2PVNA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
total genus 109
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvnA02
2WQEA 4Q5HA 5HNIX 2OIBA 2R3IA 1S9JA 2R3MA 2G1TA 3ACKA 4U3YA 5E8YA 3D7TB 3KXNA 4QMYA 4G17A 4D5HA 4FGBA 1J7UA 3VBYA 4W8DA 3HEGA 4I94A 3DNDA 1H1QA 1DI9A 2PVYA 1M2QA 2RFEA 3T9IA 2JFMA 3ZS5A 4OTGA 4OTPA 4FTAA 3AC2A 2ZOQA 2I40A 4FTLA 5HLNA 4E26A 5IQAA 3MH0A 4GUBA 4EC9A 2R9SA 3VS2A 3UTOA 5JSMA 4BWKA 3F3ZA 2B52A 1R3CA 2R3FA 2XKFA 3DY7A 2XM9A 1MQ4A 2O65A 5DBXA 5ACBC 1PY5A 3PZHA 4FTOA 4IAIA 4XV9A 1QPDA 3VS4A 4EJNA 3OMVA 4FT9A 5DLSA 1A9UA 3VUKA 4EHGA 4F6UA 3UOJA 4G6LA 4J53A 4PTEA 4EWHA 1SVHA 3V5TA 2P55A 4W4WA 4QMOA 1JOWB 3NCGA 2X6DA 2W1CA 3FZOA 3MH3A 3NCZA 4N70A 2C6KA 3G6HA 3R2YA 3PSCA 1TKIA 5CYIA 4DTKA 3ORKA 4FYOA 5ACKA 3JPVA 4HPTE 4M97A 4AGCA 4LFIA 3BU6A 4ACMA 5FQDC 3RAKA 3MGYA 4C36A 2XNEA 1SM2A 2YM7A 5BVNA 4F6WA 4AZFA 1PXNA 2ZJWA 4ZY6A 2JKOA 3FLSA 4O96A 3VS5A 4HYSA 5CSVA 4LV8A 4D58A 4F63A 3TKIA 2E2BA 3VS7A 4YR8A 3QRTA 4P5QA 3AD4A 3A7JA 3KMMA 2X8DA 4EH9A 3BWJA 2BILB 2UVYA 3MPTA 3QBNA 4QTBA 4EK3A 4XLIA 2P0CA 4FTUA 4XRLA 4AA5A 2PE2A 2YAAA 4J52A 5CU4A 3AQVA 5AAEA 2UV2A 5GHVA 5F4NA 4WNPA 3ZSGA 3RNIA 3NW6A 3CCNA 5DN3A 2YA9A 5HE1A 5C26A 3FXWA 3KFAA 4QMSA 4EKLA 4L00A 4F7LA 4PY1A 1XH9A 1H00A 2UZVA 4CKIA 3HX4A 2BRHA 3NYVA 3ODYX 5CAUA 3KXGA 5AV4A 3C0HA 4KABA 4O7LA 4AW5A 5IQHA 2OSCA 3CD8A 5M4CA 1MQBA 2OJFE 3F5PA 3EN4A 3FZPA 3UYTA 3KA0A 3FZTA 3VS0A 4B7TA 4XLVA 4C2VA 4CSVA 3BHUA 4RJ5A 4USFA 5CTPA 4FKLA 2ITWA 2PMLX 2ETMA 3MW1A 1PXOA 5EM6A 5HNGA 2BVAA 1XHAA 3RK7A 4FV4A 4FV9A 2HW7A 4O6LA 2JLDA 1QPJA 1YDSE 4HGTA 4E6CA 2F57A 2ITQA 4B6LA 4LGGA 5E8UA 2QOQA 4EUUA 4Z55A 5L6PA 5EW9A 1YI4A 1K3AA 2Q83A 3PTGA 5ETIA 3AC8A 3RBWA 3HV4A 4D9TA 1AGWA 1NVQA 1NY3A 3GCQA 1VYZA 3CKWA 3Q9YA 5EOBA 4UN0C 4FG7A 3RAIA 1G5SA 4DG2E 4A9TA 3AC1A 3LAUA 4ZY5A 3HECA 4BDIA 1TQIA 3FV8A 1ZOGA 3MS9A 4DGOA 3NYNA 1DI8A 3WILA 5A54A 3PRIA 3WYYA 4DITA 2XZSA 4Z3VA 5IPJA 4GFMA 2YDKA 2BUJA 2VU3A 3ZLWA 4YHFA 3VBWA 5K3YA 4AN9A 4BDDA 5LMKC 1M17A 4I3ZA 4BIBA 2WEIA 3NRMA 2XIKA 3G0FA 3O50A 4BTMA 2H9VA 4BDKA 2JC6A 1FOTA 4RC2A 4DEDA 2F49A 3FI4A 4TY1A 3FSKA 4BDBA 4UMTA 3UJGA 5IEXA 3WIGA 3VBVA 1XKKA 2F9GA 4I92A 3LZBA 4RSSA 2Q0BA 2W1GA 2FA2A 4XBUA 5M44A 3HNGA 5HG5A 3GQIA 3EMGA 1M7NA 1KE9A 3LPBA 4FSZA 4I6FA 3MY1A 2WIHA 2XIRA 5M53A 3UIBA 5CS6A 5CQWA 3V8TA 3Q53A 2R3KA 1GOLA 5FBOA 4XV3A 1GZNA 4FKJA 2C6DA 3FMKA 4CEGA 2Z7RA 4CFUA 5I9XA 5BUJA 2CMWA 3M11A 4EOMA 4YJVA 3A61A 2WTJA 4IJ9A 2XRUA 3H0YA 4D9UA 5C01A 5HBJA 2J4ZA 3UVRA 3DJ5A 3O7LB 4GH2A 4DN5A 1GIIA 5CENA 3CR0A 2YHVA 5A6NA 4AW1A 3HMIA 5HE3A 3TXOA 3BIZA 3IS5A 5DT3A 5CALA 4M0YA 2C0OA 3NW7A 2KTYA 4U45A 2XK4A 3POOA 1JLUE 4AOIA 4CV8A 4AZEA 1YXSA 2OKRA 3CSVA 2QLQA 4Z16A 1MUOA 1VR2A 4FTIA 3RK5A 2BMCA 4BCJA 2OFVA 4O7RA 3NIEA 4IVBA 4J71A 4ALVA 5IA4A 4PF4A 4IB1A 2R4BA 4IWDA 3C4WA 3SRVB 4IQ6A 2R7IA 5E7RA 2QU5A 2VAGA 5AUXA 4GK2A 2YCSA 5AJQA 3QU0A 4E5AX 4LM5A 3TKHA 3BQCA 3KN6A 1DAWA 1ZZLA 5CU3A 4JDHA 1UNHA 2QO2A 3P4KA 3EWHA 4JIKA 3TKUA 4A7CA 4BIEA 3BELA 3ZEWA 2PU8A 2G01A 3H30A 3QQHA 4C3FA 5KO1A 5DT0A 2NRUA 3NS9A 2HY81 4PDOA 4U9AA 4R3RA 2ITPA 4QNYA 4W9XA 2H34A 1UWHA 3TN8A 5AX3A 3VS3A 3SW7A 5LCKA 3C13A 3D9VA 2BZKB 4IB3A 1U5RA 4U6RA 2VO3A 1ZARA 3R00A 3QZIA 3QHWA 3ZUTA 5GZ9A 4YJNA 4GIHA 4FTQA 2W0JA 1KOBA 3A99A 1Q3DA 4OT6A 3EFLA 2BFYA 5DH3A 4E5WA 4OLIA 3FLYA 3IPHA 2QO9A 2ERKA 1M2PA 4I5PA 3QD4A 2Z7QA 3SDJA 3TIYA 3O0GA 4CZTA 5G1XA 2WKMA 3E64A 3CJGA 4MXOA 1Z57A 4NW5A 3UVQA 3UODA 4NK9A 3LCTA 5CVFA 1TQMA 4PUZA 3QKMA 4BHNA 4EOOA 4EYMA 3QYWA 4G1WA 5HHWA 3IW7A 4YUQA 3R30A 4X0MA 2V5QA 3SRVA 3TUBA 1HOWA 4YZCA 4F7NA 4C35A 3UOLA 4XNEA 4A9UA 3ALOA 4GSBA 2W1HA 3ORNA 4DLIA 5CF8A 2RIOA 3R9DA 2REIA 4EH4A 3MIYA 3PA4A 1FQ1B 5FD2A 1P14A 3DAEA 3V5WA 5IDPA 3EYHA 3HAVA 3COMA 3JY9A 3QA8A 2OJJA 4H58A 3ALNA 4YSMA 3U87A 4C57A 5JGBA 3VN9A 4IWOA 5C8NA 3U6HA 2ZAZA 2YLFA 3EB0A 1T46A 3ODZX 4IACA 5L3AA 1FINA 3BYMA 3ORTA 4I41A 2VTHA 4CRLA 1URWA 1STCE 3NWWA 4IHPA 5A14A 4FEWA 3UOHA 1ZYJA 3QALE 3LOKA 2FB8A 2H6DA 3BLHA 4DGMA 3A2CA 2I0EA 3QX4A 3UC4A 3SC1A 2QR7A 3ZXZA 4LYNA 4ENXA 2JIVA 5IH6A 2I7QA 4EK5A 2BDWA 4IAYA 3PUPA 4JLCA 4DLJA 2Q0NA 2UUEA 2OU7A 3QZGA 4BCIA 4K6ZA 4EHEA 3AXWA 4V0GB 4ASDA 2FH9A 2Z7SA 4OUCA 5JRSA 2IO6A 1YKRA 3AT4A 4TRLA 2ESMA 3LLAA 2VWUA 1ZAOA 5L2SA 2F2UA 3L8VA 5CY3A 4DEHA 1OGUA 4OTDA 4YTFA 4FZDB 4ACHA 2GQGA 2GPHA 4DH3A 5EYMA 2XM8A 4HNIA 5LWMA 3P7BA 3FLWA 3F61A 2WU6A 4DGLC 4KWPA 4F64A 4R7BA 4JDIA 4YZNA 2R3GA 5HO7A 2GS2A 4CRSA 3MFSA 5ANJA 5HBHA 5F95A 4E3CA 5KHWA 3OF0A 4H36A 3FMDA 5CX9A 1W8CA 4FTJA 4KRCA 1JKLA 4MXZA 3F69A 4BCGA 5CT0A 3C4FA 3R73A 2BIYA 1GY3A 1KUTA 3OG7A 3RJCA 4PTCA 3I7CA 2WZJA 2OZOA 3KN5A 3A7HA 3BGZA 3VBQA 4E4MA 4DA5A 3IDPA 4ALUA 4FG8A 3WIKA 3OCTA 3BHVA 3E8EA 4L68A 1JQHA 2OBJA 1Q4LA 4QP1A 4EOKA 4O82A 4IVAA 4DFNA 5GIPE 5IA2A 2ZB1A 1BL6A 1ZMUA 4FKSA 1WZYA 4FR4A 5BVWA 4S34A 2YWVA 5CT7A 3DNEA 4JNWA 4I6BA 5D7VA 3CTQA 3VUMA 2CGXA 4TKSA 4EK4A 4Y73A 4I0SA 4MBIA 4M84A 4O2ZA 4EK8A 4N0SA 4ZJVA 2YEXA 3P79A 5IA5A 