2PVNA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
total genus 109
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvnA02
3NIZA 2JFLA 3C4EA 3F5XA 2B9JA 2QI8A 2QOFA 3GC7A 5HCZA 4CTCA 5L2IA 4DF3A 2OG8A 5EW8A 3RAKA 3BV3A 3WF7A 5HO8A 4CQGA 4D1ZA 1I44A 2R3NA 5M4CA 4EBWA 3ZSGA 3F3UA 2JKOA 4W8EA 5JQ5A 3WZDA 4IQ6A 3ROYA 3SHEA 3FLSA 4DE4A 4MK0A 4ZJVA 4NL0A 2ZV2A 2W5BA 3QC4A 2CKEA 1QMZA 1YWNA 3CTQA 3DXNA 2CJMA 1S9JA 2BMCA 3LQ3A 2BRGA 4GIHA 3PJ8A 3KU2A 5C8MA 4CMUA 3QD2B 1V0BA 4R77A 3LE6A 4C3FA 5AEPA 3NWWA 5K0XA 3LJ2A 4DGLC 2W4JA 1R78A 2P4IA 2YEXA 3ALNA 3EMGA 5FTOA 5AUXA 3GCVA 4RFYA 1E1XA 1XHAA 3LJ0A 5KKRC 1JKLA 5BVNA 2YERA 2F7EE 3ITZA 3NUXA 3QQGA 4O7SA 2UW4A 3ID6C 4FIGA 1YHWA 3R21A 2A4LA 4NM7A 4GFOA 3BYMA 4PV0A 3DQXA 1JAMA 2XNGA 5H2UA 4I94A 3ZM4A 4BCNA 2YN8A 4TWCA 2XIKA 2RG5A 2XVDA 4IADA 3ZMMA 3G9NA 3ORPA 2CKPA 4W4XA 4IAFA 3R8VA 3VC4A 4F70A 1WBPA 2FYSA 3FZTA 3V5WA 5J9YA 2BCJA 3NNUA 4QTDA 3DFAA 3OZ6A 3QALE 2F7ZE 4DCAA 3CCNA 4ZTNA 4D4VA 3JYAA 5GZ8A 2XIRA 2XM8A 2WTKB 3H30A 2VAGA 4BY9E 2DQ7X 4MBJA 3UODA 2PE1A 3F69A 2OI4X 4ACGA 1XR1A 4Y5QA 2XNBA 3DAEA 5HEZA 4F7NA 2ZOQA 2CKOA 4FTTA 1BMKA 1ZARA 3CQUA 3HMPA 4IFGA 2B9HA 4TYGA 5KUPA 1XBAA 3CR0A 3HP5A 3OY1A 2VWUA 3DZOA 4C4IA 2XNMA 3P1AA 3ZC6A 3RNYA 3AC3A 1K3AA 3RBWA 4AT5A 4EH8A 3SG9A 4H58A 2BKZA 2BZJA 3R02A 4M68A 2JC6A 1ZOEA 3CTJA 3FI2A 4TNDA 4E4MA 4YTFA 5CT0A 2YDJA 2R9SA 5FP5A 3LFQA 4OTFA 3PSBA 4L3JA 3PE1A 3HYHA 5HE2A 3BV2A 5K4IA 2VTIA 4RC3A 3UMWA 4E6AA 4EK3A 5FBOA 4JDKA 5CI6A 4O86A 2YAKA 5ICPA 4AT3A 5DVRA 3R1SA 2WNTA 1Y8GA 3O0GA 4DTAA 3TI1A 4IZAA 2OWBA 2QQ7A 3PA3A 2V5QA 3E5AA 1GIJA 5IQBA 2WMAA 4XOYA 5CXHA 4YHTA 3CY2A 3ZUTA 4XG6A 4I0SA 4FIEA 3IO7A 4O27B 2C69A 5FTGA 4O38A 5E8VA 3W8LA 4BWXA 4IX3A 3W2QA 3IG7A 3W33A 3QCQA 2EU9A 2XK7A 4BBEA 2G01A 3AT2A 3LCOA 4Y46A 4NSTA 5F20A 3VBTA 1UNGA 4PMMA 2XH5A 3VBQA 5CX9A 3W10A 5EK7A 3BGQA 2G1TA 3ZOSA 2R2PA 3O50A 3AXWA 4IAIA 5AIKA 2F49A 3R0TA 5E8UA 5I3OA 2CNQA 3MV5A 3P4KA 4I5PA 5L8LA 2W17A 3VJOA 1OL1A 5CEOA 2VTPA 3GQLA 3RJCA 2UW7A 1W84A 3MVJA 2X4ZA 3NLBA 2QOHA 3V8WA 3TNQB 4EL9A 4XG7A 3FY2A 2I0VA 4M66A 4U79A 4Y8DA 4EI4A 3QX2A 2CSNA 4NEUA 5DN3A 1O6YA 4U80A 4ZZNA 3ORLA 3UPZA 4G3EA 3VS6A 3UP7A 4F64A 3ENMA 3QHRA 4JBVA 4XCUA 1CKPA 4AG8A 4FF8A 5M4UA 3KULA 1VJYA 3KK9A 3ORIA 1IR3A 5DEWA 5AUZA 3V5JA 3MI9A 5E1SA 5LCKA 4O1PA 3CEKA 4J96A 2PZIA 2I1MA 3Q52A 3QD4A 3DT1A 3CXWA 3C0IA 4APPA 5HE1A 3RINA 4DLJA 4E26A 3LVPA 2GPHA 3EKNA 3H9OA 5IQHA 2PE0A 1O6LA 5CLPA 3G0FA 3W55A 3OWKA 2PULA 2BAQA 3HMIA 2ETRA 2WTKC 4TXCA 4H3QA 4J98A 5DYJA 3PDTA 5HLPA 2HXQA 3D0EA 4K9YA 3PE2A 4O21A 5IA0A 3FMHA 3PY1A 2XP2A 5C03A 2C6OA 4K18A 5EKNA 4V04A 2O64A 1WBSA 1Q8TA 4JQ8A 4RVLA 3DOGA 1TVOA 2IPXA 5CXZA 2PY3A 4EQUA 2X2LA 2V55A 1KE8A 4QRCA 3QHWA 2WIPA 4QMYA 1Y8YA 3KMUA 5KX8A 3AD5A 1MP8A 4OTDA 3QTIA 4DFXE 2GNJA 4J53A 3E7VA 4QP1A 3C51A 1ND4A 3GUBA 2R0UA 4XG8A 5FEEA 5AMNA 4FV2A 4QD6A 3CSVA 4PTEA 4BWKA 5JT2A 3BQCA 1PKDA 2R3FA 4IB1A 3GBZA 2G2IA 5KMOA 2BZIB 2QOIA 1OIRA 5CNNA 5HORA 3SOCA 5L8KA 3I6WA 3EFJA 1WFCA 2WPAA 5AWMA 2HCKA 3TUDA 1HCLA 3FPQA 4QMQA 4JS8A 5IA5A 2ITQA 5F1ZA 1OKVA 3OUKA 3RKBA 4G6OA 5CEIA 1Q4LA 3FE3A 2V7OA 1G3NA 5ETFA 4U44A 1OKYA 3JUHA 4AE6A 4EH7A 2YITA 4FC0A 2C68A 3CKXA 4U42A 5J5TA 2UUEA 4C4GA 2VTQA 1KWPA 2UW6A 3ZO3A 2BTSA 4XEYA 5FD2A 5K0KA 2C30A 5BVEA 2XK9A 4PDPA 4FTIA 2B9IA 3SAYA 2X7FA 3COIA 2QG7A 4O83A 2R3IA 2EB2A 4IM0A 4YZDA 4EOJA 1JKKA 3RPOA 2ZJWA 2W1EA 2Z2WA 2ITXA 3PIZA 4O0WA 4O6EA 4D58A 5FBNC 5JQ8A 1H1WA 2OH0E 2P2IA 4KAOA 3E8CA 3EQIA 5M4IA 3C9WA 3RI1A 4FOBA 3EH9A 4BKYA 5EDRA 4F08A 3PPJA 4MWHA 1YXVA 4D2TA 5L2SA 2W99B 4D4SA 5AP1A 3FI3A 4YR8A 2F9GA 3C5UA 5I9XA 5C4KA 3FKLA 5E8TA 2J90A 4FZ7A 4GG5A 3MIYA 3GU8A 4FG7A 2WQNA 4ZTLA 4GW8A 3HRCA 3JPVA 3VHEA 1ATPE 3FKNA 3DCVA 4I92A 1O9UA 5FGKA 4EUUA 4C3RA 4BGGA 3ZONA 1H08A 2VTNA 3VS2A 5E7RA 1QCFA 3LFSA 4WIHA 1BLXA 3ORZA 4XX9A 4HGEA 4D0XA 1DI8A 1H1SA 3EN5A 3TJCA 2VO6A 2REIA 2J51A 2R0IA 3HZTA 2X0GA 3RCDA 1SVHA 3EOCA 5CF4A 1OL5A 2OICA 4YZBA 3S1HA 1T45A 4L44A 2OKRA 1UWJA 4FKPA 4U43A 5C8KA 2IVSA 4ZIMA 4BDFA 3EN7A 1KV1A 3Q4UA 3EQFA 1XH9A 3TUCA 3L8XA 3BI6A 3L9NA 3T8OA 3MFUA 1OIQA 1STCE 5DWRA 2QD9A 1FOTA 1YWRA 3L8PA 2XJ1A 3DFCB 2C6TA 3KXGA 2R7BA 3PLSA 3UVPA 3WZJA 4FTQA 2PK9A 4ZTSA 4GYIA 4BCPA 2B4SB 2OFVA 4F99A 5IEYA 2OIBA 4IANA 4FGRA 4FT3A 3WYXA 3CD8A 5M51A 5AUYA 3SX9A 3R1QA 4YJPA 4IB0A 3THBA 4EUTA 4G6LA 3F2AA 3BRBA 4MHAA 5AV1A 1J7IA 2Z8CA 1H26A 3I7BA 2HYYA 3E7OA 4J8NA 1W7HA 4EHVA 2BKKA 5D12A 2H8HA 4GV1A 2VRXA 5DFPA 2VWVA 3K5VA 3MTLA 4S32A 4DEAA 4HCUA 3QRUA 4NWMA 2C5YA 4O96A 3HV6A 4PY1A 3LCTA 4TN6A 4UEUA 4L8MA 4PRJA 3E8NA 1R0PA 3PWYA 4BN1A 1KE9A 3CPCA 3RM7A 4YO6A 4YUQA 3ODZX 1Q41A 4UWYA 1H25A 1BUHA 1PXMA 4Y95A 3BLRA 4EH6A 3PG1A 2VTHA 3DK3A 5DHJA 4JAJA 1W0XC 1H01A 1OPKA 3P78A 3F2NA 3ZO1A 2OGVA 3BHUA 3NW7A 2WU6A 3SV0A 3RAWA 3QRJA 5CQWA 4KIKA 4CFUA 4R5SA 3QRTA 4CRLA 4Z7GA 3OY3A 3N4TA 4C59A 4EZ3A 4UXLA 3OROA 5LCJA 1M52A 5JKGA 3HP2A 3LKMA 4FSZA 4GUEA 4GT3A 3HUBA 4BKZA 4F1TA 4F9BA 3UZTA 5KHWA 1PXLA 2CLQA 