4M0ZA

Crystal structure of itk in complex with compound 5 {4-(carbamoylamino)-1-(7-methoxynaphthalen-1-yl)-1h-pyrazole-3-carboxamide}
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
264
structure length
264
Chain Sequence
KWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selectively targeting an inactive conformation of interleukin-2-inducible T-cell kinase by allosteric inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
total genus 88
structure length 264
sequence length 264
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m0zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m0zA01
4JJRA 5TO8A 3QF9A 3N4UA 3AC1A 3A7FA 3ZRKA 4AN9A 4L01A 5AUZA 2ZVAA 4IZ7A 4C57A 2O8YA 3BGPA 4KIKB 2AC3A 2ZM4A 4MD9E 3EL8A 2CGVA 4RMZA 4V0GA 4A9YA 5AUTA 5HNIX 3LKMA 3NMUF 4QP4A 4ZTMA 3POOA 4IDTA 3EQFA 3ZCLA 4C62A 1NA7A 2PTKA 4RJ3A 2WD1A 2IG7A 3UBDA 3QD2B 3LCTA 4PMMA 2VWZA 3R8MA 4BDIA 1CM8A 3HRCA 1K3AA 2NP8A 5J9ZA 1WBWA 3G2FA 4CLJA 2QOIA 3RCDA 4O7NA 4ZSGA 3Q53A 4IWPA 3FI3A 4G3CA 2WB8A 4H1JA 2XP2A 5AP4A 5GJGA 3IW8A 4DFXE 1DI9A 5FWKK 3FLNC 4CZUA 3KMMA 4L7FA 2QVSE 2W99B 5KMOA 1SVEA 3ACJA 5AM6A 4ASZA 2ITUA 2BIKB 4CZTA 5AR7A 4O81A 3IW6A 2VTOA 3PLAE 2W7XA 3U54A 5FLFA 5CVGA 2VWVA 4Z16A 3PSCA 2YM4A 4YC3A 3QYWA 3OP5A 1ZY4A 4O7VA 4LUDA 4UEUA 4XV9A 1FVRA 1JSUA 1SVHA 1URWA 4EUUA 5HLNA 4YJOA 4WNMA 4ZLZA 5BVFA 3PA4A 4HOKA 2X8IA 1YW2A 3KRLA 3W2CA 2RKUA 2PYWA 3OT8A 4UMUA 5BNJA 4KSQA 3OXIA 5L2TA 1BMKA 3FMEA 4CG9A 4BCPA 3I7BA 3JY9A 1Q4LA 3NDMA 5EI8A 3ORKA 3TNQB 3RHXA 5JMSA 4N57A 3R8PA 1Q99A 3EZVA 4AGUA 2VV9A 4A9TA 2XIZA 1H25A 3EB0A 3V6RA 4YO6A 2J0IA 3ALNA 3IG7A 3IW4A 4EQUA 3AQVA 1NW1A 4RLKA 3LFDA 3TACA 2C3KA 3C50A 3CGOA 3DPKA 4WHZA 4E6CA 5B0XA 1MUOA 3V5WA 1H00A 4FG7A 4JNWA 4L9IA 4RVLA 4F9AA 5I9YA 3W33A 3GI3A 4KD1A 2REIA 3QHRA 2XEYA 3U4UA 2C6OA 2ONLC 4IVBA 1Q97A 4TYHA 3TZ9A 3H9FA 4B4LA 3LCDA 4EH6A 2Y7JA 4NUSA 2B1PA 3IGGA 4E7WA 4JG7A 1WAKA 2HOGA 2Q83A 4HVDA 3QRJA 2X6EA 3F3UA 2PVHA 4FV2A 3V6SA 4EH8A 2ZB0A 4IDVA 4APCA 5E8UA 2BCJA 2JKKA 4M68A 4R3RA 5EW3A 4ZTRA 3VS3A 4AN3A 3CQUA 4I22A 4A4OA 2VTQA 2VNYA 1XKKA 3BPRA 4FZAB 4I6FA 4IM2A 3AT4A 2EWAA 1ZOEA 4X3JA 1A06A 3ZONA 1ZYJA 3GCPA 4CCUA 3CKWA 5EOLA 5EW9A 4F63A 4F7NA 4I6BA 3SAYA 4AUAA 3SG8A 3FV8A 3OEZA 3F9NA 1XQZA 3VBYA 3BHHA 5H9BA 5IQHA 5JFWA 4CFUA 1OL7A 4I5PA 2XUUA 5CAPA 3R9RA 2XK8A 4NW6A 3C5IA 3NEWA 2W5BA 3KMWA 4RJ7A 4ACGA 4Q9ZA 4GK2A 5E91A 4H3PA 4ZSJA 5H8GA 4G9RA 5DR2A 4ACHA 3SX9A 3F6XA 3P23A 4MKCA 4M13A 2YDIA 4TRLA 3FZOA 1B6CB 3N4VA 4RWJA 4AW2A 3Q2JA 5AUUA 4XLIA 1O6YA 2IZSA 2OFVA 1YHWA 1NT2A 4FUYA 3VWAA 5JFVA 1YRPA 2XNPA 3H3CA 3TUBA 1OL6A 4OBQA 3HMIA 2PUNA 5HNGA 4EH4A 2XRWA 3OT3A 5FBOA 4EBWA 4R77A 5HG9A 2DS1A 5CLPA 3BRBA 4QP6A 5KMMA 1Q24A 3UNZA 3QTSA 3NIEA 2HW7A 2V7OA 4HJOA 4P7EA 3SXSA 4X2JA 4BKYA 4EBVA 3CGFA 5AIKA 3W10A 4X7QA 4AA5A 2ZDUA 4FVPA 4FX3A 1E1VA 5AFVA 1PXNA 3MVLA 2OSCA 1H8FA 3VS7A 4AGDA 4HYHA 4IAZA 2R3JA 3A99A 2V0DA 3EFKA 2BMCA 3TJDA 2OJFE 4ZTNA 2C5XA 1YDSE 3C5UA 4NM0A 5IKWA 2EUFB 4C2VA 3KK8A 1OZ1A 4KIPA 4MYGA 3LHJA 5T6KA 4DBXA 2UZBA 2B53A 3MIAA 2Z02A 3W55A 3AMBA 3IK3A 4EHEA 3C51A 5FEEA 3PUPA 5ETFA 4USDA 3R73A 2XZSA 3A4OX 3QYZA 4FKQA 3ZO2A 1H0WA 5KKRC 5EQEA 4DGNA 4C8BA 3CIKA 4BCNA 4UMRA 2VNWA 1H1PA 1QCFA 3DDQA 4FV6A 1CSNA 4LGGA 4QP1A 3WF7A 4CCBA 4MVFA 5AUVA 3U9NA 3LLTA 3FXWA 3EN9A 5EDQA 3KVXA 2R3GA 4FTJA 4ZS0A 3LQ3A 4FUXA 4ZJJA 5DA3A 3S95A 4CFNA 2GNFA 2RFNA 4MXCA 5KX8A 4FV3A 1WVYA 4QP2A 2YISA 2I0HA 3ZSIA 1I09A 3C0IA 3HV7A 2UZUE 3M2WA 3OXZA 2XNOA 4I94A 4F65A 2WQEA 1KE6A 4U3ZA 3UC4A 1PHKA 5L4QA 2GTMA 3SW7A 3FZPA 4DTBA 1S9IA 2WIPA 3UO5A 4O7SA 4EHVA 2PVJA 3NUPA 3P5KA 3ORLA 1L8TA 4Z7GA 1UA2A 2IPXA 2QLUA 5EKOA 3DJ5A 5CEPA 2H6DA 1WBNA 4PTCA 4WT6A 2Z7RA 5CX9A 4E1ZA 5M56A 4RGJA 3DB6A 3DJ7A 4FBXA 3LFCA 4PUZA 4PPBA 3RNIA 4BDCA 4GKIA 3G6GA 3P0MA 3P4KA 1H0VA 4DFBA 3RWPA 4R7HA 3IDPA 4FV0A 1UWHA 1CDKA 3PWDA 3GU8A 4GJ3A 4I24A 4QMWA 4BBMA 2QOLA 3FY0A 3IKAA 3MPMA 2YCFA 3MA6A 4HYSA 4U40A 5DI1A 1OBDA 3D5UA 1H01A 2JIIA 3WF9A 2BDFA 5IZFA 2OJIA 3HP5A 2VWYA 5D12A 2VWXA 5ANEA 2J0JA 5IQAA 2ITPA 4S31A 2WGJA 3OZ6A 3K54A 2XF0A 4OW8A 4J71A 3V5TA 3TI1A 3FPMA 3ALOA 4FK6A 4OTHA 4EH9A 2BVAA 5CQUA 5EYKA 3D9VA 5DRDA 1HOWA 2WTWA 5J5TA 5BQ0A 3COKA 3PY0A 3WF8A 2B0QA 4AA0A 3UQCA 3UVPA 5I0BA 5HD4A 2OWBA 3FHIA 2ERZE 4UN0C 4C7TA 3E3BX 3FL4A 1STCE 4F08A 1XH7A 2GHLA 3EFLA 4GU6A 4TN6A 2R3OA 5GHVA 2F7XE 5AWMA 5E9EA 3ZZWA 4DH3A 4C3FA 4YPDA 4CYIA 4GFOA 4F70A 1WBOA 4FKRA 1OPJA 3DNDA 5AJQA 3FAAA 3VUGA 3PIZA 2OGVA 3R22A 1Q3DA 3OG7A 4F6UA 2R3QA 5E7RA 5KCVA 2Z7QA 4EK5A 3VO3A 1PMEA 2OZAB 3HV4A 5L2SA 4ASDA 4LGDA 5DYJA 4FNYA 3UPXA 4JDIA 4FTCA 4M0YA 2PSQA 3FLQA 3TZMA 5G1XA 5IA3A 4IEBA 1E9HA 4RZWA 3UIBA 3LMIA 2CCHA 4EOPA 2FSOX 2NRYA 4N6ZA 5L8KA 3RPRA 5A4EA 3TZ7A 1DAYA 1XH8A 5AA9A 3R00A 2EB2A 4B7TA 1V0OA 3QZFA 4R3CA 2OXXA 3V51A 3SD0A 3P7AA 5A3XA 4IB5A 1SVGA 4C61A 4QOXA 3D5XA 2V62A 4FL3A 3GC9A 3QUDA 3BHYA 2R7BA 3D5VA 1Q61A 4UB7A 2X6DA 3EQDA 3HDMA 4LM5A 3A4PA 3CEKA 1ZRZA 4RFMA 5M55A 1ZAOA 3M1SA 3R7UA 4NJDA 2ITWA 3D0EA 3CD3A 5KO1A 4FV8A 3AC5A 4DEEA 5CSWA 4C4FA 4NZWB 