3OTUA 4HZRA 4YO6A 1YXVA 3NPCA 2ZM3A 5AX9A 3CC6A 2C47A 3NLBA 4FG9A 4GU9A 4XG3A 3RP9A 5AUTA 4MNEB 4HVIA 3GCPA 2XA4A 3FZ1A 4FSMA 4IZYA 4EHZA 4I6QA 4QP3A 4FT0A 3R1YA 3U51A 5AWMA 4BGQA 4E8AA 2GFSA 3FC1X 5FRIA 1M52A 4QMMA 3Q04A 4IB5A 4BCPA 4RIXA 4FVQA 3R7UA 2ONLA 4DBNA 2O64A 3ZSHA 2UW9A 5JT2A 3V8SA 2Y4IB 2QI8A 3DTWA 5HCYA 3BPRA 3FMHA 4LMUA 4TW9A 3S95A 4LMNA 4F99A 2ZV9A 1H07A 4GMYA 3WF9A 4DEBA 5CF4A 1PKGA 1OKWA 4IFCA 5L8LA 5J1WA 1RW8A 4C4JA 1M7QA 3O2MA 4R7IA 3II5A 4L01A 4JQEA 5CVHA 5E8SA 4ZIMA 2YDIA 2UZBA 1R39A 3IECA 3IDCA 3PIXA 4I22A 4II5A 4S2ZA 1KOAA 3S3IA 4ID7A 1H25A 3D0EA 4QMLA 2BIKB 3QQKA 3QTUA 3ZOSA 4L42A 3OEZA 2R0IA 4E6DA 2YM4A 3ACJA 2HZIA 4BTFA 4ZTRA 5BVEA 1J91A 3EOCA 2PUNA 5C03A 3UPXA 3R7OA 2X2KA 4WSYA 1NW1A 2OJ9A 1WVXA 4QPAA 2JDOA 2X4FA 4GJ3A 4S31A 3CGOA 3MA6A 4V04A 4RX7A 4W8EA 1BKXA 4PX6A 2J5FA 2XNPA 3GU5A 4U0IA 5HGIA 2AUHA 4O22A 3LFFA 5IU2A 5KHXA 3W2SA 3ZFYA 4BBFA 3H9FA 3PXYA 4GG5A 3QTQA 3CKXA 1BI7A 3E62A 3VWAA 2WGJA 5ITAA 3D2KA 3ERKA 5EDQA 4IAAA 1SZMA 4OTQA 4C58A 3V01A 2X1NA 4J99A 4J8NA 4YC6A 5HG7A 4FGRA 5CXHA 4E1ZA 5LXMA 4KUJA 1OITA 2VTTA 4AZSA 3OEFX 4NZWB 4CTCA 1OMWA 1XR1A 5AR8A 4ZMFA 2QOFA 3FDNA 5I0BA 4BC6A 4J98A 5EHLA 3F3VA 2HZNA 2PHKA 4CG8A 3PLAE 4CGAA 3LMHA 2FSLX 5CU2A 4Y72A 3R8UA 4ZJIA 5FM2A 5M56A 3RK9A 4AGWA 3ORLA 4C3RA 5M07A 3PJ3A 5EQEA 3E92A 4OT5A 5GJGA 4TYHA 2VO7A 3KK8A 4XBRA 3V51A 4R3PA 4WD5A 5CEOA 4QQ5A 3W2RA 4H39A 2VWWA 1R78A 3HZTA 2V7AA 4G2FA 4XG7A 4FTCA 4AQCA 2PMNX 4OTIA 4QP9A 4X2GA 5AP5A 4S33A 5F1ZA 2OI4X 2Z60A 3VC4A 3RHKA 3QKKA 3LCSA 3HA8A 5JZNA 3SW4A 4AGDA 3HL7A 4DFZE 3BHTA 4C59A 5D12A 3DBQA 3KRLA 3P86A 4EOIA 4FNWA 1REKA 5CI6A 4X3FB 4JBQA 4DBXA 4R1VA 1CDKA 2E9OA 2XKCA 4F9YA 1UA2A 4OAUC 1UU3A 3HV7A 2BRGA 3QZFA 1XH4A 2QOCA 4OBPA 5AP6A 2ZV8A 3S4QA 2J6MA 5L4QA 5AR4A 1E9HA 2G2FA 1Y8YA 3Q52A 5ANEA 4BHZA 1PMNA 2CLXA 3MFUA 4O27B 3MESA 5DEYA 3DDQA 4JVGA 3PPKA 2OICA 4MWIA 4KBAA 3GGFA 1YWVA 3QZHA 4NKSA 4F65A 3RKBA 5GINE 4WHZA 3FPQA 4MBJA 5TF9A 4EONA 3E3PA 4FV2A 5ANDA 5HX8A 2W4KA 5DHJA 4EH3A 4WOVA 3CY3A 5JGDA 2C5VA 5IUHA 3HMNA 2XIYA 3D83A 5LARA 1S9IA 2E9NA 3U4UA 2YIYA 4RGJA 4NU1A 3TV6A 3VUDA 3ZLYA 4PPBA 3T8OA 4NTTA 4AN2A 1UU7A 2OIDA 4JG7A 3SG8A 2GHLA 3ENHA 4FEQA 3MPAA 5B2MA 4RJ7A 3GU6A 4ITHA 2W9ZB 3PP0A 4DINA 3NUXA 3OCBA 1H24A 1J3HA 3NYXA 1FGKA 2C0TA 4TYEA 5AP4A 3R6XA 5H2UA 3SAYA 4KBKA 1Q62A 3LJ1A 1PXLA 3ZC5A 2F7XE 1CKIA 4I93A 3TNHA 3NUSA 4RJ8A 1KE8A 5HIDA 5JRQA 4E7WA 3POZA 3Q6UA 3CLYA 3MVJA 3G6GA 5CZIA 3QQLA 5ANGA 2VTRA 3D5XA 4F0GA 5L2QA 5EKNA 4M68A 4KIPA 3ENMA 3NSZA 3VQUA 2DYLA 2GDOA 2BAJA 2UZNA 3UMWA 4K8AA 4F09A 4F1MA 2Z02A 3BYUA 3IDBA 4O0SA 4IX6A 4FUXA 2VO0A 3C5UA 4WUNA 5L2TA 4FEUA 3GB2A 2QONA 4FIFA 2Z2WA 3BZ3A 5KMLA 1OVEA 4X3JA 3E7OA 3L8PA 5DVRA 2R3LA 2BKZA 1H27A 2J90A 4O0WA 4B8MA 4R5SA 4FV3A 4D4VA 4BY9E 4FE2A 4GVAA 1L8TA 2BFXA 4H3PA 4QNAA 4FNYA 3MVLA 4HCUA 3LFBA 3I79A 1OIRA 2XNGA 3LM5A 3OS3A 4RFYA 1OIUA 5FG8A 4EQCA 4G5JA 4U8ZA 3Q5IA 4NWMA 3MYGA 5EM8A 4BCFA 4EZ7A 2VX1A 3I4BA 4RQVA 3DLSA 3FKLA 3P1AA 4ZSGA 3QD0A 3F5UA 4YZBA 3ZDIA 3FUPA 3OWJA 1A06A 4C4GA 4D2VA 3W1FA 4PTGA 3PJ1A 3DBCA 3SHEA 2WMAA 2WD1A 4K11A 2GTMA 2PZPA 2YIRA 4FIJA 4AZWA 1XO2B 4QOXA 2HWOA 3VIDA 2CGUA 3ORZA 4JI9A 4ZOGA 3HP5A 4NCTC 5BYZA 2GCDA 5IA0A 5DA3A 3BCEA 5GNKA 3EN5A 3DB6A 3FKOA 5C8MA 3QLGA 4WRGA 4KKEA 5KBRA 3OY3A 3LXKA 3U6IA 4YZMA 5KMOA 4XG8A 2IZTA 2YISA 3CIKA 4BI0A 1IA9A 2QOOA 3KB7A 3PXKA 1NA7A 4I5MA 4RLLA 4RVMA 4XP3A 2UW7A 4ZTLA 3RVGA 5JK3A 3Q6WA 4V0GA 1WBWA 1WBTA 3WF8A 3UQGA 4XCUA 4C4IA 4N6ZA 5DR2A 4KIKA 3Q32A 2PL0A 5CEQA 1TVOA 3OHTA 2BTRA 4ASXA 2CHLA 2OXYA 4EKKA 2ZDUA 5BX0A 5HESA 3EFWA 1KSWA 4CFWA 1UU9A 4I21A 4CMUA 3FYKX 4F1TA 4FEVA 2NRYA 4FT7A 4Z7HA 2FSMX 2PUPA 5AR2A 4G3DA 4DCEA 1OBGA 2GHMA 4QMWA 3T3VA 4AS0A 3F66A 3MBLA 3EKNA 3OROA 4QQTA 4X6QC 2C1AA 3O96A 2YJRA 2QCSA 5IEVA 3RNYA 2UZOA 4IE9A 4B8LA 1UKHA 4XP0A 5GIOE 3RCJA 2J2IB 4BDCA 2QC6A 3E63A 4KS8A 4Y85A 5DNRA 1BX6A 2PUIA 5EI8A 5IQBA 2OZAB 2QR8A 4FKRA 4PMSA 1FPUA 1ZY5A 4AN3A 2VWXA 5CSPA 2VTIA 5I5ZA 4RC4A 3PVUA 3RM7A 3JY0A 3GXLA 4RVTA 4NSTA 2JGZA 4L3LA 2WIPA 4IX4A 1YI6A 5EYKA 2QO7A 3AT2A 1CM8A 3F82A 4NIFB 5EHYA 3IW4A 4NUSA 2IVTA 4K9YA 3Q4CA 4FKQA 4FSTA 2W4OA 3FKNA 5IQEA 1APME 3S1HA 5HE2A 3I5ZA 2XK7A 4PL4A 2X2MA 2E9UA 2IJMA 1YHVA 4ITJA 3KK9A 4PDSA 4XG2A 5EQPA 4HCTA 4J1RA 4O91A 4ZY4A 3UZPA 2QQ7A 3EN9A 4YJQA 2YERA 4XMOA 2C0IA 3AMAA 4MF1A 2OFUA 4JQ7A 4Y5HA 3ET7A 3GUBA 2EXCX 4P90A 5CSHA 5FLFA 2IW8A 5AP1A 3DS6A 1T45A 3D5WA 4OW8A 3ORMA 3VUTA 4E6AA 5HVKA 2HY0A 2OGVA 4TWPA 5KMKA 4BZNA 4C7TA 3NUAA 3QTIA 4NM3A 1H28A 5DRDA 4EOPA 3UBDA 4JRVA 4ONAA 3WF6A 2WO6A 5KE0A 4AX8A 2VNWA 4O7NA 2HZ0A 4CT1A 1M2RA 3VHKA 3T3UA 5J8IA 3F2RA 1Q41A 3G33A 3QHRA 3BYVA 3OXZA 3TIZA 5AV1A 5LQFA 3DK6A 4N6YA 4ERWA 4FA2A 3TZMA 2W05A 4UWYA 2Z8CA 4YHTA 3U54A 4BWXA 4Y46A 3RINA 1H1PA 1O6YA 5BMSA 4HPUE 1H1WA 4YJTA 5E90A 2ITNA 4GV1A 3M2WA 4NM0A 3THBA 4ACDA 3LJ0A 5AUYA 3ZXTA 4O86A 3PFQA 1OBDA 1WFCA 4ACCA 5EG3A 4Q9ZA 3H9OA 5L8JA 3OUKA 5AV3A 3DAKA 1NVSA 1Q61A 2XB7A 2X7OA 3LFCA 4QTCA 