4M0ZA

Crystal structure of itk in complex with compound 5 {4-(carbamoylamino)-1-(7-methoxynaphthalen-1-yl)-1h-pyrazole-3-carboxamide}
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
264
structure length
264
Chain Sequence
KWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Selectively targeting an inactive conformation of interleukin-2-inducible T-cell kinase by allosteric inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 264
sequence length 264
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m0zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m0zA01
5HX6A 5AX9A 4WSYA 4PTGA 4OGRA 3R30A 5D12A 3LFBA 2W1ZA 2GQRA 4IM3A 4H1JA 4IZYA 1J1CA 4FKSA 1M2QA 2H6DA 2R3HA 3LIJA 4I6HA 3VF9A 3EN9A 5IQCA 2WMSA 4FTRA 3LPBA 3ZUUA 3FC1X 4U81A 3DXQA 1BLXA 1KOAA 1YWRA 4CFNA 2XYNA 4M13A 5IG1A 4EUTA 5ANEA 3GI3A 4IVDA 3KCKA 4ASDA 1WFCA 4ONAA 1F0QA 5DT0A 5M53A 3QLGA 2UZLA 5HNIX 2WMVA 3VS2A 4HPTE 4RJ5A 2WOTA 4NIFA 2W7XA 4LRMA 4D58A 3ATTA 3HMMA 1ZXEA 3NW7A 2P33A 3RPSA 4AOTA 4CEGA 2A27A 3B8RA 4BDFA 4W9WA 1U5RA 4K2RA 2JBPA 5HE1A 2I7QA 2BIKB 4C2WA 5FEEA 2WELA 4JDIA 4UV0A 3DCVA 5AR5A 3WZKA 2SRCA 5KMNA 3B8QA 3KCFA 5EM7A 2GQGA 2GFCA 1UWJA 4BDKA 3W16A 2OFVA 1S9JA 3OZ6A 4I1ZA 1G8AA 2IVSA 3AD4A 3DXPA 4I22A 3QQHA 5DEWA 1R0EA 2V7AA 1OIQA 5IF1A 4DYMA 4RIYB 5FBOA 5AAGA 3VS1A 5M57A 1UKIA 2VZ6A 3R21A 3KMUA 2BDWA 5IUHA 4L68A 5B2KA 3RINA 4BTMA 2UW4A 1G3NA 1KE5A 4IADA 4KAOA 1WMKA 3BGPA 3FLYA 5A4EA 1AQ1A 4L6QA 4A4OA 5AUYA 5CQWA 3FBVA 4F7JA 4QPSA 3QX4A 5HTBA 1JSTA 3CE3A 3Q6UA 4PL4A 3NVKI 5GZ9A 2UVZA 4FK3A 5HBHA 2P55A 1ZYCA 4DGOA 5IH4A 2VTAA 2B7AA 2UZDA 3HECA 2BVAA 2E9NA 3HDNA 3NUPA 2BAQA 4AA0A 3DKFA 4O83A 2XK6A 4I4FA 4JIKA 4CRLA 3ACKA 2QG7A 4QTEA 2C5OA 5LWMA 2OWBA 3FSFA 5AR8A 4L42A 2W99B 5AP5A 5L2QA 2WQNA 4FOCA 3KRRA 4D4RA 4S30A 4U79A 5E8UA 4GH2A 2QOQA 4BTFA 5A9UA 3I0OA 2QHNA 1WBOA 3SX9A 5KBRA 3SVVA 3SOCA 1ZLTA 4OW8A 2QOLA 4PTCA 2VO0A 4ZTSA 4DEDA 2OJJA 2VWBA 5AR2A 3DTWA 4ZTQA 5CASA 4W4WA 1I44A 1YWNA 3GCSA 4FTIA 4XYFA 2BZKB 1UVRA 4RPVA 3QHWA 2WFYA 3VHEA 4YZBA 3BEGA 2UZBA 4NFMA 4TW9A 4BZNA 5CSVA 4I21A 2UW6A 3KN5A 3QC9A 2VTTA 2PE1A 3AMYA 3F6XA 4X2NA 3TEIA 4IWPA 3ZEWA 1OBDA 4PDPA 3V5PA 4X2GA 4NFNA 4B9DA 4FIJA 5IQFA 2YM5A 3V8TA 3EHAA 5HX8A 1K3AA 4EZ5A 3PY1A 3DBCA 3QTWA 4NT4A 4TTHB 1AGWA 2B0QA 3BI6A 5D10A 5LMBA 3S4QA 2FSMX 2R4BA 1R0PA 3FLQA 1A06A 1V0BA 3AGMA 3EQBA 3HL7A 3NWWA 2O3PA 3GOPA 4XG6A 3FYJX 1YOLA 2CJMA 4FKGA 4G5PA 4U6RA 3T9TA 3UZRA 3CGFA 3IW6A 3ROYA 4PPCA 2O65A 4BCOA 4FIIA 4RLKA 4U8ZA 4BKZA 1BL7A 4IC8A 5FP6A 5FTGA 1OL5A 5CT7A 4F6WA 2WKMA 3OG7A 3KF4A 4F9AA 4YO6A 3P1AA 1T46A 2HY81 3PXYA 1JKSA 3MESA 1V1KA 2X6EA 3O71A 5HCZA 3NUAA 3H3CA 3PRFA 3FXXA 4RQKA 3I79A 5CAPA 4AX8A 2RFEA 2C4GA 3THBA 4AOJA 2R3QA 4DBNA 4N4SA 4AN9A 4J71A 3Q4ZA 4L7SA 4RX9A 3L9PA 5AP1A 3OCBA 1WBTA 4HGTA 4E1ZA 5E90A 4OAVB 3E88A 2YM8A 1M52A 4IFCA 3AXWA 3WYYA 4ZY5A 4ZMEA 2YERA 2ERZE 4ANQA 3BLRA 5DLSA 2PMLX 2Z60A 5ANKA 3QCXA 4TWOA 4EUUA 3QRIA 3ZLWA 2X4FA 2X8DA 5TF9A 3H30A 1LPUA 4D2PA 5HD4A 2GS2A 2R3OA 2UW8A 1OKVA 4CNHA 4YUQA 2OICA 3R01A 4ALVA 3WZEA 4UX9A 1IAHA 2OGVA 3C7QA 3R2YA 3VIDA 3E3PA 4FV1A 1YRPA 2X7GA 2Y0AA 4GJ3A 2KULA 3JYAA 1SVGA 4XHKB 5BVNA 5CAUA 5L6OA 4R6VA 2NNWB 4DGLC 3EYHA 1ZYDA 4FTTA 4HJOA 5JFVA 1JSVA 4IB3A 4O2ZA 5DFPA 2OI4X 1OIUA 4MYGA 3MH2A 3EN5A 2C5VA 5I3OA 3BPRA 4DEEA 2XJ0A 3PYYA 2IZUA 2CSNA 4O27B 2R3IA 4RMZA 4UMTA 4QQ5A 5CWZA 3PSDA 1H26A 4AZFA 4JS8A 1P4FA 3GBZA 4M3QA 5DI1A 3W2PA 3H0YA 2WQBA 3K3IA 4W4YA 3LFAA 4I6QA 1OMWA 4E6CA 4EK5A 1U46A 3GQLA 5F4NA 1Q8TA 2W4KA 2YM4A 3MH1A 3R1YA 4AF3A 4DAWA 3ZUVA 4EWHA 4EYMA 4PP7A 4B0GA 4J1RA 4BHNA 2HWOA 4QP3A 3UODA 4L43A 2ZJWA 2GS6A 3BRBA 3ZFYA 4DH1A 5DBXA 3UZTA 5LVPA 2XIRA 2PZPA 2ITOA 3C5UA 5DIAA 4U42A 4QP7A 2YWPA 3GP0A 3UO6A 5CI6A 2ZV9A 4J8NA 4M84A 3AG9A 2CKQA 3R73A 2GNJA 3QCSA 3BBTB 4CV9A 3PXRA 1CTPE 3QD0A 4CG8A 2XRWA 4TNBA 5ETIA 5BUEA 4R8QA 4ERWA 4V0GB 4D1ZA 3V5QA 3C4ZA 1W8CA 3QWJA 1Q97A 3COHA 4XRLA 5E7RA 5E8XA 3ZHPC 3ZZEA 4K6ZA 3I60A 3IG7A 3UQCA 2BTSA 2IJMA 4CXAA 1RJBA 1MP8A 2C3JA 5GHVA 5AM7A 2BFYA 1J1BA 4J52A 3S95A 4DH5A 1PJKA 2VO7A 4U40A 4YJNA 4DFLA 4K11A 4ACCA 2O0UA 2XUUA 5DR2A 5HLPA 4RSSA 5DR6A 3EFLA 2X0GA 3Q9XA 4YJOA 4XOYA 4IMYA 4JXFA 4LOOA 3SD0A 3WF7A 2JITA 4F1TA 4C37A 4MQ1A 1P2AA 3W8LA 4D2VA 2WQMA 3VHKA 4ARKA 5HESA 4PRJA 4FKRA 4QMWA 3NGAA 4Y95A 5M4IA 3PIYA 3D15A 4HZRA 4QPMA 2QURA 1ND4A 4IJ9A 4YTIA 5I9XA 4BRXA 3A7IA 4U45A 1ZARA 5K5NA 4PF4A 3HV6A 3UP7A 4ZSAA 4CT1A 1WVXA 4KIQA 4PNKA 5CF6A 5FXRA 4ZS4A 2W1HA 1VYWA 5M44A 2I40A 1XBAA 2W1FA 4P2KA 3LCKA 4RX5A 3BYOA 1KE6A 4WD5A 3MDYA 3DXNA 4FSZA 5AUVA 4I3ZA 3R8PA 1JQHA 2HWPA 2P4IA 4TYIA 4O96A 1UU7A 2HW7A 2YA9A 4ZTRA 1Q8UA 5I3RA 3U6IA 4RJ7A 1BL6A 2PVNA 3BHTA 3DQWA 3FHRA 4DF3A 5EYMA 2WMXA 3ULZA 4NIFB 4EKKA 5CEIA 4Z7HA 5DOSA 3ZFMA 1UA2A 4NSTA 2OFUA 4FV4A 1A9UA 4FTAA 3VQHA 4W4VA 4BWXA 3F9NA 2W5HA 2RG6A 5EI8A 2R7IA 4EHZA 2QHMA 5TR6A 2JDSA 3Q4TA 4ZTLA 3TKIA 2ZV8A 3PXFA 2GHGA 3HA8A 3MY0A 4MXCA 4GCJA 4E8AA 4ANBA 4TYJA 4X2KA 2F49A 3RWPA 4P5ZA 4QQJA 3TN8A 1ZOEA 3OP5A 3PJ1A 3EL7A 5HO7A 3QUPA 5GJFA 2JDVA 4Y73A 