4C38A 3EFWA 4HZRA 5GIPE 4FSYA 5CNNA 4FYNA 2QHNA 3KRJA 4ALWA 4RBLA 1PRYA 2OFUA 4UXQA 4AOJA 5A4CA 3T9IA 3DB8A 3B2TA 3MH2A 4I5MA 4N0SA 3RP9A 3SXRA 3OBGA 1U54B 2YAAA 2QR7A 3RZBA 1W82A 3BLRA 1REJA 3L8XA 4G1WA 5CVHA 1JVPP 3BQRA 5ANGA 5EM5A 5TR6A 2CKQA 3FZTA 3E88A 3GGFA 2X81A 4ZEGA 3DAKA 5DHJA 1Y57A 1Y91A 2BHEA 3CY3A 3FMJA 4GH2A 4AZVA 4F9YA 4QMNA 3L9PA 5FP6A 4MD8E 5CWZA 5DR9A 2G2FA 3R1QA 1IA8A 2XNNA 3DQWA 3R2BA 2HXLA 5EYDA 5BYLA 3VUDA 3VUKA 3AC8A 3C4CA 3P86A 3A7HA 2XBAA 3EN7A 2H8HA 2JLDA 2J6MA 2YLEA 5H2UA 4MAOA 1VZOA 2WMSA 1M2PA 1WVXA 4FSUA 4HZSA 5AR4A 1OUYA 3KXMA 4FI1A 4ITIA 4EH7A 2PULA 2O2UA 3FZ1A 2XKFA 4M69B 4E73A 1FQ1B 2BZJA 2UZEA 4CKRA 3THBA 4FOCA 3FLYA 1H1RA 1TQMA 1Q3WA 3QQFA 4OBOA 4JS8A 3CD8A 4JR7A 2QHMA 4JG8A 4YU2A 4CYJA 5IU2A 3RM7A 3AXWA 2GS7A 3TTJA 1R0EA 3JY0A 2IVUA 4PP9A 2BKKA 3OWLA 4ZMEA 5BPYA 5JEBA 1OM1A 1H1WA 4PF4A 4IC7A 5EM6A 1RE8A 1ZYSA 2PVRA 3MW1A 2VAGA 2X9FA 4BIBA 4PDSA 3PE1A 5IQCA 4I6QA 3ZBXA 4AU8A 4O0UA 4BL1A 2OICA 2X8EA 4AW0A 5AUWA 4AOTA 4ERWA 3ID6C 4DEHA 1W8CA 2C6LA 1YDTE 2Y0AA 3BQCA 3EWHA 1Z9XA 3HP2A 3DQXA 1Y6BA 4G34A 4EOQA 3RAIA 1U5QA 4TWPA 1H1QA 2VWWA 2JBOA 4TTHB 1JQHA 4RVTA 3LFAA 4ALVA 4BN1A 2YN8A 2GPHA 2WU7A 4I0RA 3HEGA 4L67A 5JN2A 3EMGA 3NS9A 4ACMA 4F1TA 4BRXA 3NR9A 1VEBA 3BBWA 2ITYA 4G6LA 4DA5A 3IGOA 2GQGA 4FNZA 5KUPA 1FVVA 3BE9A 3ZDUA 3NNVA 3NRMA 3PA5A 3W2QA 4KWPA 4BWXA 1O6LA 3MFUA 4IB3A 5AP5A 4QTCA 3F61A 4O0XA 5EQPA 1OI9A 1XH9A 4V04A 3PXZA 5K4IA 5M57A 4WBOA 5D10A 4I93A 5HE2A 3AT3A 5CT7A 5AP7A 4F64A 5KMJA 4AZWA 3ATSA 2E9PA 3NNUA 4FV4A 4DH8A 4ARKA 2WQBA 3MTFA 4G6NA 4XG3A 2QU6A 2GDOA 3FMDA 5BUEA 3QA8A 2CKPA 2XS0A 2V5QA 1G8AA 4E4LA 4C3PA 2GNHA 4X21A 1FMKA 1HCKA 4FZ7A 1J7UA 3PDTA 1SNUA 2OZOA 3MJ2A 3RBWA 4O0WA 1FOTA 3NPCA 4IWOA 3QAME 4JI9A 4IBMA 5IA1A 4YZCA 4QYEA 2YM8A 4R8QA 2YJSA 3FSFA 3WZDA 4IC8A 4BDGA 4DH1A 3B8QA 5HEZA 4JAIA 4YLJA 3UYSA 4F7LA 3ZMMA 4BB4A 4Y95A 3HVCA 3EQIA 2ONLA 3MTLA 4GVAA 4IJPA 4LG4A 4GYIA 3MB7A 2GNIA 4QD6A 4BBEA 1YOJA 3RPVA 2PMNX 1XR1A 3OMVA 5HG7A 3FLSA 2OZAA 2JAVA 5JSMA 1SMHA 1ZXEA 4FKUA 3JXWA 4JBVA 3C4XA 4EOJA 1WFCA 2WELA 4BHNA 3KGAA 3QC4A 5JK3A 3DK6A 3IPHA 1GAGA 4IW0A 3TCPA 2R3PA 4Y72A 4R7IA 4RIXB 5DT3A 5FXSA 3W32A 3R7EA 4JRVA 4D0XA 1H1SA 5DE2A 4L7SA 1YXXA 3CS9A 3VRYA 3HA8A 4QMOA 2W1DA 1APME 3Q4ZA 3G9LX 4J52A 2QKWB 1M2QA 4QMXA 2Z8CA 4APPA 2NNWB 2R3KA 3LFQA 4U3YA 2F57A 2OJJA 1Y8YA 3KXXA 3DAJA 3R30A 2WTDA 4IE9A 2XCKA 3QGWA 4NT4A 3VW6A 5AP3A 1CTPE 3PJCA 1QPCA 2HY81 5M09A 3GU4A 1WBVA 3UVQA 3ZFXA 4CD0A 4BKJA 4E4XA 5K5NA 4E6QA 3F5PA 5E8VA 4OAUC 2BZIB 4YJTA 2ZV9A 4H05A 2QOKA 3R1SA 4KABA 4M3QA 2IN6A 1SZMA 4UY9A 3K5VA 1ZOGA 4FZFB 2QO9A 3TKHA 3G5DA 4YURA 2X7GA 1QMZA 2OJ9A 4EI4A 3UNKA 3T3VA 3VS2A 3RI1A 4Y5QA 4JRNA 5M4CA 4HGSA 5FM2A 4IX5A 4BY9E 2J9MA 3ZC5A 3PXFA 3SXFA 1KE7A 1GY3A 2R3MA 5C03A 2ZMDA 5EM8A 4JQEA 3FDNA 5J95A 3TEIA 4NH1A 2X4ZA 1KSWA 5D41A 4E6AA 3O8PA 4XRLA 3LFSA 3QQLA 4O82A 2B9JA 2H96A 2W05A 5L8LA 5A4LA 2ERKA 4N70A 4CFWA 3BCEA 3H9RA 3OTUA 3NW5A 3ZRMA 5D1JA 4M84A 3A62A 1OIUA 3HLLA 3KKVA 4B0GA 2BUJA 4ONAA 3O8TA 2XEZA 5A14A 2HY0A 2EXMA 2WO6A 5TKDA 4ZAUA 1H4LA 3E92A 2WKMA 5AR8A 4UZDA 3BEGA 4S34A 4UMTA 4AOIA 4FNXA 2W0JA 4XG6A 1H26A 5KNJA 4G17A 4BCHA 2EXEA 3VJNA 3AD5A 4OAVB 4DN5A 3MFRA 5CAOA 3P1AA 3Q9WA 4V0GB 1R78A 4YHFA 4DGLC 1P5EA 3MA3A 3PSDA 1GIHA 3Q4UA 4BZDA 1WZYA 4E8AA 4QMUA 2YZLA 3UNJA 3QWJA 2C5YA 5HGIA 1URCA 4FT3A 1JWHA 4QP3A 1YHSA 3EQGA 1H08A 3E7VA 5IQBA 4WIHA 2PMLX 4YZBA 3MB6A 3WARA 3KEXA 3FQEA 3MV5A 4I0SA 4G5JA 2VTMA 1XO2B 3QUEA 1O9UA 1OGUA 2OKRA 4GT3A 2AUHA 1BL7A 3ZYAA 4QYGA 4HCVA 4PY1A 3A7GA 1EH4A 2WQMA 3MJ1A 4RIWB 4BBFA 3FKNA 3I4BA 3PVBA 4S30A 4QPMA 5BVOA 4RG0A 4PV0A 3E8NA 4FTNA 4TPTA 3R8UA 2NRUA 3S1HA 1JKLA 3KB7A 1ATPE 3PWYA 4XJ0A 5TF9A 4EOLA 1YI4A 1YHVA 4KKEA 4YTHA 2YIXA 2WEVA 3F7ZA 4NIFA 2XM9A 3ZTXA 4BDDA 1VR2A 4IH8A 4AQCA 5AADA 4G3EA 5J1VA 5IQDA 5HCZA 4MNEB 3TTIA 4AT5A 5ACKA 3ZEWA 2WMRA 4CTCA 4G3GA 1PMUA 1MRUA 4XS2A 4YNEA 5HVKA 4DTKA 1QPJA 3ODYX 3UO4A 2W4OA 3L1SA 1B38A 3DS6A 1YXTA 3CC6A 3R9NA 2VTSA 5BUJA 2XMYA 2JKQA 3NUYA 4MNFA 4P5ZA 5AP1A 5B7VA 3QX2A 3ORMA 3DNEA 2FSMX 4RC2A 4KRDA 3ANRA 3LLAA 2UZDA 2YCSA 4LL0A 2HZ0A 2UW0A 3VW8A 2CKOA 3R6XA 4LV5A 5CU3A 4L45A 1UNGA 4NCTC 4OTRA 4YHTA 3U6IA 3HGKA 2UW5A 4YBJA 4B8LA 2WOUA 3MVJA 5EK7A 4UMPA 3ITZA 5CF5A 2BIYA 1ZMUA 2W5HA 3GCUA 4JX3A 4CV8A 4S32A 3Q52A 5CQWA 4RZVA 3OOMA 4M66A 3RZFA 3TN8A 5M4UA 2XK9A 4ZK5A 2FSTX 4IB0A 3DKCA 3ZUTA 3PRFA 5JQ5A 5AX3A 1UNLA 2YERA 3AMAA 4MF0A 2IZUA 5FRIA 2ITVA 4FZ6A 5LMKA 4FKLA 3VNTA 3LVPA 4GG5A 4R5SA 3UJGA 3L9MA 5E4HA 2C0IA 5ETIA 2O0UA 1M14A 1NVSA 2PE0A 4ZY6A 3KULB 3HMMA 1ZLTA 2QU5A 2Y4IC 3PPJA 5HCYA 2FA2A 4UZHA 4C34A 3HNGA 4YUQA 3DXPA 2BAJA 4F0IA 2P2HA 4MD7E 4UALA 5GIOE 4U81A 4JQ7A 3VN9A 1JSTA 3FMMA 4XG4A 3LM5A 4F9WA 2ZAZA 3A7JA 3PZEA 4K77A 1CKPA 3QUPA 1LPUA 2P0CA 2R7IA 3PFQA 4CEGA 3DKFA 3KREA 3RALA 4ANOA 1TVOA 4FT5A 5CY3A 3MY1A 2Q0NA 1PF8A 3DGKA 4FV1A 3BKBA 1F3MC 3OOGA 3WIKA 4YZMA 5LMKC 2BZHB 3BZ3A 4I41A 2YAKA 4FV7A 4WG3A 3VBXA 3V5JA 3HMOA 4CSVA 2ETRA 2XIRA 1OMWA 3E7OA 5F4NA 3WYXA 5BUIA 1IG1A 5EHOA 3R9DA 2HAKA 5L2IA 5CEQA 