5T68A 3EHAA 1FVVA 2X0GA 3WYXA 3D5UA 4MAOA 4A4LA 3FHIA 4FSYA 1ZZ2A 5E92A 5AEPA 4FK6A 5EM7A 3SQQA 3NAYA 5I9ZA 3C51A 5LWNA 4EH6A 4FUYA 4BTJA 4HCVA 3RM6A 3HMMA 5A4CA 2UZLA 4QMNA 4D4YA 4L8MA 1CKPA 4MX9A 3ATTA 4U41A 4WT6A 5FEEA 4WA9A 3NX8A 1BMKA 3G51A 2HXLA 5ETAA 1NVRA 1O6LA 3H0ZA 3QGWA 5AR5A 4R78A 5A4LA 2VTAA 5FGKA 3ZH8A 4AF3A 4UV0A 2C4GA 3TTJA 4KAOA 4U79A 4FT3A 5JGAA 2WMUA 4XOZA 3AT3A 3A8XA 2YZLA 5M06A 1J1CA 1ZMWA 4IB0A 3HDMA 5B7VA 3C0IA 2W1EA 2JITA 4FKIA 4GCJA 3QTZA 3KXZA 4XOYA 3RZBA 3ZUVA 3FLZA 4CKRA 2YIWA 1V0OA 3BGPA 4NJ3A 3W32A 3LLTA 3RTPA 4B0GA 1R0PA 3W8QA 4D2PA 3D94A 2GNJA 3BU5A 4GS6A 5CNNA 3OWLA 4BZDA 4ZK5A 3U55A 5H3QA 4C37A 3VUIA 3ZO3A 4UMPA 4FZ6A 3FEGA 2B1PA 2JDTA 4WSQA 3EQIA 4OTHA 3SGCA 1ZOHA 3GC8A 4QYEA 2FVDA 5HBEA 3QYZA 4KIQA 3IOKA 3ZLXA 4RA4A 2FUMA 1BYGA 1QL6A 2F7ZE 4WBBB 4ASZA 3VS1A 3EQDA 3GU4A 1SMHA 4ZLZA 1JKKA 1OL6A 1ZYLA 4EH2A 3TG1A 2YFXA 4LUEA 4I4EA 3WZDA 1QPEA 1ZXEA 3KF4A 2CN5A 4IWQA 2ZB0A 3HV5A 3TI1A 2WNTA 4D1SA 4CNHA 4JG6A 2YITA 2XNBA 4J97A 2W1DA 4FX3A 3IGOA 5DG5A 3PG3A 4XX9A 5AAFA 3RZFA 4WIHA 3PG1A 2QHNA 1OIYA 4YLJA 1WBOA 4FMQA 1P4OA 4OR5A 4FYNA 4KKHA 4DEAA 3HAMA 5EDPA 4D4SA 4CG9A 5J9ZA 1YHWA 1ZWSA 3HUBA 5EDRA 3UP7A 5IZFA 4I1ZA 4LV5A 1PMVA 1Q8ZA 4JBPA 3LFEA 4U80A 3CEKA 2PVLA 4G5PA 2O5KA 5HCZA 2RSVA 2B9HA 2WMBA 4L44A 2QHMA 3GOPA 5KKRC 2X7GA 5DPVA 2R0UA 2W4JA 3LXNA 3R7GA 4IMYA 5HD7A 3JYAA 3RALA 3VF8A 4AE6A 1GAGA 3E7VA 3PXFA 4RZVA 3NMUF 3GT8A 3ZO4A 3JVSA 4MTAA 4A9RA 4FV0A 4FV1A 5IH5A 1JVPP 4XRJA 5BYLA 1LP4A 2CCHA 4IVDA 1GZOA 1UVRA 3QRUA 3FLNC 3CPCA 2OZAA 3PY0A 4GYIA 3TJDA 4AP7A 1P5EA 1U46A 3E93A 3L9MA 3QD2B 4FI1A 4IWPA 4QTDA 1YOLA 3OT8A 2Y7JA 5I9UA 2NO3A 3L9PA 2XJ0A 5HICA 3EYGA 5K0XA 3UZTA 3PLSA 4WNOA 3M1SA 1IAHA 5E8WA 3SXFA 4HOKA 4ANNA 2CPKE 3DFAA 4PNIA 2GU8A 3AMBA 3WF7A 2Y9QA 3O17A 1JSVA 4Y5QA 5FBNC 3R8ZA 5BNJA 3LCKA 5E91A 5E8ZA 4AT5A 3R9NA 3UC3A 1PRYA 4JG8A 3DGKA 5ETCA 3ZLSA 3RAWA 2NNWB 4ORKA 5H8EA 3QCXA 4UXQA 4LL5A 2JD5A 4AW0A 2X81A 3PRFA 4D55A 2PSQA 4FIGA 4FKPA 4BB4A 2FO0A 5I3RA 3QC9A 3KL8A 4M3QA 3BBWA 3DU8A 2WOTA 4RC3A 5FWKK 2HIWA 4EI4A 3EZRA 4RQKA 4D28A 2IN6A 3MI9A 3R0TA 2PZRA 1JSUA 5HCXA 2BRNA 3QWKA 4UALA 4BICA 4I4FA 3C4XA 5LJJA 5J9YA 3LFQA 4FTRA 1JNKA 3R8VA 2VTLA 2IVVA 2NPQA 3ZO1A 3RCDA 5CEKA 4BKYA 3MN3A 2B9JA 3PPZA 4I23A 4HJOA 1H08A 1YQJA 2BDJA 4RJ4A 2IWIA 5TKDA 4K77A 4XV2A 3FL5A 2BHHA 3FL4A 5KMMA 1UNGA 4UWCA 3UOKA 1OKVA 5CEPA 4R7HA 5BQ0A 4NJDA 4KSQA 4YHJA 4FNXA 4BKJA 4GT5A 2ITUA 2GNHA 4MCVA 2J0MB 3ZFXA 4QMPA 5M51A 3DBEA 4MD7E 2G9XA 2OXDA 2XJ2A 1QCFA 3K5UA 4PDPA 5HX6A 3B2TA 2X9EA 3E3BX 1GNGA 4QQJA 1O9UA 2OH0E 3KMUA 4G3GA 3G9NA 3BBTB 4XEYA 4RIYA 4RIXB 4CMTA 5DIAA 5TOZA 4CV9A 3DQWA 1A48A 3NVKI 5M09A 3GVUA 2BROA 4W4YA 4ZS0A 1PF8A 4X3FA 4BGHA 2UW4A 4L52A 1W7HA 4H1JA 4YPDA 4L43A 1V1KA 2BDFA 3BE2A 2XNOA 5LVPA 3R04A 4RLKA 5HQ0A 5HZNA 5DR6A 2OLCA 4I24A 2XCHA 2W5BA 3FMMA 2B7AA 4GT4A 2XH5A 3E87A 4MK0A 2XP2A 3LIJA 1ZOEA 3LFDA 3UMXA 1U54B 3FYJX 5BUEA 2W5HA 3DZQA 3ZRMA 4E4NA 5M4UA 2WTKC 3CD3A 2WTVA 2VO6A 4WKQA 3GU8A 3OWPA 4O0UA 5L2WA 4RG0A 3KVXA 4K2RA 5K5NA 3B8RA 1OIQA 4BWPA 4TYIA 2WQBA 3CS9A 3WZUA 2EWAA 4FOCA 1LUFA 3BEAA 4I20A 4M8TA 3LW0A 4F1OA 2OK1A 4RJ3A 2DS1A 3EQGA 3UDBA 4R77A 3IKAA 4FSWA 4PNKA 4ZZOA 3NR9A 4A4OA 4TTHB 3UVPA 4L53A 4BDEA 4I0RA 3Q5ZA 4C3PA 1REJA 2J51A 4M14A 1OECA 4C8BA 4DFXE 2OJIA 5KMIA 3FZRA 3TT0A 1CTPE 5IISA 5HOAA 5IUIA 4MBLA 4MH7A 2QU6A 2BPMA 2CNQA 3V6RA 3C5IA 2GQRA 4DFBA 2GNLA 2XKDA 3H10A 2HXQA 5AUZA 3SV0A 4EEVA 4UBAA 1WBVA 1V0PA 3GFWA 5ETFA 4C02A 3UIUA 3MV5A 3A7IA 4FL3A 1YDRE 4ZSEA 3LXPA 2ZDTA 3LJ2A 4EBVA 4DF3A 4DH1A 1JSTA 5DT4A 2B4SB 2UVZA 2X2LA 4LG4A 4TYHB 3QUDA 2WU7A 5FXQA 1X8BA 5A4EA 1YWNA 3DPKA 4WRSA 4U42A 4YO4A 5IDNA 4K1BA 1G8SA 1CKJA 3O8TA 3KY2A 5EYCA 3EFKA 3I6WA 1OKYA 4BCKA 2QOBA 5CLPA 1PXJA 3DZOA 2PZIA 3HUCA 3OBGA 4IAKA 4JXFA 4L3JA 4AFEA 5AUUA 1BI8A 1RQQA 3PXZA 3FQEA 4QPSA 2V0DA 4WBOA 2YJSA 2UW5A 4JX3A 5KCVA 4MHAA 5CAPA 4RX8A 5LVLA 1YOMA 3C9WA 4JIAA 3C4EA 4IM3A 2HWPA 3FE3A 3PY3A 2R2PA 1PMUA 3LCOA 4RPVA 3EL8A 4EK6A 2UW6A 3VRYA 3FJQE 2BALA 4TYGA 4IXPA 4FIEA 2VTSA 3G2FA 4DEEA 2W99B 3Q9ZA 3NNVA 4FSNA 1E1XA 3VW8A 5B2LA 2XIXA 2BZIB 1PYEA 2R3RA 5LMAA 3FSFA 4KRDA 3RPOA 3IW8A 2OH4A 3R21A 5JN2A 4AZVA 4FSRA 3GBZA 4QMXA 5A46A 4EHVA 3CQUA 4IZ7A 4BDGA 2BRBA 4TPTA 4ZZNA 2O3PA 3BYSA 3R2BA 4IIRA 4CLJA 2A2AA 2HCKA 3NYOA 3PJ8A 2YWPA 1MRUA 1W83A 2BCJA 3A4OX 3DKFA 3SD0A 5LOHA 1W98A 3DXQA 4FSQA 4ZMEA 4HGLA 1O6KA 3R7YA 4X2NA 5D7AA 5FTGA 4GT3A 3EQRA 2IW9A 3DAJA 4M7IA 4MXYA 4BRXA 3O8PA 4H1MA 4UX9A 2CKPA 2OO8X 5E8VA 5LVOA 4YTIA 2ITTA 4O0VA 4QP4A 4O1PA 1H8FA 4HVHA 4C4HA 4YGAA 3R7EA 1JKSA 1WBSA 4PV0A 4HVDA 2JKMA 3PVGA 5DEWA 1Q5KA 5HORA 4PMMA 3QCYA 3RI1A 5C27A 3CBLA 2PVNA 3PJCA 3MTFA 2XCKA 3D4QA 4IANA 4JAJA 3QTSA 2JKQA 2DWBA 2FSTX 2YN8A 1JPAA 4NIFA 5GJDA 4A07A 4HYUA 4N57A 5B2KA 4A4XA 3ZC6A 2DUVA 4RWJA 1L3RE 1KE7A 4WO5A 1B6CB 1AQ1A 3FXXA 1B39A 1HCLA 3AGMA 3VBTA 5CAQA 5CU0A 3H3CA 4APCA 3FBVA 5FEDA 3D2IA 2YABA 3QKLA 3EKKA 2CKOA 5T3QA 1JKTA 2E9PA 4MEDA 2I6LA 