4GKHA 2RFSA 4QMSA 2VAGA 2X39A 3NYVA 3L1SA 5EW9A 4R78A 3UOLA 2OH4A 2B53A 3Q5ZA 5D7VA 2C47A 5DA3A 4X2JA 2OJGA 4HCTA 3ZC6A 1ZOHA 5A4TA 3GC7A 4D28A 4GS6A 3MFSA 3HV7A 4OBPA 3R8VA 3ZDUA 4BIBA 4DCAA 4AW0A 4IWDA 3ZM4A 5IMXA 2XEZA 4DH3A 4FIGA 3HMOA 4RZWA 2ITPA 5I9UA 3BWJA 3DGKA 3QQKA 4U3YA 5M51A 4YNEA 2PZYA 1H0WA 4XG8A 4XG3A 4F7SA 5JGBA 2JKMA 2YISA 2AUHA 3KMWA 3AGLA 3LFEA 2EXMA 3AQVA 2X9EA 3C4WA 2X2LA 4D55A 4USFA 5IA0A 1TKIA 3C4CA 2C1AA 4FKIA 1Y8YA 2UW9A 3TUBA 5L2SA 3PWDA 4NK9A 3R63A 4KKGA 4KUJA 5IQEA 3PXKA 3JS2A 4WNOA 2VRXA 2GSFA 4A9UA 4IAIA 5BUIA 3C5IA 1SVHA 5L3AA 2I1MA 3OY1A 4WA9A 5KNJA 2J90A 2FVDA 3DU8A 4IX4A 4M12A 3NAXA 4BDIA 5LCKA 4B4LA 3WOWA 1W7HA 4JLCA 4R1VA 4PDYA 3Q32A 1M2PA 1XBCA 3MIAA 4FL2A 1NT2A 3PDTA 4ANLA 4A07A 5G6VA 4RVTA 2YFXA 1RDQE 3G15A 3W8QA 1DS5A 5HG5A 1REKA 3TZ8A 3P9JA 4HCUA 4ZTNA 4NCTC 5TE0A 3G9LX 3V01A 5AA9A 4O7YA 2OJFE 4BY9E 1H1QA 3BYMA 3QBNA 5GJGA 4E4NA 2PK9A 3NIZA 4IB0A 1YI4A 3DZOA 4M66A 4QMMA 3JXWA 4FODA 3PJ2A 4RX7A 4YSJA 2WTJA 2BRNA 2Z8CA 3RKBA 4LMNA 2BDFA 2ITWA 4DFXE 4FYNA 4FV9A 3CTHA 4BB4A 5M07A 4MVFA 5K0XA 4UYNA 3BIZA 4L44A 3WZUA 1YOJA 3TL8A 3IOPA 3QUEA 1NY3A 2EWAA 2V55A 4BTKA 4JNWA 3RNIA 3BYVA 4UWYA 2QKWB 1LUFA 1REJA 3TNHA 4FGBA 4W9XA 5IQHA 4G16A 4XG4A 3PTGA 3TKUA 4B7TA 1KE8A 3HRFA 4TZRA 1QMZA 4MXOA 5GNKA 4F9CA 3CQEA 3A7GA 3LLTA 4BGGA 3FXZA 4FT7A 3VF8A 3TTJA 1OL2A 1APME 4FBXA 1KUTA 4H36A 2YACA 3TI1A 3D7TA 3PA4A 4ZAUA 3BU5A 3PA5A 2R3FA 1OKYA 2Z7QA 4PNIA 1J7IA 2PL0A 4F6UA 2QO9A 3IPHA 3QTUA 2UV2A 2RL5A 4EK8A 4I20A 3ENMA 4RC2A 4HGEA 4KNBA 3GB2A 5HTIA 2OF4A 5FM2A 4RWLA 3RCDA 3SGCA 4EZ3A 3COIA 4J53A 3GFWA 4WNPA 3UVQA 4LL5A 5A4LA 3JVSA 3Q52A 2QO7A 4BCJA 2HZNA 5CF5A 2QLUA 1PMNA 2G1TA 4D9TA 3EZVA 1HOWA 5C4KA 2WU6A 3K3JA 3VWAA 4FTQA 5C1QB 1R1WA 3A60A 3VBVA 2GQSA 4GFGA 5CNOA 1QCFA 3KXMA 4AFJA 4ACGA 4BC6A 3DOGA 5IPJA 4FZ6A 1CKJA 2WU7A 4QYGA 4HYHA 4IH8A 4C8BA 3R8ZA 5E8TA 3PVBA 2AC5A 1Q3WA 1XH9A 5I5ZA 4RIXA 4FOBA 3MVMA 3BGZA 2VX1A 4MBLA 4BL1A 3U87A 4YURA 4BVUA 3REPA 5EDPA 2NRUA 2OK1A 2WTWA 3PIZA 4IAYA 5TO8A 3ULIA 1XH4A 5DYJA 4C3RA 2YABA 5T3QA 2IN6A 4DEIA 4YHFA 3QXPA 4FL3A 4QTAA 3COKA 4EYJA 5K5XA 4I5HA 4F65A 4IB1A 2VWXA 3LM5A 3MFRA 5KBQA 1URWA 3KRXA 3GU8A 4R3CA 3O7LB 4QMOA 1MRYA 2G15A 2YM3A 4YBJA 4GKIA 3BV2A 4CTBA 5ETAA 4RX8A 4R3PA 3SOAA 2Y8OA 3FMEA 4H39A 1BMKA 4QMTA 4O7TA 3CP9A 5AFVA 4LRKA 1PMVA 4K0YA 1QL6A 1NVSA 4DG2E 5JFSA 2ETMA 2VTIA 5KMMA 3OWKA 2OW3A 3W2RA 3SG9A 4DFUA 2QO2A 2R3GA 1MUOA 4R7IA 4CGAA 2VWYA 4JQ8A 3HP5A 3EYGA 4CZUA 1NVQA 2J51A 3AMAA 3KULA 3PSBA 1F3MC 2XM8A 4U5JA 4RJ6A 2ZAZA 4EI4A 2QD9A 4YTFA 3HNGA 4RFMA 2JC6A 3KK8A 1M14A 4NJDA 4ASEA 4RLLA 3WZJA 3F7WA 3FL5A 4CFUA 4E93A 4C3PA 4D4VA 1YXSA 3ZC5A 4CFFA 5CSWA 4K33A 5A6NA 2W1IA 3E93A 3I1AA 3UIMA 4QTBA 2R5TA 4D4YA 4JG7A 5ANOA 3UP2A 3BLQA 3V04A 3VVHA 4AFEA 4Y72A 4IDTA 4XV3A 3TT0A 4C62A 1H07A 3OC1A 3R7OA 5J1WA 1V0OA 4G3DA 4N6ZA 2Y9QA 4TN6A 2FSOX 5AR7A 3WF8A 2YJRA 3O50A 4G17A 4PPBA 1XH8A 3SDJA 3UOKA 2XKDA 3SXFA 2QOHA 3LFDA 4GT5A 4IE9A 4K77A 4G3FA 4AT3A 3VS7A 3OD6X 4JQEA 4IM0A 2V22A 4PDSA 4AW2A 4DG3E 4APPA 1H1WA 4KWPA 4FK6A 3ZS5A 2WGJA 2PVHA 1Q3DA 4M14A 5FXQA 3FZTA 5CF8A 2WD1A 3UO5A 3Q9ZA 3MI9A 2DWBA 2CLXA 3CPBA 5CQUA 2DS1A 3NNWA 2WXVA 3R6XA 4FZFB 3ZSIA 4AT5A 1T45A 3MPTA 5HEZA 3HV3A 3HLLA 3QGYA 2R3LA 4UXLA 1X8BA 5FWKK 3VW6A 3DDQA 2OXDA 2OXXA 3LLAA 4M7IA 4JG8A 3DNDA 2ZB0A 2VN9A 4O21A 5C8MA 3R22A 4X0MA 5CT0A 5EOBA 3IKAA 4JRNA 4NM3A 3OROA 3QQJA 2XIZA 3C50A 4DGNA 4LUDA 2Z7RA 3HMPA 3EN6A 3FLWA 3GCUA 2C0IA 1YI6A 1WBVA 1ZMWA 1XJDA 3W10A 4EZ7A 3O96A 5KKRB 1JVPP 3ZZWA 2G2FA 1NXKA 3EQIA 4IX6A 2I0VA 3W32A 3A4PA 2BR1A 4KD1A 2QU5A 3MGYA 5C01A 2CGXA 3EWHA 1W0XC 3LAUA 4IX3A 4ACHA 2UW5A 1YI3A 4QP9A 4ALUA 1W98A 3DV3A 3U4UA 4C4GA 2P2IA 2ZDUA 3V5WA 3NYXA 2J5FA 4GK4A 3VAPA 2A0CX 2J5EA 4EEVA 3RK7A 3POOA 4D5KA 1M17A 4I0RA 4IZAA 3FY2A 3OUKA 2B1PA 4DLJA 4QP8A 4I94A 5FP5A 4JG6A 3IDBA 3QFVA 2X8EA 2XCKA 3R1SA 3PZEA 4KABA 5F94A 4DGMA 4ORKA 3IW8A 4AW5A 4GMYA 4ANNA 4R7HA 3ZBXA 5J7HA 2WZJA 3V5JA 3U8WA 2XNNA 3LW0A 4FTJA 3NCGA 3F5XA 5HG8A 1OPJA 2XEYA 4CVAA 4D1SA 3VUKA 3LKMA 2O8YA 3KF7A 5DH3A 5T6KA 2BMCA 5CX9A 3FEGA 3C51A 3ETAA 5FEDA 3BZ3A 4JDHA 5HIDA 3V3VA 4F9BA 3FI8A 3ORNA 5J9LA 2FGIA 3KA0A 2YDIA 3QUDA 4TWPA 2PPQA 5KO1A 4DTAA 3VUHA 5B2MA 2OG8A 5DWRA 2CNVA 2BPMA 4FKTA 4YU2A 2A19B 4L3PA 4MNFA 5CZIA 3SQQA 5HQ0A 4XEYA 2OIDA 3A8XA 2WO6A 4OTQA 3ZSGA 5E8WA 3W18A 5EYDA 1OUKA 4CRSA 4CV8A 3ALNA 4UBAA 5DE2A 3WILA 5AV4A 4O84A 5ANIA 2CCHA 2J9MA 4FYOA 3TG1A 4PMTA 4IXPA 1PXOA 2P2HA 3BEAA 1IRKA 5CVGA 5L6WL 4FEVA 5GIOE 5LVLA 2YIRA 1RE8A 3QTZA 3D5XA 3DKOA 2NRYA 3VUMA 5HNBA 4YNOA 5CY3A 1U54A 3EQHA 4H3PA 3QCQA 3FZSA 2VO6A 3MW1A 2JIUA 2WTKB 3FI2A 4EOQA 5L2WA 4DTKA 4LUEA 4C57A 3QQLA 1MQBA 2GTNA 2X1NA 5CTPA 5JQ8A 2CPKE 5IKWA 5KUPA 2YJSA 1SNUA 2FSLX 4FVPA 2XNOA 1FVRA 3U4WA 4ERKA 1LP4A 3S0OA 3UVPA 4FSWA 1E1VA 2EB3A 4WBBB 3V5TA 4BWPA 3PJ8A 4EHEA 4Y85A 3RTPA 2OZAA 5HORA 3CY3A 1XHAA 3LJ1A 4H1MA 5IZFA 2QR8A 3K2LA 3IW7A 4ACDA 4HZSA 2BTRA 4BIEA 2XIKA 3LHJA 1TVOA 5CVFA 3VBTA 5KKRC 3QU0A 4GG5A 4O1PA 2VTJA 1GZOA 5CU2A 2DQ7X 2ERKA 3DPKA 3D7TB 