4PL3A 2IVTA 3HYHA 4LRKA 3W1FA 4MQ2A 3D94A 4EYJA 1A48A 2ESMA 2X2KA 4RIWA 4TYJA 3EJ1A 4YHJA 4II5A 2VZ6A 1NVRA 2XNEA 4WG4A 3T8OA 4YJVA 4FKWA 5E92A 5FXQA 2Y6OA 3KXZA 4ZY5A 1LR4A 2J50A 3F5XA 4XG8A 2XYNA 5EDPA 4QTEA 3QGYA 2OIQA 4BC6A 3QWKA 5E8SA 3I5ZA 2ITQA 3NVKI 4CRSA 2I7QA 5LVLA 3BIZA 4RC4A 4DFYA 4O0SA 4LYNA 4AGCA 4O2ZA 4X3FA 4HNIA 3E8EA 5HHWA 4DHFA 2J7TA 3DTWA 1MQBA 3E87A 2ZM3A 4Z9LA 2J4ZA 4PMSA 4PL4A 2R0IA 4L00A 4OR5A 5FG8A 1UVRA 3E64A 2YCQA 4DBNA 5BMMA 2BAQA 4ZTQA 2IVSA 3CLYA 4TWCA 4WKQA 5HVJA 4O7ZA 1KOAA 4FIHA 4C4HA 3MIYA 4BI0A 1VJYA 5HKMA 1B39A 5HORA 4NTSA 1I44A 4WA9A 3ZS5A 2RL5A 1FGIA 4CFFA 4O7RA 2E2BA 2C3JA 3EKKA 5M4IA 5IA5A 1FGKA 2YWVA 3L8SA 3PG1A 1UNHA 3PJ3A 2VTTA 5I5ZA 4JXFA 4ZMFA 3FC2A 3TJCA 4C4IA 2XJ0A 2BTSA 3DBFA 4D2WA 3OBJA 2BDJA 1UU3A 3QRIA 4NIFB 3SQQA 1DM2A 3HUCA 3FQSA 1IEPA 1T46A 3ORZA 3OXTA 2YIWA 3SHEA 1GJOA 2ZMCA 3QU0A 4GSBA 5JH6A 2IO6A 1O6KA 3CJGA 3FYJX 4GG7A 3W18A 3CPBA 5CF6A 4ZP5A 3LJ0A 3LCSA 4IM3A 1QPEA 2WFYA 4FSMA 3V3VA 4EC8A 2O63A 4EL9A 5IQEA 5FM3A 4XP3A 4JDHA 3UQFA 2CNUA 4C4JA 3PJ2A 3PP1A 5JRQA 1IASA 5FD2A 3NYNA 2YHVA 4ANBA 5JKGA 4FG9A 2BDWA 4L6QA 3OC1A 3OS3A 5HICA 2JDVA 3PLSA 2W1CA 4Y73A 1PYEA 4XUFA 1BYGA 3QTRA 4LFIA 5IH6A 3LXKA 3TIZA 3OCSA 4FIIA 4QO9A 4QTBA 4C59A 4FT7A 1NXKA 1YVJA 4XBUA 4XLVA 5CS6A 3BE2A 4RLLA 3ROYA 3PTGA 2A2AA 4A9RA 4BF2A 2HW6A 2VTLA 1MRYA 2HZ4A 4O0RA 2KULA 4D4VA 3G9NA 2WTIA 3KC3A 4Z3VA 2RSVA 3I6UA 3VJOA 1U46A 2Q0BA 2UUEA 4FSTA 3QTZA 4PP7A 4MBIA 3SLSA 5I3RA 5IA2A 4KSPA 3OUNB 4NSTA 3KXGA 2SRCA 4GCJA 3QCXA 1XWSA 3LPBA 3RAKA 5EQYA 4HNFA 1GZ8A 5LVPA 4CT2A 4ERKA 1PXOA 4RSSA 5JFSA 2RG5A 2YIQA 4CMUA 5HNBA 2WTVA 4FTTA 4EQCA 4BTKA 2YM7A 3MVMA 3VRZA 3NYVA 3HAVA 5IQGA 4K0YA 5HTCA 4DH7A 4F6SA 3F2NA 2LAVA 5IA0A 2DUVA 4XEYA 3NW7A 3F66A 4QMZA 4KS7A 4FT9A 3AC3A 3KA0A 4FTKA 4YNOA 4FIJA 5KE0A 4YTIA 5E8YA 4YLKA 4EH2A 2V22A 5CSHA 5DFPA 2R3LA 3Q2MA 4BGHA 4IX4A 2PE2A 4BCKA 3IDCA 4PX6A 4M67A 2C47A 3D2KA 2AYPA 3ZDIA 3U55A 3D4QA 3PVGA 2FGIA 4K18A 4BIEA 3WILA 4USEA 4ZSAA 4QQTA 5IDNA 4GJ2A 5LMAA 3QQHA 2R3IA 3F3TA 3GU7A 4XBRA 4C58A 4HGEA 4DEAA 3FKLA 3PPZA 3HL7A 4PMTA 4D1ZA 3UGCA 2RF9A 5J87A 4BDKA 3Q4TA 3FLWA 5FUTA 2W1EA 3OCTA 4FKIA 5HIEA 4ANSA 2UZVA 3OCGA 4I6HA 2X1NA 3GENA 4FKVA 2FH9A 3LXLA 4Q2AA 5FDPA 3WZKA 1TQIA 4MHAA 3NCGA 3PXQA 4QPSA 4E4MA 2E9VA 3OTVA 4D9TA 3PG3A 5D9HA 1XBBA 5AAEA 4ANNA 4NL0A 4FV5A 3KRRA 3MS9A 4RX7A 3KF7A 3ORXA 4J96A 4KRCA 4ZSEA 4LL5A 4G6OA 5DT4A 3BV3A 4ZY4A 4HVHA 2W9FB 4EOOA 3OVVA 3VULA 5HZNA 5HE3A 5AEPA 3UODA 2B54A 3TV6A 2QI8A 3QLGA 3R7VA 3RWQA 4PRJA 4BDEA 2G9XA 3DDPA 3K2LA 4FE2A 2EVAA 4HCTA 3U8WA 2XNMA 4E5WA 2ZV2A 3FY2A 4U7ZA 3VC4A 2ITZA 3V8TA 1Z5MA 3I1AA 2WXVA 3PRIA 5AP0A 3C4WA 4RA5A 1M52A 1OKYA 3BWJA 4KNBA 4O0YA 4O21A 1FMOE 3PPKA 2B55A 3NCZA 2JFMA 3VHKA 3TG1A 1PW2A 3UP2A 2PMIA 4BDHA 4MXYA 5M08A 3FMKA 1Q8WA 2QR8A 1OKVA 3I60A 4XCUA 4XYFA 5ANDA 4IHPA 3E93A 5I9UA 1BL6A 3KVWA 3OY1A 3ZSHA 3DBCA 3ZSGA 3UOJA 2CLXA 3VIDA 5EW8A 5J79A 4BYJA 2P3GX 2FO0A 5I9ZA 3S00A 1J91A 2QG7A 2YITA 3H0YA 4DYMA 4NM5A 4DLIA 2VD5A 3PXRA 4FTAA 4PTEA 4JX7A 2JC6A 3Q60A 4RVMA 4ANLA 2ACXA 1YOLA 2WU6A 3R71A 3E62A 4S33A 4IACA 1K2PA 4P2KA 5C8NA 4O0TA 2UW6A 1W0XC 4D4SA 5IUGA 4H58A 2WMXA 5DG5A 3Q5IA 1PXPA 4AFEA 4C3RA 4BTJA 3ZUUA 2JAMA 3EQPA 5EH0A 4DINA 4EEVA 4EZ5A 3BYVA 1WBPA 3N9XA 1IA9A 5C8KA 4UX9A 3HV6A 3OEFX 4DGGA 2XH5A 5JFXA 2W1GA 3RMFA 4BWPA 3V5LA 4WBBB 2QLQA 5CSVA 4BCQA 2P2IA 2IWIA 4NWMA 4MNEA 5HX8A 2GQRA 2CHLA 2P4IA 4JT3A 1M2RA 3LXPA 3A61A 3H4JA 4AS0A 5AMNA 3OF0A 1SNXA 4F9CA 2ITXA 2PZIA 4DG0E 2BR1A 4E4NA 3CTJA 2YM6A 4HCUA 4YSJA 4HVSA 4FTOA 4FIEA 4FKGA 2HYYA 4RC3A 4BDFA 1AGWA 4YJNA 5A9UA 3NVMB 4JLCA 4J53A 3CE3A 4F6WA 1YXVA 1OUKA 4WSYA 1TKIA 5LCKA 4W8DA 4D55A 2YEXA 3IQ7A 3W8LA 1ZMWA 4U45A 5T3QA 1JPAA 4H3QA 4QMQA 4XNEA 4F0GA 3KF4A 5IEVA 5IG1A 2ITOA 1PXJA 3C0GA 4YLLA 5K3YA 5A54A 3ERKA 5DR6A 1JBPE 2Z60A 2JBPA 3PVWA 3MPTA 2VTIA 5E1EA 2KTYA 2UZNA 3F3ZA 3OD6X 4DFNA 1R1WA 4IANA 5CNOA 1UKIA 3S3IA 3SV0A 3QX4A 2YJRA 2RFSA 2PUUA 4RFYA 4BCMA 5IDPA 2VO6A 4L43A 3TL8A 4DAWA 5HI2A 3CBLA 4O0VA 3FMHA 2UVZA 3NUAA 2Y9QA 1Q8TA 3K3IA 2GFSA 1FINA 2CLQA 3R83A 4UYAA 1GZKA 1ZYCA 2CNVA 4MCVA 3FPQA 5HU9A 4XV1A 4A4XA 4J7BA 3D7ZA 5CU6A 3ZXTA 5ETAA 4H39A 2VX3A 4WSQA 2VGPA 4IAIA 3ZZEA 3MWUA 4GV1A 4O96A 2C3LA 4M69A 3QD4A 4LRJA 4DFLA 4J97A 4MF1A 3PJ8A 2C1AA 4LGHA 3HZTA 4EWHA 3EYHA 3Q6WA 2XIYA 4E5BA 3UE4A 4BTMA 3MDYA 3W8QA 3GVUA 3QD0A 1OECA 4JOAA 4BI1A 4EK4A 4DITA 3QQUA 2I0EA 3VBVA 2JGZA 1PY5A 4AW1A 4KINA 4TYIA 5GZ9A 3W2RA 3LCKA 3P79A 4MBLA 3VHEA 1R39A 3JPVA 4KS8A 5E8XA 5CANA 3SRVA 5M53A 4L52A 3OY3A 4EKKA 2ZV8A 4U80A 2B7AA 3DJ6A 3MI9A 4UMQA 4I20A 3GP0A 4IB1A 1SM2A 1YWNA 2YDKA 4NJ3A 3S0OA 3ULZA 4WNOA 4C02A 3PY1A 3FEGA 3BYOA 3E3PA 1IRKA 2OIDA 4DC2A 3AGMA 5I4NA 1OVEA 5DEYA 4MXAA 5AV0A 3L8PA 4OTWA 3R7YA 5A6OA 2G1TA 3FSKA 4OGRA 4ACDA 4U43A 4GVJA 4FKOA 3ZH8A 4RA4A 4DFZE 3BGZA 3WBLA 5CZHA 5CF8A 3ENHA 3F5UA 2W1HA 3L9LA 4IQ6A 4V05A 4FEQA 5K0KA 5FXRA 4AW5A 5J7HA 3SRVB 3U9CA 2WPAA 4M14A 2A19B 4I21A 3GOKA 1DAWA 3R01A 4MX9A 4D0WA 4E5AX 1OPLA 4NK9A 3WZEA 4ASXA 4FYOA 4AG8A 5E8TA 3DT1A 4DT8A 