3VULA 3DKOA 4BDAA 4B4LA 5JQ5A 2PE1A 2PE0A 2C6LA 4R8QA 5JFVA 2VV9A 4FV6A 4DFLA 3MA3A 3LFNA 3VBXA 4A9YA 1MP8A 2C3LA 4ZAUA 5AIKA 5BUIA 3CE3A 4CKJA 5EI6A 3PA5A 3CTJA 3HV6A 3TZ7A 2VTNA 5F94A 3EJ1A 4LRKA 4AT4A 3UO6A 2R3JA 1WMKA 3VRZA 3UQCA 3GP0A 4QD6A 3ZU7A 3ZSIA 1ZMVA 4JOAA 4EH5A 1VZOA 2OG8A 5C4KA 4ZLOA 4AXAA 2FGIA 1H0WA 3AD5A 3Q9XA 4NTSA 3NUUA 3PYYA 3NUPA 3DTCA 3WZJA 2JAMA 3TNWA 2VWBA 3G0EA 2CGWA 2PMOX 3F2NA 2EB2A 2V55A 5D1JA 2RF9A 3PJ2A 5J7HA 5J9LA 4IBMA 3PSDA 2Y6OA 1U54A 4XP2A 3TZ9A 3COIA 4EOJA 2UZEA 2WMQA 4FV5A 4YZ9A 3VW6A 2HELA 3PIZA 4HGEA 2BTSA 4AE9A 5AR7A 3RGFA 2WFYA 3WF5A 5I9WA 2B55A 4U43A 3V6SA 5KX8A 3LKMA 5HU9A 3CGFA 5D41A 3ID6C 3EQCA 5K4JA 4WUAA 4D0WA 4UZHA 3UPZA 3W16A 4LRJA 3RWQA 5ICPA 3MH1A 5LMBA 3SG9A 1PMEA 4QMVA 4BI2A 1DM2A 4FNZA 4ZSLA 5A6OA 4OBOA 3OP5A 4D2SA 5HO6A 4YLKA 5K4IA 3KRXA 4E6QA 4GL9A 4P4CA 5GJFA 5DRBA 3OBJA 3HP2A 4GVJA 4YNEA 1U59A 2QOHA 3LXLA 1Z9XA 1P4FA 5HVJA 3W55A 3MFTA 1OPLA 4XG9A 4FL1A 3F3TA 1XH5A 3IW6A 3IOPA 5IA1A 3SOAA 4D0XA 1UU8A 2J0LA 4M67A 5C8KA 4FBXA 4YLLA 3QF9A 4MXCA 3ZM4A 3AOXA 4D4RA 5JZJA 1Q24A 2R3PA 3R71A 3SLSA 4O2PA 4QP7A 3N4TA 4JS8A 3I0QA 2ZMDA 2XF0A 1ATPE 3ELJA 4WG4A 5EM5A 3TWJA 1UKIA 5CQUA 5HIBA 1Y8GA 2Y0AA 4LUDA 3L8SA 3ROCA 5DE2A 3AD6A 5J95A 2XEYA 4AT3A 3EZVA 4U3ZA 3VQHA 3FHRA 4JDJA 5AIRA 4UMRA 3ZFMA 1H4LA 4DEGA 4AFJA 3TL8A 4JT3A 5AP0A 3L9NA 5J7BA 2PMIA 3DT1A 4WNKA 4FICA 2QG7A 4MQ2A 4PP7A 2CNVA 2YZAA 2PULA 4KKGA 2IZSA 4P2KA 4DTBA 3FMLA 4TNBA 2YCFA 4NM5A 4O0TA 4F70A 3ZZWA 3UGCA 3NUNA 3AC4A 3FMEA 1BLXA 2X8IA 4O0YA 1QMZA 3JXWA 2VTOA 2I1MA 2HAKA 4LL0A 4HVSA 3N4UA 3CTHA 4LOOA 3ITZA 3MSSA 1FGIA 4IFGA 3PP1A 5FDXA 5FM3A 4GJ2A 3AMYA 2RKUA 2OWBA 2V7OA 4CFFA 3ZM9A 1PXIA 4MF0A 4U7ZA 5LVMA 5KKRB 2P2IA 3BYOA 4NT4A 1XBCA 4UYAA 4F9CA 2QKRA 4IH8A 1ZRZA 4L45A 4GG7A 4Q9SA 2IVUA 4EQMA 1YWRA 3OW3A 5E1SA 2C3JA 4Y8DA 5CXZA 3B2WA 4O7SA 3EQBA 3QX2A 5HEZA 1RDQE 3KCKA 3CQWA 3QQFA 4ZXTA 4BIDA 3C50A 5AV2A 5FTOA 3OTVA 1LEZA 4E4LA 3P9JA 4JBVA 2B53A 2XK8A 3IQ7A 2J0IA 4G34A 4IDVA 4JX7A 4UB7A 3KGAA 3QUEA 3CP9A 1IAJA 2H8HA 3IGGA 3K2LA 5AADA 3PVBA 4QRCA 2HYYA 3EH9A 4KIKB 5HU3A 5AM6A 3W2OA 3A8WA 3ZBXA 4RVLA 5CEMA 4KS7A 4CCBA 3G9LX 4C38A 2A1AB 4IADA 2C5YA 5CU6A 3HYHA 5EK7A 1JAMA 4RFZA 3GEQA 5HO8A 4RWKA 4ANSA 5CAVA 4EYJA 4KIOA 4CQEA 4O7ZA 4E5BA 3VHEA 1XJDA 5EKOA 3PDTA 3V8WA 3PWDA 5BYYA 4JR7A 4TWNA 2PVHA 4QMQA 4DT8A 3PPJA 5FP5A 2XVDA 2KULA 4OAVB 3E88A 4PWNA 2GS6A 2VWYA 1OZ1A 1YRPA 4E4XA 4RZWA 5A3XA 3NNUA 4YJPA 3QCSA 5KUPA 2XS0A 4X2JA 2BZJA 4QP6A 4CZYB 2R7BA 3HGKA 1OL5A 3OVVA 2W1IA 4EORA 3ZBFA 3O23A 2EXMA 3R9RA 4U97A 3VVHA 3IK3A 2IW6A 3E8CA 4GK3A 2YM3A 4QPMA 2OJGA 4YURA 4EJ7A 4RIWA 4JJRA 3A60A 2QNJA 4W9WA 5BVFA 4B9DA 3Q2JA 3CPBA 4BBEA 4LQMA 2R3HA 5JQ8A 5EQYA 2BKKA 3TEIA 2PK9A 2SRCA 4XH6A 3O51A 3S00A 3TNIA 3DKCA 4NH1A 2BRMA 4CVAA 3A7FA 1H26A 2JBOA 2VTPA 2QODA 4BKZA 1UV5A 1XWSA 2CDZA 3U9CA 4QYFA 2XEZA 3Q3BA 4R5YA 1EH4A 5HIEA 4AWIA 4C33A 5ANIA 4DH8A 3EIDA 4CFNA 3MDYA 4E73A 5C4LA 1ZYCA 3EQHA 1W84A 4QYYA 4RJ6A 3C4ZA 3C0GA 4G6OA 2Y6MA 4USEA 3FPMA 3W18A 4O81A 3A4PA 3QUPA 2BAQA 4ANBA 1YI3A 3F5XA 3HV3A 4I5HA 2YCQA 3UG2A 3O71A 1PHKA 3GCSA 4RBLA 2O2UA 3W8LA 3F3WA 3MJ2A 3RHXA 4EOSA 4XS2A 1YXTA 3QTXA 5CI7A 4K0YA 3I0OA 1FVTA 1J1BA 3KEXA 4TT7A 4UEUA 4AW2A 4D1XA 4UWBA 1AD5A 4U40A 2VWVA 2J0KA 5D11A 3MPMA 5J5SA 3AGLA 4ITIA 4ZEGA 3ZO2A 2GNFA 3HKOA 2HW6A 5CSWA 3A7GA 3LQ3A 3PXRA 4QP2A 4QQCA 2VGOA 4FOBA 4WNMA 1LR4A 2YM5A 2C5OA 5KZ0A 2XYNA 4BGGA 1ZY4A 1ERKA 4C2WA 2QG5A 2VTQA 2XK3A 3QD3A 4G16A 4G9RA 4G3CA 3GQLA 4J95A 2VX3A 3ANRA 4M69A 4NKAA 4YNOA 3VF9A 1ZYDA 3EL7A 3ZRKA 4YTHA 1Q8TA 1IA8A 3MVHA 4BCNA 4MQ1A 2VD5A 3R9OA 1WVWA 5TO8A 3BGQA 2C6MA 4KB8A 1VYWA 3ZONA 5FUTA 3H4JA 2I0VA 4QP8A 2WELA 4Y83A 5H8BA 4HNFA 2PVKA 3ZMMA 3OC1A 4M15A 4XG4A 4AOJA 4C4EA 3R1SA 3BLQA 3ZUUA 2E9VA 2ZM1A 2X6EA 1OPJA 4EQUA 4IW0A 1LEWA 4L7SA 4X21A 3OT3A 3RMFA 2V62A 3OZ6A 3P7CA 5FTQA 3ZYAA 3FAAA 2QOIA 3KRRA 3V5LA 4DYMA 2PYWA 4IM0A 3K3IA 5D10A 4KBCA 2GSFA 2WTKB 3DOGA 2XK6A 2YM6A 4LGDA 4MNFA 5CSXA 4DGGA 3QC4A 5J5TA 4QO9A 1IRKA 5C1QB 2J5EA 2PY3A 3CQEA 3NAXA 4EC8A 2G15A 2O0UA 3DJ6A 3UE4A 4NEUA 1OM1A 4LGHA 3UNZA 3UQFA 3RPVA 3UYSA 1KV1A 5J79A 3O7LD 3EFJA 2C68A 5E1EA 1I44A 2RFNA 4DGNA 4GFGA 4OTRA 4DFUA 2UZUE 4GW8A 4DAWA 3P7AA 3UP2A 3ZDUA 4YC8A 4GKIA 4LOQA 4ZLYA 1YOJA 3K5VA 3NGAA 2WMRA 4UXLA 1F0QA 3FMNA 1XBBA 4PL3A 4TL0A 3LQ8A 2I0HA 2A27A 2QOKA 3R1NA 5K0KA 4F6SA 2F7EE 4YJSA 3GI3A 4V01A 3U8WA 3KXXA 3QCQA 1F3MC 5HNBA 3P08A 5JH6A 3TM0A 2R5TA 4O0XA 3OW4A 4FZ7A 4RWLA 2JIIA 3FI2A 5CASA 3BE9A 4R6VA 3TDVA 5AP2A 3Q4TA 2CSNA 3Q60A 1Y91A 4EZ3A 3UIMA 5CNOA 2RFDA 3EN6A 4L9IA 2R3NA 3V5JA 5ANKA 4O7WA 3OCGA 4XYFA 2AYPA 3W10A 3DJ7A 4FTMA 4LOPA 1VJYA 2JDVA 2QKWB 2WTIA 5EHOA 3VNTA 5HTCA 5IG1A 4YPSA 4N4SA 4D1ZA 4L6QA 2HOGA 4FK3A 4O1OA 3W2PA 4PL5A 4FT5A 1IASA 2C69A 4GKHA 3UO4A 2I0YA 4CTBA 4KSPA 3IONA 1F5QA 3GC7A 4B99A 3ZTXA 2LGCA 3DBDA 3VJNA 4GU6A 4IDTA 3LFSA 4EZ5A 5AP7A 4JL9A 1Q8YA 2CJMA 2AC3A 4AA4A 2AC5A 4DE4A 1G3NA 2PZ5A 2YAKA 3RPSA 2UZTA 2GMXA 2VUWA 3REPA 