1GZ8A 2HIWA 2C5XA 3L8VA 4JG6A 2WEVA 2UZDA 2V62A 4MNFA 3NS9A 4G6NA 1WMKA 5I5ZA 5HU9A 3MDYA 1PMVA 2WTCA 5HIBA 3VBWA 3PSCA 4CFNA 4FGBA 2DYLA 3UZRA 1OMWA 4D5HA 3ETAA 2FO0A 3PPZA 5LMBA 4W9WA 3U9CA 3MA3A 5KNJA 3S0OA 3D5WA 4WBOA 5B0XA 4EWQA 3R9OA 3AMBA 4PTGA 1Q8YA 2ZDTA 3ZH8A 4L45A 3PRFA 5AR3A 1IA8A 3K3IA 3ZC5A 5IH5A 3R7UA 5CEPA 3KVXA 3VW6A 1K2PA 4FTNA 3VUKA 1IAJA 3M2WA 2ITNA 4RX9A 1U5RA 3U51A 4RWKA 3F88A 3OWPA 3JVSA 2ZV9A 3TV7A 4BYJA 3D94A 5IA1A 4AT4A 3WARA 3AG9A 1HCKA 4OBPA 3PPKA 4JQ7A 4RGJA 4RC2A 5CSVA 4PP7A 5CS6A 5LVNA 5L2QA 3HGKA 3OBGA 5E4HA 3KRLA 4DGNA 2GFSA 3AMYA 1ZMWA 2Z60A 2YLFA 4IX6A 2OJIA 2HW6A 3LOKA 4NJDA 5HIDA 3SXFA 3UG2A 4C38A 4FTCA 3LXPA 2B0QA 4ZJIA 4OTQA 3Q6WA 2ITVA 3QTZA 3I5ZA 4CQEA 5CYIA 4FTMA 4JQEA 4KRCA 3B2WA 4JL9A 1BL6A 3DAJA 1M14A 3C0GA 3NGAA 4CFFA 5DR6A 4ENYA 3MH2A 5IISA 5B7VA 1PYEA 1XWSA 2GQSA 3KK8A 4KKGA 5A4CA 4MXCA 2DWBA 2O65A 4PP9A 1GIHA 3DKOA 1FMKA 2R3KA 3DU8A 2Z7SA 3NVMB 5FTQA 1UWHA 3T9TA 3AMAA 3MFSA 2WKMA 4FL3A 4GRBA 4ZXTA 4NCTA 2JDTA 3RAIA 2HW7A 2JIVA 2OXDA 1PW2A 2HENA 3TKIA 1G5SA 1UU3A 5AR2A 5FDXA 3G5DA 3OCSA 4FYOA 5AAGA 3E8EA 4NIFB 3HUCA 3M11A 4DGOA 2IZTA 2ACXA 4FG9A 4C8BA 4CZYB 2P33A 3LQ5A 4PDSA 2WTIA 4TY1A 2PVLA 1H0VA 4M69A 3FXWA 4RA5A 4E7WA 3NPCA 3LLTA 1OL2A 3UPXA 4ZOGA 5GJDA 4A9UA 2YM6A 5CAQA 2WU7A 1WBTA 3MS9A 4WG4A 3VW8A 3W8QA 1V0OA 4Z16A 1OVEA 4BI2A 4EH3A 4TYIA 4O7TA 2BDWA 2Y4IC 2J0KA 4FNXA 5EI2A 3HV3A 4FI1A 4FNZA 4V0GA 3RP9A 4RFMA 5IEVA 2YFXA 4DG2E 1H1PA 2CPKE 4FV0A 2BHHA 5AP0A 2BZKB 4C4FA 5IG1A 1H07A 5HBEA 3SD0A 2X9EA 4ITJA 1BI8A 3BBWA 5IKWA 3VF8A 3MPAA 5CAVA 4Y5HA 3G33A 5CZIA 1OIUA 4NFMA 3SA0A 3F66A 3NNWA 4FSTA 4TL0A 2B7AA 3UZPA 3R83A 5A46A 3EJ1A 3C4WA 1ZXEA 1Z5MA 4FR4A 3R8ZA 4CV8A 2PMLX 4DFLA 4EK6A 5DLSA 4ZLOA 2PPQA 2IJMA 4F0IA 2QOQA 2QHMA 4M15A 3BBTB 4FSRA 3VRZA 3LFFA 2BTRA 1OZ1A 4BIEA 2J6MA 4KS8A 5AV0A 3OT3A 3MH3A 3VS4A 3ZZEA 3E8DA 2B9FA 3RWPA 1J1BA 2BDJA 4J1RA 4IZ7A 3GU7A 3FMJA 3KN5A 4DH5A 3FMKA 3E64A 3EFWA 4ZZMA 5AV4A 3PY0A 5HE3A 3BHVA 1DS5A 1XKKA 2FB8A 5EI6A 4R3PA 5EOLA 2CKQA 4R3CA 1UU7A 5ANGA 3VUHA 3L8SA 3TNPC 4FEWA 2RG6A 3VRYA 5HCYA 4CFWA 2CMWA 3FLZA 4ZY5A 4MXAA 5M07A 4LL0A 3U6JA 3ET7A 4XOZA 4BGQA 5HTIA 3DKFA 1UU9A 3UIBA 4GK4A 4E4NA 4L3PA 4RC4A 4A9RA 3PLAE 4ALUA 1NW1A 2DS1A 4YHJA 5I0BA 4RIWA 4ANOA 2QC6A 3COKA 4WO5A 1MQBA 3PJ1A 5AUTA 2WMUA 4MYGA 2BZHB 4ZSLA 4AZSA 3GT8A 4ITHA 5EW9A 4AN9A 4BRXA 4S33A 2VTAA 3OWJA 4WHZA 4R7BA 2Z7RA 2B53A 3F61A 2UZWE 1F5QA 3I4BA 4YZCA 4E20A 4BC6A 3QRIA 4F63A 5ITAA 3VHKA 4AGUA 3AC5A 2WMTA 1JKTA 3EN6A 3NUNA 1PMNA 3CTHA 4TT7A 2PZ5A 5EYCA 4RIXA 1JQHA 3UQCA 4LGHA 5C27A 1AQ1A 2CGWA 2FSOX 2BAKA 3MTFA 3OFMA 3BHYA 2BILB 2PVHA 4E3CA 3R22A 4FK6A 3REPA 5CF5A 1OBDA 2WGJA 3P7CA 3ZZWA 3R63A 4AZVA 5A4QA 2W7XA 5AAFA 2JITA 3UVRA 1VZOA 2WMVA 3AC8A 5CSPA 3U87A 3MVHA 4O7WA 2W1HA 3E62A 1CMKE 3P7BA 3HRFA 2Z7QA 4PMSA 4UZDA 5H8BA 4MF0A 4DAWA 1RJBA 1YOMA 3BE9A 4YO4A 4RX8A 1IRKA 2GNLA 4YP8A 5IH6A 1REKA 3GFWA 3GOPA 2ITTA 2QU5A 1NXKA 3F9NA 4MKCA 3F5UA 3FZOA 3GENA 3PUPA 3R9DA 3U6HA 2EXMA 3QF9A 3M1SA 3ALOA 2V7AA 2YM4A 4X2KA 3FQSA 4AA0A 4AN3A 4CMTA 5J87A 2WQEA 2ZV8A 5JFXA 1JKSA 4RZWA 2P55A 1PF8A 3R7IA 4JI9A 2ZB1A 4HPTE 3BX5A 3TV4A 3NVKI 3PJCA 4DFUA 3VUDA 3CC6A 4IZYA 1MRVA 2QO9A 1OIYA 4FV4A 3TJDA 2F4JA 4FZDB 3NNXA 3FQHA 4FSMA 4J99A 4WOVA 4NTSA 4ZP5A 1ZLTA 5TT7A 3SLSA 3DJ6A 5I9WA 3FLQA 3QBNA 2ZMDA 4JOAA 3FHRA 3IW8A 1RDQE 4PNIA 4K1BA 2FH9A 1P14A 3RM6A 4JX3A 5CEQA 5T6KA 1VYWA 2WMXA 3VAPA 5IDPA 3QRKA 4IB3A 2YM8A 2ETMA 3QU0A 4HOKA 4K2RA 4NKSA 4L68A 1XBBA 3GC9A 4H36A 4EZ5A 3Q9WA 3GP0A 4FX3A 4L00A 4CKIA 4D1SA 2XYNA 2C6MA 4QMVA 3RZBA 3VS3A 3WZKA 5GZAA 3SW7A 1DAWA 4M0YA 2W1GA 4WT6A 3LLAA 5BVWA 2W05A 3NIEA 4TWPA 4KABA 4FKIA 1U4DA 3TXOA 3UG1A 1PXIA 2BHEA 5FG8A 2Y0AA 2GDOA 3TL8A 4PNKA 2HXLA 4CFXA 4F6SA 1H1QA 2JKKA 2C3IB 1JBPE 1B39A 3NUSA 3FMEA 1PXOA 5C26A 5GIOE 2VX0A 4OBQA 5AM6A 4ZSAA 3LMHA 2X7OA 1YI4A 5IUGA 4JX7A 3GCUA 4DINA 2UVZA 3R73A 2G15A 3OUNB 4FVRA 1Q24A 2C5NA 3K5UA 2XCKA 3PYYA 5AP7A 4RVKA 3I60A 4QYYA 4YC6A 4F0GA 1PXJA 4XG4A 2XEYA 2QKRA 2UW8A 4CLJA 4BTMA 4BCHA 4YSJA 2KTYA 1OECA 2RFNA 4FZFB 5KMJA 2ZM4A 3LCDA 3QWKA 5AIRA 1ZWSA 3GCSA 2HWPA 2UZNA 4HGSA 2ONLA 3CBLA 3LXNA 4YJUA 2ZVAA 4IB5A 2IZRA 4II5A 4F9YA 2ZMCA 4G5PA 2I0HA 2X8DA 5CNOA 4QMNA 1B6CB 3D9VA 4V05A 2VN9A 4BZNA 4DFBA 2HY81 4O6LA 3FMDA 5BUJA 4E6QA 3O23A 5EG3A 5C9CA 3UOLA 4E4XA 3GI3A 5JGAA 4FEXA 3EB0A 4FIFA 1U46A 4C4EA 2PWLA 4UZHA 3FWQA 4ASZA 3BEAA 3QGYA 5LWNA 4JBOA 3DBQA 4M7IA 2J5EA 4X3FB 3ROCA 3TACA 3UNZA 5AP2A 3D83A 3R28A 2WEIA 4BDIA 4C7TA 1Q8WA 2XKFA 4ZLZA 4GKIA 3QQFA 4MF1A 1ZYDA 3A7IA 3DXQA 2IWIA 4YHFA 4A07A 2OFUA 2YCRA 4E5WA 2WQBA 4DBNA 2IZUA 3TZ8A 1GZKA 1SM2A 1TQIA 5FEDA 2VGOA 1WVXA 4IBMA 2XJ2A 4UB7A 2PU8A 3NUPA 5JFWA 2WOTA 3EIDA 5E8XA 4ASXA 5LARA 4D2SA 3NX8A 4CMOA 4QMSA 5E90A 4C3PA 2G2HA 5A9UA 4MBLA 5C01A 2QOCA 2W96B 2X7GA 4JNWA 4RBLA 2XIZA 4LOOA 4FSNA 4MXZA 2CCIA 3QLGA 4YLJA 4DEGA 3O8UA 3KRRA 3OCTA 4I22A 5DR9A 5I4NA 2YA9A 4FKQA 4YBKA 4FTRA 4LGDA 1P4OA 4ACHA 1YXTA 4X6RA 3VBXA 5JN2A 