2C5VA 3DK7A 5HLPA 5HO8A 3DTCA 4BCFA 2PVLA 4EQMA 4TNDA 3FI2A 5HD7A 3VS5A 3VS6A 4ZXTA 4EORA 3GQIA 5I9XA 3ULIA 2X7OA 4WRSA 3ATTA 5J1WA 1REKA 3ORNA 4BDJA 4K11A 3UZTA 2VUWA 1E1XA 3KFAA 4IADA 2GFCA 3QTXA 2QCSA 5F95A 4XV3A 5JGBA 3PVUA 4QMYA 2GSFA 3H0ZA 2JIVA 4J8MA 2XA4A 2X7FA 3QFVA 2PU8A 4FMQA 3EQHA 1KE8A 2RGPA 2OXDA 2WNTA 5CEIA 4M8TA 4KBAA 3TIYA 4FODA 5ANKA 3D7TB 3EFJA 4HVIA 3U6JA 2IW6A 2PZ5A 2VTAA 3QCYA 1M17A 5JT2A 5G6VA 3ENMA 4IFCA 3P78A 1WBSA 4YSMA 2EU9A 1M7NA 2WMBA 3QTUA 4OTQA 3T9TA 4BZNA 2C5OA 3QZHA 3EH9A 2VX1A 2C6TA 1OL2A 2F4JA 3GCQA 2WMVA 3GQLA 3NYXA 3KL8A 3JR1A 2V7AA 3ROCA 5CXZA 5M07A 4CKJA 1GNGA 4YBKA 4AE9A 3RGFA 4CQGA 4G3FA 2VTHA 4FC0A 3BLHA 4WD5A 3NAYA 4UYNA 5CU0A 4IZ5A 3FZSA 4XP2A 5ACBC 5L6OA 4CG8A 1G3NA 1ZYDA 2HZNA 2QODA 3DLZA 3QKMA 2QC6A 3ZBFA 4WUNA 2A0CX 3DZQA 3SC1A 3POZA 4IAFA 2PK9A 4DLJA 3LMHA 3COHA 3FL5A 4ORKA 1UWJA 1ZOHA 2WIHA 4AWIA 3W2SA 4JIKA 4EOSA 4CVAA 5CENA 2IZRA 2UZOA 2QNJA 2JKMA 3ELJA 2W9ZB 4OT5A 3KN6A 3TDWA 4CV9A 4NEUA 2UW7A 4KB8A 3FXZA 1BX6A 3W16A 3R1NA 1L3RE 3R63A 2O5KA 4IWDA 4O6EA 2C5NA 1ZY5A 4OTGA 3ZLSA 1DI8A 5JRSA 3ZO4A 4ALUA 2QOHA 1UKHA 3P7CA 5HQ0A 2B9FA 3QTIA 3HV5A 4QTDA 2JIUA 3P7BA 5H8BA 3I0QA 3RK5A 5GZAA 4W4XA 5AR3A 5A46A 3PP0A 3E63A 2GCDA 3JVSA 4XMOA 5AIRA 2WHBA 4KBKA 5HG5A 2QO7A 2OF2A 4GT5A 4R1VA 3VUHA 1A9UA 5CAUA 2CN5A 3W2OA 2JKOA 4XH6A 2UW4A 2XM8A 3H10A 1ZYLA 3LCOA 4BDAA 2BFYA 3A2CA 4O7WA 5JGDA 2XVDA 5KZIA 4IX6A 2A4LA 5GINE 4FA2A 4FTRA 4HPTE 2ZJWA 4I5HA 4RIOA 3E8CA 2JD5A 1LEWA 2C30A 3FC1X 3NWWA 4YC8A 5HE1A 5C01A 3FQHA 3DZOA 5DEWA 1XJDA 4E3CA 4V01A 2WQNA 1QPDA 1YOMA 3WE8A 4MWIA 3HECA 4F7SA 1YXSA 4GS6A 1P4OA 4EHZA 4FL2A 3BLQA 4JBPA 5GJDA 4O83A 2CPKE 4KA3A 5C9CA 2QQ7A 4AZSA 3VQUA 1W84A 1XH4A 4CMOA 3DOGA 3QTWA 3HV3A 4ZZMA 4PPAA 5C4LA 4FNWA 1YWVA 2G2HA 4FVRA 4NYEA 3ACKA 3QRTA 3BYUA 3IONA 4O1PA 2YZAA 4Y46A 4YJUA 5L2WA 4FF8A 3C9WA 3GFEA 5H8EA 2R3RA 3PA3A 4IAAA 4M15A 2GQSA 4BGGA 3ZLWA 3D14A 4I4FA 5FEDA 2J0KA 1WCCA 3AMYA 3VF9A 4EK3A 3C7QA 2NPQA 1UV5A 4B6LA 1F0QA 3LFEA 1WVWA 3HMNA 3QZGA 4HVGA 5HLWA 3UIMA 4DFUA 4X2NA 5M44A 4FGRA 3VS0A 4W4YA 1Z57A 4O7YA 2GU8A 2PMOX 2R9SA 3JYAA 4PNIA 4QRCA 3RAHA 5KBRA 4BR3A 4KBCA 1OIYA 3QRKA 1FPUA 3RINA 4EK6A 2EXCX 2RFEA 3Q9XA 1R0PA 2FVDA 5EG3A 2OXYA 3UYTA 3QHWA 5IA4A 5F94A 2IW8A 2QKRA 2HIWA 2X0GA 3PIYA 2PY3A 1PMNA 2OK1A 4O22A 3ZUVA 5CAVA 3VUTA 4F9BA 2VTNA 4PWNA 3REPA 2QOOA 4M12A 4Y8DA 1YI6A 2WMQA 3QL8A 1BKXA 4FKTA 2GNJA 3EZRA 4D2TA 5CEMA 3GB2A 5IQFA 5DLSA 4ANMA 4D2PA 4QMLA 4O7LA 2PVYA 4LMNA 2ITNA 4GRBA 4G16A 4XG2A 3P08A 4JVGA 4FTQA 5DVRA 2QURA 4LI5A 4J1RA 5EOBA 4E6DA 4EOKA 2QD9A 3CXWA 3F88A 3AGLA 5LVMA 3NUNA 3G6HA 3FI8A 4RQVA 1H28A 4YPSA 2J5FA 4FGBA 3BHTA 4L68A 2B9HA 4G2FA 3R21A 4ZOGA 3C4ZA 1AQ1A 4RX8A 4I0TA 3TZ8A 3ET7A 4FK3A 2PUPA 4OTPA 5C8MA 4A06A 1J3HA 3UO6A 4FEVA 5D7AA 4EHGA 2YACA 3GU6A 2XRUA 4IM0A 3PXYA 2W1FA 4XG7A 2JITA 3BX5A 4FR4A 3G33A 3QQJA 4CGAA 2VX0A 1S9JA 2XK3A 2I6LA 2C1BA 2PWLA 4L42A 2X4FA 4C35A 3RK9A 2C0OA 2FSLX 2OJGA 4DEBA 1FBNA 3DKGA 2R64A 4BCGA 3CTQA 2FB8A 3MVHA 4GUEA 4U6RA 1Y6AA 4BKZA 4C37A 2R4BA 1OKWA 2GS6A 5FTGA 2Z2WA 1LP4A 2BILB 3DBDA 3EOCA 3WZJA 4LV8A 5E8WA 2CGUA 4YJQA 1PXMA 4GFGA 3SW4A 1VYZA 3BI6A 4U44A 2PVKA 4A07A 5BYYA 3QXOA 4HW7A 3TUDA 1J7LA 2F49A 2UW9A 3SKCA 4BCOA 4U9AA 2X8DA 4TXCA 5LWMA 5CYIA 2C6MA 3F5GA 3LJ2A 4JR3A 4RJ8A 4S2ZA 4CZYB 4EONA 2J0LA 4YR8A 5K0XA 1W7HA 1YKRA 3EHAA 1P2AA 3O17A 1V0PA 3C13A 4LOPA 1DS5A 5KBQA 3IW7A 1GZOA 5HIDA 4D4RA 4LOQA 5CALA 4A7CA 2HCKA 4HYIA 2XKDA 1UU7A 3MGYA 2JDSA 4ZIMA 4D28A 2W4JA 4AN2A 3Q96A 2QOCA 4W4WA 1OL1A 4BTFA 2YIYA 2H34A 4IVCA 2E9OA 3MFTA 2BALA 2X2LA 4PL5A 2WTKB 4R1YA 4F4PA 3G15A 2OI4X 3IOKA 4JG6A 5TOZA 3CQWA 2VN9A 3IO7A 4K6ZA 4J98A 3H30A 3IW5A 3LMGA 3VBTA 4UWBA 5LVOA 3DBQA 4QP7A 2R3FA 5HE0A 3LZBA 4QNYA 4E93A 5AR2A 5CXHA 1KUTA 3DV3A 5CZIA 4BCIA 5LOHA 1IAHA 5AX9A 3ZM9A 2CJMA 3RM6A 4PPCA 4PNKA 5EI2A 4D5HA 3D7TA 4L3LA 4EWQA 5DMZA 3V5PA 4K8AA 4PDPA 4FVQA 3V04A 1Q62A 4Q9SA 4C4GA 2XBJA 2PL0A 3SA0A 1TQPA 4RJ4A 2X9EA 3OFMA 5LARA 4CNHA 4QYYA 3QBNA 4O27B 1YI3A 3BWFA 1P4FA 3HRBA 3BHVA 1Q8UA 4FZDB 1U4DA 2PVFA 1Q8ZA 3ORIA 3GC0A 2OLCA 5IH4A 1BI8A 3ANQA 5JGAA 4WO5A 4D2VA 3MN3A 3AT2A 3TT0A 3LQ5A 5LJJA 4FTUA 2RFDA 1KV1A 4RIXA 5JZJA 3AG9A 2XK6A 5I3OA 5CEKA 3EIDA 4ID7A 4MXOA 3G51A 3OWJA 5A4TA 4ITHA 1LEZA 3IOPA 2VTJA 4DE4A 5M51A 3BU3A 3GXLA 5IQIA 5HU3A 3UMXA 4EZ3A 3DCVA 5AV1A 4JDJA 2ITTA 2HK5A 3PSBA 4J8NA 2O64A 3W2PA 3F7WA 2PZRA 2CN8A 3UP7A 5HOAA 1XBCA 2DQ7X 4IMYA 4J95A 4MWHA 4BVUA 1PKDA 2XYUA 4DG2E 4F99A 3DA6A 3NUUA 4RRVA 1JLUE 3I7CA 3VVHA 2WMTA 5A4QA 4TNBA 4WNPA 2PE1A 4O6LA 1J7IA 2QG5A 4BYIA 4O86A 4ZJVA 4AA4A 5EM7A 4EKLA 4XRJA 3QQGA 4D1SA 1IAJA 2WMWA 3MSSA 4QMPA 3DKOA 5EYCA 4FTLA 3GC7A 5CVFA 5BVDA 2Y8OA 2IVVA 2ZOQA 3CKXA 4D1XA 5L6PA 4FEUA 1KV2A 4YMJA 5IPJA 5E1SA 3NIZA 3QRUA 2F9GA 2WTCA 2BFXA 3V01A 3MFSA 3WF6A 2F2UA 2OBJA 3GBZA 3FLZA 4EJNA 5CSPA 3M42A 2GMXA 3TDVA 3HAMA 4CMTA 2EB3A 4QT1A 2BZKB 2R0UA 2Y6MA 4TT7A 3DBEA 3A8XA 2C68A 1YWRA 2VTRA 5EHLA 4RIYB 1OIQA 4NW5A 3BV2A 1G5SA 4ENYA 3QTQA 1KE9A 2W06A 4ANQA 3VS1A 5K4JA 2PPQA 3UZRA 3M11A 3R0TA 