4BYJA 5KMJA 3PY1A 4JR3A 5CANA 1PKDA 2EXEA 4IAZA 4F9WA 2CCIA 3F7ZA 4XUFA 3VUGA 3R01A 3WARA 2ITXA 5ANOA 3RAHA 4Z7GA 2GTNA 3BLRA 2OW3A 2X7FA 5AM7A 4K33A 4FF8A 4ZJJA 3WBLA 3S2PA 3AG9A 1UNLA 3P5KA 3MJ1A 4ZSJA 5IQCA 2W1FA 5FP6A 1WBNA 5CF5A 4YJRA 3QWJA 3NUYA 4YZDA 2G2IA 4FC0A 1JBPE 3COHA 3DKGA 4FVRA 4DTAA 1UWJA 2WOUA 1XQZA 3HDNA 5I3OA 5A9UA 4IC7A 4APPA 4QTAA 3DXPA 2H96A 4YBKA 2CNUA 3CXWA 3G90X 5A4QA 5I9YA 5K9IA 5L6WL 5J87A 2ITVA 1WVYA 1YXUA 3ORXA 2WQMA 1GJOA 4D2WA 5KBQA 2PUUA 3MB6A 1VEBA 1OKZA 1PYXA 4W4XA 3D15A 3QQUA 3QXPA 4BYIA 5AFVA 5CZHA 2WTWA 3FQHA 4PRJA 4CD0A 2XBAA 2WMTA 3I1AA 4Y95A 1WAKA 5EYDA 3BRBA 4R1YA 1Q99A 3COKA 3R8MA 3BI6A 3BV3A 4EL9A 3PSBA 3QQGA 3PXQA 3TUDA 3DCVA 3TNQB 4USDA 4IX5A 4DFYA 1PXKA 5GZ8A 2JAVA 1PJKA 2WQNA 2GNIA 2PZYA 2C6EA 5FXSA 2UW0A 2Z7LA 3IG7A 4KA3A 2Y4PA 3P0MA 3R7VA 3TZ8A 5JFWA 4F7SA 5IMXA 1ND4A 3AC5A 3RPYA 4X7QA 4U5JA 4BFMA 5AV0A 2O8YA 5JFSA 5K5XA 3QRKA 5M55A 4IX3A 2HK5A 3D7TA 4YJUA 5AMNA 5HTIA 5F20A 4FV7A 4YU2A 4O6EA 2IVSA 3R8LA 3QGYA 3PE2A 4TN6A 3GU7A 3SX9A 4G9CA 2CKEA 3PIYA 4HW7A 3FY2A 4J96A 1BUHA 3GNIB 4DG3E 3IO7A 1SNXA 3BX5A 1MRYA 1E1VA 5CF6A 3N9XA 5EH0A 4L7FA 4YTCA 2GNGA 4C61A 4O21A 1B38A 4BF2A 1OUYA 1Y57A 3LCDA 2XJ1A 3LE6A 3OXTA 4WG5A 3P78A 5HTBA 2VWZA 4TYJA 4BVUA 2C30A 3WZEA 2GHGA 5CAOA 2ZV2A 2RG5A 1FMOE 4KNBA 1U4DA 2A0CX 3GFEA 4PPCA 4M66A 4MKCA 4HZSA 3MH2A 4NFMA 5D9HA 4RIYB 5CEIA 4YC3A 5JMSA 2ITYA 3KU2A 4ZSAA 2RGPA 5E8XA 3EN7A 3UIXA 2WB8A 1KV2A 4C34A 1IEPA 4YP8A 3W33A 3KREA 3G15A 3DFCB 4HYIA 3TACA 2UW3A 2JIUA 5I4NA 5HLPA 1ZYSA 3NEWA 3P23A 2EVAA 1NXKA 4BTKA 1CMKE 4O38A 1RE8A 2GFCA 2QD9A 3Q2MA 1DAYA 4QYHA 2WPAA 4PQNA 4W4VA 3WE4A 4AU8A 4G6NA 2CKQA 2P3GX 4DG0E 1FMKA 2EB3A 4FVPA 1DS5A 2ERZE 3QRJA 2WMXA 3MWUA 4FKVA 4EBWA 4FZFB 5EOLA 1YXXA 3DA6A 3NNWA 3PVWA 2W96B 2C1BA 4O84A 4J8MA 3V5QA 3VO3A 2VX0A 3ORIA 3ZHPC 2P33A 3TDWA 4DH7A 5IUGA 2ZV7A 4M0ZA 1Z5MA 3K3JA 3KQ7A 4NFNA 2JBPA 3ZZEA 5TE0A 3N4VA 5IMEA 2FYSA 2P4IA 2W5AA 2F2CB 4G31A 4PPAA 3OD6X 2PVFA 4QMTA 2DQ7X 3GC0A 1IG1A 1XH6A 4GEOA 5HG8A 3DB8A 4RMZA 4UY9A 4BN1A 3U4WA 1PW2A 2JDRA 3BEGA 1K2PA 4P5ZA 4IEBA 3SKCA 4GK4A 3DBFA 4O7YA 2WMSA 4ZTNA 4H3BA 3ULIA 4NL0A 4D5KA 3BHHA 5H9BA 4XJ0A 4FSUA 1SNUA 4ENYA 3UO5A 4MWHA 3MVMA 3BV2A 4QYGA 3KULB 3MTLA 4Q5EA 3TTIA 5IA3A 3Q4ZA 2WQOA 2VRXA 3LVPA 3C7QA 4K18A 4UMUA 1CSNA 4XHKB 2C5XA 2R3QA 3OUNB 2EU9A 3Q9WA 4U81A 4MYGA 3MB7A 2RL5A 2PWLA 3BWFA 3R9HA 4FTNA 5HG9A 5BVDA 5EW3A 4QTEA 3F88A 4FKTA 3HMOA 1OL2A 2C6IA 3HRCA 3KMWA 2R3OA 1R0EA 3KRWA 3R28A 1J7LA 5L8KA 1PXPA 1Q97A 1JWHA 4S30A 4ANQA 5BPYA 3PWYA 4C62A 4FTTA 4RWIA 3QRIA 3OWKA 3FY0A 3MY5A 2V22A 3FI3A 2PVMA 4ZS4A 4NM7A 1SVGA 2XNMA 2LAVA 2RG6A 3K54A 4TWCA 4ERKA 5HKMA 4BR3A 3QTWA 1LPUA 3SOCA 4V05A 2OIQA 4YMJA 3G5DA 5AR3A 5JKGA 5LMKA 3NVMB 3KRJA 2GS7A 3D5VA 3V5PA 1Q8UA 2YDJA 5BVKA 2X4ZA 3D14A 3ETAA 4G3FA 2CN8A 3F2AA 4IM2A 4QT1A 4EOQA 3EQFA 2J9MA 4JBOA 3QQJA 1GIHA 4CFVA 2WTDA 4A9SA 3QL8A 5AAGA 2YM8A 3QXOA 1URCA 1Q8WA 3DK3A 3W2CA 4KINA 1QPCA 3KXMA 3TJCA 4BDJA 4E93A 5FXRA 5HI2A 4IZAA 5JEBA 3GENA 1MRVA 4RIOA 4ANLA 3LMGA 3OY1A 5E9EA 2ETKA 5C9CA 3R8PA 4GYGA 4FKWA 4CXAA 5M57A 2OF4A 3HLLA 4KD1A 4O7VA 4EUTA 4FTKA 5J1VA 2WMWA 1BL7A 3PE1A 4RVKA 4EOLA 5A4TA 5F9EA 2J50A 3OOGA 2WHBA 3UG1A 3F3UA 3LHJA 1XH8A 2PVJA 2B9FA 5DI1A 3QTRA 1H01A 2G2HA 3DK7A 4FKGA 2WEVA 3DDPA 1XBAA 1FVRA 4FIHA 4S32A 3U6JA 3FI8A 5DMZA 2BAKA 4AZTA 5IKWA 4L67A 2JKKA 4FODA 4NYEA 3JUHA 3ORPA 4X2FA 2B0QA 5KZIA 2ONLC 3V04A 2WTCA 5BMMA 4MXXA 5EI2A 2QURA 3TNPC 4L46A 4ACGA 4OBQA 4PDYA 3LFAA 1H0VA 4C4FA 5IH4A 4MVFA 3WZKA 3UNKA 2BZHB 4CLIA 2XK9A 4RIWB 3I6UA 5E4HA 4XV1A 3E8NA 1WBPA 4BDHA 4AAAA 3ZEPA 3GCVA 3I5NA 4JRNA 4X3FC 4YJOA 2WXVA 3R1QA 1OI9A 5JFXA 3UZRA 4EH7A 2CGVA 3ATSA 4UMQA 4U44A 4YSJA 2VWIA 2FSOX 4PMPA 5G6VA 4DH5A 1OL7A 5AUVA 1SVEA 3NNXA 3QA0A 4AGUA 2RFSA 5GZAA 3TUCA 3WOWA 1WCCA 4OTWA 4UYNA 3BU3A 5DOSA 4G3EA 1YW2A 4ANMA 4R3CA 4YBJA 3BQRA 1U5QA 3RWPA 2Y8OA 2JDSA 2W06A 2PTKA 5M08A 3PA3A 2EUFB 3QLFA 3HA6A 5KMNA 2ZMCA 2VZ6A 3A62A 3V3VA 2W1ZA 1KE5A 2F4JA 3KXHA 4M69B 1H1SA 2R64A 4TNDA 2VNYA 2CLQA 5DR9A 3FMJA 4CYJA 3HRFA 4AA0A 1OPKA 2HZ4A 3SXSA 4GIIA 4ASEA 1YVJA 4TZRA 3E5AA 3BHYA 1OB3A 2J0JA 2O63A 3R7IA 2XMYA 2QOLA 2W7XA 3OFMA 3TV7A 2OF2A 3O8UA 2VTJA 3KVWA 4X2KA 3GCUA 4FKUA 4O0RA 4F0IA 1OUKA 3DLZA 5HLWA 3ULZA 3SA0A 3CY2A 2ETRA 4FZAB 3M42A 3OXIA 4ZZMA 5FEQA 1M14A 2C6TA 3CJFA 5L2IA 3SXRA 1OL1A 1YHSA 4RA5A 2QVSE 4EH8A 5L6OA 4FV8A 3C4CA 2YLEA 4HGSA 4IJPA 5LCJA 1RJBA 2W9FB 1ZLTA 3S0OA 2X9FA 4C0TA 3NW5A 2VTMA 1J7IA 4P7EA 4ZTSA 2UW8A 3DXNA 2PVRA 3KULA 4IZ5A 1V0BA 4Z9LA 4BDFA 5M4IA 3EQPA 2ITZA 4BZOA 3Q96A 4D2TA 5AP3A 3DV3A 1YDTE 4BBMA 4F7JA 3R22A 2VGPA 3C1XA 2B54A 3L1SA 3NDMA 4AUAA 1G8AA 3N51A 2XUUA 2IZRA 4CCUA 4F0FA 2WMVA 4ZTMA 5EFQA 5I9VA 1GIJA 3FZSA 5DGZA 2XRWA 2BHEA 4MXAA 3RPRA 2IZUA 4BCOA 2GQSA 1W0XC 3I7BA 2JFLA 4RX5A 3R83A 1Q3WA 4F08A 1GZKA 3ANQA 4BCQA 4JQ8A 5IF1A 3R63A 2ITOA 3IW5A 3JS2A 3DQXA 1R1WA 3LQ5A 5DYJA 2ACXA 3MY0A 4IAFA 4RT7A 4F9AA 2XIZA 2Y4IC 4RFMA 4BCMA 3ZRLA 4OGRA 5KNJA 