3QYZA 4EOLA 1GAGA 4RX5A 2PMOX 5D7VA 2PUPA 4LMNA 4AP7A 5IA4A 3NUYA 1JNKA 3S00A 3FI4A 3PXZA 2XK6A 3VWAA 1UKIA 3TN8A 2R3QA 1WCCA 2ZDUA 3Q4ZA 4AW1A 4CXAA 5K5XA 3QQKA 4NT4A 4U7ZA 1OKWA 2QLUA 3Q5ZA 4Y85A 3FYKX 4ANBA 2GTNA 3ZUVA 4BL1A 4PX6A 2RIOA 3D7TA 1J3HA 4FV6A 4DGGA 4FNWA 3HDNA 2G2FA 3ZLYA 4U97A 2JBPA 3DS6A 2RFSA 4UBAA 3GU5A 3SW4A 4JLCA 5CTPA 3LIJA 3OP5A 1R3CA 5AP4A 3P0MA 2HZNA 4H3BA 3UP2A 3L9PA 4USDA 3W2OA 1AGWA 4FV3A 5ETCA 4E6CA 1KE5A 2R3OA 5AUWA 4HCTA 4EHEA 3W16A 4EH5A 4HCVA 4KSPA 4RJ5A 4WG3A 3G90X 2VO7A 4I0RA 4CFVA 1FPUA 5EFQA 3CS9A 3VUTA 2J0MB 4YPSA 3GVUA 4WA9A 4XV2A 5IZFA 5AP6A 4R3RA 2QNJA 4GVJA 2XZSA 3FLYA 4IDTA 4W9XA 3CQEA 3ZFXA 5JSMA 1A9UA 2C5OA 4KBKA 4EKKA 4KA3A 3UYTA 3QD3A 1IASA 4MXXA 3QXOA 2B54A 2HY0A 3OF0A 5CT7A 2E9UA 1YKRA 2IVVA 1SVGA 4EKLA 5JGDA 2GU8A 2BRMA 4G16A 4X3FC 2JKMA 5CU0A 5GINE 5HICA 4AGCA 2VX1A 4X2GA 5CSHA 3ORTA 2BFXA 5J5SA 2R3JA 4NM5A 5EHOA 4RPVA 3DLZA 1QPCA 5AR4A 4Q2AA 4AOTA 1JLUE 4L7FA 3UGCA 3A7FA 2BRNA 4L53A 4CD0A 2C3KA 3O7LD 4G9RA 4HYSA 4EOPA 3PP0A 5DT3A 1YRPA 4BGHA 1WBOA 4Z7HA 5TF9A 4KIKB 3H10A 3L1SA 4BDBA 3UIUA 1Q99A 4FEQA 3N4UA 4ERWA 3HLLA 4KRDA 3OVVA 4QO9A 5CAOA 4XNEA 4B8MA 3GXLA 5D1JA 3U4WA 4ASEA 4K77A 4QOXA 3RAHA 1Q3DA 4IVDA 5JZJA 4QP3A 3UNKA 1CSNA 2ZYBA 2W5HA 4DT9A 4PPAA 2B1PA 3MYGA 3MN3A 4FK3A 3V51A 3RZFA 4CKRA 4GJ3A 5GJGA 4JDHA 5K3YA 3VBYA 2ITPA 1KOBA 5CU2A 4NKAA 3ZSIA 3Q2MA 2WELA 4K8AA 2X4FA 5HVJA 3RMFA 4AZEA 3EQCA 3BWFA 5EI8A 4FIJA 1M2PA 3BYVA 2CDZA 3OTVA 5TO8A 3CPBA 5AJQA 2BUJA 2R3RA 4WUAA 4EOOA 3OG7A 3QA8A 4DFNA 4HGLA 2WD1A 2WMWA 3Q2JA 4O7VA 4I24A 3AD6A 1YVJA 2GFCA 5IQCA 3D5XA 5AX3A 3VNTA 2UZOA 3QC9A 2IZSA 4S30A 5M56A 3PJ2A 5EYDA 3ZRKA 1FVVA 1OM1A 3HV7A 3IKAA 3KCFA 1WVYA 5CF8A 3MESA 5L2WA 4QPSA 4KIPA 4DT8A 4I23A 3JVRA 4TRLA 3W2RA 1CKJA 2XYUA 5IUHA 3I79A 2X6DA 4I21A 3VS1A 5IU2A 3KVWA 4C02A 4F7LA 4G34A 3PWDA 4EWHA 4O22A 2EB3A 2A0CX 3UC3A 2AYPA 4C4JA 1YI3A 2GSFA 3NDMA 3KFAA 1MQ4A 3FYJX 2YLEA 1WBWA 4FBXA 3C5IA 2JLDA 4MXYA 4RWIA 4TWOA 4FV7A 4PPBA 5ANJA 4QT1A 3QTXA 3V8TA 4BDGA 5KMMA 4Z9LA 3DB8A 3E3BX 1QL6A 2VUWA 2P0CA 4MQ1A 1M2QA 5DT4A 3EQHA 3TIZA 2W9ZB 2VWXA 5JFVA 3TNWA 4DTBA 3F7WA 3RALA 4FKLA 3OCGA 4L46A 3FDNA 4HVHA 2XCHA 4YJRA 1QPEA 5AV3A 4M84A 3POZA 3FMLA 2J2IB 5E8YA 4YLKA 5J7HA 2IVUA 4KIQA 4NM3A 3UE4A 3G51A 3FSFA 3KB7A 5EHYA 3MY1A 3DNDA 3EHAA 2XNNA 1DAYA 3LMGA 1LUFA 4E8AA 3EN9A 3KQ7A 3JY0A 1W98A 2OJJA 4PL5A 2RFDA 4IW0A 3DKCA 2HAKA 2YJSA 3IW4A 2QLQA 2O63A 2YIXA 4OR5A 5EQPA 3JS2A 3AC4A 4O0TA 4KSQA 4XRLA 4XH6A 3ULZA 5LVOA 2C3JA 4S31A 4A9TA 1M7NA 4UMTA 4ITIA 4YU2A 4X2NA 3DGKA 3AOXA 3LFEA 2OSCA 2PVYA 3H4JA 2XB7A 4TKSA 3WYYA 4ANSA 1PXPA 4TYHB 2OK1A 4RLKA 3WBLA 4KWPA 5FRIA 2GHLA 3DPKA 3Q3BA 4JRVA 4BICA 1JSUA 3BCEA 3FMNA 3HECA 3QLFA 1DM2A 1R1WA 3S4QA 3V6SA 4QQCA 5M44A 2W1FA 3P86A 4I5MA 2YIQA 5HTCA 1ZYLA 2I40A 1REJA 2UW9A 4O2ZA 4DTKA 4U45A 1KUTA 3COHA 2XNEA 2JIIA 5G6VA 3IECA 1GZNA 1YHVA 2RF9A 5HNBA 4IFCA 5BX0A 4G17A 2E9PA 4ZSJA 1AD5A 4YMJA 3R9RA 2R5TA 3ORKA 4GYGA 4AS0A 4F6WA 3BZ3A 3LZBA 4S2ZA 4KB8A 4YC8A 3BGZA 4ZSGA 4CKJA 4QMTA 3IW5A 4ZTRA 1V1KA 3OC1A 1YWVA 3S2PA 1U5QA 1PHKA 2WMRA 4I4FA 4O7ZA 1Q8UA 2HZIA 4KKEA 5IQFA 5B2LA 3Q4TA 3NEWA 5DRBA 3FUPA 4AW5A 3R9HA 5HX8A 4D9TA 3RHXA 4QMMA 4GK3A 2UZTA 5M4FA 4ANQA 1YQJA 3NW5A 4K0YA 2GCDA 4FTUA 4G3DA 3BHTA 4MBIA 1ZMUA 3NSZA 4XP0A 5DH3A 4GG7A 4FMQA 2WAJA 4AZFA 4XLIA 3HAVA 2Q0NA 3MWUA 3OD6X 3OXZA 4AA5A 5BYYA 2QHNA 2YDIA 4DEEA 3A7HA 5KMKA 2Y6MA 4IHPA 3NZ0A 4MX9A 4IE9A 5J9LA 1YXSA 4XBUA 3VIDA 4XG9A 2WQOA 1J7LA 3FBVA 3HMMA 4RIWB 1TKIA 2PTKA 4XJ0A 4OT5A 2BROA 4F6UA 2JEDA 1LEZA 4I5HA 4C58A 2J5FA 4ONAA 3U6IA 4X0MA 5LMKC 3FC2A 3EZVA 4UMPA 2OZAA 5JRSA 1OUYA 4IVAA 1ZZLA 4FTJA 5HI2A 3EFKA 2PVNA 2PUUA 3ZFMA 4DH3A 2PVKA 1H24A 3EKKA 4CCBA 4CG8A 2C5VA 2J0LA 4EYJA 3NRMA 5IH4A 4DA5A 3N9XA 2ITUA 1ZOHA 2PZRA 2PMIA 4L43A 3QYWA 3ZU7A 4CYIA 4I93A 5LMAA 3VN9A 2PVJA 2QR7A 1WZYA 4J95A 4L3LA 4YC3A 4NW5A 4ERKA 5FM3A 3H9FA 2XIYA 1OGUA 2C1BA 2P2HA 4RSSA 3H0ZA 4DH7A 2Y8OA 3ZEPA 4DEBA 3R8PA 4B99A 3GNIB 2X39A 2BDFA 3GCPA 4FT7A 4U6RA 4WRGA 4IJPA 3MA6A 1OITA 4YNOA 2FUMA 4FIHA 2NRYA 2UW3A 4BCFA 4DFYA 2PYWA 3VULA 4BFMA 2Z02A 3FZPA 3H0YA 4QP2A 5ANIA 5KMIA 2W1ZA 4C2WA 4HJOA 5LWMA 2HZ4A 1ZYCA 4YGAA 1QPDA 3E93A 1UA2A 3NR9A 4GSBA 5BMSA 3SKCA 2FSLX 4I0TA 4QYEA 4CLIA 5BVFA 3I1AA 5C1QB 2X2MA 4HYIA 2OO8X 4BIBA 2E9OA 4DH8A 4O0RA 3V04A 5IQDA 4L9IA 4RX7A 5AFVA 4HZRA 4FKSA 4AW2A 4DBXA 3G6GA 2GNHA 5EDQA 5HLWA 3WIKA 4QMLA 4S34A 5CVFA 2FA2A 2F57A 5A4TA 5E91A 1YI6A 2WXVA 3KF7A 3ELJA 3QA0A 3FAAA 5CANA 3TDWA 4FA2A 2XJ0A 1XQZA 3MBLA 4I41A 2YACA 4X2JA 5KMLA 2F2CB 3IS5A 4UALA 4D2WA 4AE9A 3R01A 4RJ3A 3UQGA 4IWQA 2UZEA 3C13A 1XH6A 4C34A 3SXSA 3KEXA 4L42A 3PTGA 2J50A 4RIYB 4QMXA 3QTUA 4LRMA 4EJNA 2IVTA 2VX3A 1P4FA 3FXXA 1VYZA 4FV9A 4X6QC 4A9SA 4BB4A 1J91A 2VO3A 3TZ7A 4D1XA 4AA4A 5HBJA 5LVMA 4W4YA 1R0EA 3PVGA 2X2KA 2NP8A 3PJ3A 3CP9A 4U9AA 5EW3A 5IDNA 2WFYA 1U54A 4X2FA 3NYOA 2YWPA 2XK4A 1Q3WA 2XIXA 4TNBA 1BKXA 3TG1A 4GUBA 3EYGA 5F9EA 4FSYA 3FQEA 4NU1A 2LGCA 5BMMA 