4NFNA 3C0HA 4EC9A 2BAKA 2YDJA 4QYHA 4U42A 3NX8A 1JKKA 2CGWA 1ND4A 4B99A 4XV2A 4R3PA 4R6VA 3O7LB 3RPSA 5B2LA 4FSNA 3HX4A 5CU2A 1ZZLA 2FYSA 4IVAA 4KIOA 1WMKA 3WYYA 4Z55A 4N6YA 5EFQA 4K1BA 2BTRA 5IF1A 2WMUA 4U41A 3Q4CA 3WI6A 5CTPA 3JUHA 3NSZA 3NYOA 4MXXA 2HELA 4BDBA 3HKOA 1PMVA 2BRGA 4LQMA 4RWLA 2F7EE 2XJ1A 4BGQA 3AD6A 3E8DA 3R8VA 3TWJA 1BI7A 2HWOA 3ZHPC 1G8SA 2UVXA 4G31A 5LCJA 2V55A 3WIGA 3PY3A 4N4SA 5J9YA 2Y4IB 3MESA 2WEIA 3I79A 1ZARA 3ZRLA 4USFA 3DFAA 4WUAA 1PXIA 2VWIA 5DT0A 3KQ7A 3P9JA 4NM3A 2ZYBA 1OITA 3QXPA 4P5QA 4PDOA 5AM7A 4O84A 5J9LA 3FKOA 5FQDC 2BKZA 4ACCA 3DXQA 2XK4A 5ANOA 3EN5A 4F7JA 4U97A 2C3IB 3A8WA 3KU2A 4TWNA 4AGWA 3PZHA 4WRGA 5BX0A 4QQCA 2P55A 2CDZA 4EK8A 4G5PA 2B9IA 4JDKA 5IMEA 4X3FB 3BBTB 3R7GA 4MBJA 5GZ8A 4OUCA 3QZIA 3VBWA 2BRBA 3DLSA 5ETCA 4FICA 2HWPA 2QOQA 4RVKA 5D11A 4B9DA 4AXAA 3PXKA 3FI4A 4TY1A 3GCVA 4FKJA 5HO6A 4TYHB 1W83A 3N51A 3OW4A 5HBEA 4OLIA 5IMXA 4HYUA 5ITAA 3C1XA 3EN6A 1PYXA 4M97A 3CQEA 3TKIA 5L8JA 3RTPA 2JEDA 2LGCA 3B8RA 3BHUA 4IZYA 5DH3A 4TZRA 3UC3A 3RCJA 4I92A 3CJFA 3CR0A 5CF4A 4AZTA 3QD3A 2C6EA 4MQ1A 2UZTA 1LUFA 3BYMA 3GU5A 4QMMA 3NUXA 3UOHA 3SOCA 1UU9A 2I0YA 2ETMA 5KMNA 4FV9A 3S2PA 2BROA 1YXUA 2X2MA 1NY3A 2OG8A 5KMKA 2R3HA 3ETAA 3ODZX 3RAWA 5IEXA 2R3NA 3BEAA 1ZMVA 3I81A 2YFXA 3A60A 4RFZA 3COMA 5EKNA 2A27A 3CP9A 3L9NA 2VRXA 4IFGA 4ZZNA 5CAQA 2OH4A 2OW3A 1XH6A 4XG9A 4XHKB 4ZLOA 2WTKC 3LQ8A 2J90A 5EDRA 3ZM4A 4AZFA 4CRLA 3GC8A 3HDNA 5HTIA 4JIAA 2BRHA 5M4FA 2YM5A 2C6IA 3UOKA 2WMAA 3D5WA 1PJKA 2CSNA 4O7TA 4FG8A 3K3JA 4ZS4A 5AR5A 1V0BA 4U5JA 2Z7SA 2R2PA 4QMSA 5IUHA 4WOVA 4B8MA 1Q8YA 1XBAA 3AD4A 2VTPA 3OW3A 3R9OA 2BRMA 5M06A 5ANIA 3OUKA 2UV2A 4QPAA 1UU8A 5E90A 2VGOA 4TKSA 5F9EA 4F1MA 4ITJA 4L46A 4L44A 5AAGA 4DEIA 4TYGA 1Q41A 3TXOA 4FEXA 4F09A 5AV4A 4GW8A 5CI7A 4FKSA 4IZAA 5AV2A 4RQKA 4YO4A 2A1AB 3PIXA 1U5RA 4AZEA 1OIRA 3BELA 4WNKA 5CT0A 3UG1A 1JAMA 4Y85A 4X2FA 3ZOSA 3U87A 3KMUA 3UIXA 5K5XA 3AOXA 1OB3A 2JDRA 5HBJA 4OTIA 4MK0A 3HMPA 2JDTA 4GIHA 3VQHA 2CMWA 3RNYA 3I0OA 4YJPA 5LXMA 3QCQA 3RKBA 5C1QB 2BHHA 2JFLA 4PMPA 2QOBA 1J1BA 3IECA 1KWPA 1PXKA 4W9XA 4H1MA 4GMYA 5DWRA 3BU5A 3KXNA 4QP9A 2WQOA 2IJMA 2UW3A 3RK7A 4BHZA 2WAJA 4I4EA 2AC5A 4DGMA 3CCNA 2XKEA 4FTIA 5I9WA 4KAOA 5EI6A 4C36A 4CTBA 4XOZA 3LIJA 2P33A 2YIRA 4QQ5A 2OH0E 2RG6A 5FGKA 4AAAA 4O91A 3D2IA 5BVNA 4DEGA 4R7BA 2G01A 4YZDA 2CNQA 4FSWA 4X6QC 3HA6A 3LE6A 2CGXA 3OWKA 5KMIA 5IEYA 1ZWSA 4UBAA 3LFNA 3PE2A 1OBGA 1MP8A 4IAYA 3OHTA 4BZOA 4CLIA 3T3UA 4CQEA 1BLXA 3FYKX 4UXLA 3K5UA 2ZM1A 3KRWA 4FL1A 4G3DA 4G9CA 4OTFA 2DYLA 5GNKA 1OKZA 3EYGA 2B4SB 3V8WA 4YC6A 3R04A 4FTMA 3HRFA 4RJ6A 4DEDA 2VU3A 2R5TA 2XB7A 4Y5HA 3KY2A 4DF3A 4K2RA 2YWPA 4QNAA 3MPAA 5CU4A 5JQ8A 3H9OA 5CSXA 4P4CA 4FKPA 4KKGA 3DU8A 3OCBA 5IUIA 3C4FA 2PZYA 3O2MA 2YLFA 3Q5ZA 3U51A 4AT4A 2UVYA 4EH5A 1QL6A 4AFJA 2VWUA 4DG3E 3TUCA 4AP7A 5B2KA 3DAEA 5AV3A 4D4YA 3F3WA 3GT8A 4LMUA 4AX8A 3SVVA 1VYWA 4Q5HA 1F5QA 4IWQA 4X2GA 5IH5A 3Q9ZA 4I1ZA 1H07A 3KULA 3TM0A 3DFCB 3Q6UA 5HX6A 3QALE 2X39A 4EOMA 3IS5A 3KCKA 4PTGA 2FUMA 4PQNA 3VF8A 1RJBA 4AT3A 3CY2A 3GFWA 2XIKA 4DGOA 2OU7A 3TNPC 3SG9A 2C0TA 3TV7A 3QA0A 3FZRA 4A9UA 5J5SA 1MRVA 5ANJA 3LFFA 4OBPA 3SDJA 3IDBA 4BCJA 5KHXA 2F7ZE 5FBNC 2PUIA 4GK3A 1CKIA 2XIXA 4GUBA 3F82A 1T45A 2W4KA 5J8IA 4C2WA 4Z7HA 3FE3A 5HTBA 5HVYA 3TV4A 4ENXA 3FWQA 4CFXA 3LOKA 2G2IA 1JKSA 4EJ7A 3O8UA 3EKNA 4FOBA 3LM0A 3MYGA 4ZJIA 4FT0A 4LRMA 3VUMA 2NO3A 4XOYA 4ZZOA 4O38A 5DOSA 5DRBA 4AACA 1CMKE 3WZUA 4XP0A 2GNGA 3UTOA 4D2SA 2WTJA 4I5CA 3OWPA 5T68A 5L6WL 4ZLYA 4DCEA 2UW8A 4JBOA 4PDYA 3S4QA 4D9UA 2HZIA 3R8LA 3O51A 5B2MA 3LFBA 5GJFA 3FJQE 4TWOA 1KOBA 3UQGA 5EHYA 1PKGA 4KIKA 2QONA 3GCSA 4OT6A 1K9AA 3ORPA 4GU9A 1J1CA 4YJSA 2C6KA 3DXNA 3II5A 2F2CB 3GOPA 4IIRA 4YGAA 3ZO1A 4NCTA 1HCLA 2PHKA 3CTHA 3BGQA 4DT9A 5DN3A 3TNHA 1ZZ2A 2W96B 1OL5A 3R28A 5TE0A 3ZXZA 4GL9A 5K9IA 3N4TA 2I40A 4X3FC 3QC9A 5BYZA 4O2PA 5L2QA 2Y4PA 4GFMA 3G0FA 2ETKA 1JNKA 4GK4A 5LWNA 4BICA 3O7LD 3FXXA 4HPUE 4NKAA 4U8ZA 3R8ZA 1RW8A 3Q04A 3HUBA 3KXHA 3VBQA 4Y83A 5I9VA 2I1MA 4LUEA 1XH5A 3U4WA 4FIFA 4BWKA 5FEQA 5CASA 4R78A 2O65A 4L8MA 2XNBA 4UWYA 2IW9A 3C4EA 3BU6A 3WOWA 4I23A 4L3JA 5DPVA 2ZV7A 2C69A 2O3PA 5KHWA 3UZPA 3FBVA 3O0GA 2B52A 3R2YA 4BIDA 4QMVA 2C4GA 1H24A 3E5AA 3KN5A 3D15A 2PVMA 4QQJA 3RPOA 3RVGA 2W1IA 3MH3A 4X2KA 4FEWA 4GIIA 3L8VA 5TT7A 3EN4A 3ZO3A 4JAJA 2W1ZA 3QQKA 2GHGA 3R7OA 1RQQA 2E9NA 4JBQA 4A9SA 4F1OA 5DIAA 3TNWA 3LW0A 4OTDA 5HIBA 4KKHA 4TL0A 4QYFA 5J7BA 5HBHA 2OO8X 4DTAA 3MH1A 3CSVA 1JOWB 3FMNA 2Z7LA 2UZWE 4X6RA 4NU1A 1OPKA 2IZTA 2RIOA 3EQBA 3OROA 4H3BA 2VO0A 4AE6A 1SYKA 2WZJA 2E9UA 3U6HA 2W5AA 4L53A 5EYMA 3R7IA 3UDBA 3FHRA 3V8SA 5BVKA 2ZB1A 1CKJA 3QKLA 3WF5A 4CKIA 3KRXA 3EL7A 2XKCA 3O71A 1FVTA 1YDRE 3NGAA 2BPMA 4U0IA 4C4EA 4CFMA 4EH3A 3JVRA 3BYSA 5BVEA 3UOLA 2HENA 4FIGA 4QP8A 1NVQA 4FSQA 1R3CA 5KMLA 3R02A 3O96A 5DNRA 2XJ2A 4DH5A 3TKUA 4RX5A 2JDOA 4RIYA 4W8EA 4IJ9A 1GZNA 2GNLA 2WOTA 2YCRA 3QCSA 4NTTA 4L3PA 3MBLA 4UWCA 3D83A 4A4LA 2BRNA 4RWKA 5BMSA 3UG2A 3DK3A 4YZNA 2J2IB 3VAPA 1W98A 1U59A 3VUIA 3SGCA 2I0VA 3RPYA 2OF4A 2PVNA 3F2RA 5HESA 4CFVA 