4M0ZA

Crystal structure of itk in complex with compound 5 {4-(carbamoylamino)-1-(7-methoxynaphthalen-1-yl)-1h-pyrazole-3-carboxamide}
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
264
structure length
264
Chain Sequence
KWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Selectively targeting an inactive conformation of interleukin-2-inducible T-cell kinase by allosteric inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 264
sequence length 264
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m0zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m0zA01
2XB7A 5HBJA 3IW4A 5HO7A 1ZMVA 2OXXA 3COKA 2UW5A 4RPVA 2P55A 3IGGA 2QOFA 4QMSA 2WQEA 3KRLA 3BE2A 4BDAA 2ETKA 3BBTB 3QQJA 2RSVA 2YFXA 3W32A 4CT2A 5IEXA 3PXQA 4S33A 4W9WA 4LYNA 4ZLOA 2JKKA 2WQBA 4RIXB 4MWIA 1W82A 2QNJA 3OTVA 3OWPA 5B0XA 3TJDA 4W8DA 5KMNA 3E8CA 4UYAA 3UYSA 1O6LA 3CQWA 4UZHA 5BQ0A 2CSNA 4G5PA 1PXMA 4F9WA 3D94A 5GJDA 5C27A 5L2IA 2QONA 2YIWA 4J1RA 3QQGA 2A19B 1UWHA 2R4BA 3EFWA 3D15A 3PJ8A 1YWRA 4APPA 3FL5A 2O2UA 5L2TA 1SM2A 1GZNA 3HP2A 4YSMA 3ZHPC 1JSUA 2JD5A 3D7ZA 3KMMA 3NRMA 3NUAA 5AV1A 5J1VA 2V0DA 3BYVA 3GQLA 3LXPA 4I5MA 5HIDA 3ZTXA 4BDIA 1QPJA 5IA4A 3ETAA 5FXSA 1OL2A 4FTNA 3E64A 4L43A 4MD9E 4AFJA 4CXAA 2XA4A 5CI6A 5M06A 4ZTQA 2Q0NA 3GCUA 2Y6MA 3SC1A 2R3LA 3F5UA 4MEDA 4AN2A 2VNWA 1VEBA 5LCKA 2GCDA 3EN9A 3MH2A 4GL9A 3FY2A 2P2IA 3R7IA 5J5SA 4HCTA 3GU6A 5KKRC 2ZJWA 4E26A 4RZWA 3ZFXA 4DGGA 2QHMA 3B2WA 4QPAA 1Q97A 3HMOA 2YISA 5HG7A 4AZVA 4FEVA 1RQQA 2C47A 3FDNA 3KXZA 3LLTA 1BI7A 3ET7A 2YIQA 5CYIA 1OPJA 4LOOA 4C35A 1CKJA 2R3NA 4CLIA 2XK8A 4JX7A 5DIAA 5BYYA 3BEAA 3BELA 3MPMA 1Y91A 4XG6A 3PVBA 3S0OA 1FOTA 3DFCB 2UW8A 4FTLA 3S3IA 3DOGA 4DEGA 3R7OA 2W4KA 2ZDTA 4ZJJA 3I60A 3L8SA 4WBOA 4DEBA 5GIPE 4DG0E 3E87A 2KTYA 2PZIA 2E9OA 2BZKB 1H24A 3R1SA 2WPAA 5CS6A 3LAUA 1M2RA 1Q8ZA 4OT5A 2ACXA 1LR4A 3W8LA 5ANDA 3C0IA 2XKCA 1BMKA 3DKGA 5F95A 4ITIA 5HE0A 3TTIA 4E5WA 3VS4A 5M09A 4XV9A 3RP9A 4YNOA 5BX0A 2BMCA 4RX9A 4UMPA 2J4ZA 3BBWA 1WMKA 3KXMA 3Q4ZA 3TZ8A 5CU6A 5FEDA 4AE6A 3VS5A 3NUSA 2QOIA 3DU8A 4EYMA 4FT0A 1Q3WA 4DEIA 4PDYA 4LMNA 3VS1A 5IDPA 2PZYA 5AM6A 2F7XE 4YTIA 5AR8A 2J0JA 3CEKA 1OVEA 3DAKA 2XZSA 2QKWB 3D7TA 3ZXTA 5DPVA 3K3JA 3TWJA 4IAKA 2GTMA 2HOGA 1CTPE 1ZARA 5L4QA 4QRCA 3QCYA 2GNJA 3AXWA 2JDTA 4IM3A 3KMWA 3EZVA 2C68A 2OIQA 4FL3A 4UWBA 3WIGA 4JR3A 4MBJA 4R8QA 5JSMA 3H10A 5EI6A 3R22A 4IAZA 3AT2A 4CSVA 4E93A 5HHWA 4PP7A 4IX3A 5C4KA 2OW3A 4LL5A 2WTVA 4I20A 4F9YA 4X2JA 2VUWA 5E8ZA 4GW8A 3I5ZA 