3EQGA 4P4CA 5HCXA 3C4EA 3DTCA 1YDTE 5EOLA 5AV2A 4N0SA 4KSPA 4LM5A 3W1FA 4AZTA 3COMA 5FG8A 5J9ZA 5M09A 3FSKA 3GCQA 4HCVA 3MTFA 4TL0A 4MAOA 4UWCA 3E8NA 5IEVA 3G90X 3I81A 4QP2A 4BR3A 3LFNA 5L8KA 3BQCA 3ROCA 2JKKA 4RFZA 3Q4UA 4FT9A 3TXOA 3NNXA 1P14A 4H3BA 4NKAA 4C4JA 2JD5A 2E9PA 3TV6A 3Q9YA 4LMUA 2XRUA 4DA5A 2Y4IB 4ZSEA 3ANQA 1Q8ZA 4I6FA 2VTLA 4FV5A 2J0JA 3C0HA 3UGCA 1U59A 3TNIA 2P3GX 3MJ2A 4MF0A 1Y8GA 2UVYA 4XCUA 3SC1A 4GIIA 3ZMMA 3QA0A 3VUIA 2HCKA 4FV0A 4E7WA 3BWFA 1PF8A 3NUSA 4X3FA 3DKCA 1GIIA 4RIXB 2YCFA 5CAQA 4KIOA 2GHLA 4GT3A 4O0VA 5AEPA 1HCKA 4L53A 4BKYA 4D2WA 4DH7A 1OPLA 3A7FA 2F7EE 4EC8A 3EKKA 3H9FA 2H8HA 3QKKA 3ORPA 3GXLA 4YLJA 4C7TA 2C6TA 1GZKA 2JIIA 4HVIA 2C5YA 4LL0A 5K4IA 3Q4CA 4LFIA 3W2OA 3ORZA 4OR5A 5F20A 3MSSA 1ZOGA 1Z5MA 3KEXA 4MTAA 4O6EA 1CKPA 4LOQA 3E92A 5HE2A 3B2TA 5JRQA 5DRBA 2E9OA 5HG9A 3RM7A 3AC8A 3EQFA 3HMNA 2FUMA 2GTMA 4LOPA 4JR3A 4AW1A 4EOIA 3UPZA 4RWIA 3BKBA 4MCVA 3ZO3A 1UNGA 2VTNA 5HI2A 3UOJA 2WIPA 2PVRA 3L8XA 1PXMA 2IG7A 3I7CA 2QONA 3DBQA 2V0DA 3QCYA 5HBJA 5EQPA 4XG2A 2WTKC 4XJ0A 5CVHA 4YJQA 5IQDA 3D9VA 3JR1A 4NWMA 3H4JA 4I6BA 1M7NA 2BHHA 4FF8A 5M08A 3KULB 3GOKA 1H28A 2R0IA 3GCVA 4QYEA 4KA3A 4MWHA 3RAHA 3L8VA 3OWPA 3RMFA 4KBCA 1PRYA 5DPVA 4RQVA 2X7FA 5JK3A 2XM9A 3ZXTA 1XR1A 5B0XA 3S00A 3VUDA 3C4XA 3FQEA 4JL9A 4TXCA 3ATSA 5E1SA 2YIWA 5BQ0A 3GQIA 3PVWA 2HZ0A 3HRBA 2XK3A 3EH9A 3LOKA 3PPKA 5H8EA 4HW7A 4O1OA 4F63A 2HZIA 4OT5A 2HYYA 3FV8A 5AP0A 5E8ZA 5AP6A 4A9RA 4B99A 3ANRA 2C6EA 4TKSA 3UOHA 5BX0A 3OXZA 5IEYA 4ZXTA 4JI9A 3V8WA 4N70A 4O91A 2UZTA 3BLHA 5I9VA 4BIDA 4L9IA 4P90A 2R64A 5K9IA 1LEZA 2ETRA 1XO2B 3KL8A 3R7UA 4PMPA 1YW2A 4RWKA 4O81A 5JFWA 2VX3A 3LJ0A 4OTDA 3W33A 3NYOA 4B8MA 5CSHA 5CU3A 5HO8A 5IEXA 1G8SA 4GIHA 3KFAA 4F7NA 1ATPE 3GC8A 4JX7A 1JNKA 4AZWA 5L8JA 4UMRA 5AUWA 4X7QA 3OBGA 4Q5EA 1UKHA 3DJ7A 4QYHA 1CM8A 5AAEA 5LOHA 2YZAA 3NRMA 3IECA 4QP6A 4QP4A 5HNGA 3H9OA 5IA4A 4D0WA 5KE0A 2HOGA 5CENA 3D2IA 5AP2A 3KY2A 5M4CA 3SG8A 2JKOA 3CY2A 4AA5A 2O63A 3GUBA 5DN3A 3W2CA 3CBLA 3M11A 4U3ZA 2QOBA 3A99A 2XJ2A 4MBIA 4FSQA 4Q2AA 4Q9SA 5H2UA 3SLSA 2Y4IC 5A54A 3CJGA 5ICPA 3FDNA 4NTSA 4YJPA 3SXRA 3QTRA 5KX8A 3C0IA 2F4JA 2VX0A 3T3VA 5BUJA 3O17A 4RVMA 4QMPA 3KC3A 3G6GA 4I5MA 4QMVA 4A4XA 3IO7A 4U44A 2G2HA 4XBRA 5ETFA 3PG3A 3KN6A 4FT5A 4M97A 5AADA 3UNKA 4CLJA 5K0KA 2GFSA 3MB7A 1JWHA 5AMNA 3QKMA 4IWOA 4CYIA 2PSQA 5DT3A 1B39A 2HK5A 2ITZA 3PRIA 4PL3A 3TJCA 3R0TA 5F95A 2ZV7A 2IVVA 5EYKA 4J95A 2YIXA 5DHJA 4FE2A 3R7EA 4EOOA 4JAIA 3FJQE 4AAAA 3OMVA 4DEBA 4F99A 3PPZA 4S31A 3R9DA 3DJ6A 3NMUF 4O22A 3R71A 4D2TA 4QQTA 1QPDA 5TOZA 4FKJA 5AP3A 4IDVA 2YDJA 3HV5A 3RPRA 1OL7A 3UE4A 4C33A 3FPMA 1U5QA 3Q6WA 2GHMA 3MV5A 4I0TA 2BCJA 4EK4A 4L46A 3N4UA 4F4PA 3CTJA 3DB6A 3AOXA 4NZWB 3SA0A 2RIOA 4O7ZA 3U54A 2PUPA 4IEBA 4EH3A 3OBJA 2QLQA 3F82A 3M1SA 3DS6A 1Z57A 3LMIA 4AG8A 4EHGA 4L01A 1Y91A 2VWUA 3MPMA 3ZO2A 3GENA 4A9YA 4BI0A 4EH2A 4CYJA 2OO8X 3ET7A 1JOWB 2WTCA 2ZM1A 3V6RA 3D5WA 4FVRA 4RJ4A 5AV0A 5CF4A 2UW0A 3E3BX 3FE3A 3UG2A 3AC5A 2W1GA 4O0TA 3BGQA 2OIQA 3VUGA 2JLDA 5G1XA 1Q8YA 2FA2A 3KXNA 2XZSA 4U97A 3WYXA 3BHHA 4EK6A 3WBLA 4AP7A 4QP1A 5CEQA 5C27A 3VS4A 4FTOA 3TV4A 3QRJA 1U54B 4MD8E 3II5A 4D1XA 2PWLA 4Y8DA 1A48A 5M56A 4GL9A 4WUNA 3NNUA 1Y6AA 4R77A 4YC8A 2C6LA 3NUYA 4MEDA 3V51A 3VJOA 2PUNA 3ORIA 3O8TA 4F1OA 5E4HA 3IW4A 4TYHA 4I5PA 4AXAA 4EWQA 5BPYA 4RJ8A 5HLWA 5ANGA 5EQEA 2WMBA 4ZSLA 4EBWA 4E20A 2HZ4A 3EKNA 4U9AA 2B52A 3DK3A 2CDZA 2OZAB 3C0GA 4RIWA 1PMEA 3O7LD 3TUDA 3LQ3A 3ZM9A 3ZLSA 3LXPA 1WBWA 4II5A 4NKSA 3VS0A 3FZPA 1JKKA 4IHPA 1WBSA 2GNGA 3UO4A 3IQ7A 5FLFA 3ORLA 3BHYA 2GNLA 4I4EA 4L3JA 5BNJA 3QWKA 4E6AA 1E9HA 3EN4A 1OZ1A 3EB0A 1XBBA 3KXHA 4OBOA 1BKXA 2C3KA 4YPSA 3EQPA 1YKRA 4ZK5A 4YO4A 2G9XA 5HD7A 1UU8A 2IZSA 3PXZA 1PXJA 2G2IA 3LCOA 4HYSA 4G6NA 5HHWA 4BCPA 4EK3A 2RSVA 5AAFA 4CCBA 5IA5A 5GZ8A 4RC4A 2KTYA 4JRVA 2YAAA 1PHKA 1G5SA 2VNYA 4M67A 3JVRA 2XH5A 2VO3A 4E4XA 3DK7A 2E2BA 3MH0A 3QA8A 1JKTA 2HIWA 3A4OX 1Y57A 4WG4A 5A3XA 3LQ5A 4RZVA 3PA3A 2A1AB 5JMSA 4FNYA 2XIYA 3PJ3A 4OTWA 3D7ZA 3QX2A 3Q5IA 5D11A 4JX3A 3WE8A 4KRDA 5HICA 3NAYA 4JBOA 4O82A 1ZY5A 4NJ3A 1YOMA 4WIHA 3ZOSA 2C6DA 4YPDA 4Z9LA 5C4LA 1WVWA 4MD7E 4FG7A 5J1VA 4GW8A 2JBOA 4AE6A 4Y83A 4O0XA 4KS8A 3R7YA 3IDCA 4CLIA 2VTSA 3Q53A 3IONA 3OEZA 5H8BA 2CNQA 4NW5A 4EL9A 4F7LA 5JZJA 4ZJJA 3F3VA 4ZOGA 2OLCA 1Q41A 4FL1A 1LEWA 4FV8A 4ID7A 3E62A 1OUYA 5IDPA 2XNMA 3KK9A 4BCQA 2Z7LA 1UNHA 1YHWA 2PE2A 3EZRA 4WSQA 2H96A 5HZNA 1YQJA 4YZ9A 3B2WA 3HGKA 3LFFA 4QTDA 4FSMA 4LQMA 5H8GA 4FNZA 4V05A 4ZTHA 2WNTA 4UB7A 2ESMA 4E6QA 2UZVA 5B7VA 4MD9E 5IQIA 3CIKA 3G2FA 1ZZ2A 3PE2A 3LXNA 5CU0A 4N57A 2PMNX 4WNKA 3TZ9A 2CKPA 4GRBA 4IZ7A 5AV1A 4CFXA 4PTEA 1ZYJA 4GFMA 1XH5A 4QNYA 1SVEA 2YCQA 4G2FA 4C34A 3DAJA 5H3QA 4I93A 2BAJA 4XV2A 3DFAA 3RALA 1MQ4A 2XK8A 2PY3A 2Z2WA 4OLIA 2HAKA 4I24A 2C3IB 2QR7A 3PP0A 3R28A 3MTLA 1BYGA 1WBNA 2ZV2A 4LRJA 5L2IA 4MXAA 1L8TA 2ITTA 2O2UA 2PVFA 2RFNA 2UW3A 2ZVAA 4XH6A 4XP3A 4EC9A 3GU7A 1FOTA 4Z7GA 5LVNA 3I4BA 2VNWA 3PY0A 1J7LA 3PFQA 3FXWA 4MQ2A 4DHFA 4F6SA 2V5QA 2FH9A 2H9VA 2VTQA 5HTCA 2ITVA 5CXHA 4FSTA 4YJVA 