3I5NA 4LOOA 5C26A 3AC2A 2J0MB 5FDXA 4AF3A 2C6DA 3Q3BA 4Q5EA 5DBXA 3GUBA 3LXNA 3AC4A 5AP6A 4UV0A 4YJRA 4CXAA 3F3VA 4DCAA 3RHKA 4R5YA 4ZSLA 2CKEA 3PJ1A 5FTOA 1Q5KA 1Y8GA 1RDQE 5A6NA 4RPVA 3TNIA 3UMWA 3NLBA 3F2AA 4BI2A 5C4KA 4J99A 4E20A 3UIUA 5L3AA 2PZPA 4GT4A 1KE5A 3KK9A 5F1ZA 2GS2A 2ZDTA 4EYMA 4YTCA 3ZU7A 2YABA 1M7QA 4FSRA 5JZNA 4D58A 2J51A 5H3QA 4MEDA 3ZLYA 3ORTA 4M0ZA 5AA8A 4EZ7A 1MQ4A 2UZLA 3NNXA 5KKRB 4W9WA 4IXPA 3SOAA 3EQRA 2QO2A 3UVRA 3JS2A 3ZEPA 3NW6A 4F0FA 2HXQA 3MY0A 4RJ5A 4K33A 5LMBA 5F20A 4CT1A 4QMTA 5D7VA 2GTNA 3CPCA 3FMLA 4IX3A 4C0TA 2XNGA 2QOFA 3LJ1A 4JQ8A 4I3ZA 3QKKA 5KZ0A 3O23A 5DGZA 5E8ZA 3FUPA 4QTAA 2YA9A 4ZTHA 2VO3A 2W17A 5CI6A 3WE4A 2H9VA 4GEOA 4HGTA 5HCXA 5IISA 4YZ9A 4O1OA 5FP5A 2XCHA 3R1YA 2YM3A 3COIA 1H27A 3ZLXA 4U79A 3VS4A 5AAFA 4EOIA 4XX9A 1GOLA 3F69A 4KUJA 3DY7A 5AUYA 2XK7A 1YQJA 3MH0A 1WBTA 4KIQA 3R9HA 4RX9A 4JL9A 5AUXA 4YP8A 3ZC6A 4YTFA 1JSVA 2VWBA 1P14A 2DWBA 4TYEA 5AP2A 1IR3A 4M7IA 5ICPA 3ZFMA 3MY5A 2J5EA 3NUSA 3ZFYA 2VO7A 3G0EA 4IVDA 4D5KA 5LVNA 1GIJA 4BFMA 5HO7A 4MH7A 4H36A 2OIBA 4GKHA 1X8BA 5C27A 1GIIA 3QLFA 3I6WA 4IAKA 3NZ0A 1JKTA 5FTQA 3KCFA 4NKSA 4ZTSA 3V5QA 5LQFA 3B2WA 1BUHA 1AD5A 3UPZA 3PYYA 2G15A 3NAXA 4W4VA 1U54A 5BVWA 3EQCA 2CCIA 1XHAA 4MTAA 4NFMA 4EUTA 4RT7A 4NM7A 3LAUA 3GEQA 4HGLA 4P90A 4E26A 3Q9YA 4FSZA 3A7IA 5CEOA 1PXLA 3GNIB 4ZTLA 2GHMA 1ERKA 5HG8A 3G90X 3NNWA 4MXZA 1V1KA 4K9YA 4TW9A 4WG5A 4C33A 4ASEA 3O50A 4GYGA 4RWIA 4X0MA 3RJCA 3Q32A 4D2RA
chains in the Genus database with same CATH superfamily
4JJRA 5TO8A 3QF9A 3N4UA 3AC1A 3A7FA 3ZRKA 4AN9A 4L01A 5AUZA 2ZVAA 4IZ7A 4C57A 2O8YA 3BGPA 4KIKB 2AC3A 2ZM4A 4MD9E 3EL8A 2CGVA 4RMZA 4V0GA 4A9YA 5AUTA 5HNIX 3LKMA 3NMUF 4QP4A 4ZTMA 3POOA 4IDTA 3EQFA 3ZCLA 4C62A 1NA7A 2PTKA 4RJ3A 2WD1A 2IG7A 3UBDA 3QD2B 3LCTA 4PMMA 2VWZA 3R8MA 4BDIA 1CM8A 3HRCA 1K3AA 2NP8A 5J9ZA 1WBWA 3G2FA 4CLJA 2QOIA 3RCDA 4O7NA 4ZSGA 3Q53A 4IWPA 3FI3A 4G3CA 2WB8A 4H1JA 2XP2A 5AP4A 5GJGA 3IW8A 4DFXE 1DI9A 5FWKK 3FLNC 4CZUA 3KMMA 4L7FA 2QVSE 2W99B 5KMOA 1SVEA 3ACJA 5AM6A 4ASZA 2ITUA 2BIKB 4CZTA 5AR7A 4O81A 3IW6A 2VTOA 3PLAE 2W7XA 3U54A 5FLFA 5CVGA 2VWVA 4Z16A 3PSCA 2YM4A 4YC3A 3QYWA 3OP5A 1ZY4A 4O7VA 4LUDA 4UEUA 4XV9A 1FVRA 1JSUA 1SVHA 1URWA 4EUUA 5HLNA 4YJOA 4WNMA 4ZLZA 2X0QA 5BVFA 3PA4A 4HOKA 2X8IA 1YW2A 3KRLA 3W2CA 2RKUA 2PYWA 3OT8A 4UMUA 5BNJA 4KSQA 3OXIA 5L2TA 1BMKA 3FMEA 4CG9A 4BCPA 3I7BA 3JY9A 1Q4LA 3NDMA 5EI8A 3ORKA 3TNQB 3RHXA 5JMSA 4N57A 3R8PA 1Q99A 3VONA 3EZVA 4AGUA 2VV9A 4A9TA 2XIZA 1H25A 3EB0A 3V6RA 4FRFA 4YO6A 2J0IA 3ALNA 3IG7A 3IW4A 4EQUA 3AQVA 1NW1A 4RLKA 3LFDA 3TACA 2C3KA 3C50A 3CGOA 3DPKA 4WHZA 4E6CA 5B0XA 1MUOA 3V5WA 1H00A 2A98A 4FG7A 4JNWA 4L9IA 4RVLA 4F9AA 3W33A 5I9YA 3GI3A 4KD1A 2REIA 3QHRA 2XEYA 3U4UA 2C6OA 2ONLC 4IVBA 1Q97A 4TYHA 3TZ9A 3H9FA 4B4LA 3LCDA 4EH6A 2Y7JA 4NUSA 2B1PA 3W0NA 3IGGA 4E7WA 4JG7A 1WAKA 2HOGA 2Q83A 4HVDA 3QRJA 2X6EA 3F3UA 2PVHA 4FV2A 3V6SA 4EH8A 2ZB0A 4IDVA 4APCA 5E8UA 2BCJA 2JKKA 4M68A 4R3RA 5EW3A 4ZTRA 3VS3A 4AN3A 3CQUA 4I22A 4A4OA 2VTQA 2VNYA 1XKKA 3BPRA 4FZAB 4I6FA 4IM2A 3AT4A 2EWAA 1ZOEA 4X3JA 1A06A 3ZONA 1ZYJA 3GCPA 4CCUA 3CKWA 5EOLA 5EW9A 4F63A 4F7NA 4I6BA 3SAYA 4AUAA 3SG8A 3FV8A 3OEZA 3F9NA 1XQZA 3VBYA 3BHHA 5H9BA 3KIOC 5IQHA 5JFWA 4CFUA 1OL7A 4I5PA 2XUUA 5CAPA 3R9RA 2XK8A 4NW6A 3C5IA 3NEWA 2W5BA 3KMWA 4RJ7A 4ACGA 4Q9ZA 4GK2A 5E91A 4H3PA 4ZSJA 5H8GA 4G9RA 5DR2A 4ACHA 3SX9A 3F6XA 3P23A 4MKCA 4M13A 2YDIA 4TRLA 3FZOA 1B6CB 3N4VA 4RWJA 4AW2A 3Q2JA 5AUUA 4XLIA 1O6YA 2IZSA 2OFVA 1YHWA 1NT2A 4FUYA 3VWAA 5JFVA 1YRPA 2XNPA 3H3CA 3TUBA 3AKKA 1OL6A 4OBQA 3HMIA 2PUNA 5HNGA 4EH4A 4LDTA 2XRWA 3OT3A 5FBOA 4EBWA 4R77A 5HG9A 2DS1A 5CLPA 3BRBA 4QP6A 5KMMA 1Q24A 3UNZA 3QTSA 3NIEA 2HW7A 2V7OA 4HJOA 4P7EA 3SXSA 4X2JA 4BKYA 4EBVA 3CGFA 5AIKA 3W10A 4X7QA 4AA5A 2ZDUA 4FVPA 4FX3A 1E1VA 5AFVA 1PXNA 3MVLA 2OSCA 1H8FA 3VS7A 4AGDA 4HYHA 4IAZA 2R3JA 3A99A 2V0DA 3EFKA 2BMCA 3TJDA 2OJFE 4ZTNA 2C5XA 1YDSE 3C5UA 4NM0A 5IKWA 2EUFB 4C2VA 3KK8A 1OZ1A 4KIPA 4MYGA 3LHJA 5T6KA 4DBXA 2UZBA 2B53A 3MIAA 2Z02A 3W55A 3AMBA 3IK3A 4EHEA 1XMLA 3C51A 5FEEA 3PUPA 5ETFA 4USDA 3R73A 2XZSA 3A4OX 3QYZA 4FKQA 3ZO2A 1H0WA 5KKRC 5EQEA 3W0QA 4DGNA 4C8BA 3CIKA 4BCNA 4UMRA 2VNWA 1H1PA 1QCFA 3DDQA 4FV6A 1CSNA 4LGGA 4QP1A 3WF7A 4CCBA 4MVFA 5AUVA 3U9NA 3LLTA 3FXWA 3EN9A 5EDQA 3KVXA 2R3GA 4FTJA 4ZS0A 3LQ3A 4FUXA 4ZJJA 5DA3A 3S95A 4CFNA 2GNFA 2RFNA 4MXCA 5KX8A 4FV3A 1WVYA 4QP2A 2YISA 2I0HA 3ZSIA 1I09A 3C0IA 3HV7A 2UZUE 3M2WA 3OXZA 2XNOA 4I94A 2NYAA 4F65A 2WQEA 1KE6A 4U3ZA 3UC4A 1PHKA 5L4QA 2GTMA 3SW7A 3W0SA 3FZPA 4DTBA 1S9IA 2WIPA 3UO5A 4O7SA 4EHVA 2PVJA 3NUPA 3P5KA 3ORLA 1L8TA 4Z7GA 1UA2A 2IPXA 2QLUA 5EKOA 3DJ5A 5CEPA 2H6DA 1WBNA 4PTCA 4WT6A 2Z7RA 5CX9A 4E1ZA 5M56A 4RGJA 3DB6A 3DJ7A 4FBXA 3LFCA 4PUZA 4PPBA 3RNIA 4BDCA 4GKIA 3G6GA 3P0MA 3P4KA 1H0VA 4DFBA 3RWPA 4R7HA 3IDPA 4FV0A 1UWHA 1CDKA 3PWDA 3GU8A 4GJ3A 4I24A 4QMWA 4BBMA 2QOLA 3FY0A 3IKAA 3MPMA 2YCFA 3MA6A 4HYSA 4U40A 5DI1A 1OBDA 3D5UA 1H01A 2JIIA 3WF9A 2BDFA 5IZFA 2OJIA 1TFFA 3HP5A 2VWYA 5D12A 2VWXA 5ANEA 2J0JA 5IQAA 2ITPA 4S31A 2WGJA 3OZ6A 3K54A 