4BL1A 5AA9A 4JDKA 5DWRA 2VN9A 4RRVA 5EW8A 3T9TA 2B9IA 4BI1A 3HRBA 4DEIA 4D2RA 1I09A 5BVOA 3KCFA 3TCPA 2J7TA 3VAPA 4TXCA 3FLQA 3GC9A 5M4FA 4CZUA 1KE6A 4AG8A 2HENA 3MIAA 2NP8A 5AUWA 3ZCLA 4F9BA 2WAJA 3FC2A 4PP9A 4LI5A 3GOKA 2OXXA 3LM0A 3LMIA 4DT9A 3FXZA 2ZYBA 2ZM4A 2YIQA 1K9AA 3W2QA 4OTFA 3U9NA 4EWQA 3FWQA 2X8EA 3F5GA 3KF7A 4CYIA 5TR6A 4M13A 3WI6A 2C5NA 3F6XA 4ANOA 4DHFA 1PXMA 4A06A 4IC8A 4TWOA 4ZTHA 4ALWA 5AA8A 4FEXA 4DCAA 3ROYA 3FQSA 2IG7A 2BR1A 4E20A 3H9RA 4CFMA 3F9NA 2XKEA 4ZTQA 4RX9A 3HMPA 5E8TA 5IQDA 2X39A 4MNEA 5HE0A 5DFPA 2QLUA 4AOTA 1NT2A 4MD8E 4XG6A 5IQGA 3B8QA 4FIIA 4FKOA 3AC3A 3BKBA 2YIXA 4GUEA 4HYHA 5TT7A 2C6OA 3VUHA 3JR1A 3L9LA 3MFRA 1Y6BA 4CFXA 2JEDA 3QAME 2W17A 2YCRA 3Q4UA 5HD4A 2UZDA 4GRBA 5HVYA 3VS6A 3NIZA 3L8XA 3TV4A 1KWPA 2XBJA 1XH7A 3F7WA 3JVRA 3UNJA 1TQPA 1SYKA 1H1RA 4WG3A 4CT2A 2PPQA 4J7BA 2P2HA 4JAIA 4LRMA 4NW6A 4H05A 2ZVAA 1FBNA 3I60A 5LVNA 1P2AA 4CMOA 3HVCA 2XNNA 2UVXA 2C3IB 1Y6AA 2XYUA 5CWZA 3KC3A 3QFVA 4X6RA 1IR3A 4O83A 3KKVA 4IVCA 5FDPA 4Q2AA 2IPXA 4M12A 5B0XA 4AACA 2A19B 4H3QA 5CVGA 2A4LA 3WE8A 4GFOA 4I6HA 3R02A 4ZP5A 4PMTA 4HVGA 4I5CA 4O7TA 2C3KA 4DC2A 2UZWE 4QMUA 4FL2A 3E8DA 3NZ0A 5T6KA 3I81A 3OCSA 1GZ8A 3PZEA 4CQGA 5IEYA 5IQFA 4L3PA 3OOMA 4ARKA 3SVVA 4UZDA 1W82A 5IQIA 5H8GA 1HCKA 3VJOA 3D7ZA 4MD9E 4QMZA 2YACA 4NCTA 4I0TA 4F4PA 4BCHA
chains in the Genus database with same CATH superfamily
2WQEA 4Q5HA 5HNIX 2OIBA 2R3IA 1S9JA 2R3MA 2G1TA 3ACKA 4U3YA 5E8YA 3D7TB 3KXNA 4QMYA 4G17A 4D5HA 4FGBA 1J7UA 3VBYA 4W8DA 3HEGA 4I94A 3DNDA 1H1QA 1DI9A 2PVYA 1M2QA 2RFEA 3T9IA 2JFMA 3ZS5A 4OTGA 4OTPA 4FTAA 3AC2A 2ZOQA 2I40A 4FTLA 5HLNA 4E26A 5IQAA 3MH0A 4GUBA 4EC9A 2R9SA 3VS2A 3UTOA 5JSMA 4BWKA 3F3ZA 2B52A 1R3CA 2R3FA 2XKFA 3DY7A 2XM9A 1MQ4A 2O65A 5DBXA 5ACBC 1PY5A 3PZHA 4FTOA 4IAIA 4XV9A 1QPDA 3VS4A 4EJNA 3OMVA 4FT9A 5DLSA 1A9UA 3VUKA 4EHGA 4F6UA 3UOJA 4G6LA 4J53A 4PTEA 4EWHA 1SVHA 3V5TA 2P55A 4W4WA 4QMOA 1JOWB 3NCGA 2X6DA 2W1CA 3FZOA 3MH3A 3NCZA 4N70A 2C6KA 3G6HA 3R2YA 3PSCA 1TKIA 5CYIA 4DTKA 3ORKA 4FYOA 5ACKA 3JPVA 4HPTE 4M97A 4AGCA 4LFIA 3BU6A 4ACMA 5FQDC 3RAKA 3MGYA 4C36A 2XNEA 1SM2A 2YM7A 5BVNA 4F6WA 4AZFA 1PXNA 2ZJWA 4ZY6A 2JKOA 3FLSA 4O96A 3VS5A 1G8JA 4HYSA 5CSVA 4LV8A 4D58A 4F63A 3TKIA 2E2BA 3VS7A 4YR8A 3QRTA 4P5QA 3AD4A 4JMQA 3A7JA 3KMMA 2X8DA 4EH9A 3BWJA 2BILB 2UVYA 3MPTA 3QBNA 4QTBA 4EK3A 4XLIA 2P0CA 4FTUA 4XRLA 4AA5A 2PE2A 2YAAA 4J52A 5CU4A 3AQVA 5AAEA 2UV2A 5GHVA 5F4NA 4WNPA 3ZSGA 3RNIA 3NW6A 3CCNA 5DN3A 2YA9A 5HE1A 5C26A 3FXWA 3KFAA 4QMSA 4EKLA 4L00A 4F7LA 4QEBA 4PY1A 1XH9A 1H00A 1TZDA 2UZVA 4CKIA 3HX4A 2BRHA 3NYVA 3ODYX 5CAUA 3KXGA 5AV4A 3C0HA 4KABA 4O7LA 4AW5A 5IQHA 2OSCA 3CD8A 5M4CA 1MQBA 2OJFE 3F5PA 3EN4A 3FZPA 3UYTA 3KA0A 3FZTA 3VS0A 4B7TA 4XLVA 4C2VA 4CSVA 3BHUA 4RJ5A 4USFA 5CTPA 4FKLA 2ITWA 2PMLX 2ETMA 3MW1A 1PXOA 5EM6A 5HNGA 2BVAA 1XHAA 3RK7A 4FV4A 4FV9A 2HW7A 4O6LA 2JLDA 1QPJA 1YDSE 4HGTA 4E6CA 2F57A 2ITQA 4B6LA 4LGGA 5E8UA 2QOQA 4EUUA 4Z55A 5L6PA 5EW9A 1YI4A 1K3AA 2Q83A 3PTGA 5ETIA 3AC8A 3RBWA 3HV4A 4D9TA 2XAMA 1AGWA 1NVQA 1NY3A 3GCQA 1VYZA 3CKWA 3Q9YA 5EOBA 4UN0C 4FG7A 3RAIA 1G5SA 4DG2E 4A9TA 3AC1A 3LAUA 4ZY5A 3NFFB 3HECA 4BDIA 3W0NA 1TQIA 3FV8A 1ZOGA 3MS9A 4DGOA 3NYNA 1DI8A 3WILA 5A54A 3PRIA 3WYYA 4DITA 2XZSA 4Z3VA 5IPJA 4GFMA 2YDKA 2BUJA 2VU3A 3ZLWA 4YHFA 3VBWA 5K3YA 4AN9A 4BDDA 4O4EA 1M17A 5LMKC 4I3ZA 4BIBA 2WEIA 3NRMA 2XIKA 3G0FA 3O50A 4BTMA 2H9VA 4BDKA 2JC6A 1FOTA 1W2CA 4RC2A 4DEDA 2F49A 3FI4A 4TY1A 3FSKA 4BDBA 1ST4A 4UMTA 3UJGA 5IEXA 3WIGA 3VBVA 1XKKA 2F9GA 4I92A 3LZBA 4RSSA 2Q0BA 2W1GA 2FA2A 4XBUA 5M44A 3HNGA 5HG5A 3GQIA 3EMGA 1M7NA 1KE9A 3LPBA 4FSZA 4I6FA 3MY1A 2WIHA 2XIRA 5M53A 3UIBA 5CS6A 5CQWA 3V8TA 3Q53A 2R3KA 1GOLA 5FBOA 4XV3A 1GZNA 4FKJA 2C6DA 3FMKA 4CEGA 2Z7RA 4CFUA 5I9XA 5BUJA 2CMWA 3M11A 4EOMA 4YJVA 3A61A 2WTJA 4IJ9A 2XRUA 3H0YA 4D9UA 5C01A 5HBJA 2J4ZA 3UVRA 3DJ5A 3O7LB 4GH2A 4DN5A 1GIIA 5CENA 3CR0A 2YHVA 5A6NA 4AW1A 3HMIA 5HE3A 3TXOA 3BIZA 3IS5A 5DT3A 5CALA 4M0YA 2C0OA 3NW7A 2KTYA 4U45A 2XK4A 3POOA 1JLUE 4AOIA 4CV8A 4AZEA 1YXSA 2OKRA 3CSVA 2QLQA 4Z16A 1MUOA 1VR2A 4FTIA 3RK5A 2BMCA 4BCJA 2OFVA 4O7RA 3NIEA 4IVBA 4J71A 4ALVA 5IA4A 4PF4A 4IB1A 2R4BA 4IWDA 3C4WA 3SRVB 4IQ6A 2R7IA 5E7RA 2QU5A 2VAGA 5AUXA 4GK2A 2YCSA 5AJQA 3QU0A 4E5AX 4LM5A 3TKHA 3BQCA 3KN6A 1DAWA 1ZZLA 5CU3A 4JDHA 1UNHA 2QO2A 3P4KA 3EWHA 4JIKA 3TKUA 4A7CA 4BIEA 3BELA 3ZEWA 2PU8A 2G01A 3H30A 3QQHA 4C3FA 5KO1A 5DT0A 2NRUA 3NS9A 2HY81 4PDOA 4U9AA 4R3RA 2ITPA 4QNYA 4W9XA 2H34A 1UWHA 3TN8A 5AX3A 3VS3A 3SW7A 5LCKA 3C13A 3D9VA 2BZKB 4IB3A 1U5RA 4U6RA 2VO3A 1ZARA 3R00A 3QZIA 3QHWA 3ZUTA 5GZ9A 4YJNA 4GIHA 4DDIA 4FTQA 2W0JA 1KOBA 3A99A 1Q3DA 4OT6A 3EFLA 4F78A 2BFYA 5DH3A 4E5WA 4OLIA 3FLYA 3IPHA 2QO9A 2ERKA 1M2PA 4I5PA 3QD4A 2Z7QA 3SDJA 3TIYA 3O0GA 4CZTA 5G1XA 2WKMA 3E64A 3CJGA 4MXOA 1Z57A 4NW5A 3UVQA 1VLRA 3UODA 4NK9A 3LCTA 5CVFA 1TQMA 4PUZA 3QKMA 4BHNA 4EOOA 4EYMA 3QYWA 4G1WA 5HHWA 3IW7A 4YUQA 3R30A 4X0MA 2V5QA 3SRVA 3TUBA 1HOWA 4YZCA 4F7NA 4C35A 3UOLA 4XNEA 4A9UA 3ALOA 