B 3ZZEA 3HAMA 4X2FA 3IDPA 4FTQA 4ZP5A 5M4CA 2C6DA 2YDKA 4C61A 1GY3A 1YXTA 4C2WA 3QF9A 4UV0A 2JLDA 5HU3A 2IG7A 3W32A 3SRVA 2WQBA 3DBFA 4E26A 5AR8A 4FBXA 1MQ4A 1GZNA 3DOGA 3UG1A 4TYEA 2BKZA 1U54A 3WF9A 2C0TA 3COMA 4LYNA 3GFEA 3I60A 2OZAA 3UZPA 4QTEA 1UU3A 1KV1A 4FMQA 3ORIA 1J7IA 2PVFA 3GU4A 2F49A 2FYSA 3K3JA 1BKXA 3G9LX 5E1EA 3R9HA 5HU9A 4NEUA 3GC8A 4BZNA 3FV8A 3H10A 3L9MA 4G17A 3R1NA 3ZHPC 4F6WA 1S9IA 1IA9A 3HDNA 4ITJA 1LEWA 3LIJA 4DH7A 4QOXA 1NA7A 3FXWA 4QMLA 5M4FA 4I5CA 2GTMA 3E7VA 2C5NA 4JLCA 3JVSA 3W2PA 3PIYA 4IAAA 3QUPA 1J1CA 5HQ0A 3SKCA 1XBAA 4I5HA 3TWJA 4DGLC 5J5TA 2EXMA 5FWKK 1H26A 2QU5A 2XNBA 3T8OA 3A60A 2G2FA 4FIFA 4PY1A 3WOWA 4AP7A 3UTOA 4XOYA 2ZB1A 3NVKI 3WE8A 2W05A 2O65A 2W1IA 4OT6A 3P08A 5E8YA 4WO5A 1A06A 1LPUA 5FG8A 1SMHA 3RAWA 4QP1A 3LM5A 4L42A 4RX8A 5HE3A 4XG2A 4CTCA 3R2BA 3FMDA 2VTOA 3QTXA 4E4LA 1FBNA 4WHZA 2JDOA 1V0BA 5E8ZA 4QMUA 2Z60A 3O8PA 1U46A 4P2KA 3OCBA 5HBJA 3JYAA 4FTLA 3W2OA 4BBFA 2HWOA 1ZLTA 3UZTA 4CFFA 4U97A 4O7LA 5E8UA 3TZ9A 5IA0A 3HKOA 2CCIA 2F7ZE 1DM2A 3R9NA 2YWVA 4GVAA 4N57A 1O6YA 3HV7A 4IWQA 2JKMA 3ETAA 3O23A 4TZRA 4R3PA 2FSOX 2CNQA 3F2RA 3CKXA 4B0GA 1KE5A 1R0EA 2QD9A 4DFZE 1ZMVA 2JGZA 3GU6A 4RC4A 4RIOA 4DCAA 2R3MA 5M55A 3AG9A 1K9AA 2BRBA 3BZ3A 2XIRA 3FL5A 1R39A 4GL9A 5AAFA 3UJGA 3VAPA 3UMWA 2F9GA 4DFBA 1NVRA 4EKKA 2OU7A 3F2AA 4S34A 3MPAA 4A9YA 3H0YA 3BRBA 5EQYA 1JAMA 1ZZ2A 2PTKA 3VF9A 5JFWA 4FSWA 1H4LA 3S1HA 3FZOA 4RQKA 2H6DA 3D5UA 4N4SA 4BFMA 4CZUA 2E9OA 3MB7A 4CMOA 5BVEA 2WMSA 3QRJA 2HENA 4OTWA 4D9TA 1H0VA 3GC7A 3GENA 4I20A 4JX7A 4QP3A 5ACBC 5LVMA 3LLTA 3BYUA 4AN2A 2P55A 3OMVA 5IQIA 2YFXA 2VWYA 3OWJA 3AC4A 4CRLA 4BCNA 3PXFA 2Y6MA 5T68A 3OCGA 4ANMA 3DJ7A 4Y5QA 4KRDA 4OAVB 4W4YA 3FLYA 4KSPA 4O7RA 2CNVA 1ZMUA 4NFMA 4QMWA 2BIYA 4UWCA 2EWAA 2PMIA 5B2LA 2E2BA 3LXLA 3MIAA 4CFNA 4EL9A 4L00A 2E9VA 5DFPA 1U4DA 5HHWA 4JI9A 3AD6A 5JT2A 3FHIA 5A9UA 2J5EA 3V5TA 1PXKA 3TXOA 4FV9A 4AE6A 4JRNA 3WARA 4F08A 3B8RA 5IH5A 5EYDA 3UNKA 5HIBA 4USFA 2OF4A 5L6WL 3VN9A 5CEPA 2AC3A 3UVPA 1GAGA 2R4BA 4N0SA 3P9JA 4W4VA 3OY3A 2PYWA 1UA2A 4Y8DA 3ORPA 5IQBA 3EL8A 4E5AX 5CU4A 2ZM3A 4GG5A 3R9RA 2FSTX 4AFJA 2BFXA 5IKWA 1UU7A 3GCPA 3HRFA 3FKLA 2GS6A 3EOCA 5ANDA 5IUGA 3EKNA 2BZKB 2JD5A 3F3VA 2ZVAA 3IW8A 3BLHA 2C6MA 3A4PA 2X9FA 4MCVA 4RZWA 4W9XA 5DT3A 5JK3A 4I0RA 5KMLA 4AT3A 5JH6A 2OXYA 2KTYA 4F9YA 3RZBA 3ZDIA 2QC6A 2ZDUA 3PRIA 3U4UA 1Y8GA 2GS7A 3E8NA 3R73A 4OT5A 1DI9A 3KRLA 4O0RA 4QYGA 4YJPA 4ZK5A 4E93A 1YRPA 4CT1A 4DC2A 4FVRA 1H25A 5DMZA 3FI3A 1OPKA 4R78A 3KVWA 4CEGA 1XH7A 3TKIA 5AP6A 5CZHA 4CLJA 2UVXA 5HCYA 2QG7A 4ZSEA 5C9CA 2H96A 2C68A 2CGWA 3QCXA 3NAXA 4MXYA 3G0FA 2X7FA 5C27A 3A7FA 5GZAA 1NY3A 1SZMA 3TTJA 1W82A 5J9ZA 4C59A 3QUEA 4TY1A 4D2RA 1UWJA 1QMZA 4A06A 4BIDA 5FP5A 5L8KA 3TUCA 4ARKA 2C6OA 3QD4A 3JPVA 4FC0A 4YTHA 1KUTA 2BAQA 2BFYA 2XKDA 5E8VA 4GT5A 4IZAA 2YHVA 4EH6A 2XNEA 3QBNA 3QXOA 3LKMA 2YITA 4RA5A 3WYXA 1ZZLA 4EKLA 1OL5A 5B2KA 4HW7A 1L8TA 5TF9A 2XB7A 2XK6A 4E4MA 3R28A 3HRBA 4AT4A 1WBPA 3QKMA 5ANKA 4BDJA 4E7WA 4DTBA 4WBOA 3KK8A 3TT0A 5E8XA 3NX8A 5AX3A 3UGCA 3Q4ZA 3UO4A 4LGGA 2HK5A 3KCKA 3VC4A 4F63A 5HD7A 5IG1A 4J99A 5FDXA 5D10A 3UO5A 1W7HA 2JDSA 2YERA 3GP0A 3VUMA 4C7TA 2BAJA 3BWJA 3ORMA 4RPVA 2EXCX 4G16A 3F5PA 3U8WA 2W4KA 1FOTA 4L43A 4X21A 2CKOA 3A62A 1JBPE 4USDA 1FGKA 3FLSA 4UY9A 4ZOGA 3KB7A 3RINA 4RVTA 2C47A 4I6FA 5AIKA 4G9RA 2YWPA 2A27A 3RPSA 3B2WA 2F2CB 2OK1A 4BBMA 1YI6A 3C13A 4PRJA 4EBVA 4YNEA 4KBKA 3HUBA 3NEWA 3HMMA 2BZJA 3DXNA 2W17A 4P5ZA 4IZ5A 4TYHB 3LHJA 4G31A 3LAUA 4PF4A 2X39A 2QO7A 4RIWB 5HCZA 3DB8A 2J9MA 3U6HA 3ENMA 3O0GA 3U9CA 5CVHA 3ROYA 3T3VA 3H9OA 1H1SA 3QQJA 4NM3A 3M11A 5DRBA 4D4YA 3BHYA 4CFVA 3CR0A 4EOMA 4F6SA 4ACCA 4OTQA 4OTFA 1Y57A 2YM3A 4C34A 1V0OA 3GOPA 4MXCA 3NVMB 1YXSA 2B52A 4WG5A 2GNFA 1PKDA 3QL8A 5LXMA 4A9RA 3ZTXA 4CG9A 2J50A 4Z7HA 3FXZA 1FVVA 3VUTA 4BDEA 3ZFYA 2BZHB 3F5UA 3I6WA 4C4IA 3FI8A 1M2QA 3O71A 2ZV7A 3WF8A 4PTGA 3LMGA 5KZ0A 4MWHA 2H34A 3PWYA 1OIQA 4GK2A 5ANOA 3E88A 3OCTA 4HGSA 4IQ6A 2WO6A 3E93A 4EC9A 3V01A 3LW0A 4H1MA 3NUYA 3E7OA 3PA3A 4LOQA 2JDRA 3EN6A 1UNHA 1KWPA 3KC3A 1Q3DA 5EW3A 3ZLYA 4FGBA 4Q5EA 3TI1A 4NYEA 4PDYA 3DQXA 3BCEA 3LZBA 1BMKA 5F20A 3KGAA 4U6RA 5IISA 2IZTA 5HG5A 5FLFA 5C8MA 3C4XA 3MA6A 1ATPE 5CF5A 3I5ZA 1B38A 4DTAA 3MVLA 3VHKA 3MVMA 5CAUA 5I5ZA 4FT7A 5C1QB 2GNHA 2J0LA 1LR4A 4G3FA 2UZOA 3AT3A 4CG8A 2YDJA 3S0OA 3BKBA 2CLQA 1KSWA 4ONAA 2CN5A 4QYFA 3GU5A 2OGVA 3SLSA 3KCFA 2VX0A 2VV9A 3E92A 5CZIA 3LQ8A 4BDIA 3EQIA 5J9YA 4U43A 5DG5A 1IAHA 4WIHA 5CU2A 4D2VA 4BR3A 4G3EA 2OIBA 3IECA 3MH2A 1G5SA 4FV8A 3UQGA 3QU0A 3KN5A 4X3FC 5DI1A 3O8UA 2VNYA 4F64A 2DS1A 5AAEA 4LL5A 2R7IA 1Q8TA 4G34A 4V05A 1U5RA 4YZNA 4K1BA 4IAKA 3R1SA 4S31A 4IADA 3V04A 2XRWA 2NP8A 2XBJA 4E6CA 2BR1A 1DAWA 2R3HA 3ACKA 3BEGA 5K0KA 5JQ8A 2XVDA 5CU6A 3MI9A 1TKIA 5HX8A 3VO3A 4ALWA 1JKTA 3CQUA 4EYJA 