2YWVA 4N6YA 1L3RE 2B52A 2WO6A 4LOPA 4DHFA 4RVTA 4Y73A 3A61A 1GOLA 3BHHA 2C6LA 3R7VA 3V01A 4C36A 4FUXA 2C1AA 2YIRA 2CGUA 1G8SA 2GTMA 3DXPA 5E9EA 3OXIA 4X21A 3S95A 4GFMA 3UJGA 5C8NA 1Y91A 2GNGA 4Q5HA 3EZRA 4EOSA 1IAHA 4GU9A 4BCJA 4FSWA 5GNKA 3TT0A 5J1WA 3TTJA 4JIAA 2VTOA 3I6UA 4G3CA 5CF6A 4E73A 4ENXA 3DBCA 5DMZA 4KS7A 4CTBA 3QL8A 3UVQA 2I0YA 2OF4A 3QQLA 3MJ1A 4G2FA 4D9UA 4F65A 5FDPA 5HG5A 3NAYA 3Q5IA 3O2MA 2XKDA 4YPDA 3R8UA 5EM6A 3QTWA 4GH2A 3MFRA 3TUBA 3O8PA 5E8ZA 5KZ0A 5L6WL 4O84A 2YDKA 1ZYSA 4EC8A 2QOKA 1YXUA 2ZV7A 3II5A 4ZEGA 3DTCA 4N6ZA 4IC7A 5HNIX 1BYGA 4PWNA 2OU7A 4QPAA 4QQJA 3FEGA 3GOKA 3LFBA 3MVLA 4BF2A 2XUUA 1Q61A 2GQRA 4QP7A 4X7QA 1OB3A 3PXFA 1LEWA 4FEUA 3ZLXA 2NO3A 4HVIA 4FV8A 2C6DA 5AUVA 2I7QA 3V5LA 3DTWA 3GCQA 4FKWA 2HELA 3ZFYA 3A7JA 2XMYA 3BEGA 2ZM3A 3O71A 4QYHA 3NW6A 1KSWA 1YDRE 4JJRA 1WAKA 4RVMA 5A6OA 1FVRA 3P9JA 4FE2A 2BPMA 4FTLA 1E9HA 4EH2A 4IM2A 2H96A 2J0JA 3F82A 3IGGA 4FKGA 4XUFA 4P90A 2WOUA 1NY3A 4XG2A 1X8BA 4Y83A 3DKGA 4B7TA 4Z55A 3QUEA 4GS6A 2JBOA 4EOKA 2Y9QA 3TIYA 3UQFA 3MY0A 5M08A 4R6VA 2BAJA 4EH4A 3QQUA 4FT5A 4HNFA 3ZDIA 3ZSHA 2UZUE 1CM8A 2W0JA 4GK2A 5J79A 4IAYA 3ZEWA 3WZEA 4CT1A 3QWJA 4H1MA 4QQ5A 3ATSA 2YCFA 3EYHA 3KGAA 2QOBA 3M42A 4LM5A 3KXMA 4OTWA 4I4EA 4CSVA 5IF1A 4OAUC 2W9FB 3ZRMA 4JRNA 1F0QA 2RSVA 4I6FA 3BU5A 4HYUA 3TNIA 1EH4A 2KULA 2YM3A 4PDOA 5HX6A 1FBNA 3MB7A 4JR7A 5DOSA 4ZLYA 4BCOA 4EH9A 1T46A 4KIOA 4XMOA 3VS0A 3CJGA 4X3JA 3C50A 4BKJA 2WQMA 2ITYA 1I09A 3Q9YA 4QP4A 4LV5A 1IEPA 3RPVA 3F5PA 4L01A 3V5QA 2VTJA 2W1IA 4LGGA 3QZHA 5EYMA 4FKVA 3KC3A 4A4OA 4IEBA 5HD4A 3D7TB 5D9HA 1YDSE 4FTOA 4EOMA 4U40A 2DUVA 5ETAA 2JAMA 5DA3A 5I9UA 4IX5A 1Z9XA 3EWHA 4GJ2A 2O2UA 2FVDA 2XKCA 3NYNA 3ZXZA 3UO5A 3IOKA 2PVMA 2JDSA 3VBVA 3DK7A 3PZHA 1KE7A 2R3GA 4YNEA 4IAAA 3KREA 4OBOA 5DEYA 4M8TA 3C7QA 4IZ5A 5ANEA 5L2TA 1V0PA 5IQEA 4J8MA 2C6KA 2RL5A 4JIKA 4BBMA 1OPLA 1GJOA 3OEFX 4YJNA 4AN2A 3T3VA 1A06A 2CLXA 2OLCA 5KCVA 4ACMA 2JD5A 2VWBA 5D7AA 1J1CA 4O1OA 3BGPA 4EOQA 4C0TA 2YABA 5KKRB 3LPBA 5M55A 3PA5A 3RGFA 4BTKA 4JDJA 4YZMA 2WTDA 4RWJA 5EM8A 1H00A 3SRVA 3ZXTA 5HIEA 3ACJA 5A6NA 3D2IA 3WIGA 4EORA 3JY9A 2ITZA 1BX6A 4PTCA 4PMTA 5JZNA 4J7BA 3KULB 3K2LA 4RJ7A 5KO1A 3BPRA 4FVQA 1XBCA 3QZGA 2A1AB 5LQFA 1LP4A 1NVRA 4G31A 1XJDA 4P2KA 4BCKA 5L6OA 3GC0A 4P5ZA 3SDJA 3U9NA 1W83A 2AC3A 4BYIA 5CAUA 5A4LA 4FZ6A 4OUCA 1CDKA 2Z7LA 3A4OX 4M13A 4XBRA 3FZRA 1PMUA 3LCSA 4NIFA 4JG8A 3GQIA 3LAUA 1SZMA 4L52A 3NYXA 2A27A 3VUIA 3WF6A 3PVUA 4BHNA 4ACCA 5EHLA 4PL4A 4DEIA 1A48A 3DZQA 4C57A 3QAME 2W4OA 5HVKA 2YHVA 3ZM9A 4HVGA 3GB2A 3CQWA 2JDVA 3E87A 5EQYA 4V01A 4F7JA 3SC1A 3G15A 2OBJA 4OLIA 5IQGA 2OIDA 4O81A 3R30A 2X6EA 2XKEA 3PVBA 2ERZE 1Y6AA 4AGWA 2PL0A 4YJTA 4PPCA 4NH1A 3U4UA 2E9NA 3SXRA 4U41A 3AT4A 5F95A 3K54A 2EUFB 3UOKA 4ANMA 3KXHA 4N70A 3F2RA 4O7RA 5HZNA 2NNWB 3LFCA 4LOQA 3O51A 5M57A 5HG7A 3LM0A 4KKHA 5AR5A 2CN8A 4ZMEA 3QCYA 2YZLA 3V6RA 5M09A 3U55A 3TZ9A 1LPUA 4FKTA 5HHWA 4W4WA 3O17A 4K6ZA 2UV2A 3D2KA 4FL2A 4E5BA 4DGMA 4U5JA 4IMYA 4L7SA 1Y6BA 1OBGA 2W1DA 1MRUA 2AC5A 2QO2A 2CGVA 3LQ8A 5EM5A 2LAVA 2CCHA 1CKIA 2OXYA 3RK7A 4LI5A 3W2CA 4YZNA 3HV4A 5L8JA 4D28A 2VTTA 3P79A 4JR3A 4E6DA 5KMNA 2XA4A 4R78A 4YTHA 3V8SA 4QP6A 2JFMA 3BYUA 3QGWA 4YTIA 4BCMA 4C62A 1ZY4A 4ZMFA 2GS2A 3MVMA 2R4BA 3UO6A 4O0UA 3LXLA 2QKWB 4FT0A 4QMUA 3IDPA 4Q5EA 1WVWA 5ANDA 3UIMA 2X9FA 2I6LA 5AX9A 5E8SA 3VVHA 3F3VA 4M14A 4MWIA 5KE0A 4AGDA 3OWLA 5FLFA 1PRYA 2VNYA 3GFEA 3ZBXA 3IDCA 4RJ4A 3UOHA 3Q4CA 3ZCLA 3UOJA 2W1CA 2QODA 2GNIA 2VTLA 3F3TA 5DBXA 4DFZE 4Y72A 5M06A 1GY3A 5T3QA 2GMXA 1FQ1B 2J9MA 3HDMA 1GZOA 5CQUA 1FMOE 4H39A 2Q0BA 1PXKA 2IW6A 3ZTXA 1TQMA 3A62A 3MGYA 3W2PA 3EQDA 5BVOA 4ZS4A 4FZAB 4TZRA 4EQCA 3R7GA 4G3FA 4GU6A 1HOWA 3IK3A 1VR2A 5HG8A 2B55A 3HAMA 1UVRA 3IPHA 3MPMA 2GS6A 4O0YA 4I6HA 3GU4A 3QTSA 4EBVA 2CN5A 2JIUA 4PUZA 4CEGA 2C47A 4DITA 4ZY4A 5C4LA 4L67A 4UWBA 1UNHA 5F94A 5FEQA 4AW0A 1SYKA 3W1FA 2BVAA 5HU3A 1R39A 2UVYA 4CG9A 3RWQA 1PYXA 3FV8A 1G8AA 3VUGA 1ZMVA 1JSVA 3GGFA 2QVSE 4XYFA 3VO3A 3HL7A 4ZSEA 1H4LA 5DRDA 3HMNA 3WI6A 2YM7A 3R1YA 4M97A 4OAVB 2XEZA 4N0SA 2YISA 3UYSA 3LJ1A 4EJ7A 3EFLA 3DAKA 3V3VA 4DLIA 4C4HA 2QCSA 3FXZA 4DCEA 4BR3A 3HRBA 3FL4A 3MW1A 5HO7A 4WNPA 5DR2A 4WD5A 3ZLWA 5IMXA 4FTAA 1O6KA 4D2PA 3E88A 2JGZA 4XV1A 3EN4A 3N51A 2JDRA 5HO6A 4FNYA 3DB6A 4PDYA 3SG8A 2P3GX 3DDQA 5ANOA 3KXZA 4XLVA 4CCUA 4F7SA 4XV3A 4EK5A 2VWIA 3W2SA 5BQ0A 3TNHA 5AM7A 2UW0A 4AF3A 3C4CA 1M7QA 1Y57A 3KRJA 3QFVA 5CI7A 5TOZA 3UBDA 4ZTMA 4FICA 4JXFA 4MD8E 4M0ZA 5D11A 4RT7A 5DIAA 4AX8A 5CEKA 3KXNA 3ORNA 4MNEA 2XS0A 3PIYA 1TQPA 4FSUA 2C3LA 4MD9E 5I3RA 1GIIA 4BDHA 4CZUA 4HGTA 5AAEA 2W06A 4F1MA 4I1ZA 5EOBA 1OPJA 5CU6A 1DI9A 3LMIA 1OL7A 1B38A 4FKOA 2XM9A 2V0DA 3E63A 3ZLSA 4O7YA 2QR8A 2BFYA 3A8XA 4AFEA 2WMQA 3EL8A 3OCBA 4IH8A 2SRCA 4QPMA 3R04A 4AZTA 4BDKA 1NT2A 4F9WA 3MH0A 5I9YA 4O0VA 2IN6A 4MVFA 1K9AA 4FV1A 5G1XA 2X8IA 5TKDA 3PSDA 4G1WA 3MFTA 2OZAB 3D5UA 2C6IA 4BBFA 5LXMA 3OHTA 5CU4A 4N4SA 5BYZA 4UY9A 4USEA 2J7TA 4R7HA 3C4ZA 1RW8A 3K3JA 5IA3A 2RGPA 