4GSBA 2W1HA 3ORNA 4DLIA 5CF8A 2RIOA 3R9DA 2REIA 4EH4A 3MIYA 3PA4A 1FQ1B 5FD2A 1P14A 3DAEA 3V5WA 5IDPA 3EYHA 3HAVA 3COMA 3JY9A 3QA8A 2OJJA 4H58A 3ALNA 4YSMA 3U87A 4C57A 5JGBA 3VN9A 4IWOA 5C8NA 3U6HA 2ZAZA 2YLFA 3EB0A 1T46A 3ODZX 4IACA 5L3AA 1FINA 3BYMA 3ORTA 4I41A 2VTHA 4CRLA 1URWA 1STCE 3NWWA 4IHPA 5A14A 4FEWA 3UOHA 1ZYJA 3QALE 3LOKA 2FB8A 2H6DA 3BLHA 4DGMA 3A2CA 2I0EA 3QX4A 3UC4A 3SC1A 2QR7A 3ZXZA 4LYNA 4ENXA 2JIVA 5IH6A 2I7QA 4EK5A 2BDWA 4IAYA 3PUPA 4JLCA 4DLJA 2Q0NA 2UUEA 2OU7A 3QZGA 4BCIA 4K6ZA 4EHEA 3AXWA 4V0GB 4ASDA 2FH9A 2Z7SA 4OUCA 5JRSA 2IO6A 1YKRA 3AT4A 4TRLA 2ESMA 3LLAA 2VWUA 1ZAOA 5L2SA 2F2UA 3L8VA 5CY3A 4DEHA 1OGUA 4OTDA 4YTFA 4FZDB 4ACHA 2GQGA 2GPHA 4DH3A 5EYMA 2XM8A 4HNIA 5LWMA 3P7BA 3FLWA 3F61A 2WU6A 4DGLC 4KWPA 4F64A 4R7BA 4JDIA 4YZNA 2R3GA 5HO7A 2GS2A 4CRSA 3MFSA 5ANJA 5HBHA 4O4BB 5F95A 4E3CA 5KHWA 3OF0A 4H36A 3FMDA 5CX9A 1W8CA 4FTJA 4KRCA 1JKLA 4MXZA 3F69A 4BCGA 5CT0A 3C4FA 3R73A 2BIYA 1GY3A 1KUTA 3OG7A 3RJCA 4PTCA 3I7CA 2WZJA 2OZOA 3KN5A 3A7HA 4BJJB 3BGZA 3VBQA 4E4MA 4DA5A 3IDPA 4ALUA 4FG8A 3WIKA 3OCTA 3BHVA 3E8EA 4L68A 1JQHA 2OBJA 1Q4LA 4QP1A 4EOKA 4O82A 4IVAA 4DFNA 5GIPE 5IA2A 2ZB1A 1BL6A 1ZMUA 4FKSA 1WZYA 4FR4A 5BVWA 4S34A 2YWVA 5CT7A 3DNEA 4JNWA 4I6BA 5D7VA 3CTQA 3VUMA 2CGXA 4TKSA 4EK4A 4Y73A 4I0SA 4MBIA 4M84A 4O2ZA 4EK8A 4N0SA 4ZJVA 2YEXA 3P79A 5IA5A 3OTUA 4HZRA 4YO6A 1YXVA 3NPCA 2ZM3A 5AX9A 3CC6A 2C47A 3NLBA 4FG9A 4GU9A 4XG3A 3RP9A 5AUTA 4MNEB 4HVIA 3ML1A 3GCPA 2XA4A 3FZ1A 4FSMA 4IZYA 4EHZA 4I6QA 4QP3A 4FT0A 3R1YA 3U51A 5AWMA 4BGQA 4E8AA 2GFSA 3FC1X 5FRIA 1M52A 4QMMA 1OGYA 3Q04A 4IB5A 4BCPA 4RIXA 4FVQA 3R7UA 2ONLA 4DBNA 2O64A 3ZSHA 2UW9A 5JT2A 3V8SA 2Y4IB 2QI8A 3DTWA 5HCYA 3BPRA 3FMHA 4LMUA 4TW9A 3S95A 4LMNA 4F99A 2ZV9A 1H07A 4GMYA 3WF9A 4DEBA 5CF4A 1PKGA 1OKWA 4IFCA 5L8LA 5J1WA 1RW8A 4C4JA 1M7QA 3O2MA 4R7IA 3II5A 4L01A 4JQEA 5CVHA 5E8SA 4ZIMA 2YDIA 2UZBA 1R39A 3IECA 3IDCA 3PIXA 4I22A 4II5A 4S2ZA 1KOAA 3S3IA 4ID7A 1H25A 3D0EA 4QMLA 2BIKB 3QQKA 3QTUA 3ZOSA 4L42A 3OEZA 2AEGA 2R0IA 4E6DA 2YM4A 3ACJA 2HZIA 4BTFA 4ZTRA 5BVEA 1J91A 3EOCA 2PUNA 5C03A 3UPXA 3R7OA 2X2KA 4WSYA 1NW1A 2OJ9A 1WVXA 4QPAA 2JDOA 2X4FA 4GJ3A 4S31A 3CGOA 3MA6A 4V04A 4RX7A 4W8EA 1BKXA 4PX6A 2J5FA 2XNPA 3GU5A 4U0IA 5HGIA 2AUHA 4O22A 3LFFA 5IU2A 5KHXA 3W2SA 3ZFYA 4BBFA 3H9FA 3PXYA 4GG5A 3QTQA 2ZFYA 3CKXA 1BI7A 3E62A 3VWAA 2WGJA 5ITAA 3D2KA 3ERKA 5EDQA 4IAAA 1SZMA 4OTQA 4C58A 3V01A 2X1NA 4J99A 4J8NA 4YC6A 5HG7A 4FGRA 5CXHA 4E1ZA 5LXMA 4KUJA 1OITA 2VTTA 4AZSA 3OEFX 4NZWB 4CTCA 3BLAA 1OMWA 1XR1A 5AR8A 4ZMFA 2QOFA 3FDNA 5I0BA 4BC6A 4J98A 5EHLA 2HZNA 2PHKA 3F3VA 4CG8A 3PLAE 4CGAA 3LMHA 2FSLX 5CU2A 4Y72A 3R8UA 4ZJIA 5FM2A 5M56A 3RK9A 4AGWA 3ORLA 4C3RA 5M07A 3PJ3A 5EQEA 3E92A 4OT5A 5GJGA 4TYHA 2VO7A 3KK8A 4XBRA 3V51A 4R3PA 4WD5A 5CEOA 4QDEA 4QQ5A 3W2RA 4H39A 2VWWA 3W0MA 1R78A 3HZTA 2V7AA 4G2FA 4XG7A 4FTCA 4AQCA 2PMNX 4OTIA 4QP9A 4X2GA 5AP5A 4S33A 5F1ZA 2OI4X 2Z60A 3VC4A 3RHKA 3QKKA 3LCSA 3NFGB 3HA8A 5JZNA 3SW4A 4AGDA 3HL7A 4DFZE 3BHTA 4C59A 5D12A 3DBQA 3KRLA 3P86A 4EOIA 4FNWA 1REKA 5CI6A 4X3FB 4JBQA 4DBXA 4R1VA 1CDKA 2E9OA 2XKCA 4F9YA 1UA2A 4OAUC 1UU3A 3HV7A 2BRGA 3QZFA 1XH4A 2QOCA 4OBPA 5AP6A 2ZV8A 3S4QA 2J6MA 5L4QA 5AR4A 1E9HA 2G2FA 1Y8YA 3Q52A 5ANEA 4BHZA 1PMNA 2CLXA 3MFUA 4O27B 3MESA 5DEYA 3DDQA 4JVGA 3PPKA 2OICA 4MWIA 4KBAA 3GGFA 1YWVA 3QZHA 4NKSA 4F65A 3RKBA 5GINE 4WHZA 3FPQA 4MBJA 5TF9A 4EONA 3E3PA 4FV2A 5ANDA 5HX8A 2W4KA 5DHJA 4EH3A 4WOVA 3CY3A 5JGDA 2C5VA 5IUHA 3HMNA 2XIYA 3D83A 5LARA 1S9IA 2E9NA 3U4UA 2YIYA 4RGJA 4NU1A 3TV6A 3VUDA 3ZLYA 4PPBA 3T8OA 4NTTA 4AN2A 3TMOA 1UU7A 2OIDA 4JG7A 3SG8A 2GHLA 3ENHA 4FEQA 3MPAA 5B2MA 4RJ7A 3GU6A 4ITHA 2W9ZB 3PP0A 4DINA 3NUXA 3OCBA 1H24A 1J3HA 3NYXA 1FGKA 2C0TA 4TYEA 5AP4A 3R6XA 5H2UA 3SAYA 4KBKA 1Q62A 3LJ1A 1PXLA 3ZC5A 2F7XE 1CKIA 4I93A 3TNHA 3NUSA 4RJ8A 1KE8A 5HIDA 5JRQA 4E7WA 3POZA 3Q6UA 3CLYA 3MVJA 3G6GA 5CZIA 3QQLA 5ANGA 2VTRA 3D5XA 4F0GA 5L2QA 5EKNA 4M68A 4KIPA 3ENMA 3NSZA 3VQUA 2DYLA 2GDOA 2BAJA 2UZNA 3UMWA 4K8AA 4F09A 4F1MA 2Z02A 3BYUA 3IDBA 4O0SA 4LDTA 4IX6A 4FUXA 2VO0A 3C5UA 4WUNA 5L2TA 4FEUA 3GB2A 2QONA 4FIFA 2Z2WA 3BZ3A 5KMLA 1OVEA 4X3JA 3E7OA 3L8PA 5DVRA 2R3LA 2BKZA 1H27A 2J90A 4O0WA 4B8MA 4R5SA 4FV3A 4D4VA 4BY9E 4FE2A 4GVAA 1L8TA 2BFXA 4H3PA 4QNAA 4FNYA 3MVLA 4HCUA 3LFBA 3I79A 1OIRA 2XNGA 3LM5A 3OS3A 4RFYA 1OIUA 5FG8A 4EQCA 2XAOA 4G5JA 4U8ZA 3Q5IA 4NWMA 3MYGA 5EM8A 4BCFA 4EZ7A 2VX1A 3I4BA 4RQVA 3DLSA 3FKLA 3P1AA 4ZSGA 3QD0A 3F5UA 4YZBA 3ZDIA 3FUPA 3OWJA 1A06A 4C4GA 4D2VA 3W1FA 4PTGA 3PJ1A 3DBCA 3SHEA 2WMAA 2WD1A 4K11A 2GTMA 2PZPA 2YIRA 4FIJA 1W2FA 4AZWA 1XO2B 4QOXA 2HWOA 3VIDA 2CGUA 3ORZA 4JI9A 4ZOGA 3HP5A 4NCTC 5BYZA 2GCDA 5IA0A 5DA3A 3BCEA 5GNKA 3EN5A 3DB6A 3FKOA 5C8MA 3QLGA 4WRGA 4KKEA 5KBRA 3OY3A 3LXKA 3U6IA 4YZMA 5KMOA 4XG8A 2IZTA 2YISA 3CIKA 4BI0A 1IA9A 2QOOA 3KB7A 3PXKA 1NA7A 4I5MA 4RLLA 4RVMA 4XP3A 2UW7A 4ZTLA 3RVGA 5JK3A 3Q6WA 4V0GA 1WBWA 1WBTA 3WF8A 3UQGA 4XCUA 4C4IA 4N6ZA 5DR2A 4KIKA 3Q32A 2PL0A 5CEQA 1TVOA 3OHTA 2BTRA 4ASXA 