4FT5A 2WTDA 3HA6A 2W1ZA 3R8ZA 2UV2A 5FXQA 5CLPA 4RIWA 4C4EA 4X6RA 4A07A 5C4LA 2UZTA 1NT2A 3I7CA 3DLZA 1W8CA 2OSCA 2J0IA 2GPHA 4GKIA 4AOJA 1OBGA 2VTQA 3EQDA 3DBEA 1YDTE 3QX2A 4YO4A 3TTIA 3D7ZA 5FXRA 4ID7A 5LVOA 2LAVA 1OKVA 2P2IA 1Q8UA 1HCLA 4BKYA 4UYNA 4Z7GA 4YJOA 4C57A 3E3PA 3I4BA 1JSUA 2GDOA 5FP6A 4AWIA 2AYPA 3CGFA 3KMMA 4YJRA 4K18A 5EOBA 4O7VA 3HMPA 5AP5A 3E62A 4QPMA 4D2WA 4TYIA 2UW6A 1WMKA 5I4NA 1YHWA 3HMOA 4B8LA 3REPA 2BTSA 3JXWA 2VGPA 3ZSHA 4XCUA 4DEIA 3O96A 3PSCA 5FM3A 3VW6A 4F70A 5CSXA 5AUYA 1OPJA 2HIWA 4E5WA 5LVNA 4BIBA 5BYLA 5EM5A 1ZYCA 3QZHA 4EOLA 4EJ7A 2PVNA 2XM9A 1WAKA 4NK9A 4RQVA 4U42A 2RGPA 4FZAB 5FTOA 2X9EA 2GQRA 4MEDA 3VBYA 4G3DA 4DEGA 3QQHA 5J8IA 3AC5A 2YABA 4DA5A 4BDCA 1PMUA 1CKPA 4AA5A 2B9FA 4H3PA 5I9XA 4D5KA 4RJ3A 1ZYJA 3OS3A 4QTAA 4ZJJA 4O2PA 1GZOA 2JBPA 3CKWA 4NFNA 5TO8A 4M14A 3LXNA 4FZ7A 1OVEA 2PSQA 2WMVA 2YM5A 4HCTA 5B7VA 1REJA 2YACA 1U59A 3HLLA 4EOSA 3IDCA 2I0HA 2J4ZA 2ITWA 3DK7A 5FXSA 4M0ZA 5ETAA 3I6UA 3ZONA 2YEXA 3DTWA 3V3VA 2YIXA 2VTNA 3R04A 5CT7A 3FY0A 4R7IA 3VQHA 4FTNA 4FV2A 4BI1A 4WG4A 2W4JA 4QO9A 4YZ9A 2YM8A 5HG9A 4DLJA 5M57A 3ORKA 2VTLA 3VBQA 3PPZA 3QTWA 4L7SA 4CD0A 5IH4A 2LGCA 2XNMA 5KHXA 3EZVA 2QO9A 4FSNA 4NTTA 4M68A 2OICA 4YLJA 3NUNA 3W18A 2XKCA 3KL8A 3A4OX 3QRTA 4FKPA 4W8EA 3C4ZA 1O6KA 3C1XA 4XG9A 1Q24A 3ZLWA 3U4WA 5A4LA 3DBDA 2G01A 2PE1A 4FNYA 3ZS5A 3COKA 3V5WA 4AN9A 5E8SA 3SXSA 3VS6A 4DFYA 4QYEA 3KVXA 3O7LB 4Y85A 2ERKA 5HCXA 3JY9A 5KMIA 3SG8A 4HVHA 3K5VA 4D0XA 4D0WA 4E1ZA 1RQQA 2CGUA 3RHKA 4B8MA 4UX9A 3KRJA 3D94A 3IS5A 3QFVA 4XJ0A 5AUWA 3UOKA 4G6OA 3CLYA 4M69A 3ZRLA 3AXWA 3MH3A 5I9VA 4AQCA 2QOLA 1OBDA 3EIDA 2CLXA 2ETKA 4GJ3A 3ZH8A 3OVVA 3TL8A 1B6CB 4FKSA 3HUCA 4HGLA 5AEPA 2H8HA 1GNGA 4IDTA 5EG3A 3FMKA 4QD6A 2PZYA 4RC3A 4D4SA 4F1MA 3WZKA 4ZMFA 4G9CA 4YHFA 3HECA 3QD2B 5A54A 4QT1A 2VO0A 2R3LA 4JBQA 3SDJA 1KOBA 5DA3A 1WBVA 1H08A 4MBJA 1F3MC 4AA4A 3DXPA 1Z5MA 2R5TA 3FHRA 3DKOA 4IEBA 4CKRA 3KXGA 5HZNA 5CASA 2UW3A 4MF1A 4CYIA 5ACKA 1BL7A 3FMNA 4JBPA 4I5MA 2G2IA 1GZ8A 3POOA 4I3ZA 2ZMCA 2W7XA 4FTUA 4J8MA 3BQRA 1H24A 3OCSA 4I0TA 3FE3A 5K4IA 1YW2A 2Y7JA 5M06A 1JWHA 3RVGA 3ZXZA 4GFOA 4IVBA 5DNRA 5K3YA 5JEBA 2OH4A 4K77A 4D1ZA 1ND4A 2C3KA 4XG6A 3LFAA 3P1AA 2OH0E 2OJGA 4HNFA 4EUUA 4K11A 3ZCLA 3P0MA 2WNTA 4PP7A 4IWOA 4M15A 4EZ5A 3Q9YA 4IE9A 2Y9QA 3EZRA 3P86A 4IMYA 3ZO2A 2O3PA 4RJ6A 4AGDA 4QP4A 5L2QA 4RVMA 2A0CX 3MBLA 4TTHB 3RJCA 5CENA 3BHHA 3ERKA 5ETIA 2I0VA 4JG8A 4NW6A 3ZBXA 4BI2A 3OT8A 4CZYB 4EH3A 2BMCA 2JIVA 3N4VA 3CD3A 3PJCA 1YI4A 5J95A 4ZAUA 3IW7A 4QPSA 4JOAA 4FV5A 3D15A 5BVWA 3UIXA 4USEA 5JQ5A 3CP9A 3LOKA 4RJ5A 4EK4A 3TDVA 1I44A 1MRYA 2XK3A 4RFYA 2V0DA 4XS2A 3HRCA 1MRVA 5GINE 2WOUA 4APCA 2YIYA 4AW5A 3LCSA 1JLUE 2Z7SA 3V51A 5A4EA 1XBBA 4QRCA 3FY2A 4YJVA 4C38A 4KKGA 3L8VA 3OWPA 4M84A 2WQEA 3G90X 1NW1A 3S3IA 4CZTA 5BYYA 5J5SA 3CEKA 3EFLA 2WIHA 5A46A 2RFSA 2W1FA 2ETMA 1H27A 4DT9A 1Q3WA 4WUNA 4ZJIA 4RLLA 4TWCA 4EK3A 3WILA 3LJ2A 3QQGA 3U51A 2WTKB 2X6EA 4C3RA 3BU6A 5GNKA 2R3KA 5M53A 3TIYA 3MFUA 4D1XA 4J97A 4IVCA 4LI5A 4O6LA 3MWUA 1ZYSA 3QHWA 4X2JA 1YWNA 3TNWA 4BCGA 4OBOA 4I6BA 2UW9A 5CAVA 2GHMA 3MPMA 1PHKA 3NYVA 4KB8A 5E91A 4NCTA 3EH9A 2HY81 2RFNA 3A8XA 4APPA 5I9ZA 2X4ZA 1QCFA 3HV3A 4MD8E 4U9AA 1H1QA 3V5LA 4ZTLA 1M7NA 3MH0A 2PVRA 4IB1A 4TWPA 2GQGA 3VBXA 1Q8WA 3Q4CA 2VTHA 4KIPA 1IR3A 3JUHA 3NZ0A 4QMXA 4FEXA 4H58A 3BE2A 2P4IA 4I4EA 5CXZA 2JKOA 5HO8A 5K4JA 3PDTA 4FSRA 4YBKA 1APME 3PXKA 5IF1A 3RCJA 5EOLA 3PVBA 4QQCA 5KMJA 4DN5A 4H05A 2IZRA 4IANA 3DK3A 5AV2A 3IW6A 2CKPA 4BTKA 2I6LA 5AM7A 4DBXA 1TQPA 5D11A 2X8DA 2PZ5A 2QODA 4BTJA 3CPBA 5E92A 2GHGA 5LOHA 2C3IB 4TKSA 3UOHA 3DNDA 4RIYB 4JDJA 4TWNA 4FSZA 5HNGA 1A9UA 3UODA 2PK9A 5FBNC 5HTBA 4BWPA 1XWSA 2FGIA 4OBPA 5IA1A 4ZS4A 4ACDA 4JDIA 3JY0A 3DAJA 3R0TA 5AUUA 4JRVA 1XQZA 3LPBA 5ETCA 2BHEA 1I09A 3BU3A 3MFTA 3Q3BA 2Z7QA 4BDDA 1Y6AA 4QP8A 2WEIA 4KAOA 3KA0A 3WZDA 3SW7A 3MESA 3PIZA 2YJSA 4MNEA 4XMOA 4IHPA 3HZTA 1GZKA 5HE0A 5DIAA 3TNIA 5BPYA 4BBEA 4BGHA 3PXRA 2A1AB 3GT8A 4FI1A 4P5QA 4YHTA 2UZVA 4J95A 4V0GB 4KKEA 4BB4A 5HE2A 4BZOA 2V7AA 3F61A 3IDBA 3O8TA 5DWRA 2BKKA 2DYLA 3Q9ZA 5HBEA 1BL6A 2C1BA 4F4PA 4F99A 4ANLA 2WTKC 3OEFX 3AC1A 1KE6A 3QC9A 3P4KA 2YIQA 2XNNA 4O2ZA 3CGOA 4CRSA 3ODYX 3CS9A 4WUAA 4YJTA 4I0SA 3V5QA 3QHRA 4AXAA 1IEPA 1SVGA 2VTJA 3LCTA 3NCZA 4YHJA 2CKEA 4FTJA 5JKGA 4CSVA 2P0CA 3PP0A 3RKBA 2C3LA 4O7ZA 1P14A 3ORTA 3QGYA 4EK8A 4ZLYA 2QLQA 1JSVA 3O17A 3OG7A 4YLKA 5FQDC 4D2TA 4A9TA 4IAZA 4F9BA 4DFUA 3AC8A 3AC3A 3QQUA 4D9UA 3V8TA 4DEBA 2O2UA 4S2ZA 5IU2A 2C1AA 4RVLA 2IVUA 2OW3A 2GNJA 3IGGA 1VEBA 2JC6A 5BUEA 4O7WA 5AA8A 5AADA 5IMXA 3A7IA 2FUMA 4L9IA 4RX7A 2W5BA 3GQLA 4CT2A 5DR6A 4FVPA 5GZ8A 4FEQA 4FT0A 1X8BA 3NPCA 2ZV9A 2HOGA 3OUKA 4O6EA 2VTAA 2IW8A 2XNGA 3B8QA 4GRBA 4H1JA 4YZBA 5L2TA 5DPVA 4FKRA 1OPLA 3W16A 4FYOA 5ANJA 3DZOA 3D83A 4GW8A 4R1VA 4DGNA 