5HCXA 1J7UA 4F4PA 3GC8A 3QKLA 3A4PA 3DJ7A 3G2FA 4NM0A 5FQDC 4OTHA 4EK8A 3P08A 4LG4A 5AV2A 3DBEA 4EHZA 3TV6A 3A7GA 4RMZA 2H6DA 4BDDA 5A4EA 4U3ZA 1W82A 3VS5A 4ACDA 2PSQA 1GNGA 4FIIA 3RK5A 5K5NA 3VQHA 4OGRA 3EQBA 4O82A 5CZHA 2VWZA 1JPAA 2YM5A 4KD1A 4UV0A 2OZOA 4D4YA 3LFAA 4P5QA 3AD4A 2OW3A 2PZPA 3LXKA 4BCQA 4EK4A 3I0OA 2VWWA 3D4QA 2OH4A 2YZAA 1YXXA 3FZSA 4CZTA 1S9IA 4CRSA 2F7XE 4JVGA 3G0EA 4QNYA 5HGIA 4LFIA 5CEMA 2HK5A 4I6QA 3BYOA 4Q9SA 3Q60A 3FLWA 3ATTA 4FKRA 2GNFA 4NTTA 3R2YA 1VEBA 4MQ2A 1JVPP 4ZS0A 3NCGA 5L3AA 3BQRA 3PIXA 2PUNA 4KNBA 4GEOA 4FYNA 1FGKA 4HNIA 3CIKA 3TWJA 4P4CA 1NA7A 4QTAA 4JAIA 3PVWA 2WB8A 5KBQA 4HPUE 2WIHA 3Q96A 5K9IA 4IJ9A 4X3FA 2JDOA 3LFNA 3KKVA 5CY3A 3IW7A 2WTJA 2VWYA 5FWKK 3OOGA 4BI1A 4J97A 5FXQA 3QD0A 4MD7E 5CVGA 3PY3A 4AXAA 5HOAA 1L8TA 2ITOA 4HZSA 1RE8A 3H3CA 4IDVA 2OXXA 3TZMA 4AU8A 3KN6A 4D0WA 5LJJA 5J1VA 4GT5A 5L4QA 4OW8A 1H27A 4WBBB 2PE2A 3Q9XA 4C37A 3FPMA 5J8IA 1WBNA 1IA9A 2WTVA 3POOA 3CE3A 4KBCA 4M69B 3ENHA 1YW2A 5B2KA 2ZAZA 2ZM1A 3ZYAA 4TW9A 2VZ6A 2RKUA 3O96A 4UYNA 5ANKA 1U54B 1KV2A 3IOPA 3JXWA 3F3ZA 3BYSA 4FKUA 5E1EA 4KUJA 5CASA 4DG3E 2XBJA 2BRBA 4ZY6A 2C4GA 3VS7A 3E3PA 1IG1A 4USFA 4BDCA 3PXKA 4GMYA 4BDJA 4V0GB 2VO0A 3OEZA 3GU6A 3DA6A 5FP6A 4GCJA 4NK9A 2X81A 3DNEA 3OOMA 2BALA 4AAAA 4TYEA 2WHBA 3CD3A 2VV9A 5JMSA 3L9MA 4UYAA 2X8EA 2YIWA 3DBFA 3FSKA 3LW0A 2R3MA 4FKJA 5ACKA 2ITWA 4BIDA 4BVUA 5D41A 2QG5A 3DBDA 3NUAA 4CFMA 5JH6A 3FC1X 2PMNX 4GFGA 4YJVA 4BCGA 4RA4A 4JBQA 5BUIA 3TTIA 1URWA 5IMEA 1OKZA 2UVXA 3C0HA 3OBJA 3QZFA 4IM3A 3WF5A 3WE4A 2R3LA 4AFJA 3R2BA 2BIKB 3BU6A 2OJGA 5TE0A 4BTFA 3L9LA 4R1YA 3W18A 4H3PA 4NUSA 4LRKA 4Z3VA 3RTPA 2VGPA 1JWHA 4H05A 3TKHA 4M67A 4DEDA 4O91A 1UU8A 5CU3A 2VTMA 2YCQA 3BE2A 2YIYA 3CLYA 3EQGA 3FLNC 4OTGA 4WUNA 3ZDUA 4C33A 4YURA 2A2AA 4YJQA 4DYMA 2UZVA 2R3HA 2H9VA 3MIAA 4U0IA 5BVKA 3UNJA 3ZS5A 4A9YA 4GIIA 3HMOA 3I7CA 4CYJA 5EQEA 5BYLA 3F6XA 5F4NA 4AZWA 4EEVA 3FI8A 3DQWA 2R64A 4IXPA 2XRWA 1PKGA 4A4LA 1YDTE 4I6BA 4EQMA 2WTWA 3SQQA 3W32A 3VJNA 5DGZA 3QKMA 2HZ0A 3QCXA 3R7YA 1MRYA 1UV5A 2WMSA 3EL7A 5GZ9A 3TCPA 4J71A 3HA6A 1QPJA 3DV3A 1ZZ2A 2O0UA 4IAZA 5CSXA 3FHIA 4XV9A 4QTEA 3ODYX 4O0SA 4NCTC 1YOJA 2G9XA 5LVPA 1CTPE 2VTSA 3MJ2A 3D15A 5EYKA 1KOAA 2OJ9A 3CKWA 4K11A 4I3ZA 4GT4A 4QYGA 1E1VA 4RIXB 4BZOA 4ARKA 4GL9A 3WILA 3PRIA 4LL5A 4UX9A 1SMHA 4D5KA 3SGCA 4M12A 3KXXA 4YBJA 5AR8A 5HVYA 3WOWA 2Y4IB 3PZEA 3D14A 3R9NA 4OTRA 2GS7A 3WF8A 4ALVA 2PZYA 4EONA 1XH5A 3RPRA 1ZRZA 3HX4A 1H0WA 3RPSA 2CGXA 4YJOA 4R8QA 3I81A 3Q32A 4MXOA 1RQQA 2QONA 4R7IA 3RVGA 3OMVA 4H1JA 2FSMX 4GKHA 3A2CA 3BU3A 3RK9A 2UZLA 2OF2A 3EQRA 2HOGA 1XH4A 4BDEA 4C35A 4IX4A 1U59A 2GHMA 3QCSA 4YJSA 4F09A 4EYMA 5HBHA 4BTJA 4PQNA 4D2VA 2H34A 1BI7A 3VQUA 4AUAA 2ETKA 3P7AA 2O5KA 5EDPA 5A54A 3MY5A 4FG8A 4NYEA 3ACKA 5IUIA 4MEDA 3ZUUA 5JFSA 2Y7JA 3B8QA 3A8WA 3MH1A 1PJKA 4U3YA 3KY2A 2CNVA 4RZVA 2UW5A 5H8GA 1XH7A 3NNVA 3Q6UA 4FEVA 3NCZA 3E92A 3FY0A 5B2MA 3OTUA 3PFQA 5ACBC 1F3MC 1Q5KA 2J0IA 3PXYA 3AC1A 5HKMA 3ANRA 3F5GA 4R1VA 5FXRA 4D55A 4IWDA 5LVLA 3HEGA 3LM5A 1ZOGA 4AQCA 2OIQA 3LHJA 4NW6A 4UMUA 3UTOA 3KRXA 4G3GA 4UN0C 3SVVA 3QQHA 3U8WA 2PVFA 4KINA 4BZDA 4FV5A 3IDBA 4RG0A 2XF0A 4LMUA 4U81A 5KHXA 5JRQA 1NVQA 3HA8A 3SRVB 4E5AX 5K4JA 1Q97A 5I9ZA 3VUMA 4WKQA 4AOIA 5HLNA 3H9RA 4CVAA 3HNGA 3R00A 3D7ZA 1FVTA 4CT2A 3KF4A 3KMMA 3MSSA 5IQIA 3TDVA 5ETIA 2QU6A 5AP5A 2XK8A 5DI1A 3PXQA 5LMKA 3KA0A 1XH8A 5EKOA 4HVDA 5IPJA 5BNJA 5AUUA 5HG9A 2WZJA 3QX4A 3UIXA 3AGMA 4BDAA 2ESMA 3DK6A 5HE0A 3IONA 4FL1A 3TKUA 4R5YA 4XG3A 3BWJA 3R1NA 2A19B 3TM0A 2VD5A 3ANQA 3G6HA 4OTIA 3ORMA 4F9AA 2QURA 4ZAUA 3PA4A 2R3PA 5E8WA 5GIPE 4FUYA 4RWLA 3QUPA 3A99A 5FM2A 4G9CA 4MCVA 3EQPA 3O8TA 4UXQA 4WNOA 3B8RA 4BI0A 2Q83A 5JK3A 3HVCA 2VNWA 3P23A 2GHGA 3TEIA 4A06A 1FGIA 5JEBA 5AA9A 4QNAA 5H8EA 3RPYA 2O8YA 4PL3A 2R7IA 3V5TA 1BL7A 2I0EA 3R7OA 3MPTA 3ULIA 4ANLA 4FODA 5J9ZA 3UDBA 3CGFA 4APCA 4HYHA 2NPQA 4BCIA 4IWOA 4BHZA 4E1ZA 5BUEA 1LR4A 4DEHA 4TYHA 4B9DA 4IWPA 4CNHA 4JG7A 5CAPA 1SNXA 5T68A 4AACA 2E9VA 4OTPA 1Q8ZA 4UWCA 2C0OA 4IC8A 4ANNA 4B4LA 2NRUA 2OJFE 2WMBA 4DH1A 3C1XA 1NVSA 1XO2B 3T9IA 4O7LA 5HTBA 4JDIA 3RHKA 4WNMA 2VTRA 4N57A 1KE6A 1ZY5A 4QQTA 2FGIA 4U8ZA 2PHKA 4C2VA 4DN5A 3NUUA 4XP3A 2C0TA 1YOLA 2UZBA 3CGOA 4YTCA 2QOOA 5IA2A 1JSTA 3LCKA 3KL8A 4XP2A 2IW8A 4EOIA 5CENA 3S3IA 3R6XA 3UO4A 5BVDA 3OW3A 3ZO2A 5I9VA 4EHGA 1PY5A 3R71A 5J95A 2CHLA 3JR1A 4BWPA 3R8MA 4K33A 4O2PA 3CJFA 4I5CA 2IG7A 5DT0A 4RQKA 1SVEA 5CSWA 5BPYA 3IQ7A 3ZHPC 3WZUA 1W8CA 3IGOA 4QTBA 4LUDA 4TTHB 5DPVA 5A3XA 4D4RA 4WNKA 3OW4A 4DC2A 2QO7A 4TPTA 4WSQA 5HESA 2BR1A 2GQGA 3FKOA 3FZ1A 2O3PA 4IACA 4ORKA 2EXEA 2W5AA 4B6LA 2PVRA 1H8FA 1YHSA 4YLLA 4ZJJA 3ZRLA 3MB6A 2XK3A 3QQJA 2VU3A 4NFNA 3T3UA 5A14A 5JGBA 4LUEA 3CY3A 4MAOA 2YJRA 4F9CA 4QMPA 2QOLA 3KCKA 2V22A 4PMPA 2EVAA 2E2BA 5E92A 4IVCA 5FUTA 1UNLA 4QMWA 3NYVA 2F2UA 1UKHA 3I0QA 2JAVA 3HV5A 3C4FA 2FSTX 2XBAA 4MTAA 4C61A 5AADA 3KRWA 3G9LX 2C0IA 3D5VA 3IW6A 4FOCA 2IW9A 4O7NA 2JKQA 2Y6OA 2C6EA 4G5JA 4ID7A 4ZTHA 4EZ7A 3BLQA 