4CQEA 1STCE 1MRUA 2O64A 3QD3A 2Y7JA 3BCEA 3LM0A 1ZYLA 3FUPA 3FQSA 5EI2A 5J87A 4P5QA 3SW7A 5ACBC 3TV7A 2R2PA 1OI9A 1PMUA 2XKEA 3GC0A 4PV0A 5IUGA 1YWVA 5J8IA 3DBFA 3E8CA 3EQRA 1DI8A 2HY0A 3HV4A 3MJ1A 2F7ZE 3RI1A 5BVDA 4M68A 2X8IA 4BYJA 5A46A 5I0BA 1AD5A 3U6JA 1SMHA 3OTUA 3TJDA 3UYTA 5BMSA 2YWVA 4UZDA 5EM8A 4BCGA 2OJ9A 4K8AA 3OCTA 4NYEA 3A7JA 3ODYX 2OXYA 5JEBA 4ZIMA 3DKGA 3P23A 4DFNA 2H34A 1H00A 1SNXA 4YJRA 4IANA 3OUNB 1KE9A 2Y4PA 2F2CB 1GOLA 3L8PA 3R00A 2QODA 2ZMDA 3UPXA 4RVKA 4DGGA 3RPOA 3OOGA 1B38A 2BRHA 2W05A 4IW0A 3JPVA 2BKKA 4JBQA 4PL5A 4Y5HA 4KIPA 1RQQA 2WPAA 3QTQA 1URCA 4PY1A 1H1RA 4QMQA 4V01A 2ONLA 5L6PA 5M4UA 1ZZLA 4USEA 4TWCA 1YDRE 4KIKA 3VS3A 3O51A 1Q5KA 4AZSA 2XBAA 1OM1A 4CKIA 2IVTA 4EOMA 4GUBA 4WRGA 3RAIA 2GCDA 2PTKA 5GZAA 4JR7A 3RJCA 4BDBA 1UNLA 2XKFA 2BRGA 5FD2A 4FEWA 5FQDC 3BHUA 4XS2A 4YJSA 5AJQA 3F2NA 3HX4A 3T8OA 2BILB 1L3RE 3LFSA 5CI7A 4TYGA 5CZHA 2UZOA 2PVMA 1OGUA 2I0YA 3OFMA 2YN8A 4D0XA 3KXGA 4O2PA 4G34A 1YXVA 2V62A 4JBPA 4ITJA 4QRCA 4QMLA 5L4QA 3CCNA 4TY1A 2ITQA 3FY0A 2UZEA 4XP2A 1OPKA 2BFXA 5DEYA 4GSBA 3RPYA 1KSWA 3CD3A 3CQWA 1SYKA 3QALE 4C38A 3R8LA 4EHVA 1O9UA 2JAMA 3FI4A 4MF1A 2YDKA 5E9EA 3D5UA 4UEUA 5LXMA 4O7NA 3IDPA 2UZNA 3VBXA 3G0EA 3FC2A 1PKDA 4GUEA 2JEDA 2QKRA 3Q9WA 5FEQA 5CEKA 1OBGA 3IK3A 3R1NA 3HEGA 1K2PA 3Q04A 1U4DA 4FVQA 3GNIB 4NM7A 1FPUA 2W5BA 4CKJA 3MY1A 4YTCA 3CTQA 2JFLA 3UIXA 3ERKA 4YZCA 5J9YA 3BU3A 5KMKA 2B9HA 2XK4A 2C5XA 5D41A 4IBMA 3TKHA 3OS3A 3F3ZA 5ETCA 2EB2A 5IQAA 4UXQA 4BGHA 3FMKA 4L00A 3ZSHA 2OF2A 2O5KA 3VS6A 4K18A 4JDJA 2IZRA 4FTLA 3HA6A 5FTQA 4ZZMA 2X4ZA 4FKPA 4EBVA 2CCIA 4OTRA 2VTMA 4GU9A 4KINA 4DITA 1JBPE 4C4HA 4EKLA 1TQPA 4LV5A 4BKJA 2EXCX 5CYIA 5FRIA 5IA1A 5LVMA 5AUZA 4YR8A 3N4TA 3UG1A 1FBNA 4FKLA 4RJ3A 4BDDA 1OB3A 4G6OA 4E5BA 1ZWSA 3H0ZA 3HKOA 3O8UA 4BDEA 4O7RA 2REIA 3HRCA 5HU9A 1IAJA 4R5YA 5CAVA 3SRVA 3ITZA 4V04A 2EXEA 3BE2A 1QPJA 1VZOA 2J0MB 3NNVA 3UC4A 5J5SA 5KMIA 4O0WA 4BZDA 2R9SA 3AD6A 1H4LA 4A7CA 2B9IA 1UWHA 3BV3A 3KXXA 3R2BA 3PUPA 3QZIA 4MWIA 4DE4A 2VD5A 1PYEA 3FLSA 3UDBA 5A14A 3EQCA 3R1QA 4A9SA 3AC4A 1W84A 5AWMA 4BCKA 2R3NA 5KZ0A 3OY3A 4GEOA 3V5LA 3PJCA 1YXTA 3HUCA 1IASA 4GVJA 4PX6A 3LFQA 5BVOA 4UYAA 1H25A 4M69A 2WMAA 3E87A 3Q60A 3QZGA 3ZEPA 3TNWA 2XKCA 2CKOA 3LE6A 4FKWA 4TYHB 3ZLXA 1OL6A 5JKGA 4WUAA 5FGKA 3ZRLA 4EJ7A 3G9NA 5EM5A 1JPAA 1O6LA 4IWQA 2GS7A 4FG8A 3R8UA 2XNGA 1WVYA 4Y5QA 4NTTA 4BCNA 1BUHA 4RA5A 5JQ5A 1W82A 3P79A 4F70A 2ETKA 4RIWB 4I41A 2X9FA 2XNPA 3EJ1A 3EQDA 4BCFA 5B2LA 4UN0C 5IA2A 4CKRA 3K54A 2QOOA 4OTGA 4HYIA 3QAME 1FQ1B 5HGIA 5EKNA 3ORMA 4FI1A 4LYNA 3BYUA 3H10A 5KZIA 3RVGA 2J50A 4I0SA 5CLPA 3RM6A 4GU6A 3T9IA 2Z02A 3OXTA 3BBWA 1PW2A 4V0GA 1IEPA 2VWIA 3U9CA 1J7UA 3DZQA 3QRUA 1PXNA 5T68A 4CQGA 3MPAA 1GJOA 3UMXA 4BWKA 4F0GA 2C6KA 4CMOA 1PXPA 2JGZA 3NUXA 4IVAA 3HAMA 1FINA 4EOJA 2WMUA 3BELA 4ANSA 3TDVA 3NUNA 1XH6A 3PSCA 3ZO1A 5H9BA 3O8PA 4BI2A 1YVJA 3F7ZA 4KBAA 3IGGA 4E73A 1TQIA 5DNRA 3OCSA 5LMKA 2IPXA 2WMQA 4MBJA 1M2RA 4KS7A 4NU1A 2WMWA 3IOKA 4G5JA 2IW9A 3TNPC 3TZMA 5AM6A 3PVGA 3RZBA 1H0VA 1H08A 3P5KA 5JH6A 3D5VA 2HXLA 2YCSA 5BYLA 4BCMA 2XP2A 5CNNA 4YJTA 3R04A 2E9VA 2HELA 3A2CA 2UZUE 4IAFA 3D4QA 5EHLA 2XK7A 3MIYA 3MWUA 2CHLA 1JKLA 3EL8A 2B9FA 1OIYA 4F0IA 2J7TA 3OVVA 3FI3A 3O0GA 4PWNA 3GC9A 3DDPA 3KRWA 4FX3A 4YLLA 3ZTXA 3S3IA 4FEUA 4QTCA 4BI1A 3QXOA 3F3WA 3NZ0A 4HNFA 4U0IA 2B9JA 2C5NA 4QYYA 5J5TA 3Q2JA 3I5NA 2ITUA 4WBOA 3E64A 2WMRA 2BHEA 1FGKA 3E8DA 5HO6A 3DNEA 4C36A 4J97A 3IW5A 3KQ7A 4JDKA 4IIRA 4EQUA 1DI9A 2QOIA 2R3PA 4FZDB 4J98A 3MVJA 5BYYA 1WAKA 4XUFA 1GY3A 4E5WA 4DBXA 3SKCA 4YBKA 2JFMA 3F66A 3GCPA 3MFUA 3LVPA 4MXXA 4FZ7A 3G33A 3POZA 3RPVA 2CGVA 2OBJA 3OW4A 4J8MA 2J6MA 2QOFA 2ZOQA 5K3YA 3ZFXA 5FXSA 4AN3A 5JN2A 5KHXA 2VTHA 1R3CA 3VS5A 3KB7A 4FR4A 4ZZOA 3CPCA 4CZYB 2CLQA 2I0HA 2DUVA 1KV1A 1ZRZA 3ORXA 2RGPA 4EOKA 4GFOA 2W9FB 1CKIA 2IW6A 3ALOA 5K4JA 2WQOA 5EW8A 3VULA 3R9HA 3F5UA 3LJ2A 5I9YA 2W1EA 4EONA 3QYWA 4IAAA 4OAUC 3OF0A 2BUJA 4ZJVA 4X2FA 5I9WA 1R39A 2Y6OA 4CTCA 4Z3VA 5FUTA 4IX5A 2HW6A 2PUIA 1YXXA 2ITNA 4TNDA 5BYZA 4UY9A 4S33A 2F57A 2C3LA 3CQUA 2RF9A 4XOZA 3P0MA 5FDPA 4BBEA 4C4IA 4FUYA 4HOKA 4IC7A 4AZEA 5CXZA 2F2UA 2ZDTA 4AU8A 2PHKA 3L9LA 4GK3A 2R3MA 4D9UA 2BROA 3DAEA 3G51A 4DINA 1GZ8A 4XNEA 4ALWA 4D2RA 1UU3A 2YLEA 3LXKA 4F64A 4DFBA 2C0OA 5AA8A 2LGCA 5CEMA 4ANOA 3OTVA 3ORTA 3VC4A 1NW1A 1M7QA 1ZAOA 2C30A 2CGWA 3G5DA 5EKOA 4NUSA 4ZEGA 3ACJA 4RGJA 4KIKB 2W17A 3A7HA 5LWNA 1NVRA 3KVWA 4QPAA 3CKWA 4ZLOA 1JAMA 3S2PA 3LCTA 2QCSA 3ID6C 4FG9A 4GT4A 4S32A 4TT7A 3UBDA 4FV3A 3NUUA 4IAKA 4BTJA 1QPCA 4X21A 3C9WA 3DFCB 4DEGA 4B8LA 5CALA 3UVRA 2YCRA 5ANDA 3NIEA 5M06A 4YC3A 3DJ5A 5D7AA 1FVVA 3N9XA 4UWBA 4YZNA 3CJFA 5CEOA 2ITXA 2Q0BA 3L9MA 4FSUA 5M55A 2FSTX 3FHIA 4XMOA 2CGUA 4UMPA 3QTIA 4S34A 2VU3A 3BHVA 4DFYA 3WF9A 5I9ZA 2OIBA 1ZMUA 2C6MA 2XNEA 3RHKA 3ZRKA 4PPAA 4L8MA 4C02A 2JDOA 1VJYA 3AT2A 3LZBA 4BICA 4QMZA 1W83A 2GDOA 3AT3A 4HVDA 5FDXA 2G01A 4MH7A 5AUTA 4H58A 4AGWA 5AIKA 4QO9A 4AE9A 3KREA 5CANA 3WZDA 3DBDA 4BCIA 3QRTA 3UIBA 3FMNA 4RA4A 3KU2A 4G3GA 4PP9A 3C13A 1MRVA 3BQRA 3F61A 4EH8A 