4ZLZA 4F9AA 3SQQA 3FMJA 4K33A 2GFCA 4BCPA 5HO7A 4EI4A 4LMUA 1Y91A 4L01A 2PZRA 3D2IA 3GBZA 3GNIB 4IB5A 4O0TA 3ZDUA 4BY9E 2RG6A 1Q62A 2EVAA 3COHA 5D1JA 3FLZA 3MA3A 4KBCA 2VRXA 4OGRA 1H1WA 4JNWA 3WF7A 4ITIA 4AZWA 1UNGA 2ITTA 4MAOA 3R7YA 5CEQA 3VRZA 4L8MA 4EH9A 2UZUE 2C5XA 1Z57A 3CY3A 4MBIA 2QOCA 3B2TA 2J6MA 3EWHA 1YHVA 2DUVA 4D5HA 4BDFA 1H00A 5M09A 4MD7E 4D1SA 2BHHA 2JDVA 4YMJA 3QKKA 3G15A 5IEVA 4FUXA 5HLPA 4K8AA 3TNPC 4TXCA 5DR2A 4A4OA 5C8KA 3GCQA 2C0OA 1YOLA 4V01A 5J79A 4A7CA 4OAUC 1EH4A 4ANNA 4GUBA 3QTQA 2UW4A 2XH5A 2BDWA 2OXXA 2Q0BA 3FSFA 5J1VA 4MNEB 5EM8A 4NM7A 4H36A 4IJ9A 4UB7A 5HEZA 2BAKA 4F1TA 2ZM1A 4MXZA 4DFXE 3QA8A 4U3ZA 2YAAA 2WD1A 3Q60A 3WE4A 4MXXA 1YXXA 2GQSA 3PUPA 4KIKB 2QR7A 4NUSA 4GMYA 4BYJA 3DAEA 4RJ4A 3DDQA 4IACA 3ZFMA 1PKGA 2NRYA 3DGKA 3WBLA 4WSQA 1V1KA 5BMMA 2FH9A 4FSUA 2QKRA 4UZDA 2OJ9A 4GYIA 5HGIA 3AC2A 4FV6A 4DEHA 4BCMA 5JZNA 3V5JA 5JGBA 5BUJA 5I9WA 3HV5A 2ONLC 5HVJA 2WKMA 3NUPA 4FKGA 5CQWA 4U81A 1FVRA 5H2UA 1RDQE 4JAIA 1HOWA 3HV6A 2ETRA 3HP2A 4MXAA 5DRDA 5AX9A 4BCFA 5KHWA 3CPCA 4KBAA 3E8EA 4Y5HA 2FB8A 5CU0A 2UZBA 4J96A 2WTVA 2WB8A 2GFSA 2X8EA 4ZTQA 3RAKA 4CLIA 5M4UA 1H07A 3MPTA 2O0UA 2XMYA 1JKLA 2P33A 4M13A 3AT2A 3VUKA 2E9NA 4XH6A 5CSPA 1XKKA 2B55A 2OZOA 5C01A 1XH5A 5IQFA 5HTIA 1FVTA 3AMBA 3ZM4A 4CFXA 4RSSA 3MJ1A 4O27B 4O1PA 3R30A 4U44A 2VX1A 4YZMA 3NRMA 4GVJA 5JRSA 2WTCA 2QLUA 4ZSGA 2BILB 5E4HA 4CVAA 4R7HA 1Z9XA 2W1DA 4NKAA 3UQCA 4PL5A 5AUZA 3C4WA 3NYXA 4O21A 5EKOA 5M51A 2R3OA 4HPUE 2VTMA 3PY3A 1GJOA 3G6GA 4S32A 3H3CA 3BHTA 4UBAA 2XIXA 2XNOA 4I94A 2XKFA 1KE7A 2OIQA 4LV5A 4IAIA 5FEEA 3AOXA 4XG4A 4BGGA 3FMLA 4FV1A 4FIEA 4BGQA 4CV8A 3KXNA 4XP3A 2XIZA 3LFFA 3BHUA 2W1HA 4LM5A 3FMHA 3QTUA 1R0PA 5TT7A 2J0MB 3PVGA 4X3FB 4G1WA 5EW8A 5CSHA 1P4FA 3EN4A 3QQFA 2G15A 3EQPA 1M7QA 3R63A 4ZTNA 4EOQA 5HOAA 3FDNA 3PA4A 5LJJA 5KMMA 4F7SA 3N4UA 2QR8A 4OUCA 1GOLA 3KXMA 3KMWA 3PLSA 3PPJA 4HCVA 4WG3A 2WHBA 4YJSA 3NCGA 2P2HA 3SG9A 3V5PA 4QMPA 4X3FA 1OB3A 3H9FA 3ZSGA 2NPQA 3DS6A 4MYGA 5ANGA 1GIHA 4EHEA 3DB6A 4P4CA 1J1BA 1K3AA 4O0VA 5AR3A 4QMNA 4ZJVA 1ERKA 1QL6A 4NH1A 2XNPA 5GJFA 1PYEA 3NIZA 3PE1A 4UZHA 3OTVA 5K5NA 1Q99A 3QCYA 5B0XA 4OTDA 3NNVA 4BIEA 5BVKA 5AP4A 3GI3A 3TUDA 3KXHA 3FUPA 3Q5ZA 3H4JA 3T3UA 1UU8A 1WBWA 3P7AA 3E63A 5AIRA 5KO1A 4FKQA 5EI6A 4EORA 5FDPA 5L4QA 4EUTA 2Z8CA 4I4FA 3JR1A 3PFQA 5LQFA 3F69A 3FI4A 2CKQA 2XF0A 4IJPA 5KX8A 2AC5A 4MKCA 4IW0A 2WMQA 2X2LA 5AP2A 4IAYA 2RKUA 2YAKA 4J1RA 5EYMA 5LMKA 3MY0A 2J7TA 3KU2A 2PUPA 4BTFA 3ANQA 4IBMA 3OBJA 4AU8A 2Y0AA 2WOTA 5A6OA 1VR2A 2WQMA 5A14A 2W4OA 5BX0A 4L6QA 2JFMA 2WU6A 1UVRA 1REKA 3ITZA 4O96A 4PNIA 2ZOQA 4TW9A 5TKDA 5TOZA 3W8LA 4NU1A 3F3ZA 4XX9A 3SOAA 3NNUA 4FKWA 4BDKA 3LMIA 3BHVA 5DN3A 5D7VA 3A99A 1UV5A 5HESA 5LARA 4C2VA 4IX5A 3R8PA 3R8UA 5JRQA 4FICA 5CNNA 5EI2A 3KMUA 4AF3A 2JFLA 3NNXA 4IB0A 5AUXA 5AV0A 4EOIA 3R1QA 4IZ7A 5I9YA 1PXMA 2WQOA 4MHAA 3OW3A 4EHGA 2R3FA 3TV7A 2XK9A 4X2GA 4NL0A 4EOPA 4GEOA 1OM1A 3ATTA 3IO7A 3EFJA 4D2SA 4EHVA 4FEVA 5CI6A 4AFEA 1OIRA 2QQ7A 4QP6A 4DFNA 1SNUA 2J2IB 4FKVA 4GK3A 4LRMA 3HVCA 3C4FA 3LFQA 2R3RA 4FA2A 2A19B 3GCUA 5FTGA 3FZPA 4M66A 2REIA 3DKGA 2OWBA 2SRCA 4F0IA 2IVVA 5J1WA 2XK7A 5M56A 3GOKA 4GU6A 3U9NA 3UOJA 4RX5A 5ITAA 4O7TA 2R3QA 3UDBA 3TM0A 4IAFA 2WMRA 4EWHA 1PMNA 4LOPA 1PY5A 3M2WA 4JBOA 2CGXA 2V55A 3MFRA 3Q32A 4TN6A 5LMBA 2B7AA 5ETFA 2EU9A 3DTCA 4LV8A 4GKHA 4FK3A 2I7QA 2WMTA 4RG0A 5M08A 3F3WA 4G3GA 2J0KA 4D2PA 2CHLA 2UZDA 3TACA 4BL1A 3NYNA 2YCRA 4L68A 5LCKA 4DG3E 1B39A 4R5YA 4ZY6A 4XOZA 4R1YA 3BLRA 4CMTA 4WNKA 2R3IA 5DVRA 2QU6A 4GK4A 4G6NA 2QKWB 5CVGA 3VUHA 2IVSA 3EFWA 2OO8X 3BELA 2I0EA 4GT3A 3UOLA 3OROA 3PG1A 3W33A 3KRXA 4OTGA 1QPDA 3G0EA 4WNPA 4JQ8A 5CY3A 2QO2A 3ZO1A 5L6PA 3IKAA 4PX6A 3RPYA 3V8SA 3S95A 2XA4A 3ZC5A 2XKEA 1H01A 5A4QA 2QURA 4M69B 3R8VA 4YTIA 3VW8A 4HZSA 2VO7A 4GUEA 4ASDA 1JSTA 4OLIA 3O2MA 2R3JA 4IXPA 5EM6A 5HLNA 3QYZA 4DFLA 2R2PA 3E5AA 3VJOA 2J5FA 2BTRA 4FT9A 4EC8A 1A48A 4DG0E 4G5JA 2XK4A 5IDPA 3FPQA 4NIFA 4Q5HA 4I24A 4ANBA 4FTOA 4R8QA 5EH0A 4DCEA 3F3TA 4NWMA 2BDJA 3UVQA 4ZTRA 5L2SA 3WF6A 1URCA 5CXHA 5L8LA 2IVTA 5L2IA 3HA8A 3RWQA 3WZJA 4JDKA 3QTRA 2W96B 4KSQA 2IW6A 4OTRA 3RHXA 1PXJA 2GNLA 3U55A 1P2AA 2OG8A 3Q9WA 4PV0A 4ZSJA 4AGUA 3A8WA 2XRUA 3MSSA 4H3QA 2C30A 3O51A 2JIUA 4GFGA 4KINA 4RIXB 3FZTA 4AGCA 4DHFA 4FKJA 2XCHA 4QMQA 1DAYA 5CEKA 5JGDA 3PLAE 2Y6OA 2G2HA 2Z7LA 4O22A 4GG7A 4W4WA 4X2NA 5H8BA 2ITVA 4HOKA 4I5PA 3TJCA 1Y6BA 3PJ2A 4AUAA 3QQKA 3TDWA 4FR4A 3LFNA 4CFMA 2XK8A 4BHNA 4MK0A 1ZY5A 3BU5A 1ZOHA 1BI7A 5AV1A 4DEEA 4UWYA 1OL6A 1ZOGA 4E3CA 3GXLA 3NUUA 5CYIA 1H8FA 5KCVA 3P5KA 5KMOA 4BCHA 1VJYA 4XV9A 4RT7A 3FQHA 1XH9A 3BGPA 1HCKA 2C4GA 3W2CA 1U5QA 3DJ5A 5IMEA 3VQUA 3BPRA 3NR9A 3VS1A 2ZV2A 3KRRA 4BTMA 3ID6C 1QPJA 2B1PA 4Y46A 4BRXA 2ZDTA 2XCKA 2PL0A 1WVXA 1JNKA 4A9SA 4EH4A 3NIEA 4MVFA 4LFIA 3W10A 3RAHA 