2ZFYA 2XF0A 4OW8A 4J71A 3V5TA 3TI1A 3FPMA 3ALOA 4FK6A 4OTHA 4EH9A 2BVAA 5CQUA 5EYKA 3D9VA 5DRDA 1HOWA 2WTWA 5J5TA 5BQ0A 3COKA 3PY0A 3WF8A 2B0QA 4AA0A 3UQCA 4FJVA 3UVPA 5I0BA 5HD4A 2OWBA 3FHIA 2ERZE 4UN0C 4C7TA 3E3BX 3FL4A 1STCE 4F08A 1XH7A 2GHLA 3EFLA 4GU6A 4TN6A 2R3OA 5GHVA 2F7XE 5AWMA 5E9EA 3ZZWA 4DH3A 4C3FA 4YPDA 4CYIA 4GFOA 4F70A 1WBOA 3UDZA 4FKRA 1OPJA 3DNDA 5AJQA 3FAAA 4O4FA 3VUGA 3PIZA 2OGVA 3R22A 1Q3DA 3OG7A 4F6UA 2R3QA 5E7RA 5KCVA 2Z7QA 4EK5A 3VO3A 1PMEA 2OZAB 3HV4A 5L2SA 4ASDA 4LGDA 5DYJA 4FNYA 3UPXA 4JDIA 4FTCA 4M0YA 2PSQA 3FLQA 3TZMA 5G1XA 5IA3A 4IEBA 1E9HA 4RZWA 3UIBA 3LMIA 2CCHA 4EOPA 2FSOX 2NRYA 4N6ZA 5L8KA 3RPRA 5A4EA 3TZ7A 1DAYA 1XH8A 5AA9A 3R00A 2EB2A 4B7TA 1V0OA 3QZFA 4R3CA 2OXXA 3V51A 3SD0A 3P7AA 5A3XA 4IB5A 1SVGA 4C61A 4QOXA 3D5XA 2V62A 4FL3A 3GC9A 3QUDA 3BHYA 2R7BA 3D5VA 1Q61A 4UB7A 2X6DA 3EQDA 3HDMA 4LM5A 3A4PA 3CEKA 1ZRZA 4RFMA 5M55A 1ZAOA 3M1SA 3R7UA 4NJDA 2ITWA 3D0EA 3CD3A 5KO1A 4FV8A 3AC5A 4DEEA 5CSWA 4C4FA 4NZWB 4C38A 3EFWA 4HZRA 5GIPE 4FSYA 5CNNA 4FYNA 2QHNA 3KRJA 4ALWA 3UDSA 4RBLA 1PRYA 2OFUA 4UXQA 4AOJA 5A4CA 3T9IA 3DB8A 3B2TA 3MH2A 4I5MA 4N0SA 3RP9A 3SXRA 3OBGA 1U54B 2YAAA 2QR7A 3RZBA 1W82A 3BLRA 1REJA 3L8XA 4G1WA 5CVHA 1JVPP 3BQRA 5ANGA 5EM5A 5TR6A 2CKQA 3FZTA 3E88A 3GGFA 2X81A 4ZEGA 3DAKA 5DHJA 1Y57A 1Y91A 2BHEA 3CY3A 3FMJA 4GH2A 4AZVA 4F9YA 4QMNA 3L9PA 5FP6A 4MD8E 5CWZA 5DR9A 2G2FA 3R1QA 1IA8A 2XNNA 3DQWA 3R2BA 2HXLA 5EYDA 5BYLA 3VUDA 3VUKA 3AC8A 3C4CA 3P86A 3A7HA 2XBAA 3EN7A 2H8HA 2JLDA 2J6MA 2YLEA 5H2UA 4MAOA 1VZOA 2WMSA 1M2PA 1WVXA 4FSUA 4HZSA 5AR4A 1OUYA 3KXMA 4FI1A 4ITIA 4EH7A 2PULA 4BJJA 2O2UA 3FZ1A 2XKFA 4M69B 4E73A 4AXEA 1FQ1B 2BZJA 2UZEA 4CKRA 3THBA 4FOCA 3FLYA 1H1RA 1TQMA 1Q3WA 3QQFA 4OBOA 4JS8A 3CD8A 4JR7A 2QHMA 4JG8A 4YU2A 4CYJA 5IU2A 3RM7A 3AXWA 2GS7A 3TTJA 1R0EA 3JY0A 2IVUA 4PP9A 2BKKA 3OWLA 3P5JC 4ZMEA 5BPYA 5JEBA 1OM1A 1H1WA 4PF4A 4IC7A 5EM6A 1RE8A 1ZYSA 2PVRA 3MW1A 2VAGA 2X9FA 4BIBA 4PDSA 3PE1A 5IQCA 4I6QA 3ZBXA 4AU8A 4O0UA 4BL1A 2OICA 2X8EA 4AW0A 5AUWA 4AOTA 4ERWA 3ID6C 4DEHA 1W8CA 2C6LA 1YDTE 2Y0AA 3BQCA 3EWHA 1Z9XA 3HP2A 3DQXA 1Y6BA 4G34A 4EOQA 3RAIA 1U5QA 4TWPA 1H1QA 2VWWA 2JBOA 4TTHB 1JQHA 4RVTA 3LFAA 4ALVA 4BN1A 2YN8A 2GPHA 2WU7A 4I0RA 3HEGA 4L67A 5JN2A 3EMGA 3NS9A 4ACMA 4F1TA 4BRXA 3NR9A 1VEBA 3BBWA 2ITYA 4G6LA 4DA5A 3IGOA 2GQGA 4FNZA 5KUPA 1FVVA 3BE9A 3ZDUA 3NNVA 3NRMA 3PA5A 3W2QA 4KWPA 4BWXA 1O6LA 3MFUA 4IB3A 5AP5A 4QTCA 3F61A 4O0XA 5EQPA 1OI9A 1XH9A 4V04A 3PXZA 5K4IA 5M57A 4WBOA 5D10A 4I93A 5HE2A 3AT3A 5CT7A 5AP7A 4F64A 5KMJA 4AZWA 3ATSA 2E9PA 3NNUA 4FV4A 4DH8A 4ARKA 2WQBA 3MTFA 4G6NA 4XG3A 2QU6A 2GDOA 3FMDA 5BUEA 3QA8A 2CKPA 2XS0A 2V5QA 4O4BB 1G8AA 4E4LA 4C3PA 2GNHA 4X21A 1FMKA 1HCKA 4FZ7A 1J7UA 3PDTA 1SNUA 2OZOA 3MJ2A 3RBWA 4O0WA 1FOTA 3NPCA 4IWOA 3QAME 4JI9A 4IBMA 5IA1A 4YZCA 4QYEA 2YM8A 4R8QA 2YJSA 3FSFA 3WZDA 4IC8A 4BDGA 4DH1A 3B8QA 5HEZA 4JAIA 4YLJA 3UYSA 4F7LA 3ZMMA 4BB4A 4Y95A 3HVCA 3EQIA 2ONLA 3MTLA 4GVAA 4IJPA 4LG4A 4GYIA 3MB7A 2GNIA 4QD6A 4BBEA 1YOJA 3RPVA 2PMNX 1XR1A 3OMVA 5HG7A 3FLSA 2OZAA 2JAVA 5JSMA 1SMHA 1ZXEA 4FKUA 3JXWA 4JBVA 3C4XA 4EOJA 1WFCA 2WELA 4BHNA 3KGAA 3QC4A 5JK3A 3DK6A 3IPHA 1GAGA 4IW0A 3TCPA 2R3PA 4Y72A 4R7IA 4RIXB 5DT3A 5FXSA 3W32A 3R7EA 3TYKA 4JRVA 4D0XA 1H1SA 5DE2A 4L7SA 1YXXA 3CS9A 3VRYA 3HA8A 2XARA 4QMOA 2W1DA 1APME 3Q4ZA 3G9LX 4J52A 2QKWB 1M2QA 4QMXA 2Z8CA 4APPA 2NNWB 2R3KA 3LFQA 4U3YA 2F57A 2OJJA 1Y8YA 3KXXA 3DAJA 3R30A 2WTDA 4IE9A 2XCKA 3QGWA 4NT4A 3VW6A 5AP3A 1CTPE 3PJCA 1QPCA 2HY81 5M09A 3GU4A 4AXCA 1WBVA 3UVQA 3ZFXA 4CD0A 4BKJA 4E4XA 5K5NA 4E6QA 3F5PA 5E8VA 4OAUC 2BZIB 4YJTA 2ZV9A 4H05A 2QOKA 3R1SA 4KABA 1W2DA 4M3QA 2IN6A 1SZMA 4UY9A 3K5VA 1ZOGA 4FZFB 2QO9A 4O4DA 3G5DA 3TKHA 4YURA 2X7GA 1QMZA 2OJ9A 4EI4A 3UNKA 3T3VA 3VS2A 3RI1A 4Y5QA 4JRNA 5M4CA 4HGSA 5FM2A 4IX5A 4BY9E 2J9MA 3ZC5A 3PXFA 3SXFA 1KE7A 1GY3A 2R3MA 5C03A 2ZMDA 5EM8A 4JQEA 3FDNA 5J95A 3TEIA 4NH1A 2X4ZA 1KSWA 5D41A 4E6AA 3O8PA 4XRLA 3LFSA 3QQLA 4O82A 2B9JA 2H96A 2W05A 5L8LA 5A4LA 2ERKA 4N70A 4CFWA 3BCEA 3H9RA 3OTUA 3NW5A 3ZRMA 5D1JA 4M84A 3A62A 1OIUA 3HLLA 3KKVA 4B0GA 2BUJA 4ONAA 3O8TA 2XEZA 5A14A 2HY0A 2EXMA 2WO6A 5TKDA 4ZAUA 1H4LA 3E92A 2WKMA 5AR8A 4UZDA 3BEGA 4S34A 4UMTA 4AOIA 4F78A 4FNXA 2W0JA 4XG6A 4AXDA 1H26A 5KNJA 4G17A 4BCHA 2EXEA 3VJNA 3AD5A 4OAVB 4DN5A 3MFRA 5CAOA 3P1AA 3Q9WA 4V0GB 1R78A 4YHFA 4DGLC 1P5EA 3MA3A 3PSDA 1GIHA 3Q4UA 4BZDA 1WZYA 4E8AA 3BL9A 4QMUA 2YZLA 3UNJA 3QWJA 3PFYA 2C5YA 5HGIA 1URCA 4FT3A 1JWHA 4QP3A 1YHSA 3EQGA 1H08A 3E7VA 5IQBA 4WIHA 2PMLX 4YZBA 3MB6A 3WARA 3KEXA 3FQEA 3MV5A 4I0SA 4G5JA 4DDGA 2VTMA 1XO2B 3QUEA 1O9UA 1OGUA 2OKRA 4GT3A 2AUHA 1BL7A 3ZYAA 4QYGA 4HCVA 4PY1A 1OGYA 3A7GA 1EH4A 2WQMA 3MJ1A 4RIWB 4BBFA 3FKNA 3I4BA 3PVBA 4S30A 4QPMA 5BVOA 4RG0A 4PV0A 3E8NA 4FTNA 4TPTA 3R8UA 2NRUA 3S1HA 1JKLA 3KB7A 1ATPE 3PWYA 4XJ0A 5TF9A 4EOLA 1YI4A 1YHVA 4KKEA 4YTHA 2YIXA 2WEVA 3F7ZA 4NIFA 2XM9A 3ZTXA 4BDDA 1VR2A 4IH8A 4AQCA 5AADA 4G3EA 5J1VA 5IQDA 5HCZA 4MNEB 3TTIA 4AT5A 5ACKA 3ZEWA 2WMRA 4CTCA 4G3GA 1PMUA 1MRUA 4XS2A 4YNEA 5HVKA 4DTKA 1QPJA 3ODYX 3UO4A 2W4OA 3L1SA 