4BYIA 3NW6A 1H8FA 3EN7A 2XVDA 2JDRA 2GNIA 2XF0A 3JY0A 3QZFA 4U7ZA 3O23A 2Y6MA 2NPQA 4JJRA 3PZHA 3ENHA 4G3CA 4OTFA 4QD6A 4F0FA 4FIHA 3L8SA 3P7BA 2IO6A 3QL8A 3FLZA 3C1XA 3UIUA 1Q99A 1Q4LA 2R3JA 3HDMA 4H3QA 3UNZA 3T3UA 3D83A 3LXLA 3DY7A 3BU6A 4I23A 5EW3A 2HXQA 4YGAA 4EJNA 2QI8A 3Q96A 4O7LA 3QHRA 2BRMA 1FGIA 3NYNA 3TUCA 4HNIA 2IVUA 2UZWE 3GEQA 3SRVB 2YITA 3SAYA 3E63A 1HCLA 4FV2A 3ZUTA 3C4FA 2Q83A 1WBPA 4MKCA 3UYSA 4KB8A 5CU4A 2JDTA 3RCJA 4F08A 2J2IB 3ELJA 4O38A 2R7BA 3RZFA 1IA8A 5AR3A 3N4VA 2GNHA 1OIRA 4IVCA 3R8MA 5HVKA 3PY3A 4R1YA 2BKZA 3RHXA 5EDQA 4A4LA 3F3TA 1UV5A 5JSMA 4L3LA 4IQ6A 3NVMB 1KV2A 3FZOA 5C8KA 4QT1A 5DVRA 5JRSA 3WE4A 4E6DA 1YHSA 3M2WA 4HPUE 3EFWA 3N51A 4M69B 5D9HA 4BGQA 2WTIA 3WF5A 5C26A 5E91A 5BVEA 3E7VA 3OT8A 2BZIB 2OSCA 4FTMA 2OJIA 4PDOA 5EDRA 2ONLC 2R3RA 2I6LA 5F9EA 4DH8A 3GVUA 4ASXA 2BAKA 3AC1A 4GVAA 3FLNC 4BHZA 3MFTA 4MK0A 1PYXA 3UZPA 5IH6A 2RFDA 4W8EA 4NM0A 1Z9XA 4FTUA 3NSZA 4FC0A 4ZS0A 5IDNA 4LV8A 4ENXA 2W06A 4KSQA 4L45A 3R7VA 3SW4A 5KMJA 5EM6A 4YMJA 1CSNA 2AYPA 4OT6A 4TPTA 4O0RA 4DCEA 4BF2A 4UZHA 2C0TA 4ZZNA 4NEUA 5C8NA 4FEXA 5FBNC 4QQCA 2WEIA 3MS9A 3UMWA 4EQCA 3I7BA 3QLFA 4S2ZA 2PMOX 2Z7SA 4QMNA 3D94A 3G6HA 4I92A 3I5ZA 3CC6A 5EK7A 3RK9A 4EOLA 4BCHA 2PUUA 4L7FA 3GFEA 5IA3A 4G9CA 1FMKA 4DG0E 4CG9A 4CT2A 2XNBA 3PLSA 3VO3A 4YJUA 5E1EA 3R83A 4YHTA 3FWQA 3D0EA 1IG1A 4PQNA 4EOPA 2QNJA 5A4QA 5D1JA 2RKUA 2ACXA 5KMLA 2GNFA 3AD5A 3HYHA 4RC3A 3TIYA 2W4JA 4RFYA 2VGPA 1TQMA 3QQFA 4C0TA 3NCZA 4KRCA 2QC6A 3Q3BA 4DTBA 3KMMA 2ZM3A 5AP4A 2WHBA 4FSRA 4RBLA 3VN9A 4CMTA 4CFVA 3D14A 3M42A 3U6HA 4O7SA 3ZCLA 4O7VA 4CFWA 1KE7A 2J0KA 5HLNA 4M15A 4FT3A 3WARA 3MA3A 3CS9A 3G0FA 4NH1A 5LJJA 1H1SA 3NX8A 4GJ2A 3W2QA 3ORKA 2VTRA 4M0YA 4ZY6A 3RP9A 4D5HA 3FZ1A 2XS0A 3P7AA 2F9GA 2WQEA 4P7EA 3QKLA 3BYSA 3GU6A 4WNMA 1XQZA 1ZMVA 4XV1A 5EFQA 4F9YA 2XK9A 5CU6A 2BIYA 4QOXA 4GYIA 4KKEA 3FMLA 4FT0A 4K9YA 3OHTA 4EH9A 4YLKA 2VWZA 5HE3A 4MNEA 4CSVA 5FTOA 3ZBFA 1FMOE 2PU8A 3LMHA 3QQUA 3MB6A 3OWJA 4BDCA 5AUUA 3QTXA 3UJGA 2YEXA 2B4SB 3UC3A 5C03A 3RAKA 1H1PA 3BX5A 3MVLA 1WZYA 3E7OA 5LARA 4C3FA 4E3CA 3NW5A 5GJDA 1YHVA 4BDAA 4KBKA 2OKRA 4U41A 3ZRMA 3CGOA 3DK6A 2PMIA 1QPEA 3EMGA 4WKQA 3TTIA 5L8LA 2J4ZA 4GV1A 3K5VA 3FPQA 2ZB1A 3VBYA 3ODZX 4RVLA 3LFCA 4DC2A 3FYKX 4XP0A 3F3UA 2JKQA 1PXIA 4IB5A 5E92A 5TKDA 4E26A 5CEPA 2C69A 4E4LA 4ZY4A 4BN1A 1H24A 4NW6A 2XCHA 4G6LA 5EHOA 1I09A 3FQHA 2YM7A 1Q62A 3SHEA 3TNQB 3U51A 1H01A 4FSYA 3PIXA 4RIOA 4JQ7A 3U55A 1ERKA 4F09A 3GU5A 3KRJA 2PZ5A 4FNWA 3RWQA 5EQYA 3LCDA 3E8EA 3LCSA 3FMJA 4W8DA 3TDWA 2DYLA 5LMAA 2LAVA 1YXUA 2R3KA 1P5EA 1PXLA 3IGOA 3QYZA 5F1ZA 4QMXA 4C2VA 2R0UA 3VBWA 3P08A 5DRDA 2C68A 3DLSA 3TWJA 4LI5A 1EH4A 3PP1A 4AGDA 4X6RA 3FL4A 4AWIA 2WIHA 4LGHA 3R7IA 3KGAA 3H9RA 2C1BA 2CKEA 4FTNA 2GU8A 2W9ZB 1VEBA 5GINE 5EI6A 3RGFA 4AN2A 1OVEA 2BALA 4YZDA 3AT4A 3OT3A 4BBFA 4LGGA 5HVYA 4E5AX 1GZNA 5LVOA 2GPHA 3DLZA 3OEFX 4JIAA 4QMUA 4RWJA 5LQFA 4G1WA 1NA7A 4FZAB 4X3FB 5LMKC 5IQBA 3EFJA 2AC3A 5EHYA 1Y6BA 4XLIA 4FV6A 4IJPA 2W5AA 3DA6A 3QTSA 3GGFA 3ZXZA 2BZJA 2NP8A 5JZNA 3PG1A 3EIDA 1CDKA 5BVKA 5IU2A 3UQFA 1J91A 4LGDA 5LCJA 2FYSA 4O7WA 2C6OA 3KVXA 4A06A 2PE0A 5CSXA 4ENYA 4D2SA 3I6WA 4R7BA 4G3EA 4E4MA 2ZM4A 1JLUE 3LMGA 1S9IA 1VYZA 1ZYSA 3FKNA 1OKZA 2ZYBA 2XIXA 3O2MA 4QMYA 4WOVA 5ANJA 4IVBA 3CD8A 4U43A 5IQGA 3A8WA 4ZSGA 4EH6A 3TCPA 4GYGA 4AZVA 2QOKA 3FMDA 3OXIA 4HVHA 4FKVA 4XV9A 2YLFA 1JSUA 4ZMFA 3OW3A 4Z55A 4DLIA 1BX6A 2XYUA 1CMKE 4MHAA 4RIYA 4AA4A 5J7BA 3F2RA 2X81A 3S1HA 5BMMA 5AP7A 4XG9A 5HKMA 1GIJA 2YIQA 3AC2A 5BVFA 1K9AA 2CN5A 1RW8A 2WAJA 2YAKA 4ANMA 5ITAA 2B54A 3PLAE 2WTVA 5E8YA 2PVJA 5CSPA 4J99A 3RBWA 5IMEA 1GNGA 3MA6A 5J79A 3CXWA 1XKKA 3QGWA 4HVSA 3QRKA 2ITYA 3F88A 4UALA 2HENA 1FVTA 4MX9A 4RG0A 4BDGA 4FTCA 2B55A 1BI7A 4FKOA 4WT6A 2FB8A 2OH0E 4IACA 5E8VA 1KWPA 4I5CA 5AX3A 5BVWA 4EORA 4XX9A 4AS0A 4ZLZA 3EFKA 2GMXA 2WOUA 5CAOA 3MBLA 2V7OA 3P78A 4O0SA 3VW8A 2W4OA 2BDJA 4UMUA 3VQUA 2QOCA 2W1DA 4M8TA 2J0IA 2PZIA 4HVGA 1OITA 4ACMA 4XG7A 3V6SA 3W55A 3WIKA 2XJ1A 4FNXA 4Q5HA 5KMOA 3QZHA 4EH4A 1ZY4A 4OBQA 4OTHA 1J3HA 2OU7A 2P0CA 3A61A 2X2MA 3F5PA 3NR9A 4ASZA 4J7BA 4W4XA 5HCYA 1O6KA 4FV7A 2X7OA 4AOIA 1DAYA 3OWLA 4C59A 3SXSA 3VJNA 4FICA 1BI8A 4HGSA 4CMUA 4H05A 1R78A 4MXZA 2VGOA 2CN8A 4R3RA 4Y46A 4DEAA 4DT9A 4CCUA 2VTOA 2QQ7A 5DG5A 4YZMA 3CEKA 3ZU7A 3QD2B 3R9OA 3PVUA 2NO3A 5HU3A 1IA9A 5KCVA 4WRSA 3JUHA 4Z16A 4IAZA 2QVSE 2W96B 2VUWA 2PZRA 3EOCA 4RRVA 3ZO4A 4X3FC 3MYGA 2PULA 5DGZA 3RNYA 4TRLA 1LR4A 3ZYAA 4B6LA 4AQCA 4OTPA 4IM2A 3NS9A 3OCGA 2IW8A 4C4EA 3QD4A 4R5SA 4ITIA 3JY9A 2I0EA 4JT3A 2QG5A 3GT8A 3UQGA 2FO0A 1PXKA 2XBJA 4G31A 3A62A 3L9NA 2XB7A 3HAVA 3PPJA 3FZRA 2A2AA 5HG7A 4HGLA 5HIBA 4C35A 4FIEA 3CLYA 4O6LA 4RT7A 4KKHA 4A9TA 2YM6A 5ACKA 3ZDIA 4EH7A 3I0QA 4TYEA 2EUFB 2BZHB 2QU6A 3KRLA 4F1MA 4EOSA 4IZ5A 2UVXA 5AIRA 5JGAA 3FAAA 1Q61A 2E9UA 4K1BA 1B6CB 3Q2MA 3NDMA 3VNTA 4DEHA 4F9WA 4C4FA 1WCCA 5AUXA 5FM3A 4FGRA 3DT1A 4AGUA 2IZTA 3FMHA 4XLVA 5J95A 1IR3A 2W1CA 3F2AA 4AGCA 4AT4A 1XH7A 3DQXA 5JGDA 2JAVA 5HOAA 5DR9A 3U9NA 2JIVA 3NEWA 4BFMA 1VR2A 1KOBA 4PMMA 5HBEA 