3KULA 3DT1A 3KEXA 4FV7A 2ERZE 3KF7A 5AFVA 4FKOA 5L6OA 4I1ZA 4O0WA 2EB3A 4QNYA 3ODZX 2O8YA 3VS7A 4YSJA 1CMKE 1PXNA 2WMAA 4M0YA 4PL3A 5A3XA 4JDHA 1YKRA 3ELJA 4FKLA 4HNIA 4RRVA 1E1VA 5EQPA 2RFDA 2PUIA 3HMNA 2CMWA 2YZLA 3U6IA 2BCJA 2GU8A 4Y73A 1R78A 4RFZA 4GSBA 4ERWA 1WBNA 2VWUA 4IWDA 5KMKA 3MGYA 1L3RE 2YA9A 4C3FA 5JFSA 3BBTB 5TR6A 5BVOA 1UWHA 3Q4UA 3QZGA 4GS6A 1P4OA 4OBQA 2NRUA 4RVKA 3RMFA 2ZM4A 4YLLA 5DOSA 4EOOA 4B6LA 3IG7A 1O6LA 4HGTA 2HW7A 5EDPA 5DEYA 2KULA 4B7TA 5JGAA 3FZSA 1SVHA 5CSVA 3CQWA 4YNOA 3UPZA 5EHLA 3QYWA 2ITUA 3NW6A 5IQAA 4C37A 5KUPA 1URWA 5BYZA 2VWIA 3MN3A 4PWNA 2WMXA 3UYSA 3IOKA 3PXYA 4KWPA 4IDVA 4KNBA 4V0GA 2BRMA 2CJMA 2OFUA 4LUDA 2O64A 4GT4A 4IX4A 2UW8A 4RGJA 5L2WA 2ITPA 3RZFA 4JG7A 4QQJA 4CKJA 1S9JA 2B9IA 4JXFA 4ASXA 1F5QA 1Q97A 2BRGA 2YIWA 3E87A 3IW4A 1YOMA 4MXOA 4B99A 5EHOA 4DINA 3CCNA 2OKRA 5LMKC 3LMHA 2EUFB 3DLSA 5F4NA 3VS3A 4NZWB 4R5SA 4QQ5A 4MQ1A 5HKMA 2QOOA 5IPJA 1STCE 4FTKA 4J53A 2WAJA 4E6DA 3KQ7A 4PPBA 4F9WA 1XO2B 2RL5A 4AW1A 4DITA 3TKUA 3L8SA 4FSYA 1PXOA 2W06A 3HAVA 5I3RA 4AZEA 3PJ1A 2UUEA 2VWXA 2BROA 4RWLA 5D12A 4DT8A 2BVAA 3HYHA 4MBLA 3UP2A 2WTIA 3P78A 5JFVA 5H9BA 2C6EA 4ALUA 1Q8YA 3F5GA 4P90A 5EHYA 3FQEA 4HVDA 3MVJA 4Y72A 3WYYA 4FF8A 3EYGA 3NUXA 3OXTA 3MY1A 4FL1A 3JVRA 3VUGA 5HICA 4BCKA 1KE9A 3ACJA 4C4FA 4TL0A 4YZCA 1IASA 3LFBA 3ZO4A 3RTPA 4EWQA 2F7EE 2BPMA 4UMPA 5IH6A 2HYYA 5E90A 2PUUA 4PDOA 4CV9A 4F09A 1P5EA 4FOBA 3SXRA 2X2KA 3OOMA 3L1SA 2BRNA 3RK9A 5DE2A 4JQ7A 3S00A 1RJBA 5IUIA 3U6JA 2C5YA 4E4XA 3GC0A 3F7ZA 4J7BA 5D41A 4U3YA 4RX9A 3DPKA 3PSBA 2JKQA 3M42A 5CF8A 1PXPA 2BRHA 3TIZA 3QD0A 3TZ8A 4FSMA 3ZEWA 5C4KA 4O7SA 3T9IA 5ANEA 4BN1A 4EEVA 1CDKA 1ZYLA 5HD4A 2XIYA 2PVYA 4L3JA 3NYOA 4IM3A 1PMEA 5DBXA 4IVDA 5F94A 5G1XA 5T3QA 3CJGA 3RI1A 1WBOA 4FNWA 4ACHA 2OF2A 3QCSA 4R3RA 2PE0A 4AOIA 4F9CA 1PXLA 3GUBA 4QYYA 3VS0A 4M7IA 5ICPA 4R77A 3D7TB 3N9XA 4W9WA 3O50A 4E4NA 3LQ3A 2QOQA 2FVDA 3E64A 3G9NA 4PPCA 5HVKA 3RAIA 2WPAA 5EQEA 4JAJA 5FEDA 4FG9A 2Y4IC 3FKNA 2OJFE 5ANIA 2C5OA 3Q9XA 1XR1A 3SHEA 3OP5A 2VAGA 4O84A 4DBNA 2OLCA 3R21A 1GIJA 3QXPA 2C3JA 5BMSA 2EXEA 3BX5A 3F88A 4ITHA 4ZTHA 3BI6A 4O0UA 1TQIA 2HZNA 5LCJA 5A4TA 4TNBA 2GTNA 1G3NA 4FGRA 5J9LA 2BDFA 1FINA 3OC1A 2ITZA 2HZ4A 2JIIA 2PVHA 5LVPA 3I79A 3U54A 2HXQA 3PSDA 2QOHA 1KOAA 3LCDA 5KKRB 5AR2A 2Y8OA 4D4VA 4E73A 4YGAA 4YJUA 3MS9A 3EQGA 1PXIA 5CVFA 4ENYA 3DU8A 2F2UA 1G8AA 2I40A 4CMUA 2VWVA 2WTWA 4NKSA 4UWBA 5EM7A 4RFMA 3MIYA 4G2FA 2HY0A 4M67A 1AD5A 3MJ2A 3VBVA 2ZJWA 3C5UA 5LMAA 5KMNA 3EN9A 3UYTA 1H28A 5B2MA 3PYYA 2XP2A 3SRVB 3OXZA 3DKFA 4Z9LA 3W8QA 4NM0A 4FV3A 4M8TA 2VTIA 4ZZOA 3C0IA 5LVLA 3PPKA 2BALA 2OXDA 4IC8A 3RGFA 4CFWA 4WOVA 3R71A 3DFCB 4YC8A 5A6NA 3MYGA 4HYHA 1WVWA 2OZAB 4FEUA 4JR3A 2CPKE 3D9VA 5GHVA 4BCOA 1R1WA 1WZYA 4ZIMA 4FTCA 5KZIA 1NVQA 3TUBA 3DAKA 5KKRC 3PZHA 1M52A 2VO3A 3F2NA 2VU3A 4L3LA 3NUAA 3LM0A 1J7LA 1UKIA 2VO6A 3BIZA 4LRKA 3VHEA 4AT5A 5J7HA 3G51A 4ZY4A 3F82A 2X8IA 3DDPA 3MVHA 4C33A 3DKCA 2GNIA 4LGHA 4ZTSA 4EH7A 4FODA 3HGKA 4FTRA 2UW7A 4FT3A 1Y8YA 4J8NA 3AGLA 1RW8A 3QA0A 4L46A 4QNAA 5GJGA 3SAYA 5I9UA 3V8WA 3LCOA 4QQTA 5IDNA 4FV0A 1BUHA 4AGWA 3TEIA 3BYOA 1MQBA 4FTIA 3M1SA 2Y4IB 3RK5A 1YOJA 4EBWA 3GCVA 1ZXEA 3EMGA 3C51A 2NNWB 4AG8A 4PUZA 3NWWA 4RWKA 2IZUA 2YCQA 3PRFA 4FZ6A 3LFDA 4DH5A 5IQCA 3PZEA 3PVWA 2HELA 3LVPA 3L9PA 4LL0A 4EZ3A 5H8EA 2WFYA 3AD5A 3MW1A 1OKZA 3PP1A 2PY3A 4G5PA 1JKKA 4PNKA 4FEWA 3SGCA 3QD3A 2ESMA 5CWZA 3D2KA 4XYFA 4EH2A 5HBHA 2XBAA 4O0SA 3BGQA 5CAQA 4TWOA 4RWJA 5DYJA 3ZOSA 3OOGA 3GQIA 4PP9A 3W1FA 3R01A 5CX9A 3C4EA 4AE9A 1JQHA 4YO6A 2OBJA 3A7GA 3QZFA 4NT4A 4CGAA 4ACMA 3AT4A 2XJ0A 4ORKA 1T46A 1IG1A 4XP2A 3RPVA 2VD5A 3HP5A 5GIPE 4E6QA 1VYWA 1OL2A 1E9HA 3C0GA 3P23A 4TYGA 3R1YA 4I92A 2FO0A 3BWFA 3ZM9A 2QOKA 2VWBA 5JSMA 5T6KA 1CM8A 2IW9A 2RSVA 3OW4A 4AAAA 4F65A 2Y4PA 5EI8A 4WD5A 4J71A 4PPAA 3KFAA 1ZWSA 3ZFXA 3DBCA 2DQ7X 4X7QA 4DLIA 3ZC6A 3OWKA 4U80A 3UMXA 1QPEA 1H0WA 3RM6A 4QMOA 3CXWA 4ANSA 1J91A 4FZFB 3NW7A 3QTIA 4QP7A 3SOCA 5C8NA 3VIDA 3KKVA 3COIA 4Y95A 4FNXA 2IJMA 2J0JA 4M12A 5AP3A 2W99B 3FMEA 3TN8A 4Y83A 4YJNA 4XV3A 3CD8A 4C0TA 3EQRA 4GYGA 4XP0A 3HNGA 5CAOA 3ORNA 4DG2E 1WCCA 3EB0A 4I6QA 4PMSA 4F7LA 2HWPA 1ZMWA 3DCVA 1FGIA 2WELA 3I7BA 5L3AA 4QTDA 1ZARA 2W1GA 4NM5A 2CNUA 2Q83A 2A4LA 4BCJA 4J98A 1IA8A 4WSYA 2PPQA 3QGWA 2PMNX 3KK9A 4BWKA 1Q4LA 2F7XE 3O7LD 2CGVA 3BYMA 4C35A 4KD1A 3ULZA 3EJ1A 5IA5A 3ROCA 3LXPA 1SNXA 4FTMA 1UU9A 4QTCA 3R7UA 3QWKA 4N6ZA 1XHAA 3DK6A 3FJQE 2UVZA 3GU7A 5E8TA 5M4IA 3QZIA 1AGWA 4ZMEA 1OIYA 1XH8A 3DBQA 4S33A 4QMVA 5DH3A 3R9DA 3EQHA 3VNTA 3CE3A 4C4HA 4ZSAA 4GU9A 5K5XA 3ALNA 5J87A 3IOPA 4WA9A 2PWLA 1WBTA 3UE4A 4PMTA 2HCKA 3VUDA 3DQWA 2QOFA 3BYVA 4IH8A 3FBVA 2G9XA 2X7GA 1OL1A 3P79A 3P7CA 4YC6A 3QQLA 3ZZWA 4C62A 2OIDA 4YC3A 2Z7RA 3FZRA 3R9OA 2ACXA 4TYJA 1PRYA 1ZY4A 3VS4A 5HNBA 4U41A 3FLWA 