4QP8A 4OT6A 5L6PA 4ZZOA 4RRVA 3KMWA 5H9BA 4QMOA 4W4VA 3OT8A 5J7BA 4D2RA 3R7EA 2CNUA 4PF4A 1MUOA 3I5NA 3DY7A 4GVAA 2AUHA 3ERKA 3QUDA 4I20A 5DG5A 4IIRA 5FXSA 2EWAA 4FVPA 5AA8A 1P2AA 4ASDA 1P5EA 3QTRA 4J52A 1PMEA 2EXCX 4B0GA 4XRJA 4RFZA 4YZ9A 3QXPA 3RNIA 3WE8A 2PUIA 1ZYJA 5IQAA 2ZB0A 3GEQA 1ERKA 1WBVA 5GHVA 2Y4PA 3UMXA 1ZAOA 2ONLC 2XNPA 4RIOA 3O7LB 3OS3A 4O0XA 5D10A 4ZK5A 4FTKA 1Z57A 3NMUF 5KZIA 3QZIA 5DNRA 2J4ZA 4QTCA 1APME 4LV8A 5KBRA 1Q62A 4YSMA 5EM7A 4MH7A 1PXNA 4A4XA 1OUKA 4F0FA 5HQ0A 4RJ8A 3PG3A 5GJFA 4AWIA 4HW7A 3PP1A 5CALA 3F3WA 3BIZA 3PXRA 4JT3A 5EH0A 3U54A 3RCJA 3C4XA 4TWNA 4F1OA 4QYFA 5CWZA 3VF9A 4RLLA 4M3QA 1JOWB 4P7EA 2BRHA 4MNEB 4QMZA 5AR7A 3COMA 3Q04A 4DG0E 5AP3A 4IAKA 3UC4A 5IEXA 3LFDA 4NJ3A 1OL6A 3ZBFA 3BLHA 1OI9A 5LOHA 3ORXA 4W8DA 3AC2A 3BELA 3F7ZA 3OXTA 4LRJA 4NZWB 4QP9A 2YAAA 4UMQA 4ALWA 4RIYA 4LYNA 4JBPA 5DE2A 4IVBA 2XRUA 4TYJA 5TR6A 2XNOA 3Q53A 3SOAA 3QKKA 3R8LA 1H1RA 2HWOA 3FL5A 2ERKA 2W4KA 3V5PA 3P5KA 3DJ5A 5HD7A 3QTQA 3AT3A 4CV9A 1SNUA 4EC9A 3AGLA 4HVSA 4RQVA 4E4LA 3Q9ZA 3FMMA 1H28A 1FINA 5M53A 4CGAA 3NAXA 4FT9A 2RFEA 3HKOA 3DDPA 2X1NA 4A7CA 2IO6A 1M17A 2BIYA 4XHKB 4WSYA 4XS2A 4L6QA 5CVHA 3N4VA 4UMRA 1M2RA 3B2TA 1URCA 2YCSA 3DLSA 4LQMA 4WG5A 4ZTQA 5H3QA 3WF9A 5HNGA 3ZO4A 4RJ6A 4WRSA 4B8LA 3FJQE 4E93A 4AOJA 3BKBA 3AQVA 3A60A 4FSQA 4KBAA 4Q9ZA
chains in the Genus database with same CATH superfamily
3NIZA 2JFLA 3C4EA 3F5XA 2B9JA 2QI8A 2QOFA 3GC7A 5HCZA 4CTCA 5L2IA 4DF3A 2OG8A 5EW8A 3RAKA 3BV3A 3WF7A 5HO8A 4CQGA 4D1ZA 1I44A 2R3NA 5M4CA 4EBWA 3ZSGA 1G8JA 3F3UA 2JKOA 4W8EA 5JQ5A 3WZDA 4IQ6A 3ROYA 3SHEA 3FLSA 4DE4A 4MK0A 4ZJVA 4NL0A 2ZV2A 2W5BA 3QC4A 2CKEA 1QMZA 1YWNA 3CTQA 3DXNA 2CJMA 1S9JA 2BMCA 3LQ3A 2BRGA 4GIHA 3PJ8A 3KU2A 5C8MA 4CMUA 3QD2B 1V0BA 4R77A 3LE6A 4C3FA 5AEPA 3NWWA 5K0XA 3LJ2A 4DGLC 2W4JA 1R78A 2P4IA 2YEXA 3ALNA 3EMGA 5FTOA 5AUXA 3GCVA 4RFYA 1E1XA 1XHAA 3LJ0A 5KKRC 1JKLA 5BVNA 2YERA 2F7EE 3ITZA 3NUXA 3QQGA 4O7SA 2UW4A 3ID6C 4FIGA 1YHWA 3R21A 2A4LA 4NM7A 4GFOA 3BYMA 4PV0A 3DQXA 1JAMA 2XNGA 5H2UA 4I94A 3ZM4A 4BCNA 2YN8A 4TWCA 2XIKA 2RG5A 2XVDA 4IADA 3ZMMA 3G9NA 3ORPA 2CKPA 4W4XA 4IAFA 3R8VA 3VC4A 4F70A 1WBPA 2FYSA 3FZTA 3V5WA 5J9YA 2BCJA 3NNUA 4QTDA 3NFFB 3DFAA 3OZ6A 3QALE 2F7ZE 4DCAA 3CCNA 4ZTNA 4D4VA 3JYAA 4I6LA 5GZ8A 2XIRA 2XM8A 2WTKB 3H30A 2VAGA 2XAOA 4BY9E 2DQ7X 4MBJA 3UODA 2PE1A 3F69A 2OI4X 4ACGA 1XR1A 4Y5QA 2XNBA 3DAEA 5HEZA 4F7NA 2ZOQA 2CKOA 4FTTA 1BMKA 1ZARA 3CQUA 3HMPA 4IFGA 2B9HA 4TYGA 5KUPA 1XBAA 3CR0A 3HP5A 3OY1A 2VWUA 3DZOA 4C4IA 2XNMA 3P1AA 3ZC6A 4DHZA 3RNYA 3AC3A 1K3AA 3RBWA 4AT5A 4EH8A 3SG9A 4H58A 2BKZA 2BZJA 3R02A 4M68A 2JC6A 1ZOEA 3CTJA 3FI2A 4TNDA 4E4MA 4YTFA 5CT0A 2YDJA 2R9SA 5FP5A 3LFQA 4OTFA 3PSBA 4L3JA 3BLAA 3PE1A 3HYHA 5HE2A 3BV2A 5K4IA 2VTIA 4RC3A 3UMWA 4E6AA 4EK3A 5FBOA 4JDKA 5CI6A 4O86A 2YAKA 5ICPA 4AT3A 5DVRA 3R1SA 2WNTA 1Y8GA 3O0GA 4DTAA 3TI1A 4IZAA 2OWBA 2QQ7A 3PA3A 2V5QA 3E5AA 1GIJA 5IQBA 2WMAA 4XOYA 5CXHA 4YHTA 3CY2A 3ZUTA 4XG6A 4I0SA 4FIEA 2XANA 3IO7A 4O4BB 4O27B 2C69A 5FTGA 4O38A 5E8VA 3W8LA 4BWXA 4IX3A 3W2QA 3IG7A 3W33A 3QCQA 2EU9A 2XK7A 4BBEA 2G01A 3AT2A 3LCOA 4Y46A 4NSTA 5F20A 3VBTA 1UNGA 4PMMA 2XH5A 3VBQA 5CX9A 3W10A 5EK7A 3BGQA 2G1TA 3ZOSA 2R2PA 3O50A 3AXWA 4IAIA 5AIKA 2F49A 3R0TA 5E8UA 5I3OA 2CNQA 3MV5A 3P4KA 4I5PA 5L8LA 2W17A 3VJOA 1OL1A 5CEOA 2VTPA 3GQLA 3RJCA 2UW7A 1W84A 3MVJA 2X4ZA 3NLBA 2QOHA 3V8WA 3TNQB 4EL9A 4XG7A 3FY2A 2I0VA 4M66A 4U79A 4Y8DA 4EI4A 3QX2A 2CSNA 4NEUA 5DN3A 1O6YA 4U80A 4ZZNA 4LDTA 3ORLA 3UPZA 4G3EA 3VS6A 3UP7A 4F64A 3ENMA 3QHRA 4JBVA 4XCUA 1CKPA 4AG8A 4FF8A 5M4UA 3KULA 1VJYA 3KK9A 3ORIA 1IR3A 5DEWA 5AUZA 3V5JA 3MI9A 5E1SA 5LCKA 4O1PA 3CEKA 4J96A 2PZIA 2I1MA 3Q52A 3QD4A 3DT1A 3UDSA 3CXWA 3C0IA 4APPA 5HE1A 3RINA 4DLJA 4E26A 3LVPA 2GPHA 3EKNA 3H9OA 5IQHA 2PE0A 1O6LA 5CLPA 3G0FA 3W55A 3OWKA 2PULA 2BAQA 3HMIA 2ETRA 2WTKC 4TXCA 4H3QA 4J98A 5DYJA 3PDTA 5HLPA 2HXQA 3D0EA 4K9YA 3PE2A 4O21A 5IA0A 3FMHA 3PY1A 2XP2A 5C03A 2C6OA 4K18A 5EKNA 4V04A 2O64A 1WBSA 1Q8TA 4JQ8A 4RVLA 3DOGA 1TVOA 2IPXA 5CXZA 2PY3A 4EQUA 2X2LA 2V55A 1KE8A 4QRCA 3QHWA 2WIPA 4QMYA 1Y8YA 3KMUA 5KX8A 3AD5A 1MP8A 4OTDA 3QTIA 4DFXE 2GNJA 4J53A 3E7VA 4QP1A 3C51A 1ND4A 3GUBA 2R0UA 4XG8A 5FEEA 5AMNA 4FV2A 4QD6A 3CSVA 4PTEA 4BWKA 5JT2A 3BQCA 1PKDA 2R3FA 4IB1A 3GBZA 2G2IA 5KMOA 2BZIB 2QOIA 1OIRA 5CNNA 5HORA 3SOCA 5L8KA 3I6WA 3EFJA 1WFCA 2WPAA 5AWMA 2HCKA 3TUDA 1HCLA 3FPQA 4QMQA 4JS8A 5IA5A 2ITQA 5F1ZA 1OKVA 3OUKA 3RKBA 4G6OA 5CEIA 1Q4LA 3FE3A 2V7OA 1G3NA 5ETFA 4U44A 1OKYA 3JUHA 4AE6A 4EH7A 2YITA 4FC0A 2C68A 3CKXA 5BV3A 4U42A 5J5TA 2UUEA 4C4GA 2VTQA 1KWPA 2UW6A 3ZO3A 2BTSA 4XEYA 5FD2A 5K0KA 2C30A 5BVEA 2XK9A 4PDPA 4FTIA 2B9IA 3SAYA 2X7FA 3COIA 2QG7A 4O83A 2R3IA 2EB2A 4IM0A 4YZDA 4EOJA 1JKKA 3RPOA 2ZJWA 2W1EA 2Z2WA 2ITXA 3PIZA 4O0WA 4O6EA 4D58A 5FBNC 5JQ8A 1H1WA 2OH0E 2P2IA 4KAOA 3E8CA 3EQIA 5M4IA 3C9WA 3RI1A 4FOBA 3EH9A 4BKYA 5EDRA 4F08A 3PPJA 4MWHA 1YXVA 4D2TA 5L2SA 2W99B 4D4SA 5AP1A 3FI3A 4YR8A 2F9GA 3C5UA 5I9XA 5C4KA 3FKLA 5E8TA 2J90A 