3TACA 4YTHA 5E8SA 4NL0A 4D4SA 1GAGA 4FSNA 5AV3A 3MH3A 5KHWA 4FIFA 4BBMA 4YP8A 1DM2A 2WB8A 4C61A 4NM5A 4EQMA 3DAKA 3WIGA 2VWVA 2VTPA 2XA4A 3OOMA 4MXYA 5HE0A 3AC3A 4FMQA 4PMSA 3KKVA 2OZOA 3VRYA 4O86A 5HIEA 4O0YA 2WEVA 4BDHA 4YHJA 4WO5A 4CZTA 1Q24A 3P7CA 3LQ8A 4ZSJA 3IS5A 3R7GA 4EH5A 3R02A 2C6IA 3K5UA 5HVJA 1V0PA 3D2KA 1OKWA 3VRZA 3SV0A 3VUTA 4XRJA 4Q9ZA 1PKGA 3QQGA 5M4FA 4DT8A 2WMTA 1E1XA 3PE1A 4X6QC 4ZP5A 4ZTMA 3PXQA 1OL1A 3CKXA 3HVCA 4GK2A 2EVAA 3TM0A 2BRBA 2CNUA 2PYWA 2YZLA 4UMQA 2YIYA 5DT4A 4M0ZA 3RAWA 1SM2A 2X6DA 5I4NA 2CMWA 4FA2A 3UNJA 1XWSA 3DBEA 3P4KA 2UW7A 2J0LA 4MNEB 2ZMCA 3QF9A 1F5QA 3UTOA 4APCA 4DN5A 3R9RA 3CSVA 3HMIA 5IISA 3MY5A 4ZLYA 4G9RA 3W2SA 1Q8WA 3NLBA 3MVHA 2A4LA 1H27A 5EH0A 2IWIA 4X3JA 3V8SA 4HYUA 4WG3A 3VBQA 3WI6A 5IH5A 4GG7A 5EYCA 5GIPE 5IUIA 4OTIA 3FMMA 2VWWA 3CR0A 4J96A 2EU9A 4WHZA 5TT7A 2X2KA 3HUBA 4FUXA 5JT2A 1PY5A 4TWNA 4BZOA 3AMBA 3DB8A 4OUCA 3WF6A 4AACA 2PVLA 4WG5A 3E5AA 4N6YA 4O0UA 4QNAA 4U80A 3ZH8A 5C9CA 2PVKA 1GIHA 2PVYA 1P4OA 5EG3A 4C58A 4CD0A 2YHVA 5A6OA 4IFGA 4BDJA 4ZJIA 4YC6A 1O6YA 4USDA 1YDSE 3F69A 4XBUA 3I6UA 3GU4A 1SZMA 2F7XE 3TZ7A 4PUZA 3R9NA 4L52A 4CFMA 1OECA 3QC4A 4L67A 2WTDA 3PWYA 1UU9A 4FKQA 4JAJA 3HZTA 4LG4A 3MN3A 5A4CA 5L2TA 3F5GA 2W0JA 2RG5A 3RK5A 4FKUA 3ZONA 2VV9A 3ZLYA 1DAWA 4YSMA 3KXZA 4JBVA 4JOAA 4FEQA 4AUAA 4DFZE 4FTKA 2XMYA 5DMZA 4JVGA 5AR4A 5CS6A 3P86A 3HP2A 3FKLA 3BE9A 4ITHA 2UUEA 4QYFA 3TIZA 4NCTA 5JFXA 2Q0NA 3NPCA 3FKOA
chains in the Genus database with same CATH superfamily
5HX6A 5AX9A 4WSYA 4PTGA 4OGRA 3R30A 5D12A 3LFBA 2W1ZA 2GQRA 4IM3A 4H1JA 4IZYA 1J1CA 4FKSA 1M2QA 2H6DA 2R3HA 3LIJA 4I6HA 3VF9A 3EN9A 5IQCA 2WMSA 4FTRA 3LPBA 3ZUUA 3FC1X 4U81A 3DXQA 1BLXA 1KOAA 1YWRA 4CFNA 2XYNA 4M13A 5IG1A 4EUTA 5ANEA 3GI3A 4IVDA 3KCKA 4ASDA 1WFCA 4ONAA 1F0QA 5DT0A 5M53A 3QLGA 2UZLA 5HNIX 2WMVA 3VS2A 4HPTE 4RJ5A 2WOTA 4NIFA 2W7XA 4LRMA 4D58A 2XAOA 3ATTA 3HMMA 1ZXEA 3NW7A 2P33A 3RPSA 4AOTA 4CEGA 2A27A 3B8RA 4BDFA 4W9WA 1U5RA 4K2RA 2JBPA 5HE1A 2I7QA 2BIKB 4C2WA 5FEEA 2WELA 4JDIA 4UV0A 3DCVA 5AR5A 3WZKA 2SRCA 5KMNA 3B8QA 3KCFA 5EM7A 2GQGA 2GFCA 1UWJA 4BDKA 3W16A 2OFVA 1S9JA 3OZ6A 4I1ZA 1G8AA 2IVSA 3AD4A 3DXPA 4I22A 3QQHA 5DEWA 1R0EA 2V7AA 1OIQA 5IF1A 4DYMA 4RIYB 5FBOA 5AAGA 3VS1A 5M57A 1UKIA 2VZ6A 3R21A 3KMUA 2BDWA 5IUHA 4L68A 5B2KA 3RINA 4BTMA 2UW4A 1G3NA 1KE5A 4IADA 4KAOA 1WMKA 3BGPA 3FLYA 5A4EA 1AQ1A 4AXFA 4L6QA 4A4OA 5AUYA 5CQWA 3FBVA 4F7JA 4QPSA 3QX4A 5HTBA 1JSTA 3CE3A 3Q6UA 4PL4A 3NVKI 5GZ9A 2UVZA 4FK3A 5HBHA 2P55A 1ZYCA 4DGOA 5IH4A 2VTAA 2B7AA 2UZDA 3HECA 2BVAA 2E9NA 3HDNA 3NUPA 2BAQA 4AA0A 3DKFA 4O83A 2XK6A 4I4FA 4JIKA 4CRLA 3TMOA 3ACKA 2QG7A 4QTEA 2C5OA 3W0PA 5LWMA 2OWBA 3FSFA 5AR8A 4L42A 2W99B 5AP5A 1TZDA 5L2QA 2WQNA 4FOCA 3KRRA 4D4RA 4S30A 4U79A 5E8UA 4GH2A 2QOQA 4BTFA 5A9UA 3I0OA 2QHNA 1WBOA 3SX9A 5KBRA 3SVVA 3SOCA 1ZLTA 4OW8A 2QOLA 4PTCA 2VO0A 4ZTSA 4DEDA 2OJJA 2VWBA 5AR2A 3DTWA 4ZTQA 5CASA 4W4WA 1I44A 1YWNA 3GCSA 4FTIA 4XYFA 2BZKB 1UVRA 4RPVA 3QHWA 2WFYA 3VHEA 4YZBA 3BEGA 2UZBA 4NFMA 4TW9A 4BZNA 5CSVA 4I21A 2UW6A 3KN5A 3QC9A 2VTTA 2PE1A 3AMYA 3F6XA 4X2NA 3TEIA 4IWPA 3ZEWA 1OBDA 4PDPA 3V5PA 4X2GA 4NFNA 4B9DA 4FIJA 5IQFA 2YM5A 3V8TA 3EHAA 5HX8A 1K3AA 4EZ5A 3PY1A 3DBCA 3QTWA 4NT4A 4TTHB 1AGWA 2B0QA 3BI6A 5D10A 5LMBA 3S4QA 2FSMX 2R4BA 1R0PA 3FLQA 1A06A 1V0BA 3AGMA 3EQBA 3HL7A 3NWWA 2O3PA 3GOPA 4XG6A 3FYJX 1YOLA 2CJMA 4FKGA 4G5PA 4U6RA 3T9TA 3UZRA 3CGFA 3IW6A 3ROYA 4PPCA 2O65A 4BCOA 4FIIA 4RLKA 4U8ZA 4BKZA 1BL7A 4IC8A 5FP6A 5FTGA 1OL5A 2XALA 5CT7A 4F6WA 2WKMA 3OG7A 3KF4A 4F9AA 4YO6A 3P1AA 1T46A 2HY81 3PXYA 1JKSA 3MESA 1V1KA 2X6EA 3O71A 5HCZA 3NUAA 3H3CA 3PRFA 3FXXA 4RQKA 3I79A 5CAPA 4AX8A 2RFEA 2C4GA 3THBA 4AOJA 2R3QA 4DBNA 4N4SA 4AN9A 4J71A 3Q4ZA 4L7SA 4RX9A 3L9PA 5AP1A 3OCBA 1WBTA 4HGTA 4E1ZA 5E90A 4OAVB 3E88A 2YM8A 1M52A 4IFCA 3AXWA 3WYYA 4ZY5A 4ZMEA 2YERA 2ERZE 4O4DA 4ANQA 3BLRA 5DLSA 2PMLX 2Z60A 5ANKA 3QCXA 4TWOA 4EUUA 3QRIA 3ZLWA 4AXEA 2X4FA 2X8DA 5TF9A 3H30A 1LPUA 4D2PA 5HD4A 2GS2A 2R3OA 2UW8A 1OKVA 4CNHA 4YUQA 2OICA 4AQKA 3R01A 4ALVA 3WZEA 4UX9A 1IAHA 2OGVA 3C7QA 3R2YA 3VIDA 3E3PA 4FV1A 1YRPA 2X7GA 2Y0AA 4GJ3A 2KULA 3JYAA 1SVGA 4XHKB 5BVNA 5CAUA 5L6OA 4R6VA 2NNWB 4DGLC 3EYHA 1ZYDA 4FTTA 4HJOA 5JFVA 1JSVA 4IB3A 4O2ZA 5DFPA 2OI4X 1OIUA 4MYGA 3MH2A 3EN5A 4FJVA 2C5VA 5I3OA 3BPRA 4DEEA 2XJ0A 3PYYA 2IZUA 2CSNA 4O27B 2R3IA 4RMZA 4UMTA 4QQ5A 5CWZA 3PSDA 1H26A 4AZFA 4JS8A 1P4FA 3GBZA 4M3QA 5DI1A 3W2PA 3H0YA 2WQBA 3K3IA 4W4YA 3LFAA 4I6QA 1OMWA 4E6CA 4EK5A 1U46A 3GQLA 5F4NA 1Q8TA 2W4KA 2YM4A 3MH1A 3R1YA 4AF3A 4DAWA 3ZUVA 4EWHA 4EYMA 4PP7A 4B0GA 4J1RA 4BHNA 2HWOA 4QP3A 3UODA 4L43A 2ZJWA 2GS6A 3BRBA 3ZFYA 4DH1A 5DBXA 3UZTA 5LVPA 2XIRA 2PZPA 2ITOA 3C5UA 5DIAA 4U42A 4QP7A 2YWPA 3GP0A 3UO6A 5CI6A 2ZV9A 4J8NA 4M84A 3AG9A 2CKQA 3R73A 2GNJA 3QCSA 3BBTB 4CV9A 3PXRA 1CTPE 3QD0A 4CG8A 2XRWA 4TNBA 5ETIA 5BUEA 4R8QA 4ERWA 4V0GB 4D1ZA 3V5QA 3C4ZA 1W8CA 3QWJA 1Q97A 3COHA 4XRLA 5E7RA 5E8XA 3ZHPC 3ZZEA 4K6ZA 3I60A 3IG7A 3UQCA 2BTSA 2IJMA 4CXAA 1RJBA 1MP8A 2C3JA 5GHVA 5AM7A 2BFYA 1J1BA 4J52A 3S95A 4DH5A 1PJKA 2VO7A 