3A7HA 4QMZA 2AUHA 4QPAA 4YBJA 3FC1X 3NSZA 5CQUA 2WU7A 3MY5A 4XG3A 2RFEA 3LLAA 4LG4A 3PIXA 4YPSA 3QRIA 5EDQA 4YUQA 3C50A 3QKLA 4EJNA 5EKNA 4MF0A 2B9HA 4YSMA 5I3OA 4HJOA 2PZPA 4DYMA 1PMVA 4AACA 3DXQA 1SM2A 2VTPA 2YM7A 4KS7A 4N70A 4QMMA 1K2PA 5HIDA 5LWNA 1WBSA 2G1TA 3UIBA 1OUKA 2CN8A 2V62A 3ORLA 3R83A 3UG2A 3E8DA 3RALA 2YM4A 3BYSA 1BI8A 3WZEA 3ZMMA 4N6YA 2IN6A 4RIXA 3R02A 4K2RA 4XRJA 4AW0A 4QTBA 4G6LA 3KY2A 3GFWA 5FD2A 4QMSA 4RWIA 3R7EA 4F7NA 4O1OA 4IM0A 4ZTMA 5IA2A 4M97A 4DH1A 4D28A 3OUNB 4FUYA 4QMTA 1R3CA 1DS5A 4AX8A 2JKKA 2WQNA 4IFCA 4HGEA 4L3PA 2OI4X 2C6KA 2R64A 2YDIA 4GIIA 2HW6A 3IQ7A 5BVNA 4MQ2A 4CTBA 3VBTA 2R3PA 4FV4A 2ITOA 1H1PA 1PJKA 3KF4A 5GZ9A 2HZ0A 3CC6A 4IM2A 2XYUA 2JDTA 3UIUA 4AZTA 4XBRA 2XEYA 4FTAA 3LJ1A 4PDSA 5K0XA 5IQGA 5JN2A 3FEGA 2W5HA 5M44A 2QOIA 2W9ZB 4IC7A 5CEMA 1VYZA 4XV2A 2PVKA 2R7BA 4BDBA 1TVOA 1RE8A 5HE1A 1W0XC 3ALOA 3N51A 2RF9A 3EHAA 3RM7A 2XJ2A 3GCSA 2W5AA 2FA2A 4IX6A 3W2QA 2R0IA 1FMKA 3L8XA 4AZVA 2UVYA 1KE8A 3PXQA 4BF2A 1PW2A 3VS5A 2YJRA 4FE2A 4CNHA 2HZIA 3D0EA 3KN6A 4FIHA 3SC1A 3JS2A 3F6XA 3H9RA 4PQNA 4X3JA 1CKJA 2F4JA 3F5XA 3EFKA 4YR8A 4W8DA 5CSWA 1IRKA 4YZDA 4NTSA 2PULA 3HX4A 3I81A 3UVRA 3W55A 2X6DA 1IAJA 4FOCA 1YHSA 1CKIA 1YQJA 2NO3A 3SD0A 4R7BA 3FMMA 4TT7A 2WXVA 4KA3A 3SVVA 2YIRA 3PY1A 5IA3A 4MWIA 3C5IA 3CBLA 3NDMA 2B53A 4GJ2A 5CU3A 4XUFA 4ASEA 4C8BA 1OGUA 4RA4A 2VUWA 4KIQA 4U0IA 5JMSA 3Q04A 2Z02A 3ZRMA 4K9YA 1J7UA 5DEWA 3NMUF 3NS9A 1TQMA 3FYJX 4UMRA 1OMWA 5HX6A 4I23A 3OFMA 2ITQA 3Q4TA 5M07A 4XV1A 3VS2A 4JT3A 2QI8A 3BBWA 3DY7A 1YI3A 4MD9E 3ZBFA 2PU8A 1SVEA 4D55A 4O82A 2XZSA 1T45A 4QYHA 4U7ZA 4BCIA 4UN0C 3IGOA 3QALE 3D5XA 3UNJA 4BDGA 5KBQA 2R3NA 2XJ1A 5IZFA 1YDSE 3NW5A 3ZUVA 2GS2A 3AMAA 2V22A 4I22A 2ITNA 4XBUA 4RZVA 1M17A 3TJDA 3BE9A 2PE2A 1MRUA 5EYCA 3GEQA 3LFEA 3BGZA 3K5UA 4UALA 4E5BA 3C7QA 3OEZA 5IUHA 3FC2A 3FI2A 3QAME 4GV1A 1KV2A 2FSMX 4WNMA 5DT0A 3TNHA 4D4RA 3FAAA 5CAPA 3GVUA 4ZS0A 5KBRA 5LWMA 4XRLA 3UO6A 3ZLXA 4FIIA 3ZU7A 3FLQA 5AUVA 3KXXA 4FNZA 2UZWE 3OF0A 3T9TA 1LUFA 2QCSA 3LCKA 3LFCA 4BVUA 4Z16A 4ACGA 4L7FA 2YISA 4RMZA 2RG5A 4FX3A 2VWZA 4FIJA 4ZSLA 4ZLOA 5EDRA 3IK3A 3Q52A 4X0MA 4O81A 2YN8A 2J51A 1Q61A 4CXAA 4WKQA 5HTCA 5F95A 4ZXTA 2JAVA 3A61A 4DH3A 3F7WA 5JZJA 4UXLA 4XLVA 3VF8A 4U8ZA 2VZ6A 5KE0A 1CTPE 4CCUA 5GIOE 3BEAA 4BYIA 4JVGA 3RCDA 2UZNA 5DR9A 3TG1A 2ITYA 2ZMDA 3PTGA 3TV4A 4D58A 4BKZA 2YCSA 2BUJA 2YLFA 4V04A 4GIHA 1W83A 3PJ8A 3R7GA 2J90A 3CTHA 4C4GA 4UYAA 3F66A 1MP8A 4RJ7A 2C69A 3LQ5A 5CI7A 4I6HA 3MH1A 5D7AA 3DA6A 4TRLA 5FTQA 4HCUA 1BLXA 5AP0A 3BQCA 3ORXA 5HG7A 3ZUUA 4Z3VA 1G8SA 2CDZA 3MFSA 3PA5A 4HVSA 3UNZA 2XEZA 3IW5A 4FK6A 4FSTA 2X1NA 4I21A 4XLIA 5E8WA 3ET7A 5EYKA 3R8LA 5AR5A 4NJ3A 3BLQA 4M3QA 4L67A 1JPAA 3H30A 2VX3A 4UXQA 3EQBA 4ZZNA 5J7BA 4EQUA 5DHJA 1ZRZA 5FGKA 3UC3A 1FPUA 3MV5A 3NNWA 3Q6WA 4PTEA 4BC6A 1XH6A 3C9WA 3HL7A 2X0GA 4QP9A 3Q53A 4CCBA 1SYKA 2Z2WA 4FG8A 4GCJA 4MH7A 4WT6A 2WGJA 3OZ6A 4EONA 4DH8A 2VTTA 3H0ZA 4FG7A 2ONLA 4ZEGA 4BDAA 3GC9A 4K6ZA 2CSNA 4C02A 3E8CA 5EK7A 4KABA 2ZV8A 3VVHA 4UMUA 4DTKA 3RNIA 3ATSA 4O0XA 2JITA 3DFAA 3UQFA 3A2CA 3AMYA 2GCDA 4WRGA 4RJ8A 3D4QA 3FQSA 3VJNA 4EK5A 2F57A 4FL3A 3UBDA 4OTIA 2WIPA 4II5A 3BV2A 4DEAA 1FQ1B 4XHKB 4KIKA 4MNFA 3Q5IA 4U40A 3FLNC 3CIKA 3UPXA 5HIEA 2E9PA 3SX9A 5IA4A 4XG8A 3HDMA 3ZUTA 1OITA 3FXXA 4R6VA 4IFGA 4EH8A 3PE2A 2V5QA 4BICA 3K54A 3QTSA 4LOOA 4A4LA 3CJFA 1JOWB 1M2PA 4ANQA 5A4CA 4CQEA 1V0PA 5CF4A 4PMMA 5HNIX 1E1XA 2QONA 3UC4A 1ZAOA 4QP2A 2UZEA 3QRUA 4FL2A 4O38A 3GU8A 1O9UA 2PMOX 3BV3A 2B9JA 4PTCA 5HI2A 4C3PA 2JBOA 2GMXA 3HV4A 3OXIA 3F3UA 3EN5A 2A2AA 4GFMA 5DLSA 4QMYA 3DNEA 4FZDB 1AQ1A 4O83A 3DV3A 1LP4A 2I0YA 3I0OA 3PWDA 4HYUA 2B0QA 1OUYA 3EL7A 3QLFA 3ZXTA 4FIGA 5CF6A 2BZIB 2WMWA 3AQVA 5H8GA 3ANRA 1M2RA 3D7TA 5BVDA 4PDPA 2QHMA 4Q2AA 2Q0NA 3E3BX 1NVSA 5IEYA 2JAMA 3CQEA 2B54A 2PUNA 3ZSIA 3V6SA 4JBVA 3S2PA 2VWWA 4EOJA 2QNJA 4H3BA 5E1SA 3QLGA 3KRWA 4IB3A 4JX3A 3RP9A 4XNEA 2WEVA 5DGZA 2JEDA 4BWXA 4DE4A 3AGMA 3ZEPA 1PF8A 3D5WA 4E20A 2VTSA 4E8AA 1PYXA 1W84A 2YLEA 4FTTA 3SW4A 1MUOA 3ORZA 4WBBB 5L8JA 4RLKA 3VBWA 2GHLA 3FYKX 4HZRA 4HYSA 4DGGA 4L53A 4RBLA 1OL7A 2IZSA 5FEQA 1GIIA 5CNOA 4ALVA 4NCTC 3MTFA 4Q9SA 3LFSA 2WMBA 3S4QA 1YXVA 4EYMA 4MTAA 2O5KA 2XIKA 4TPTA 4U79A 4ASZA 1NXKA 3I5NA 2EB2A 4CYJA 3W2RA 3RBWA 5AV3A 4EZ7A 4AW2A 4B9DA 3CY2A 3OWLA 4DGOA 5I0BA 4HYIA 4FYNA 3I0QA 4O0YA 3TV6A 4EK6A 2PMLX 5AP1A 3A7JA 3PJ3A 4I41A 1Q41A 3WIGA 4WNOA 2R9SA 3FSKA 4OW8A 3ULIA 3C0HA 3G6HA 3ZRKA 2UW5A 3QC4A 3SA0A 1FMOE 5CS6A 1J3HA 3Q2JA 2YM6A 1XH4A 4JG6A 4U5JA 2QVSE 3FL4A 4W4XA 5AA9A 1F0QA 4O91A 3NUSA 2IO6A 4L52A 1YVJA 5H3QA 5BQ0A 5CANA 3K3IA 5CEIA 5IQEA 3GGFA 5E9EA 4ZZMA 5HLWA 5HVYA 4AN3A 3MB6A 1BX6A 4BDHA 4JIAA 4LQMA 2C6IA 3Q96A 3FWQA 4U45A 3N4TA 4O86A 4JIKA 2CCHA 2VGOA 4UMQA 3UIMA 2GNGA 3VWAA 4JL9A 4YJQA 1WVYA 2ZB0A 4OTHA 3CTJA 4YTFA 