4FZ7A 4GG5A 3MIYA 3GU8A 4FG7A 2WQNA 4ZTLA 4GW8A 3HRCA 3JPVA 3VHEA 1ATPE 3FKNA 3DCVA 4I92A 1O9UA 5FGKA 4EUUA 4C3RA 4BGGA 3ZONA 1H08A 2VTNA 3VS2A 5E7RA 1QCFA 3LFSA 4WIHA 1BLXA 3ORZA 4XX9A 4HGEA 4D0XA 1DI8A 1H1SA 3EN5A 3TJCA 2VO6A 2REIA 2J51A 2R0IA 3HZTA 2X0GA 3RCDA 1SVHA 3EOCA 5CF4A 1OL5A 2OICA 4YZBA 3S1HA 1T45A 4L44A 2OKRA 1UWJA 4FKPA 4U43A 5C8KA 2IVSA 4ZIMA 4BDFA 3EN7A 1KV1A 3Q4UA 3EQFA 1W2CA 1XH9A 3TUCA 3L8XA 3BI6A 3L9NA 3T8OA 3MFUA 1OIQA 1STCE 5DWRA 2NYAA 2QD9A 1FOTA 1YWRA 3L8PA 2XJ1A 3DFCB 2C6TA 3KXGA 2R7BA 3PLSA 3UVPA 3WZJA 4FTQA 4FRFA 2PK9A 4ZTSA 4GYIA 4BCPA 2B4SB 2OFVA 4F99A 5IEYA 2OIBA 4IANA 4FGRA 4FT3A 3WYXA 3CD8A 5M51A 5AUYA 3SX9A 3R1QA 4YJPA 4IB0A 3THBA 3W0PA 4EUTA 4G6LA 3F2AA 3BRBA 4MHAA 5AV1A 1J7IA 2Z8CA 1H26A 3I7BA 2HYYA 3E7OA 4J8NA 1W7HA 4EHVA 2BKKA 5D12A 2H8HA 4GV1A 2VRXA 5DFPA 2VWVA 3K5VA 3MTLA 4S32A 4DEAA 4HCUA 3QRUA 4NWMA 2C5YA 4O96A 3HV6A 4PY1A 3LCTA 4TN6A 4UEUA 4L8MA 4PRJA 3E8NA 1R0PA 3PWYA 4BN1A 1KE9A 3CPCA 3RM7A 4YO6A 4YUQA 3ODZX 1Q41A 4UWYA 1H25A 1BUHA 1PXMA 4Y95A 3BLRA 4EH6A 3PG1A 2VTHA 3DK3A 5DHJA 4JAJA 1W0XC 1H01A 1OPKA 3P78A 3F2NA 3ZO1A 2OGVA 3BHUA 3NW7A 2WU6A 3SV0A 3RAWA 3QRJA 5CQWA 4KIKA 4CFUA 4R5SA 3QRTA 4CRLA 4Z7GA 3OY3A 3N4TA 4C59A 4EZ3A 4UXLA 3OROA 5LCJA 3UDZA 1M52A 5JKGA 4MUQA 3HP2A 3LKMA 4FSZA 4GUEA 2IF8A 4GT3A 3HUBA 4BKZA 4F1TA 4F9BA 3UZTA 5KHWA 1PXLA 2CLQA 1GZ8A 2HIWA 2C5XA 3L8VA 4JG6A 2WEVA 2UZDA 2V62A 4MNFA 3NS9A 4G6NA 1WMKA 5I5ZA 5HU9A 3MDYA 1PMVA 2WTCA 5HIBA 3VBWA 3PSCA 4CFNA 4FGBA 2DYLA 3UZRA 1OMWA 4D5HA 3ETAA 2FO0A 3PPZA 5LMBA 4W9WA 3U9CA 3PUFC 3MA3A 5KNJA 3S0OA 3D5WA 4WBOA 5B0XA 4EWQA 3R9OA 3AMBA 4PTGA 1Q8YA 2ZDTA 3ZH8A 4L45A 3PRFA 5AR3A 1IA8A 3K3IA 3ZC5A 5IH5A 3R7UA 5CEPA 3KVXA 3VW6A 1K2PA 4FTNA 3VUKA 1IAJA 4BJJA 3M2WA 2ITNA 4RX9A 1U5RA 3U51A 4RWKA 3F88A 3OWPA 3JVSA 2ZV9A 3TV7A 4BYJA 3D94A 5IA1A 4AT4A 3WARA 3AG9A 1HCKA 4OBPA 3PPKA 4JQ7A 4RGJA 4RC2A 5CSVA 4PP7A 5CS6A 5LVNA 5L2QA 3HGKA 3OBGA 5E4HA 3KRLA 4DGNA 2GFSA 3AMYA 1ZMWA 2Z60A 4AXEA 2YLFA 4IX6A 2OJIA 2HW6A 3LOKA 4NJDA 5HIDA 3SXFA 3UG2A 4C38A 4FTCA 3LXPA 2B0QA 4ZJIA 4OTQA 3Q6WA 2ITVA 3QTZA 3I5ZA 4CQEA 5CYIA 4FTMA 4JQEA 4KRCA 3B2WA 4JL9A 1BL6A 3DAJA 1M14A 3C0GA 3NGAA 4CFFA 5DR6A 4ENYA 3MH2A 5IISA 5B7VA 1PYEA 1XWSA 2GQSA 3KK8A 4KKGA 5A4CA 4MXCA 2DWBA 2O65A 4PP9A 1GIHA 3DKOA 1FMKA 2R3KA 3DU8A 2Z7SA 3NVMB 5FTQA 1UWHA 3T9TA 3AMAA 3MFSA 2WKMA 4FL3A 4GRBA 4ZXTA 2XAMA 4NCTA 2JDTA 3RAIA 2HW7A 2JIVA 2OXDA 1PW2A 2HENA 3TKIA 1G5SA 1UU3A 5AR2A 5FDXA 3G5DA 3OCSA 4FYOA 5AAGA 3E8EA 4NIFB 3HUCA 3M11A 4DGOA 2IZTA 2ACXA 4FG9A 4C8BA 4CZYB 2P33A 3LQ5A 4PDSA 2WTIA 4TY1A 2PVLA 1H0VA 4M69A 3FXWA 4RA5A 4E7WA 3NPCA 3LLTA 1OL2A 3UPXA 4ZOGA 5GJDA 4A9UA 2YM6A 5CAQA 2WU7A 1WBTA 3MS9A 4WG4A 3VW8A 3W8QA 1V0OA 4Z16A 1OVEA 4BI2A 4EH3A 4TYIA 3AKLA 4O7TA 2BDWA 2Y4IC 2J0KA 4FNXA 5EI2A 3HV3A 4FI1A 4FNZA 4V0GA 3RP9A 4RFMA 5IEVA 2YFXA 4DG2E 1H1PA 2CPKE 4FV0A 2BHHA 5AP0A 2BZKB 4C4FA 5IG1A 1H07A 5HBEA 3SD0A 2X9EA 4ITJA 1BI8A 3BBWA 5IKWA 3VF8A 1XMMA 3MPAA 5CAVA 4Y5HA 3G33A 5CZIA 1OIUA 4NFMA 3SA0A 3F66A 3NNWA 4FSTA 4TL0A 2B7AA 3UZPA 3R83A 5A46A 3EJ1A 3C4WA 1ZXEA 1Z5MA 4FR4A 3R8ZA 4CV8A 2PMLX 4DFLA 4EK6A 5DLSA 4ZLOA 2PPQA 2IJMA 4F0IA 2QOQA 2QHMA 4M15A 3BBTB 4FSRA 3VRZA 3LFFA 2BTRA 1OZ1A 4BIEA 2J6MA 4KS8A 5AV0A 3OT3A 3MH3A 3VS4A 3ZZEA 3E8DA 2B9FA 3RWPA 1J1BA 2BDJA 4J1RA 4IZ7A 3GU7A 3FMJA 3KN5A 4DH5A 3FMKA 3E64A 3EFWA 4ZZMA 5AV4A 3PY0A 5HE3A 3BHVA 1DS5A 1XKKA 2FB8A 5EI6A 4R3PA 5EOLA 2CKQA 4R3CA 1UU7A 5ANGA 3VUHA 3L8SA 3TNPC 4FEWA 2RG6A 3VRYA 5HCYA 4CFWA 2CMWA 3FLZA 4ZY5A 4MXAA 5M07A 4LL0A 3U6JA 3ET7A 4XOZA 4BGQA 5HTIA 3DKFA 1UU9A 3UIBA 4GK4A 4E4NA 4L3PA 4RC4A 4A9RA 3PLAE 4ALUA 1NW1A 2DS1A 4YHJA 5I0BA 4RIWA 4ANOA 2QC6A 3COKA 4WO5A 1MQBA 3PJ1A 5AUTA 2WMUA 4MYGA 2BZHB 4ZSLA 4AZSA 3GT8A 4ITHA 5EW9A 4AN9A 4BRXA 4S33A 2VTAA 3OWJA 4WHZA 4R7BA 2Z7RA 2B53A 3F61A 2UZWE 1F5QA 3I4BA 4YZCA 4E20A 4BC6A 3QRIA 4F63A 5ITAA 3VHKA 4AGUA 3AC5A 2WMTA 1JKTA 3EN6A 3NUNA 1PMNA 3CTHA 4TT7A 2PZ5A 5EYCA 4RIXA 1JQHA 3UQCA 4LGHA 5C27A 1AQ1A 2CGWA 2FSOX 2BAKA 3MTFA 3OFMA 3BHYA 2BILB 2PVHA 4E3CA 3R22A 4FK6A 3REPA 5CF5A 1OBDA 2WGJA 3P7CA 3ZZWA 1TFFA 3R63A 4AZVA 5A4QA 2W7XA 5AAFA 2JITA 3UVRA 1VZOA 2WMVA 3AC8A 5CSPA 3U87A 3MVHA 4O7WA 2W1HA 3E62A 1CMKE 3P7BA 3HRFA 2Z7QA 4PMSA 4UZDA 5H8BA 4MF0A 4DAWA 1RJBA 1YOMA 3BE9A 4YO4A 4RX8A 1IRKA 2GNLA 4YP8A 5IH6A 1REKA 3GFWA 3GOPA 2ITTA 2QU5A 1NXKA 3F9NA 4MKCA 3F5UA 3FZOA 3GENA 3PUPA 3R9DA 3U6HA 2EXMA 3QF9A 3M1SA 3ALOA 2V7AA 2YM4A 4X2KA 3FQSA 4AA0A 4AN3A 4CMTA 5J87A 2WQEA 2ZV8A 5JFXA 1JKSA 4RZWA 2P55A 1PF8A 3R7IA 4JI9A 2ZB1A 4HPTE 3BX5A 3TV4A 3NVKI 3PJCA 4DFUA 3VUDA 3CC6A 4IZYA 1MRVA 2QO9A 1OIYA 4FV4A 3TJDA 2F4JA 4FZDB 4AXFA 3NNXA 3FQHA 4FSMA 4J99A 4WOVA 4NTSA 4ZP5A 1ZLTA 5TT7A 3SLSA 3DJ6A 5I9WA 3FLQA 3QBNA 2ZMDA 4JOAA 3FHRA 3IW8A 1RDQE 4PNIA 4K1BA 2FH9A 1P14A 3RM6A 4JX3A 5CEQA 5T6KA 1VYWA 2WMXA 3VAPA 5IDPA 3QRKA 4IB3A 2YM8A 2ETMA 3QU0A 4HOKA 4K2RA 4NKSA 4L68A 1XBBA 3GC9A 4H36A 4EZ5A 3Q9WA 3GP0A 4FX3A 4L00A 4CKIA 4D1SA 