4U40A 4YJNA 4DFLA 4K11A 3O5AA 4ACCA 2O0UA 2XUUA 5DR2A 5HLPA 4RSSA 5DR6A 3EFLA 2X0GA 3Q9XA 4YJOA 4XOYA 4IMYA 4JXFA 4LOOA 3SD0A 3WF7A 2JITA 4F1TA 4C37A 4MQ1A 1P2AA 3W8LA 4D2VA 2WQMA 3VHKA 4ARKA 5HESA 4PRJA 4FKRA 4QMWA 3NGAA 4Y95A 5M4IA 3PIYA 3D15A 4HZRA 4QPMA 2QURA 1ND4A 4IJ9A 4YTIA 5I9XA 4BRXA 3A7IA 4U45A 1ZARA 5K5NA 4PF4A 3HV6A 3UP7A 4ZSAA 4CT1A 1WVXA 4KIQA 4PNKA 5CF6A 5FXRA 4ZS4A 2W1HA 1VYWA 5M44A 2I40A 1XBAA 2W1FA 4P2KA 3LCKA 4RX5A 3BYOA 1KE6A 4WD5A 3MDYA 3DXNA 4FSZA 5AUVA 4I3ZA 3R8PA 1JQHA 2HWPA 2P4IA 4TYIA 4O96A 1UU7A 2HW7A 2YA9A 4ZTRA 1Q8UA 5I3RA 3U6IA 4RJ7A 1BL6A 2PVNA 3BHTA 3DQWA 3FHRA 4DF3A 5EYMA 2WMXA 3ULZA 4NIFB 4EKKA 5CEIA 4Z7HA 5DOSA 3ZFMA 1UA2A 4NSTA 2OFUA 4FV4A 1A9UA 4FTAA 3VQHA 4W4VA 4BWXA 3F9NA 2W5HA 2RG6A 5EI8A 2R7IA 4EHZA 2QHMA 5TR6A 2JDSA 3Q4TA 4ZTLA 3TKIA 2ZV8A 3PXFA 2GHGA 3HA8A 3MY0A 4MXCA 4GCJA 4E8AA 4ANBA 4TYJA 4X2KA 2F49A 3RWPA 4P5ZA 4QQJA 3TN8A 1ZOEA 3OP5A 3PJ1A 3EL7A 5HO7A 3QUPA 5GJFA 2JDVA 4Y73A 3PUFC 4GKHA 2RFSA 4QMSA 2VAGA 2X39A 3NYVA 3L1SA 5EW9A 3VONA 4R78A 3UOLA 2OH4A 2B53A 3Q5ZA 5D7VA 2C47A 5DA3A 4X2JA 2OJGA 4HCTA 3ZC6A 1ZOHA 5A4TA 3GC7A 4D28A 4GS6A 3MFSA 3HV7A 4OBPA 3R8VA 3ZDUA 4BIBA 4DCAA 4AW0A 4IWDA 4O4BB 3ZM4A 5IMXA 2XEZA 4DH3A 4FIGA 3HMOA 4RZWA 2ITPA 5I9UA 3BWJA 3DGKA 3QQKA 4U3YA 5M51A 4YNEA 2PZYA 1H0WA 4XG8A 4XG3A 4F7SA 5JGBA 2JKMA 2YISA 2AUHA 3KMWA 3AGLA 3LFEA 2EXMA 3AQVA 2X9EA 3C4WA 2X2LA 4D55A 4USFA 5IA0A 3ML1A 1TKIA 3C4CA 2C1AA 4FKIA 1Y8YA 2UW9A 3TUBA 5L2SA 3PWDA 4NK9A 3R63A 4KKGA 4KUJA 5IQEA 3PXKA 3JS2A 4WNOA 2VRXA 2GSFA 4A9UA 4IAIA 5BUIA 3C5IA 1SVHA 5L3AA 2I1MA 3OY1A 4WA9A 5KNJA 2J90A 2FVDA 3DU8A 4IX4A 4M12A 3NAXA 4BDIA 5LCKA 4B4LA 3WOWA 1W7HA 4JLCA 4R1VA 4PDYA 3Q32A 1M2PA 1XBCA 3MIAA 4FL2A 1NT2A 3PDTA 4ANLA 4A07A 5G6VA 4RVTA 2YFXA 1RDQE 3G15A 3W8QA 1DS5A 5HG5A 1REKA 3TZ8A 3P9JA 4HCUA 4ZTNA 4NCTC 5TE0A 3G9LX 3V01A 5AA9A 4O7YA 2OJFE 4BY9E 1H1QA 3BYMA 3QBNA 5GJGA 4E4NA 2PK9A 3NIZA 4IB0A 1YI4A 3DZOA 4M66A 4QMMA 3JXWA 4FODA 3PJ2A 4RX7A 4YSJA 2WTJA 2BRNA 2Z8CA 3RKBA 4LMNA 2BDFA 2ITWA 4DFXE 4FYNA 4FV9A 3CTHA 4BB4A 5M07A 4MVFA 5K0XA 4UYNA 3BIZA 4L44A 3WZUA 1YOJA 3TL8A 3IOPA 3QUEA 1NY3A 2EWAA 2V55A 4BTKA 4JNWA 3RNIA 3BYVA 4I6LA 4UWYA 2QKWB 1LUFA 1REJA 3TNHA 4FGBA 4W9XA 5IQHA 4G16A 4XG4A 3PTGA 3TKUA 4B7TA 2IEWA 1KE8A 3HRFA 4TZRA 1QMZA 4MXOA 5GNKA 4F9CA 3CQEA 3A7GA 3LLTA 4BGGA 3W0SA 3FXZA 4FT7A 3VF8A 3TTJA 1OL2A 1APME 4FBXA 1KUTA 4H36A 2YACA 3TI1A 3D7TA 3PA4A 4ZAUA 3BU5A 3PA5A 2R3FA 1OKYA 2Z7QA 4PNIA 1J7IA 2PL0A 4F6UA 2QO9A 3IPHA 3QTUA 2UV2A 2RL5A 4EK8A 4I20A 3ENMA 4RC2A 4HGEA 4KNBA 3GB2A 5HTIA 2OF4A 4FRFA 5FM2A 4RWLA 3RCDA 4QDVA 4EZ3A 3SGCA 3COIA 4J53A 3GFWA 4WNPA 3UVQA 4LL5A 5A4LA 3JVSA 3Q52A 2QO7A 4BCJA 2HZNA 5CF5A 2QLUA 1PMNA 2G1TA 4D9TA 3EZVA 1HOWA 5C4KA 2WU6A 3K3JA 3VWAA 4FTQA 4BJJA 5C1QB 1R1WA 3A60A 3VBVA 2GQSA 4GFGA 5CNOA 1QCFA 3KXMA 4AFJA 4ACGA 4BC6A 3DOGA 5IPJA 4FZ6A 1CKJA 2WU7A 4QYGA 4HYHA 4IH8A 4C8BA 3R8ZA 5E8TA 3PVBA 2AC5A 1Q3WA 1XH9A 5I5ZA 4RIXA 4FOBA 3MVMA 3BGZA 2VX1A 4MBLA 4BL1A 3U87A 4YURA 4BVUA 3REPA 5EDPA 2NRUA 2OK1A 2WTWA 3PIZA 4IAYA 5TO8A 3ULIA 1XH4A 5DYJA 4C3RA 2YABA 5T3QA 2IN6A 4DEIA 4YHFA 3QXPA 4FL3A 4QTAA 3COKA 4EYJA 5K5XA 4I5HA 4F65A 4IB1A 2VWXA 3LM5A 3MFRA 5KBQA 1URWA 3KRXA 3GU8A 4R3CA 3P5JC 3O7LB 4QMOA 1MRYA 2G15A 2YM3A 4YBJA 4GKIA 3BV2A 4CTBA 5ETAA 4RX8A 4R3PA 3SOAA 2Y8OA 3FMEA 4H39A 1BMKA 4QMTA 4O7TA 3CP9A 5AFVA 4LRKA 1PMVA 4K0YA 1QL6A 1NVSA 4DG2E 5JFSA 2ETMA 2VTIA 5KMMA 3OWKA 2OW3A 3W2RA 3SG9A 4DFUA 2QO2A 2R3GA 1MUOA 4R7IA 4CGAA 2VWYA 4JQ8A 3HP5A 3EYGA 4CZUA 1NVQA 2J51A 3AMAA 3KULA 3PSBA 1F3MC 2XM8A 4U5JA 4QDEA 4RJ6A 2ZAZA 4EI4A 2QD9A 4YTFA 3HNGA 4RFMA 2JC6A 3KK8A 1M14A 4NJDA 4ASEA 4RLLA 3WZJA 3F7WA 3FL5A 4CFUA 4E93A 4C3PA 4D4VA 1YXSA 3ZC5A 4CFFA 5CSWA 4K33A 5A6NA 2W1IA 3E93A 3I1AA 3UIMA 4QTBA 2R5TA 4D4YA 4JG7A 5ANOA 3UP2A 3BLQA 3V04A 3VVHA 4AFEA 4Y72A 4IDTA 4XV3A 3TT0A 4C62A 4DDIA 1H07A 3OC1A 3R7OA 5J1WA 1V0OA 4G3DA 4N6ZA 2Y9QA 4TN6A 2FSOX 5AR7A 3WF8A 2YJRA 3O50A 4G17A 4PPBA 1XH8A 3SDJA 3UOKA 2XKDA 3SXFA 2QOHA 3LFDA 4GT5A 4IE9A 4K77A 4G3FA 4AT3A 3VS7A 3OD6X 4JQEA 4IM0A 2V22A 4PDSA 4AW2A 4DG3E 4APPA 1H1WA 4KWPA 4FK6A 3ZS5A 2WGJA 2PVHA 1Q3DA 4M14A 5FXQA 3FZTA 5CF8A 2WD1A 3UO5A 3Q9ZA 3MI9A 2DWBA 2CLXA 3CPBA 5CQUA 2DS1A 3NNWA 2WXVA 3R6XA 4FZFB 3ZSIA 4AT5A 1T45A 3MPTA 5HEZA 3HV3A 3HLLA 3QGYA 2R3LA 4UXLA 1X8BA 5FWKK 3VW6A 3DDQA 2OXDA 2OXXA 3LLAA 4M7IA 4JG8A 3DNDA 2ZB0A 2VN9A 4O21A 5C8MA 3R22A 4X0MA 5CT0A 5EOBA 3IKAA 4JRNA 4NM3A 3OROA 3QQJA 2XIZA 3C50A 4DGNA 4LUDA 2Z7RA 3HMPA 3EN6A 3FLWA 3GCUA 2C0IA 1YI6A 1WBVA 1ZMWA 1XJDA 3W10A 4EZ7A 3O96A 5KKRB 1JVPP 3ZZWA 2G2FA 1NXKA 3EQIA 4IX6A 2I0VA 3W32A 3A4PA 2BR1A 4KD1A 2QU5A 3MGYA 5C01A 2CGXA 3EWHA 1W0XC 3LAUA 4IX3A 4ACHA 2UW5A 1YI3A 4QP9A 4ALUA 1W98A 3DV3A 3U4UA 4C4GA 2P2IA 2ZDUA 3V5WA 3NYXA 2J5FA 4GK4A 3VAPA 2A0CX 2J5EA 4EEVA 3RK7A 3POOA 4D5KA 1M17A 4I0RA 4IZAA 3PFYA 3FY2A 3OUKA 2B1PA 4DLJA 4QP8A 4I94A 5FP5A 4JG6A 3IDBA 3QFVA 2X8EA 2XCKA 3R1SA 3PZEA 4KABA 5F94A 4DGMA 4ORKA 3IW8A 4AW5A 2XARA 4GMYA 4ANNA 4R7HA 3ZBXA 5J7HA 2WZJA 3V5JA 3U8WA 