2BIKB 1JVPP 5HO6A 4YP8A 2UZLA 5GJDA 5AAGA 2V7OA 3ZO3A 4FKUA 2ZAZA 5EFQA 4NIFB 3EYHA 5CTPA 4YU2A 5C03A 3G5DA 4LMNA 4R3CA 4BKJA 4C4JA 3NAYA 4KS8A 1OI9A 2ITXA 3EKKA 3OHTA 3TZMA 1JKSA 5BVFA 5CALA 2FSLX 2W1CA 4PMPA 1VZOA 2XM8A 4AZSA 3R2YA 2X4FA 1OIUA 2XS0A 2C6TA 4IWPA 3ZYAA 3OY1A 1XJDA 3PXZA 3DJ6A 3R22A 4EOKA 4F0FA 4LGDA 3R8MA 5D9HA 4BI0A 3UZRA 4YTCA 2XYNA 4F0GA 4IIRA 4IX3A 3NLBA 4DGMA 5C26A 4L45A 5KNJA 3EQFA 3OBGA 4ERKA 5TE0A 4K0YA 4TNDA 3IONA 3PVUA 4J52A 3L9LA 5FUTA 4X6QC 5AR4A 5FM2A 3R7OA 4EH5A 3CSVA 1XBCA 2RIOA 4FKTA 5CEOA 3QTZA 3R00A 3TCPA 3MDYA 1BYGA 3MTLA 3I1AA 4RC2A 2OFVA 4XG7A 4Q9ZA 4AOTA 3VUIA 4O7YA 3WZUA 4CKIA 2PVJA 2PHKA 2WTJA 5AM6A 3NGAA 3W2SA 2PVMA 4H39A 1YXUA 3THBA 4C58A 5F9EA 3OD6X 3U87A 4NW5A 4PL4A 3HEGA 4DF3A 5E7RA 4KUJA 3V6RA 3Q6UA 3FPMA 3FZ1A
chains in the Genus database with same CATH superfamily
4IZYA 2YCFA 4ANOA 4A9UA 4JR7A 4ENXA 2QG5A 4JQEA 4XEYA 3R7VA 4A4XA 3TNQB 5F1ZA 3L8PA 2X2MA 3GB2A 4FSQA 4HVGA 3C4CA 2HAKA 2PZIA 1W98A 3AD4A 4C36A 3WI6A 5AUTA 5JFXA 1ZYDA 4MX9A 2VN9A 4RIYA 2B4SB 4EQMA 3DZQA 3KULB 4DEDA 4F6UA 5AV4A 2W1EA 3IPHA 2OJJA 3R6XA 3QUDA 4G3CA 4WRSA 5CT0A 4L44A 3QRKA 3TZ7A 4OR5A 4EQCA 3II5A 3POZA 4KKHA 3RK7A 4P7EA 4CFUA 3EN7A 2WMUA 2QHNA 4F7JA 3UP7A 3D14A 3L9NA 1OZ1A 3ZLSA 4BCQA 5IQDA 2E9UA 2HXLA 3FKOA 2O63A 3D5VA 3SXFA 3LJ0A 4I93A 5FRIA 5K9IA 2GSFA 4E6AA 3EQCA 3VULA 4AS0A 5DT4A 5EW9A 4CQGA 3OTUA 3WF5A 2X7OA 3PY0A 1WFCA 4KIOA 4YURA 3G2FA 4NJDA 5HORA 3QX4A 2ZFYA 4O7NA 1OKWA 2X0QA 3RWPA 3RPOA 3QWJA 2ZYBA 2X81A 5AWMA 2OJIA 5IEXA 1CSNA 4AA0A 2H9VA 5BUIA 2XUUA 1Q5KA 3OT3A 1YDRE 3CTQA 1YWRA 4KRCA 3TKHA 2W0JA 1YWVA 3ENHA 3Q2MA 4DAWA 3KREA 1H1RA 2R3GA 2YZAA 2W9FB 4ZY5A 1DI8A 3HMIA 1QPCA 5HG8A 5AJQA 3O5AA 3PG3A 4FVQA 5AR7A 1LEZA 2UW0A 4LRJA 4TYHA 4AZFA 3F9NA 1OECA 1UKHA 4BZDA 2C0IA 5IQHA 4OTPA 3KXZA 2R0UA 2VNWA 3RNYA 4LUEA 4GH2A 5AMNA 3SV0A 2IPXA 5FBOA 4BHZA 4Z55A 2VTRA 4UEUA 3LE6A 4UMTA 5G6VA 2I1MA 4HVIA 2QOBA 2DWBA 5BNJA 1M14A 2IWIA 3VRYA 1OKYA 3G33A 2PVLA 3QCQA 1Q8ZA 4S30A 1UNLA 5AP7A 4F1OA 2P3GX 3R7IA 4X2KA 1ZOEA 3K2LA 4JJRA 4NSTA 4EHZA 4FKIA 3LXKA 4YPDA 4B4LA 3RPRA 4IVAA 3WIKA 4HPTE 2WZJA 2C5VA 3P7BA 2C6LA 4JS8A 1U54B 3ZZEA 3HAMA 4X2FA 3IDPA 4FTQA 4ZP5A 5M4CA 2C6DA 2YDKA 4C61A 1GY3A 1YXTA 4C2WA 3QF9A 4UV0A 2JLDA 5HU3A 2IG7A 4DHJA 3W32A 3SRVA 2WQBA 3DBFA 4E26A 5AR8A 4FBXA 1MQ4A 1GZNA 3DOGA 3UG1A 4TYEA 2BKZA 1U54A 3WF9A 2C0TA 3COMA 4LYNA 3GFEA 3I60A 2OZAA 3UZPA 4QTEA 1UU3A 1KV1A 4FMQA 3ORIA 1J7IA 5BV3A 2PVFA 3GU4A 2F49A 2FYSA 3K3JA 1BKXA 3G9LX 5E1EA 3R9HA 5HU9A 4NEUA 3GC8A 4BZNA 3FV8A 3AKJA 3H10A 3L9MA 4G17A 1OGYA 3R1NA 3ZHPC 4F6WA 1S9IA 1IA9A 3HDNA 4ITJA 1LEWA 3LIJA 4DH7A 4QOXA 1NA7A 3FXWA 4QMLA 5M4FA 4I5CA 2GTMA 3E7VA 2C5NA 4JLCA 3JVSA 3W2PA 3PIYA 4IAAA 3QUPA 1J1CA 5HQ0A 3SKCA 1XBAA 4I5HA 3TWJA 4DGLC 5J5TA 2EXMA 5FWKK 1H26A 2QU5A 2XNBA 3T8OA 3A60A 2G2FA 4FIFA 4PY1A 3WOWA 4AP7A 3UTOA 4XOYA 2ZB1A 3NVKI 3WE8A 2W05A 2O65A 2W1IA 4OT6A 3P08A 5E8YA 4WO5A 1A06A 1LPUA 5FG8A 1SMHA 3RAWA 4QP1A 3LM5A 4L42A 4RX8A 5HE3A 4XG2A 4CTCA 3R2BA 3FMDA 2VTOA 3QTXA 4E4LA 1FBNA 4WHZA 2JDOA 1V0BA 5E8ZA 4QMUA 2Z60A 3O8PA 1U46A 4P2KA 3OCBA 5HBJA 3JYAA 4FTLA 3W2OA 4BBFA 2HWOA 1ZLTA 3UZTA 4CFFA 4U97A 4O7LA 5E8UA 3TZ9A 2XAOA 5IA0A 3HKOA 2CCIA 2F7ZE 1DM2A 3R9NA 2YWVA 4GVAA 4N57A 1O6YA 3HV7A 4IWQA 2JKMA 3ETAA 3O23A 4TZRA 4R3PA 2FSOX 2CNQA 3F2RA 3CKXA 4B0GA 1KE5A 1R0EA 2QD9A 4DFZE 1ZMVA 2JGZA 3GU6A 4RC4A 4RIOA 4DCAA 2R3MA 5M55A 3AG9A 1K9AA 2BRBA 3BZ3A 2XIRA 3FL5A 1R39A 4GL9A 5AAFA 3UJGA 3VAPA 3UMWA 2F9GA 4DFBA 4LV7A 1NVRA 4EKKA 2OU7A 3F2AA 4S34A 3MPAA 4A9YA 3H0YA 3BRBA 5EQYA 1JAMA 1ZZ2A 2PTKA 3VF9A 5JFWA 4FSWA 1H4LA 3S1HA 3FZOA 4RQKA 2H6DA 3D5UA 4N4SA 4BFMA 4CZUA 2E9OA 3MB7A 4CMOA 5BVEA 2WMSA 3QRJA 2HENA 4OTWA 4D9TA 1H0VA 3GC7A 3GENA 4I20A 4JX7A 4QP3A 5ACBC 5LVMA 3LLTA 3BYUA 4AN2A 2P55A 3OMVA 5IQIA 2YFXA 2VWYA 3OWJA 3AC4A 4CRLA 4BCNA 3PXFA 2Y6MA 5T68A 3OCGA 4ANMA 3DJ7A 4Y5QA 4KRDA 4OAVB 4W4YA 3FLYA 4KSPA 4O7RA 2CNVA 1ZMUA 4NFMA 4QMWA 2BIYA 4UWCA 2EWAA 2PMIA 5B2LA 2E2BA 3LXLA 3MIAA 4CFNA 4EL9A 4L00A 3PFYA 2E9VA 5DFPA 1U4DA 5HHWA 4JI9A 3AD6A 5JT2A 3FHIA 5A9UA 2J5EA 3V5TA 1PXKA 3TXOA 4FV9A 4AE6A 4JRNA 3WARA 4F08A 3B8RA 5IH5A 5EYDA 3UNKA 5HIBA 4USFA 2OF4A 5L6WL 3VN9A 5CEPA 2AC3A 3UVPA 1GAGA 2R4BA 4N0SA 3P9JA 4W4VA 3OY3A 2PYWA 1UA2A 4Y8DA 3ORPA 5IQBA 3EL8A 4E5AX 5CU4A 2ZM3A 4GG5A 3R9RA 2FSTX 4AFJA 2BFXA 5IKWA 1UU7A 3GCPA 3HRFA 3FKLA 2GS6A 3EOCA 5ANDA 5IUGA 3EKNA 2BZKB 2JD5A 3F3VA 2ZVAA 3IW8A 3BLHA 2C6MA 4BJJA 3A4PA 2X9FA 4MCVA 4RZWA 4W9XA 5DT3A 5JK3A 4I0RA 5KMLA 4AT3A 5JH6A 2OXYA 2KTYA 4F9YA 3RZBA 3ZDIA 2QC6A 2ZDUA 3PRIA 3U4UA 1Y8GA 2GS7A 3E8NA 3R73A 4OT5A 1DI9A 3KRLA 4O0RA 4QYGA 4YJPA 4ZK5A 4E93A 1YRPA 4CT1A 4FJVA 4DC2A 4FVRA 1H25A 5DMZA 3FI3A 1OPKA 4R78A 3KVWA 4CEGA 1XH7A 3TKIA 5AP6A 5CZHA 4CLJA 2UVXA 5HCYA 2QG7A 4ZSEA 