2XYNA 2C6MA 4QMVA 3RZBA 3VS3A 3WZKA 5GZAA 3SW7A 1DAWA 4M0YA 2W1GA 4WT6A 3LLAA 5BVWA 2W05A 3NIEA 4TWPA 4KABA 4FKIA 1U4DA 3TXOA 3UG1A 1PXIA 2BHEA 5FG8A 2Y0AA 4LV7A 2GDOA 3TL8A 4PNKA 2HXLA 4CFXA 4F6SA 1H1QA 2JKKA 2C3IB 1JBPE 1B39A 3NUSA 3FMEA 1PXOA 5C26A 5GIOE 2VX0A 4OBQA 5AM6A 4ZSAA 3LMHA 2X7OA 1YI4A 5IUGA 4JX7A 3GCUA 4DINA 2UVZA 3R73A 2G15A 3OUNB 4FVRA 1Q24A 2C5NA 3K5UA 2XCKA 3PYYA 5AP7A 4RVKA 3I60A 4QYYA 4YC6A 4F0GA 1PXJA 4XG4A 2XEYA 2QKRA 2UW8A 4CLJA 4BTMA 4BCHA 1TZDA 4YSJA 2KTYA 1OECA 2RFNA 4FZFB 5KMJA 2ZM4A 3LCDA 3QWKA 5AIRA 1ZWSA 3GCSA 2HWPA 2UZNA 4HGSA 2ONLA 3CBLA 3LXNA 4YJUA 2ZVAA 4IB5A 2IZRA 4II5A 4F9YA 2ZMCA 4G5PA 2I0HA 2X8DA 5CNOA 4QMNA 1B6CB 3D9VA 4V05A 2VN9A 2X0QA 4BZNA 4DFBA 2HY81 4O6LA 3FMDA 5BUJA 4E6QA 3O23A 5EG3A 5C9CA 3UOLA 4E4XA 3GI3A 5JGAA 4FEXA 3EB0A 4FIFA 1U46A 4C4EA 2PWLA 4UZHA 3FWQA 4ASZA 3BEAA 3QGYA 5LWNA 4O4DA 4JBOA 3DBQA 4M7IA 2J5EA 4X3FB 3ROCA 3TACA 3UNZA 5AP2A 3D83A 3R28A 2WEIA 4BDIA 4C7TA 1Q8WA 2XKFA 4ZLZA 4GKIA 3QQFA 4MF1A 1ZYDA 3A7IA 3DXQA 2IWIA 4YHFA 4A07A 2OFUA 2YCRA 4E5WA 2WQBA 4DBNA 2IZUA 3TZ8A 1GZKA 1SM2A 1TQIA 5FEDA 2VGOA 1WVXA 4IBMA 2XJ2A 4UB7A 2PU8A 3NUPA 5JFWA 2WOTA 3EIDA 5E8XA 4ASXA 5LARA 4D2SA 3NX8A 4CMOA 4QMSA 5E90A 4C3PA 2G2HA 5A9UA 4MBLA 5C01A 2QOCA 2W96B 2X7GA 4JNWA 4RBLA 2XIZA 4LOOA 4FSNA 4MXZA 2CCIA 3QLGA 4YLJA 4DEGA 3O8UA 3KRRA 3OCTA 4I22A 5DR9A 5I4NA 2YA9A 4FKQA 4YBKA 4FTRA 4LGDA 1P4OA 4ACHA 1YXTA 4X6RA 3VBXA 5JN2A 4JMQA 4QEBA 3QYZA 4EOLA 1GAGA 4RX5A 2PMOX 5D7VA 2PUPA 4LMNA 4AP7A 5IA4A 3NUYA 1JNKA 3S00A 3FI4A 3PXZA 2XK6A 3VWAA 1UKIA 3TN8A 2R3QA 1WCCA 2ZDUA 3Q4ZA 4AW1A 4CXAA 5K5XA 3QQKA 4NT4A 4U7ZA 1OKWA 2QLUA 3Q5ZA 4Y85A 3FYKX 4ANBA 2GTNA 3ZUVA 4BL1A 4PX6A 2RIOA 3D7TA 1J3HA 4FV6A 4DGGA 4FNWA 3HDNA 2G2FA 3ZLYA 4U97A 2JBPA 3DS6A 2RFSA 4UBAA 3GU5A 3SW4A 4JLCA 5CTPA 3LIJA 3OP5A 1R3CA 5AP4A 3P0MA 2HZNA 4H3BA 3UP2A 3L9PA 4USDA 3W2OA 1AGWA 4FV3A 5ETCA 4E6CA 1KE5A 2R3OA 5AUWA 4HCTA 4EHEA 3W16A 4EH5A 4HCVA 4KSPA 4RJ5A 4WG3A 4AXCA 3G90X 2VO7A 4I0RA 4CFVA 1FPUA 5EFQA 3CS9A 3VUTA 2J0MB 4YPSA 3GVUA 4WA9A 4XV2A 5IZFA 5AP6A 4R3RA 2QNJA 4GVJA 2XZSA 3FLYA 4IDTA 4W9XA 3CQEA 3ZFXA 5JSMA 1A9UA 2C5OA 4KBKA 4EKKA 4KA3A 3UYTA 3QD3A 1IASA 4MXXA 3QXOA 2B54A 2HY0A 3OF0A 5CT7A 2E9UA 1YKRA 2IVVA 1SVGA 4EKLA 5JGDA 2GU8A 2BRMA 4G16A 4X3FC 2JKMA 5CU0A 5GINE 5HICA 4AGCA 2VX1A 4X2GA 5CSHA 3ORTA 2BFXA 5J5SA 2R3JA 4NM5A 5EHOA 4RPVA 3DLZA 1QPCA 5AR4A 4Q2AA 4AOTA 1JLUE 4L7FA 3UGCA 3A7FA 2BRNA 4L53A 4CD0A 2C3KA 3O7LD 4G9RA 4HYSA 4EOPA 3PP0A 5DT3A 1YRPA 4BGHA 1WBOA 4Z7HA 5TF9A 4KIKB 3H10A 3L1SA 4BDBA 3UIUA 1Q99A 4FEQA 3N4UA 4ERWA 3HLLA 4KRDA 3OVVA 4QO9A 5CAOA 4XNEA 4B8MA 3GXLA 5D1JA 3U4WA 4ASEA 4K77A 4QOXA 3RAHA 1Q3DA 4IVDA 5JZJA 4QP3A 3UNKA 1CSNA 2ZYBA 2W5HA 4DT9A 4PPAA 2B1PA 3MYGA 3MN3A 4FK3A 3V51A 3RZFA 4CKRA 4GJ3A 5GJGA 4JDHA 5K3YA 3VBYA 2ITPA 1KOBA 5CU2A 4NKAA 3ZSIA 3Q2MA 2WELA 4K8AA 2X4FA 5HVJA 3RMFA 4AZEA 3EQCA 3BWFA 5EI8A 4FIJA 1M2PA 3BYVA 2CDZA 3OTVA 5TO8A 3CPBA 5AJQA 2BUJA 2R3RA 4WUAA 4EOOA 3OG7A 3QA8A 4DFNA 4HGLA 2WD1A 2WMWA 3Q2JA 4O7VA 4I24A 3AD6A 1YVJA 2GFCA 5IQCA 3D5XA 5AX3A 3VNTA 2UZOA 3QC9A 2IZSA 4S30A 5M56A 3PJ2A 5EYDA 3ZRKA 1FVVA 1OM1A 3HV7A 3IKAA 3KCFA 1WVYA 4BJJB 5CF8A 3MESA 5L2WA 4QPSA 4KIPA 4DT8A 4I23A 4F78A 3JVRA 4TRLA 3W2RA 1CKJA 2XYUA 5IUHA 3I79A 2X6DA 4I21A 3VS1A 5IU2A 3KVWA 4C02A 4F7LA 4G34A 3PWDA 4EWHA 4O22A 2EB3A 2A0CX 3UC3A 2AYPA 4C4JA 1YI3A 2GSFA 3NDMA 3KFAA 1MQ4A 3FYJX 2YLEA 1WBWA 4FBXA 3C5IA 2JLDA 4MXYA 4RWIA 4TWOA 4FV7A 4PPBA 5ANJA 4QT1A 3QTXA 3V8TA 4BDGA 5KMMA 4Z9LA 3DB8A 3E3BX 1QL6A 2VUWA 2P0CA 4MQ1A 1M2QA 5DT4A 3EQHA 3TIZA 2W9ZB 2VWXA 5JFVA 3TNWA 4DTBA 3F7WA 3RALA 4FKLA 3OCGA 4L46A 3FDNA 4HVHA 2XCHA 4YJRA 1QPEA 5AV3A 4M84A 3POZA 3FMLA 2J2IB 5E8YA 4YLKA 5J7HA 2IVUA 4KIQA 4NM3A 3UE4A 3G51A 3FSFA 3KB7A 5EHYA 3BL7A 3MY1A 3DNDA 3EHAA 2XNNA 1DAYA 3LMGA 1LUFA 4E8AA 3EN9A 3KQ7A 3JY0A 1W98A 2OJJA 4PL5A 2RFDA 4IW0A 3DKCA 2HAKA 2YJSA 3IW4A 2QLQA 2O63A 2YIXA 4OR5A 5EQPA 3JS2A 3AC4A 4O0TA 4KSQA 4XRLA 4XH6A 3ULZA 5LVOA 2C3JA 4S31A 4A9TA 1M7NA 4UMTA 4ITIA 4YU2A 4X2NA 3DGKA 3AOXA 3LFEA 2OSCA 2PVYA 3H4JA 2XB7A 4TKSA 3WYYA 4ANSA 1PXPA 4TYHB 2OK1A 4RLKA 3WBLA 4KWPA 5FRIA 1XMLA 2GHLA 3DPKA 3Q3BA 2XALA 4JRVA 4BICA 1JSUA 3BCEA 3FMNA 3HECA 3QLFA 1DM2A 1R1WA 3S4QA 3V6SA 4QQCA 5M44A 2W1FA 3P86A 4I5MA 2YIQA 5HTCA 1ZYLA 2I40A 1REJA 2UW9A 4O2ZA 4DTKA 4U45A 1KUTA 3COHA 2XNEA 2JIIA 5G6VA 3IECA 1GZNA 1YHVA 2RF9A 5HNBA 4IFCA 5BX0A 4G17A 2E9PA 4ZSJA 1AD5A 4YMJA 3R9RA 2R5TA 3ORKA 4GYGA 4AS0A 4F6WA 3BZ3A 3LZBA 4S2ZA 4KB8A 4YC8A 3BGZA 4ZSGA 4CKJA 4QMTA 3IW5A 4ZTRA 1V1KA 3OC1A 1YWVA 3S2PA 1U5QA 1PHKA 2WMRA 4I4FA 4O7ZA 1Q8UA 2HZIA 4KKEA 5IQFA 5B2LA 3ML1A 3Q4TA 3NEWA 5DRBA 3FUPA 4AW5A 3R9HA 4O4EA 5HX8A 4D9TA 3RHXA 4QMMA 4GK3A 2UZTA 5M4FA 4ANQA 1YQJA 3NW5A 4K0YA 2GCDA 4FTUA 4G3DA 3BHTA 4MBIA 1ZMUA 3NSZA 4XP0A 5DH3A 4GG7A 4FMQA 2WAJA 4AZFA 4XLIA 3HAVA 2Q0NA 3MWUA 3OD6X 3OXZA 4AA5A 5BYYA 2QHNA 2YDIA 4DEEA 3A7HA 5KMKA 2Y6MA 4IHPA 3NZ0A 4MX9A 4IE9A 5J9LA 1YXSA 4XBUA 3VIDA