2CHLA 2OXYA 4EKKA 2ZDUA 5BX0A 5HESA 3EFWA 1KSWA 4CFWA 1UU9A 4I21A 4CMUA 3FYKX 4F1TA 4FEVA 2NRYA 4FT7A 4Z7HA 2FSMX 2PUPA 5AR2A 4G3DA 4DCEA 1OBGA 2GHMA 4QMWA 3T3VA 4AS0A 3F66A 3MBLA 3EKNA 3OROA 4QQTA 4X6QC 2C1AA 3O96A 2YJRA 2QCSA 5IEVA 3RNYA 2UZOA 4IE9A 4B8LA 1UKHA 4XP0A 5GIOE 3RCJA 2J2IB 4BDCA 2QC6A 3E63A 4KS8A 4Y85A 5DNRA 1BX6A 2PUIA 5EI8A 5IQBA 2OZAB 2QR8A 4FKRA 4PMSA 1FPUA 1ZY5A 4AN3A 2VWXA 5CSPA 4AXFA 2VTIA 5I5ZA 4RC4A 3PVUA 3RM7A 3JY0A 3GXLA 4RVTA 4NSTA 2JGZA 4L3LA 2WIPA 4IX4A 1YI6A 5EYKA 2QO7A 3AT2A 1CM8A 3F82A 4NIFB 5EHYA 3IW4A 4NUSA 2IVTA 4K9YA 3Q4CA 4FKQA 4FSTA 2W4OA 3FKNA 5IQEA 1APME 3S1HA 5HE2A 3I5ZA 2XK7A 4PL4A 2X2MA 2E9UA 2IJMA 1YHVA 4ITJA 3KK9A 4PDSA 4XG2A 5EQPA 4HCTA 4J1RA 4O91A 4ZY4A 3UZPA 2QQ7A 3EN9A 4YJQA 2YERA 4XMOA 2C0IA 3AMAA 4MF1A 2OFUA 4JQ7A 4Y5HA 3ET7A 3GUBA 2EXCX 4P90A 5CSHA 5FLFA 2IW8A 5AP1A 3DS6A 1T45A 3D5WA 4OW8A 3ORMA 3VUTA 4E6AA 5HVKA 2HY0A 2OGVA 4TWPA 5KMKA 4BZNA 4C7TA 3NUAA 2A98A 3QTIA 4NM3A 1H28A 5DRDA 4EOPA 3UBDA 4JRVA 4ONAA 3WF6A 2WO6A 5KE0A 4AX8A 2VNWA 4O7NA 2HZ0A 4CT1A 1M2RA 3VHKA 3T3UA 5J8IA 2X0OA 3F2RA 1Q41A 3G33A 3QHRA 3BYVA 3OXZA 3TIZA 5AV1A 5LQFA 3DK6A 4N6YA 4ERWA 4FA2A 3TZMA 2W05A 4UWYA 2Z8CA 4YHTA 3U54A 4BWXA 4Y46A 3RINA 1H1PA 1O6YA 5BMSA 4HPUE 1H1WA 4YJTA 5E90A 2ITNA 4GV1A 3M2WA 4NM0A 3THBA 4ACDA 3LJ0A 5AUYA 3ZXTA 4O86A 3PFQA 1OBDA 1WFCA 4ACCA 5EG3A 4Q9ZA 3H9OA 5L8JA 3OUKA 5AV3A 3DAKA 1NVSA 1Q61A 2XB7A 2X7OA 3LFCA 4QTCA 5T68A 3EHAA 1FVVA 2X0GA 3WYXA 3D5UA 4MAOA 4A4LA 3FHIA 4FSYA 1ZZ2A 5E92A 5AEPA 4FK6A 5EM7A 3SQQA 3NAYA 5I9ZA 3C51A 5LWNA 4EH6A 4FUYA 4BTJA 4HCVA 3RM6A 3HMMA 5A4CA 2UZLA 4QMNA 4D4YA 4L8MA 1CKPA 4MX9A 3ATTA 4U41A 4WT6A 5FEEA 4WA9A 3NX8A 1BMKA 3G51A 2HXLA 5ETAA 1NVRA 1O6LA 3H0ZA 3QGWA 5AR5A 4R78A 5A4LA 2VTAA 5FGKA 3ZH8A 4AF3A 3W0OA 4UV0A 2C4GA 3TTJA 4KAOA 4U79A 4FT3A 5JGAA 2WMUA 4XOZA 3AT3A 3A8XA 2YZLA 5M06A 1J1CA 1ZMWA 4IB0A 3HDMA 5B7VA 3C0IA 2W1EA 2JITA 4FKIA 4GCJA 3QTZA 3KXZA 4XOYA 3RZBA 3ZUVA 3FLZA 4CKRA 2YIWA 1V0OA 3BGPA 4NJ3A 3W32A 3LLTA 3RTPA 4B0GA 1R0PA 3W8QA 4D2PA 3D94A 2GNJA 3BU5A 4GS6A 5CNNA 3OWLA 4BZDA 4ZK5A 3U55A 5H3QA 4C37A 3VUIA 3ZO3A 4UMPA 4FZ6A 3FEGA 2B1PA 4BJJA 2JDTA 4WSQA 3EQIA 4OTHA 3SGCA 1ZOHA 3GC8A 4QYEA 2FVDA 5HBEA 3QYZA 4KIQA 3IOKA 3ZLXA 4RA4A 2FUMA 1BYGA 1QL6A 2F7ZE 4WBBB 4ASZA 3VS1A 3EQDA 3GU4A 4DHIB 1SMHA 4ZLZA 3TYKA 1JKKA 1OL6A 1ZYLA 4EH2A 3TG1A 2YFXA 4LUEA 4I4EA 3WZDA 1QPEA 1ZXEA 3KF4A 2CN5A 4IWQA 3AKKA 2ZB0A 3HV5A 3TI1A 2WNTA 4D1SA 4CNHA 4JG6A 2YITA 2XNBA 4J97A 2W1DA 4FX3A 3IGOA 5DG5A 3PG3A 4XX9A 5AAFA 3RZFA 4WIHA 3PG1A 2QHNA 1OIYA 4YLJA 1WBOA 4FMQA 1P4OA 4OR5A 4FYNA 4KKHA 4DEAA 3HAMA 5EDPA 4D4SA 4CG9A 5J9ZA 1YHWA 1ZWSA 3HUBA 5EDRA 3UP7A 5IZFA 4I1ZA 4LV5A 1PMVA 1Q8ZA 4JBPA 3LFEA 4U80A 3CEKA 2PVLA 4G5PA 2O5KA 5HCZA 1W2DA 2RSVA 2B9HA 2WMBA 4L44A 2QHMA 3GOPA 5KKRC 2X7GA 5DPVA 2R0UA 2W4JA 3LXNA 3R7GA 4IMYA 5HD7A 3JYAA 3RALA 3VF8A 4AE6A 1GAGA 3E7VA 3PXFA 4RZVA 3NMUF 3GT8A 3ZO4A 3JVSA 4MTAA 4A9RA 4FV0A 4FV1A 5IH5A 1JVPP 4XRJA 5BYLA 1LP4A 2CCHA 4IVDA 1GZOA 1UVRA 3QRUA 3FLNC 3CPCA 2OZAA 3PY0A 4GYIA 3TJDA 4AP7A 1P5EA 1U46A 3E93A 3L9MA 3QD2B 4FI1A 4IWPA 4QTDA 1YOLA 4O4DA 3OT8A 2Y7JA 5I9UA 2NO3A 3L9PA 2XJ0A 5HICA 3EYGA 5K0XA 3UZTA 3PLSA 4WNOA 3M1SA 1IAHA 5E8WA 3SXFA 4HOKA 4ANNA 2CPKE 3DFAA 4PNIA 2GU8A 3AMBA 3WF7A 2Y9QA 3O17A 1JSVA 4Y5QA 5FBNC 3R8ZA 5BNJA 3LCKA 5E91A 5E8ZA 4AT5A 3R9NA 3UC3A 1PRYA 4JG8A 3DGKA 5ETCA 3ZLSA 3RAWA 2NNWB 4ORKA 5H8EA 3QCXA 4UXQA 4LL5A 2JD5A 4AW0A 2X81A 3PRFA 4D55A 2PSQA 4FIGA 4FKPA 4BB4A 2FO0A 5I3RA 3QC9A 3KL8A 4M3QA 3BBWA 3DU8A 2WOTA 4RC3A 5FWKK 2HIWA 4EI4A 3EZRA 4RQKA 4D28A 2IN6A 3MI9A 3R0TA 2PZRA 1JSUA 5HCXA 2BRNA 3AKLA 3QWKA 4UALA 4BICA 4I4FA 3C4XA 5LJJA 5J9YA 3LFQA 4FTRA 1JNKA 3R8VA 2VTLA 2IVVA 2NPQA 3ZO1A 3RCDA 5CEKA 4BKYA 3MN3A 2B9JA 3PPZA 4I23A 4HJOA 1H08A 1YQJA 2BDJA 4RJ4A 2IWIA 5TKDA 4K77A 4XV2A 3FL5A 2BHHA 3FL4A 5KMMA 1UNGA 4UWCA 3UOKA 1OKVA 5CEPA 4R7HA 5BQ0A 4NJDA 4KSQA 4YHJA 4FNXA 4BKJA 4GT5A 4FRFA 2ITUA 2GNHA 4MCVA 2J0MB 3ZFXA 4QMPA 5M51A 3DBEA 4MD7E 2G9XA 2OXDA 2XJ2A 1QCFA 3K5UA 4PDPA 5HX6A 3B2TA 2X9EA 3E3BX 1GNGA 4QQJA 1O9UA 2OH0E 3KMUA 4G3GA 3G9NA 3BBTB 4XEYA 4RIYA 4RIXB 4CMTA 5DIAA 5TOZA 4CV9A 3DQWA 1A48A 3NVKI 5M09A 3GVUA 2BROA 4W4YA 4ZS0A 1PF8A 4X3FA 4BGHA 2UW4A 4L52A 1W7HA 4H1JA 4YPDA 4L43A 1V1KA 2BDFA 3BE2A 2XNOA 5LVPA 3R04A 4RLKA 5HQ0A 5HZNA 5DR6A 2OLCA 4I24A 2XCHA 2W5BA 3FMMA 2B7AA 4GT4A 2XH5A 3E87A 4MK0A 2XP2A 3LIJA 1ZOEA 3LFDA 3UMXA 1U54B 3FYJX 5BUEA 2W5HA 3DZQA 3ZRMA 4E4NA 5M4UA 2WTKC 3CD3A 2WTVA 2VO6A 4WKQA 3PFYA 3GU8A 3OWPA 4O0UA 5L2WA 4RG0A 3KVXA 4K2RA 5K5NA 3B8RA 1OIQA 4BWPA 4TYIA 2WQBA 3CS9A 3WZUA 2EWAA 4FOCA 1LUFA 3BEAA 4I20A 4M8TA 3LW0A 4F1OA 2OK1A 4RJ3A 2DS1A 3EQGA 3UDBA 4R77A 3IKAA 4FSWA 4PNKA 4ZZOA 3NR9A 4A4OA 4TTHB 3UVPA 4L53A 4BDEA 4I0RA 3Q5ZA 4C3PA 1REJA 2J51A 4M14A 1OECA 4C8BA 4DFXE 2OJIA 5KMIA 3FZRA 3TT0A 1CTPE 5IISA 5HOAA 5IUIA 4MBLA 4MH7A 2QU6A 2BPMA 2CNQA 3V6RA 3C5IA 2GQRA 4DFBA 2GNLA 2XKDA 3H10A 2HXQA 5AUZA 3SV0A 4EEVA 4UBAA 1WBVA