4O4EA 5C9CA 2H96A 2C68A 2CGWA 3QCXA 3NAXA 4MXYA 3G0FA 2X7FA 5C27A 3A7FA 5GZAA 1NY3A 1SZMA 3TTJA 1W82A 5J9ZA 4C59A 3QUEA 4TY1A 4D2RA 1UWJA 1QMZA 4A06A 4BIDA 5FP5A 5L8KA 3TUCA 4ARKA 2C6OA 3QD4A 3JPVA 4FC0A 4YTHA 1KUTA 2BAQA 2BFYA 2XKDA 5E8VA 4GT5A 3NFFB 4IZAA 2YHVA 4EH6A 2XNEA 3QBNA 3QXOA 3LKMA 2YITA 4RA5A 3WYXA 1ZZLA 4EKLA 1OL5A 5B2KA 4HW7A 1L8TA 5TF9A 2XB7A 2XK6A 4E4MA 3R28A 3HRBA 4AT4A 1WBPA 3QKMA 5ANKA 4BDJA 4E7WA 4DTBA 4WBOA 3KK8A 3TT0A 5E8XA 3NX8A 5AX3A 3UGCA 3Q4ZA 3UO4A 4LGGA 2HK5A 3KCKA 3VC4A 4F63A 5HD7A 5IG1A 4J99A 5FDXA 5D10A 3UO5A 1W7HA 2JDSA 2YERA 3GP0A 3VUMA 4C7TA 2BAJA 3BWJA 3ORMA 4RPVA 2EXCX 1TZDA 4G16A 3F5PA 3U8WA 2W4KA 1FOTA 4L43A 4X21A 2CKOA 3A62A 1JBPE 4USDA 1FGKA 3FLSA 4UY9A 4ZOGA 3KB7A 3RINA 4RVTA 4AXEA 2C47A 4I6FA 5AIKA 4G9RA 2YWPA 2A27A 3RPSA 3B2WA 2F2CB 2OK1A 4BBMA 1YI6A 3C13A 4PRJA 4EBVA 4YNEA 4KBKA 3HUBA 3NEWA 3HMMA 2BZJA 3DXNA 2W17A 4P5ZA 4IZ5A 4TYHB 3LHJA 4G31A 3LAUA 4PF4A 2X39A 2QO7A 4RIWB 5HCZA 3DB8A 2J9MA 3U6HA 3ENMA 3O0GA 3U9CA 5CVHA 3ROYA 3T3VA 3H9OA 1H1SA 3QQJA 4NM3A 3M11A 5DRBA 4D4YA 3BHYA 4CFVA 3CR0A 4EOMA 4F6SA 4ACCA 4OTQA 4OTFA 1Y57A 2YM3A 4C34A 1V0OA 3GOPA 4MXCA 3NVMB 1YXSA 2B52A 4WG5A 2GNFA 1PKDA 3QL8A 5LXMA 4A9RA 3ZTXA 4CG9A 2J50A 4Z7HA 3FXZA 1FVVA 3VUTA 4BDEA 3ZFYA 2BZHB 3F5UA 3I6WA 4C4IA 3FI8A 1M2QA 3O71A 2ZV7A 3WF8A 4PTGA 3LMGA 5KZ0A 4MWHA 2H34A 3PWYA 1OIQA 4GK2A 5ANOA 3E88A 3OCTA 4HGSA 4IQ6A 2WO6A 3E93A 4EC9A 3V01A 3LW0A 4H1MA 3NUYA 3E7OA 3PA3A 4LOQA 2JDRA 3EN6A 1UNHA 1KWPA 3KC3A 1Q3DA 5EW3A 3ZLYA 4FGBA 4Q5EA 3TI1A 4NYEA 4PDYA 3W0PA 3DQXA 3BCEA 3LZBA 1BMKA 5F20A 3KGAA 4U6RA 5IISA 2IZTA 5HG5A 5FLFA 5C8MA 3C4XA 3MA6A 1ATPE 5CF5A 3I5ZA 1B38A 4DTAA 3MVLA 3VHKA 3MVMA 5CAUA 5I5ZA 4FT7A 5C1QB 3BL7A 2GNHA 2J0LA 1LR4A 4G3FA 2UZOA 3AT3A 4CG8A 2YDJA 3S0OA 3BKBA 2CLQA 1KSWA 4ONAA 2CN5A 4QYFA 3GU5A 2OGVA 3SLSA 3KCFA 2VX0A 2VV9A 3E92A 5CZIA 3LQ8A 4BDIA 3EQIA 5J9YA 4U43A 5DG5A 1IAHA 4WIHA 5CU2A 4D2VA 4BR3A 4G3EA 2OIBA 3IECA 3MH2A 1G5SA 4FV8A 3UQGA 3QU0A 3KN5A 4X3FC 5DI1A 3O8UA 2VNYA 4F64A 2DS1A 5AAEA 4LL5A 2R7IA 1Q8TA 4G34A 4V05A 1U5RA 4YZNA 4K1BA 4IAKA 3R1SA 4S31A 4IADA 3V04A 2XRWA 2NP8A 2XBJA 4E6CA 2BR1A 1DAWA 2R3HA 3ACKA 3BEGA 5K0KA 5JQ8A 2XVDA 5CU6A 3MI9A 1TKIA 5HX8A 3ML1A 3VO3A 4ALWA 1JKTA 3CQUA 4EYJA 4FT5A 2WTDA 3HA6A 2W1ZA 3R8ZA 2UV2A 5FXQA 5CLPA 4RIWA 4C4EA 4X6RA 4A07A 5C4LA 3P5JC 2UZTA 1NT2A 3I7CA 3DLZA 1W8CA 2OSCA 2J0IA 2GPHA 4GKIA 4AOJA 1OBGA 2VTQA 3EQDA 3DBEA 1YDTE 3QX2A 4YO4A 3TTIA 3D7ZA 5FXRA 4ID7A 5LVOA 2LAVA 4AAYA 1OKVA 2P2IA 1Q8UA 1HCLA 4BKYA 4UYNA 4Z7GA 4YJOA 4C57A 3E3PA 3I4BA 1JSUA 2GDOA 5FP6A 4AWIA 2AYPA 3CGFA 3KMMA 4YJRA 4K18A 5EOBA 4O7VA 3HMPA 5AP5A 3E62A 3VONA 4QPMA 4BJJB 4D2WA 4TYIA 2UW6A 1WMKA 5I4NA 1YHWA 3HMOA 4B8LA 3REPA 2BTSA 3JXWA 2VGPA 3ZSHA 4XCUA 4DEIA 3O96A 3PSCA 4DHIB 5FM3A 3VW6A 4F70A 5CSXA 5AUYA 1OPJA 2HIWA 4E5WA 5LVNA 4BIBA 5BYLA 5EM5A 1ZYCA 3QZHA 4EOLA 4EJ7A 2PVNA 2XM9A 1WAKA 4NK9A 4RQVA 4U42A 2RGPA 4FZAB 5FTOA 2X9EA 2GQRA 4MEDA 3VBYA 4G3DA 4DEGA 3QQHA 5J8IA 3AC5A 2YABA 4DA5A 4BDCA 1PMUA 1CKPA 4AA5A 2B9FA 4H3PA 5I9XA 4D5KA 4RJ3A 1ZYJA 3OS3A 4QTAA 4ZJJA 4O2PA 1GZOA 2JBPA 3CKWA 4NFNA 5TO8A 4M14A 3LXNA 1G8KA 4FZ7A 1OVEA 2PSQA 2WMVA 2YM5A 4HCTA 5B7VA 1REJA 2YACA 1U59A 3HLLA 4EOSA 3IDCA 2I0HA 2J4ZA 2ITWA 3DK7A 5FXSA 4M0ZA 5ETAA 3I6UA 3ZONA 3KIOC 2YEXA 3DTWA 3V3VA 2YIXA 2VTNA 3R04A 5CT7A 3FY0A 4R7IA 3VQHA 4FTNA 4FV2A 4BI1A 4WG4A 2W4JA 4QO9A 4YZ9A 2YM8A 5HG9A 4DLJA 5M57A 3ORKA 2VTLA 4O4DA 3VBQA 3PPZA 3QTWA 4L7SA 4CD0A 5IH4A 2LGCA 2XNMA 5KHXA 3EZVA 2QO9A 4FSNA 4NTTA 4M68A 2OICA 4YLJA 3NUNA 3W18A 2XKCA 3KL8A 3A4OX 3QRTA 4FKPA 4W8EA 3C4ZA 1O6KA 3C1XA 4XG9A 1Q24A 3ZLWA 3U4WA 5A4LA 4O86A 3DBDA 2G01A 2PE1A 4FNYA 3ZS5A 3COKA 3V5WA 4AN9A 5E8SA 3SXSA 3VS6A 4DFYA 4QYEA 3KVXA 3O7LB 4Y85A 2ERKA 5HCXA 3JY9A 5KMIA 3SG8A 4HVHA 3K5VA 4D0XA 4D0WA 4E1ZA 1RQQA 2CGUA 3RHKA 4B8MA 4UX9A 3KRJA 3D94A 3IS5A 3QFVA 4XJ0A 5AUWA 3UOKA 4G6OA 3CLYA 4M69A 3ZRLA 4QEBA 3AXWA 3MH3A 5I9VA 4AQCA 2QOLA 1OBDA 3EIDA 2CLXA 2ETKA 4GJ3A 3ZH8A 3OVVA 3TL8A 1B6CB 4FKSA 3HUCA 4HGLA 5AEPA 2H8HA 1GNGA 4IDTA 5EG3A 3FMKA 4QD6A 2PZYA 4RC3A 4D4SA 4F1MA 3WZKA 4ZMFA 4G9CA 4YHFA 3HECA 3QD2B 5A54A 4QT1A 2VO0A 2R3LA 4JBQA 3SDJA 3W0NA 1KOBA 5DA3A 1WBVA 1H08A 4MBJA 1F3MC 4AA4A 3DXPA 1Z5MA 2R5TA 3FHRA 3DKOA 4IEBA 4CKRA 3KXGA 5HZNA 5CASA 2UW3A 4MF1A 4CYIA 5ACKA 1BL7A 3FMNA 4JBPA 3W0RA 4I5MA 2G2IA 1GZ8A 3POOA 4I3ZA 2ZMCA 2W7XA 4FTUA 4J8MA 3BQRA 1H24A 3OCSA 4I0TA 3FE3A 5K4IA 1YW2A 2Y7JA 5M06A 1JWHA 3RVGA 3ZXZA 4GFOA 4IVBA 5DNRA 5K3YA 5JEBA 2OH4A 4K77A 4D1ZA 1ND4A 2C3KA 4XG6A 3LFAA 3P1AA 2OH0E 2OJGA 4HNFA 4EUUA 4K11A 3ZCLA 3P0MA 2WNTA 4PP7A 4IWOA 4M15A 4EZ5A 3Q9YA 4IE9A 2Y9QA 3EZRA 3P86A 4IMYA 3ZO2A 2O3PA 4RJ6A 4AGDA 4QP4A 5L2QA 4RVMA 2A0CX 3MBLA 4TTHB 3RJCA 5CENA 3BHHA 3ERKA 5ETIA 2I0VA 4JG8A 4NW6A 3ZBXA 4BI2A 