2XNNA 3LW0A 4FTJA 3NCGA 3F5XA 5HG8A 1OPJA 2XEYA 4CVAA 4D1SA 3VUKA 3LKMA 2O8YA 3KF7A 5DH3A 5T6KA 2BMCA 5CX9A 3FEGA 3C51A 3ETAA 5FEDA 3BZ3A 4JDHA 5HIDA 3V3VA 4F9BA 3FI8A 3ORNA 5J9LA 2FGIA 3KA0A 2YDIA 3QUDA 4TWPA 2PPQA 5KO1A 4DTAA 3VUHA 5B2MA 2OG8A 5DWRA 2CNVA 2BPMA 4FKTA 4YU2A 2A19B 4L3PA 4MNFA 5CZIA 3SQQA 5HQ0A 4XEYA 2OIDA 3A8XA 2WO6A 4OTQA 3ZSGA 5E8WA 3W18A 5EYDA 1OUKA 4CRSA 4CV8A 3ALNA 4UBAA 5DE2A 3WILA 5AV4A 4O84A 5ANIA 2CCHA 2J9MA 4FYOA 3TG1A 4PMTA 4IXPA 1PXOA 2P2HA 3BEAA 2ZFYA 1IRKA 5CVGA 5L6WL 4FEVA 5GIOE 5LVLA 2YIRA 1RE8A 3QTZA 3D5XA 3DKOA 2NRYA 3VUMA 5HNBA 4YNOA 5CY3A 1U54A 3EQHA 4H3PA 3QCQA 3FZSA 2VO6A 3MW1A 2JIUA 2WTKB 3FI2A 4EOQA 5L2WA 4DTKA 4LUEA 4C57A 3QQLA 1MQBA 2GTNA 2X1NA 5CTPA 5JQ8A 2CPKE 5IKWA 5KUPA 3BL9A 2YJSA 1SNUA 2FSLX 4FVPA 2XNOA 1FVRA 3U4WA 4ERKA 1LP4A 3S0OA 3UVPA 4FSWA 1E1VA 2EB3A 4WBBB 3V5TA 4BWPA 3PJ8A 4EHEA 4Y85A 3RTPA 2OZAA 5HORA 3CY3A 1XHAA 3LJ1A 4H1MA 5IZFA 2QR8A 3K2LA 3IW7A 4ACDA 4HZSA 2BTRA 4BIEA 3NFGB 2XIKA 3LHJA 1TVOA 5CVFA 3VBTA 5KKRC 3QU0A 4GG5A 4O1PA 2VTJA 1GZOA 5CU2A 2DQ7X 2ERKA 3DPKA 3D7TB 3EQGA 4P4CA 5HCXA 2XANA 3C4EA 3DTCA 1YDTE 5EOLA 5AV2A 4N0SA 4KSPA 4LM5A 3W1FA 4AZTA 3COMA 5FG8A 5J9ZA 5M09A 3FSKA 3GCQA 4HCVA 3MTFA 4TL0A 4MAOA 4UWCA 3E8NA 5IEVA 3G90X 3I81A 4QP2A 4BR3A 3LFNA 5L8KA 3BQCA 3ROCA 2JKKA 4RFZA 3Q4UA 4FT9A 3TXOA 3NNXA 1P14A 4H3BA 4NKAA 4C4JA 2JD5A 2E9PA 3TV6A 4BJJB 3Q9YA 4LMUA 2XRUA 4DA5A 2Y4IB 4ZSEA 3ANQA 1Q8ZA 4I6FA 2VTLA 4FV5A 2J0JA 3C0HA 3UGCA 1U59A 3TNIA 2P3GX 3MJ2A 4MF0A 1Y8GA 2UVYA 4XCUA 3SC1A 4GIIA 3ZMMA 3QA0A 3VUIA 2HCKA 4FV0A 4E7WA 3BWFA 1PF8A 3NUSA 4X3FA 3DKCA 1GIIA 4RIXB 2YCFA 5CAQA 4KIOA 2GHLA 4GT3A 4O0VA 5AEPA 1HCKA 4L53A 4BKYA 4D2WA 4DH7A 1OPLA 3A7FA 2F7EE 4EC8A 3EKKA 3H9FA 2H8HA 3QKKA 3ORPA 3GXLA 4YLJA 4C7TA 2C6TA 1GZKA 2JIIA 4HVIA 2C5YA 4LL0A 5K4IA 3Q4CA 4LFIA 3W2OA 3ORZA 4OR5A 5F20A 3MSSA 1ZOGA 1Z5MA 3KEXA 4MTAA 1W2CA 1CKPA 4LOQA 4O6EA 3E92A 5HE2A 3B2TA 5JRQA 5DRBA 2E9OA 5HG9A 3RM7A 3AC8A 3EQFA 3HMNA 2FUMA 2GTMA 4LOPA 4JR3A 4AW1A 4EOIA 3UPZA 4RWIA 3BKBA 4MCVA 3ZO3A 1UNGA 2VTNA 5HI2A 3UOJA 2WIPA 2PVRA 3L8XA 1PXMA 2IG7A 3I7CA 2QONA 3DBQA 2V0DA 3QCYA 5HBJA 5EQPA 4XG2A 2WTKC 4XJ0A 5CVHA 4YJQA 5IQDA 3D9VA 3JR1A 4NWMA 3H4JA 4I6BA 1M7NA 2BHHA 4FF8A 5M08A 3KULB 3GOKA 1H28A 2R0IA 3GCVA 4QYEA 4KA3A 4MWHA 3RAHA 3L8VA 3OWPA 3RMFA 4KBCA 1PRYA 5DPVA 4RQVA 2X7FA 5JK3A 2XM9A 3ZXTA 1XR1A 5B0XA 3S00A 3VUDA 3C4XA 3FQEA 4JL9A 4TXCA 3ATSA 5E1SA 2YIWA 5BQ0A 3GQIA 3PVWA 2HZ0A 3HRBA 2XK3A 3EH9A 3LOKA 3PPKA 5H8EA 4HW7A 4O1OA 4F63A 2HZIA 4OT5A 2HYYA 3FV8A 5AP0A 5E8ZA 5AP6A 4A9RA 4B99A 3ANRA 2C6EA 4TKSA 3UOHA 5BX0A 5BV3A 3OXZA 5IEYA 4ZXTA 4JI9A 3V8WA 4N70A 4O91A 2UZTA 3BLHA 5I9VA 4BIDA 4L9IA 4P90A 2R64A 5K9IA 1LEZA 2ETRA 1XO2B 3KL8A 3R7UA 4PMPA 1YW2A 4RWKA 4O81A 5JFWA 2VX3A 3LJ0A 4OTDA 3W33A 3NYOA 4B8MA 5CSHA 5CU3A 5HO8A 5IEXA 1G8SA 4GIHA 3KFAA 4O4FA 4F7NA 1ATPE 3GC8A 4JX7A 1JNKA 4AZWA 5L8JA 4UMRA 5AUWA 4X7QA 3OBGA 4Q5EA 1UKHA 3DJ7A 4QYHA 1CM8A 5AAEA 5LOHA 2YZAA 3NRMA 3IECA 4QP6A 4QP4A 5HNGA 3H9OA 5IA4A 4D0WA 5KE0A 2HOGA 5CENA 3D2IA 5AP2A 3KY2A 5M4CA 3SG8A 2JKOA 3CY2A 4AA5A 2O63A 3GUBA 5DN3A 3W2CA 3CBLA 3M11A 4U3ZA 2QOBA 3A99A 2XJ2A 4MBIA 4FSQA 4Q2AA 4Q9SA 5H2UA 3SLSA 2Y4IC 5A54A 3CJGA 5ICPA 3FDNA 4NTSA 4YJPA 3SXRA 3QTRA 5KX8A 3C0IA 2F4JA 2VX0A 3T3VA 5BUJA 3O17A 4RVMA 4QMPA 3KC3A 3NFFB 3G6GA 4I5MA 4QMVA 4A4XA 3IO7A 4U44A 2G2HA 4XBRA 5ETFA 3PG3A 3KN6A 4FT5A 4M97A 5AADA 3UNKA 4CLJA 5K0KA 3UDTA 2GFSA 3MB7A 1JWHA 5AMNA 3QKMA 4IWOA 4CYIA 2PSQA 5DT3A 1B39A 2HK5A 2ITZA 3PRIA 4PL3A 3TJCA 3R0TA 5F95A 2ZV7A 2IVVA 5EYKA 4J95A 2YIXA 5DHJA 4FE2A 3R7EA 4EOOA 4JAIA 3FJQE 4AAAA 3OMVA 4DEBA 4F99A 3PPZA 4S31A 3R9DA 3DJ6A 4AXCA 3NMUF 4O22A 3R71A 4D2TA 4QQTA 1QPDA 5TOZA 4FKJA 5AP3A 4IDVA 2YDJA 3HV5A 3RPRA 1OL7A 3UE4A 4C33A 3FPMA 1U5QA 3Q6WA 2GHMA 3MV5A 4I0TA 2BCJA 4EK4A 4L46A 3N4UA 4F4PA 3CTJA 3DB6A 3AOXA 4NZWB 3SA0A 2RIOA 4O7ZA 3U54A 2PUPA 4IEBA 4EH3A 3OBJA 2QLQA 3F82A 3M1SA 1ST4A 3DS6A 1Z57A 3LMIA 4AG8A 4EHGA 4L01A 1Y91A 2VWUA 3MPMA 3ZO2A 3GENA 4A9YA 4BI0A 4EH2A 4CYJA 2OO8X 3ET7A 1JOWB 2WTCA 2ZM1A 3V6RA 3D5WA 4AAYA 4FVRA 4RJ4A 5AV0A 5CF4A 2AEGA 2UW0A 3E3BX 3FE3A 3UG2A 3AC5A 2W1GA 4O0TA 3BGQA 2OIQA 3VUGA 2JLDA 5G1XA 1Q8YA 2FA2A 3KXNA 2XZSA 4U97A 3WYXA 3BHHA 4EK6A 3WBLA 4AP7A 4QP1A 5CEQA 5C27A 3VS4A 4FTOA 3TV4A 3QRJA 1U54B 4MD8E 3II5A 4D1XA 2PWLA 4Y8DA 1A48A 5M56A 4GL9A 1W2FA 4WUNA 3NNUA 1Y6AA 4R77A 4YC8A 2C6LA 3NUYA 4MEDA 3V51A 3VJOA 2PUNA 3ORIA 3O8TA 4F1OA 5E4HA 3IW4A 4TYHA 4I5PA 4AXAA 4EWQA 5BPYA 4RJ8A 5HLWA 5ANGA 5EQEA 2AQXA 2WMBA 4ZSLA 4EBWA 4E20A 2HZ4A 3EKNA 4U9AA 2B52A 3DK3A 2CDZA 2OZAB 3C0GA 4RIWA 1PMEA 3O7LD 3TUDA 1XMLA 3LQ3A 3ZLSA 3LXPA 3ZM9A 1WBWA 4II5A 4NKSA 3VS0A 3FZPA 1JKKA 4IHPA 1WBSA 2GNGA 3UO4A 3IQ7A 5FLFA 3ORLA 3BHYA 2GNLA 4I4EA 4L3JA 5BNJA 2X0PA 3QWKA 4E6AA 1E9HA 3EN4A 1OZ1A 3EB0A 1XBBA 3KXHA 4OBOA 1BKXA 2C3KA 4YPSA 3EQPA 1YKRA 4ZK5A 4YO4A 2G9XA 5HD7A 1UU8A 2IZSA 3PXZA 1PXJA 2G2IA 3LCOA 4HYSA 4G6NA 5HHWA 4BCPA 4EK3A 2RSVA 5AAFA 4CCBA 5IA5A 5GZ8A 4RC4A 2KTYA 4JRVA 2YAAA 1PHKA 1G5SA 2VNYA 4M67A 3JVRA</