1B38A 3DS6A 1YXTA 3CC6A 3R9NA 2VTSA 5BUJA 2XMYA 2JKQA 3NUYA 4MNFA 4P5ZA 5AP1A 5B7VA 3QX2A 3ORMA 3DNEA 2FSMX 4RC2A 4KRDA 3ANRA 3LLAA 2UZDA 2YCSA 4LL0A 2HZ0A 2UW0A 3VW8A 2CKOA 3R6XA 4LV5A 5CU3A 4L45A 1UNGA 4NCTC 4OTRA 4YHTA 3U6IA 3HGKA 2UW5A 4YBJA 4B8LA 2WOUA 3MVJA 5EK7A 4UMPA 3ITZA 5CF5A 2BIYA 1ZMUA 2W5HA 3GCUA 4JX3A 4CV8A 4S32A 3Q52A 5CQWA 4RZVA 3OOMA 4M66A 3RZFA 3TN8A 5M4UA 2XK9A 4ZK5A 2FSTX 4IB0A 3DKCA 3ZUTA 3PRFA 5JQ5A 5AX3A 1UNLA 2YERA 3AMAA 4MF0A 2IZUA 5FRIA 2ITVA 4FZ6A 5LMKA 4FKLA 3VNTA 3LVPA 4GG5A 4R5SA 3UJGA 3L9MA 5E4HA 2C0IA 5ETIA 2O0UA 1M14A 1NVSA 2PE0A 4ZY6A 3KULB 3HMMA 1ZLTA 2QU5A 2Y4IC 3PPJA 5HCYA 2FA2A 4UZHA 4C34A 3HNGA 4YUQA 3DXPA 2BAJA 4F0IA 2P2HA 4MD7E 4UALA 5GIOE 4U81A 4JQ7A 3VN9A 1JSTA 3FMMA 4XG4A 3LM5A 4F9WA 2ZAZA 3A7JA 3PZEA 4K77A 1CKPA 3QUPA 1LPUA 2P0CA 2R7IA 3PFQA 4CEGA 3DKFA 3KREA 3RALA 2IF8A 1TVOA 4FT5A 5CY3A 3MY1A 2Q0NA 4ANOA 1PF8A 3DGKA 4FV1A 3BKBA 3W0RA 1F3MC 3OOGA 3WIKA 4YZMA 5LMKC 2BZHB 3BZ3A 4I41A 2YAKA 4FV7A 4WG3A 3VBXA 3V5JA 3HMOA 4CSVA 2ETRA 2XIRA 3NFFB 1OMWA 3E7OA 5F4NA 3WYXA 5BUIA 1IG1A 5EHOA 3R9DA 2HAKA 5L2IA 5CEQA 4PL3A 2IVTA 3HYHA 4LRKA 3W1FA 4MQ2A 3D94A 4EYJA 1A48A 2ESMA 2X2KA 4RIWA 4TYJA 3EJ1A 4YHJA 4II5A 2VZ6A 1NVRA 2XNEA 4WG4A 3T8OA 4YJVA 4FKWA 5E92A 5FXQA 2Y6OA 3KXZA 4ZY5A 1LR4A 2J50A 3F5XA 4XG8A 2XYNA 5EDPA 4QTEA 3QGYA 2OIQA 4BC6A 3QWKA 1ST0A 5E8SA 3I5ZA 2ITQA 3NVKI 4CRSA 2I7QA 5LVLA 3BIZA 4RC4A 4DFYA 4O0SA 4LYNA 4AGCA 4O2ZA 4X3FA 4HNIA 3E8EA 5HHWA 4DHFA 2J7TA 3DTWA 1MQBA 3E87A 2ZM3A 4Z9LA 2J4ZA 4PMSA 4PL4A 2R0IA 4L00A 4OR5A 5FG8A 1UVRA 3E64A 2YCQA 4DBNA 5BMMA 2BAQA 4ZTQA 2IVSA 3CLYA 4TWCA 4WKQA 5HVJA 4O7ZA 1KOAA 4FIHA 4C4HA 3MIYA 4BI0A 1VJYA 5HKMA 1B39A 5HORA 4NTSA 1I44A 4WA9A 3ZS5A 2RL5A 1FGIA 4CFFA 4O7RA 2E2BA 2C3JA 3EKKA 5M4IA 5IA5A 1FGKA 2YWVA 3L8SA 3PG1A 1UNHA 3PJ3A 2VTTA 5I5ZA 4JXFA 4ZMFA 3FC2A 3TJCA 4C4IA 2XJ0A 2BTSA 3DBFA 4D2WA 3OBJA 2BDJA 1UU3A 3QRIA 4NIFB 3SQQA 1DM2A 3HUCA 3FQSA 1IEPA 1T46A 3ORZA 3OXTA 2YIWA 3SHEA 1GJOA 2ZMCA 3QU0A 4GSBA 5JH6A 2IO6A 1O6KA 3CJGA 3FYJX 4GG7A 3W18A 3CPBA 5CF6A 4ZP5A 3LJ0A 3LCSA 4IM3A 1QPEA 2WFYA 4FSMA 3V3VA 4EC8A 2O63A 4EL9A 5IQEA 5FM3A 4XP3A 4JDHA 3UQFA 2CNUA 4C4JA 3PJ2A 3PP1A 5JRQA 1IASA 5FD2A 3NYNA 2YHVA 4ANBA 5JKGA 4FG9A 2BDWA 4L6QA 3OC1A 3OS3A 5HICA 2JDVA 3PLSA 2W1CA 4Y73A 1PYEA 4XUFA 1BYGA 3QTRA 4LFIA 5IH6A 3LXKA 3TIZA 3OCSA 4FIIA 4QO9A 4QTBA 4C59A 4FT7A 1NXKA 1YVJA 4XBUA 4XLVA 5CS6A 3BE2A 4RLLA 3ROYA 3PTGA 2A2AA 4A9RA 4BF2A 2HW6A 2VTLA 1MRYA 2HZ4A 4O0RA 2KULA 4D4VA 3G9NA 2WTIA 3KC3A 4Z3VA 2RSVA 3I6UA 3VJOA 1U46A 2Q0BA 2UUEA 4FSTA 3QTZA 4PP7A 4MBIA 3SLSA 5I3RA 5IA2A 4KSPA 3OUNB 4NSTA 3KXGA 2SRCA 4GCJA 3QCXA 1XWSA 3LPBA 3UDTA 3RAKA 5EQYA 4HNFA 1GZ8A 5LVPA 4CT2A 4ERKA 1PXOA 4RSSA 5JFSA 2RG5A 2YIQA 4CMUA 5HNBA 2WTVA 4FTTA 4EQCA 4BTKA 2YM7A 3MVMA 3VRZA 3NYVA 3HAVA 5IQGA 4K0YA 5HTCA 4DH7A 4F6SA 3F2NA 2LAVA 5IA0A 2DUVA 4XEYA 3NW7A 3F66A 4QMZA 4KS7A 4FT9A 4QDEA 3AC3A 3KA0A 4FTKA 4YNOA 4FIJA 5KE0A 4YTIA 5E8YA 4YLKA 4EH2A 2V22A 5CSHA 5DFPA 2R3LA 3Q2MA 4BGHA 4IX4A 2PE2A 4BCKA 3IDCA 4PX6A 4M67A 2C47A 3D2KA 2AYPA 3ZDIA 3U55A 3D4QA 3PVGA 2FGIA 4K18A 4BIEA 3WILA 4USEA 4ZSAA 4QQTA 5IDNA 4GJ2A 5LMAA 3QQHA 2R3IA 3F3TA 3GU7A 4XBRA 4C58A 4HGEA 4DEAA 3FKLA 3PPZA 3HL7A 4PMTA 4D1ZA 3UGCA 2RF9A 5J87A 4BDKA 3Q4TA 3FLWA 5FUTA 2W1EA 3OCTA 4FKIA 5HIEA 4ANSA 2UZVA 3OCGA 4I6HA 2X1NA 3GENA 4FKVA 2FH9A 3LXLA 4Q2AA 5FDPA 3WZKA 1TQIA 4MHAA 3NCGA 3PXQA 4QPSA 4E4MA 2E9VA 3OTVA 4D9TA 3PG3A 5D9HA 1XBBA 5AAEA 4ANNA 4NL0A 4FV5A 3KRRA 3MS9A 4RX7A 3KF7A 3ORXA 4J96A 4KRCA 4ZSEA 4LL5A 4G6OA 5DT4A 3BV3A 4ZY4A 4HVHA 2W9FB 4EOOA 3OVVA 3VULA 5HZNA 5HE3A 5AEPA 3UODA 2B54A 3TV6A 2QI8A 3QLGA 3R7VA 3RWQA 4PRJA 4BDEA 2G9XA 3DDPA 3K2LA 4FE2A 2EVAA 4HCTA 3U8WA 2XNMA 4E5WA 2ZV2A 3FY2A 4U7ZA 3VC4A 2ITZA 3V8TA 1Z5MA 3I1AA 2WXVA 3PRIA 5AP0A 3C4WA 4RA5A 1M52A 1OKYA 3BWJA 4KNBA 4O0YA 4O21A 1FMOE 3PPKA 2B55A 3NCZA 2JFMA 3VHKA 3TG1A 1PW2A 3UP2A 2PMIA 4BDHA 4MXYA 5M08A 3FMKA 1Q8WA 2QR8A 1OKVA 3I60A 4XCUA 4XYFA 5ANDA 4IHPA 3E93A 5I9UA 1BL6A 3KVWA 3OY1A 3ZSHA 3DBCA 3ZSGA 3UOJA 2CLXA 3VIDA 5EW8A 5J79A 4BYJA 2P3GX 2FO0A 5I9ZA 3S00A 5BV3A 1J91A 2QG7A 2YITA 3H0YA 4DYMA 4NM5A 4DLIA 2VD5A 3PXRA 4FTAA 4PTEA 4JX7A 2JC6A 3Q60A 4RVMA 4ANLA 2ACXA 1YOLA 2WU6A 3R71A 3E62A 4S33A 4IACA 1K2PA 4P2KA 5C8NA 4O0TA 2UW6A 1W0XC 4D4SA 5IUGA 4H58A 2WMXA 5DG5A 3Q5IA 1PXPA 4AFEA 4C3RA 4BTJA 3ZUUA 2JAMA 3EQPA 5EH0A 4DINA 4EEVA 4EZ5A 3BYVA 1WBPA 3N9XA 1IA9A 5C8KA 4UX9A 3HV6A 3OEFX 4DGGA 2XH5A 5JFXA 2W1GA 3RMFA 4BWPA 3V5LA 4WBBB 2QLQA 5CSVA 4BCQA 2P2IA 2IWIA 4NWMA 4MNEA 5HX8A 2GQRA 2CHLA 2P4IA 4JT3A 1M2RA 3LXPA 3A61A 3H4JA 4AS0A 5AMNA 3OF0A 1SNXA 4F9CA 2ITXA 2PZIA 1W2CA 4DG0E 2BR1A 4E4NA 3CTJA 2YM6A 4HCUA 4YSJA 4HVSA 4FTOA 4FIEA 4FKGA 2HYYA 4RC3A 4BDFA 1AGWA 4YJNA 5A9UA 3NVMB 4JLCA 4J53A 3CE3A 4F6WA 1YXVA 1OUKA 4WSYA 1TKIA 5LCKA 4W8DA 4D55A 2YEXA 3IQ7A 3W8LA 1ZMWA 4U45A 5T3QA 1JPAA 4H3QA 4QMQA 4XNEA 4F0GA 3KF4A 5IEVA 5IG1A 2ITOA 1PXJA 3C0GA 4YLLA 5K3YA 5A54A 3ERKA 5DR6A 1JBPE 2Z60A 2JBPA 3PVWA 3MPTA 2VTIA 5E1EA 2KTYA 2UZNA 3F3ZA 3OD6X 4DFNA 1R1WA