3OT8A 4CZYB 4EH3A 2BMCA 2JIVA 3N4VA 3CD3A 3PJCA 1YI4A 5J95A 4ZAUA 3IW7A 4QPSA 4JOAA 4FV5A 3D15A 5BVWA 3UIXA 4USEA 5JQ5A 3CP9A 3LOKA 4RJ5A 4EK4A 3TDVA 1I44A 1MRYA 2XK3A 4RFYA 2V0DA 4XS2A 3HRCA 1MRVA 5GINE 2WOUA 4APCA 2YIYA 4AW5A 3LCSA 1JLUE 2Z7SA 3V51A 5A4EA 1XBBA 4QRCA 3FY2A 4YJVA 4C38A 4KKGA 3L8VA 3OWPA 4M84A 2WQEA 3G90X 1NW1A 3S3IA 4CZTA 5BYYA 5J5SA 3CEKA 3EFLA 2WIHA 5A46A 2RFSA 2W1FA 2ETMA 1H27A 4DT9A 1Q3WA 4WUNA 4ZJIA 4RLLA 4TWCA 4EK3A 3WILA 3LJ2A 3QQGA 3U51A 2WTKB 2X6EA 3AKLA 4C3RA 4O4FA 3BU6A 5GNKA 2R3KA 5M53A 3TIYA 3MFUA 4D1XA 4J97A 4IVCA 4LI5A 4O6LA 3MWUA 1ZYSA 3QHWA 4X2JA 1YWNA 3TNWA 4BCGA 4OBOA 4I6BA 2UW9A 5CAVA 2GHMA 3MPMA 1PHKA 3NYVA 4KB8A 5E91A 4NCTA 3EH9A 2HY81 2RFNA 3A8XA 4APPA 5I9ZA 2X4ZA 1QCFA 3HV3A 4MD8E 4U9AA 1H1QA 3V5LA 4ZTLA 1M7NA 3MH0A 2PVRA 4IB1A 4TWPA 2GQGA 3VBXA 1Q8WA 3Q4CA 2VTHA 4KIPA 1IR3A 3JUHA 3NZ0A 4QMXA 4FEXA 4H58A 3BE2A 2P4IA 4I4EA 5CXZA 2JKOA 5HO8A 5K4JA 3PDTA 4FSRA 4YBKA 1APME 3PXKA 5IF1A 3RCJA 5EOLA 3PVBA 4QQCA 5KMJA 4DN5A 4H05A 2IZRA 4IANA 3DK3A 5AV2A 2IEWA 3IW6A 2CKPA 4BTKA 2I6LA 5AM7A 4DBXA 1TQPA 5D11A 2X8DA 2PZ5A 2QODA 4BTJA 3CPBA 5E92A 2GHGA 5LOHA 2C3IB 4TKSA 3UOHA 3DNDA 4RIYB 4JDJA 4TWNA 4FSZA 5HNGA 1A9UA 3UODA 2PK9A 5FBNC 5HTBA 4BWPA 1XWSA 2FGIA 4OBPA 5IA1A 4ZS4A 4ACDA 4JDIA 3JY0A 3DAJA 3R0TA 5AUUA 4JRVA 1XQZA 3LPBA 5ETCA 2BHEA 1I09A 3BU3A 3MFTA 3Q3BA 2Z7QA 4BDDA 1Y6AA 4QP8A 2WEIA 2X0OA 3UDTA 4KAOA 3KA0A 3WZDA 3SW7A 3MESA 3PIZA 2YJSA 4MNEA 4XMOA 4IHPA 3HZTA 1GZKA 5HE0A 5DIAA 3TNIA 5BPYA 4BBEA 4BGHA 3PXRA 2A1AB 3GT8A 4FI1A 4P5QA 4YHTA 2UZVA 4J95A 1W2CA 4V0GB 4KKEA 4BB4A 5HE2A 4BZOA 2V7AA 3F61A 3IDBA 3O8TA 5DWRA 2BKKA 2DYLA 3Q9ZA 5HBEA 1BL6A 2C1BA 4F4PA 4F99A 4ANLA 2WTKC 3OEFX 3AC1A 1KE6A 3QC9A 3P4KA 2YIQA 2XNNA 4O2ZA 3CGOA 4CRSA 3ODYX 3CS9A 4WUAA 4YJTA 4I0SA 3V5QA 3QHRA 4AXAA 1IEPA 1SVGA 2VTJA 3LCTA 3NCZA 4YHJA 2CKEA 4FTJA 5JKGA 4CSVA 2P0CA 3PP0A 3RKBA 2C3LA 4O7ZA 1P14A 3ORTA 3QGYA 4EK8A 4ZLYA 2QLQA 1JSVA 3O17A 3OG7A 4YLKA 5FQDC 4D2TA 4A9TA 4IAZA 4F9BA 4DFUA 3AC8A 3AC3A 3QQUA 4D9UA 3V8TA 4DEBA 2O2UA 4S2ZA 5IU2A 2C1AA 4RVLA 2IVUA 2OW3A 2GNJA 3IGGA 1VEBA 2JC6A 5BUEA 4O7WA 5AA8A 5AADA 5IMXA 3A7IA 2FUMA 4L9IA 4RX7A 2W5BA 3GQLA 4CT2A 5DR6A 4FVPA 5GZ8A 4FEQA 4FT0A 1X8BA 3NPCA 2ZV9A 2HOGA 3OUKA 4O6EA 2VTAA 2IW8A 2XNGA 3B8QA 4GRBA 4H1JA 4YZBA 5L2TA 5DPVA 4FKRA 1OPLA 3W16A 4FYOA 5ANJA 3DZOA 3D83A 4GW8A 4R1VA 4DGNA 4ZLZA 4F9AA 3SQQA 3FMJA 4K33A 2GFCA 4BCPA 5HO7A 4EI4A 4LMUA 1Y91A 4L01A 2PZRA 3D2IA 3GBZA 3GNIB 4IB5A 4O0TA 3ZDUA 4BY9E 2RG6A 1Q62A 2EVAA 3COHA 5D1JA 3FLZA 3MA3A 4KBCA 2VRXA 4OGRA 3UDSA 1H1WA 4JNWA 3WF7A 4ITIA 4AZWA 1UNGA 2ITTA 4MAOA 3R7YA 5CEQA 3VRZA 4L8MA 4EH9A 2UZUE 2C5XA 1Z57A 3CY3A 4MBIA 2QOCA 3B2TA 2J6MA 3EWHA 1YHVA 2DUVA 4D5HA 4BDFA 1H00A 5M09A 4MD7E 4D1SA 2BHHA 2JDVA 4YMJA 3QKKA 3G15A 5IEVA 4FUXA 5HLPA 4K8AA 3TNPC 4TXCA 5DR2A 4A4OA 5C8KA 3GCQA 2C0OA 1YOLA 4V01A 5J79A 4A7CA 4OAUC 1EH4A 4ANNA 4GUBA 3QTQA 2UW4A 2XH5A 2BDWA 2OXXA 2Q0BA 3FSFA 5J1VA 4MNEB 5EM8A 4NM7A 4H36A 4IJ9A 4UB7A 5HEZA 2BAKA 4F1TA 2ZM1A 4MXZA 4DFXE 3QA8A 4U3ZA 2YAAA 2WD1A 3Q60A 3WE4A 4MXXA 1YXXA 2GQSA 3PUPA 4KIKB 2QR7A 4NUSA 4GMYA 4BYJA 3DAEA 4RJ4A 3DDQA 4IACA 3ZFMA 1PKGA 2NRYA 3DGKA 3WBLA 4WSQA 1V1KA 5BMMA 2FH9A 4FSUA 2QKRA 4UZDA 2OJ9A 4GYIA 5HGIA 3AC2A 4FV6A 4DEHA 2IF8A 4BCMA 5JZNA 3V5JA 3PUFC 5JGBA 5BUJA 5I9WA 3HV5A 2ONLC 5HVJA 2WKMA 3NUPA 4FKGA 5CQWA 4U81A 1FVRA 5H2UA 1RDQE 4JAIA 1HOWA 3HV6A 2ETRA 3HP2A 4MXAA 5DRDA 5AX9A 4BCFA 5KHWA 4AXFA 3CPCA 4KBAA 1W2DA 3E8EA 4Y5HA 2FB8A 5CU0A 2UZBA 4J96A 2WTVA 2WB8A 2GFSA 2X8EA 4ZTQA 3RAKA 4CLIA 5M4UA 1H07A 3MPTA 2O0UA 2XMYA 1JKLA 2P33A 4M13A 3AT2A 3VUKA 2E9NA 4XH6A 5CSPA 1XKKA 2B55A 2OZOA 5C01A 1XH5A 5IQFA 5HTIA 1FVTA 3AMBA 3ZM4A 4CFXA 4RSSA 3MJ1A 4O27B 4O1PA 3R30A 4U44A 2VX1A 4YZMA 3NRMA 4GVJA 5JRSA 2WTCA 2QLUA 4ZSGA 2BILB 5E4HA 4CVAA 4R7HA 1Z9XA 2W1DA 4NKAA 3UQCA 4PL5A 5AUZA 3C4WA 3NYXA 4O21A 5EKOA 5M51A 1TFFA 2R3OA 4HPUE 2VTMA 3PY3A 2A98A 1GJOA 3G6GA 4S32A 3H3CA 3BHTA 4UBAA 2XIXA 2XNOA 4I94A 2XKFA 1KE7A 2OIQA 4LV5A 4IAIA 5FEEA 3AOXA 4XG4A 4BGGA 3FMLA 4FV1A 4FIEA 4BGQA 4CV8A 3KXNA 4XP3A 2XIZA 3LFFA 3BHUA 2W1HA 4LM5A 3FMHA 3QTUA 1R0PA 5TT7A 2J0MB 3PVGA 4X3FB 4G1WA 5EW8A 4F78A 5CSHA 1P4FA 3EN4A 3QQFA 2G15A 3EQPA 1M7QA 3R63A 4ZTNA 4EOQA 4AXDA 5HOAA 3FDNA 3PA4A 5LJJA 5KMMA 4F7SA 3N4UA 2QR8A 4OUCA 1GOLA 3KXMA 3KMWA 3PLSA 3PPJA 4HCVA 4WG3A 2WHBA 4YJSA 3NCGA 2P2HA 3SG9A 3V5PA 4QMPA 4X3FA 1OB3A 3H9FA 3ZSGA 2NPQA 3DS6A 4MYGA 5ANGA 1GIHA 4EHEA 3DB6A 4P4CA 1J1BA 1K3AA 4O0VA 5AR3A 1VLRA 4QMNA 4ZJVA 1ERKA 1QL6A 4NH1A 2XNPA 5GJFA 1PYEA 3NIZA 3PE1A 4UZHA 3OTVA 5K5NA 1Q99A 3QCYA 5B0XA 4OTDA 3NNVA 4BIEA 5BVKA 5AP4A 3GI3A 3TUDA 3KXHA 3FUPA 3Q5ZA 3H4JA 3T3UA 1UU8A 1WBWA 3P7AA 3E63A 5AIRA 5KO1A 4FKQA 5EI6A 4EORA 5FDPA 5L4QA 4EUTA 2Z8CA 4I4FA 3JR1A 3PFQA 5LQFA 3F69A 3FI4A