1OM1A 2XH5A 3BHUA 4B8MA 5LCJA 2C4GA 3QYZA 2Y4IC 4MXYA 3UE4A 3DBFA 4EQUA 2ZOQA 4J98A 2YWVA 1SNUA 1WVWA 3CPBA 3HA8A 4E4NA 4YURA 4G6NA 4AGCA 4O0WA 5IA3A 5IH5A 3QYWA 5D12A 3VBVA 5I0BA 5J5TA 5AADA 5AP0A 3HP5A 4OTFA 2CDZA 5LVNA 3I0OA 2IW6A 4QTCA 3VUDA 2OF4A 2I1MA 2XNMA 4G6LA 4ZZOA 1P2AA 3D0EA 4QQCA 5HVJA 3LMIA 2NNWB 4ZK5A 2XJ1A 5DEWA 3QHRA 3UZPA 4L01A 5T3QA 4DGMA 3AMYA 2QG5A 3DK7A 5A4QA 3PXKA 3U6IA 4CFXA 2XYUA 4L42A 4C4IA 3TKIA 4J71A 3H9RA 3UVRA 5CEMA 4GFGA 4BKYA 2ERZE 1Z5MA 2CKEA 4FVQA 2WXVA 2HENA 4U7ZA 4QMQA 4O84A 5J95A 5ANKA 1NXKA 3A7IA 3P08A 4XP2A 5L2QA 5GJGA 2X81A 4E6AA 5B2LA 4GCJA 3TACA 4O81A 4R3PA 4QP7A 2C3IB 1OKWA 2IVVA 3D5WA 5A3XA 3QCSA 4G34A 4FKVA 4RA5A 3TXOA 2XCKA 1UV5A 3KL8A 3E7OA 3Q3BA 5D9HA 3M42A 3TV7A 3EFLA 1KE9A 5JFWA 4RIXA 3M2WA 3ALOA 3A7JA 3WF5A 4RT7A 4WRSA 5LVMA 4M8TA 3PJCA 5I9XA 2A1AB 2HZ0A 1F5QA 2VX3A 4E73A 3HVCA 4W4XA 5LXMA 4IVDA 4KWPA 5A4TA 4R6VA 5CF8A 4U9AA 5M55A 4RQKA 4PMTA 4UXLA 3QRKA 4EWQA 1K2PA 3DBCA 2YIRA 5E1SA 4LGHA 4R3RA 1YHVA 2DYLA 4IWOA 4QMXA 3GENA 4WD5A 3UMXA 4BBEA 2GHGA 1TKIA 2QOLA 2UZUE 3QU0A 4FL1A 2OU7A 3WE4A 2IG7A 3HZTA 3AC4A 3MGYA 4AZSA 3IDBA 4UMUA 2ZMDA 3S2PA 1IEPA 5H3QA 2NP8A 4ZIMA 4QYFA 3F6XA 4OTQA 1YDRE 2J90A 4NFNA 4EBWA 3WF7A 3LQ8A 3GC8A 2XUUA 3OOMA 2UZDA 4FTOA 1OZ1A 3A61A 3QZHA 4FSRA 2QC6A 3JYAA 3PY3A 4GK4A 4IB1A 4CYIA 2GU8A 3O0GA 2ZV9A 4QPMA 4UMTA 4ANLA 4IAIA 1JSTA 1XBAA 2PUPA 3PPZA 3MB6A 4JR7A 5CXZA 3QKLA 1J1CA 5LMKC 1OMWA 4PNIA 3IK3A 5IG1A 2F57A 5CX9A 4M97A 3PG1A 5TOZA 2C5YA 3ZO2A 5JEBA 2W1IA 4X21A 1R78A 2W4OA 3V8WA 2IZUA 2XRUA 2V5QA 5HX6A 1JKTA 4HPTE 3FJQE 5HG5A 4FEQA 4L3LA 4OBPA 4DEEA 4XBRA 2B0QA 2ITZA 2C6TA 4IM0A 4PMPA 2PMOX 2QI8A 4O83A 3SXFA 5CT7A 5CF4A 3SVVA 4HVSA 2GTNA 4TYJA 1YWNA 4K18A 1P14A 2WQNA 2WAJA 2BAQA 4EC8A 5CALA 4LUDA 5L8JA 3VNTA 2R3FA 3MN3A 5IPJA 4UWCA 2SRCA 3VW8A 4F65A 3UIXA 3CTJA 4FV6A 4QMUA 4BWPA 3H3CA 5HBHA 4FNWA 5EHYA 3ZM4A 1L8TA 2BZHB 3UODA 3N9XA 4MYGA 5EYDA 5CQWA 3MIAA 2VTLA 4F7SA 2PMLX 5CTPA 3VUMA 3UO5A 3FHRA 2ZYBA 1P4OA 5HG9A 1GIJA 2YA9A 1P5EA 4BBFA 2XM8A 3DXQA 3SGCA 2XRWA 1KUTA 2BUJA 3QCQA 4BWXA 3THBA 4GK2A 4MVFA 1O6YA 4PX6A 2RGPA 4WKQA 1PY5A 4IC7A 2JLDA 4P7EA 4EZ5A 3RAKA 4FNZA 2BTSA 1B6CB 4R3CA 3VF9A 3OW4A 1KOAA 4GRBA 3E5AA 1H25A 3B8QA 3KCFA 3DY7A 3DNDA 4C7TA 5CEOA 3W33A 3NMUF 4BYIA 3HNGA 3NUYA 3F3WA 4BBMA 3VUTA 1UVRA 1M7QA 2C3LA 4EORA 1RDQE 4BTFA 5B7VA 1BKXA 4KABA 2QCSA 5HX8A 3BKBA 4U40A 4BCFA 4G3FA 3UOKA 4U5JA 3BGPA 1YOLA 3F5XA 4LGGA 5IA0A 4C02A 4L7SA 4P4CA 4II5A 1F3MC 4ONAA 4I21A 3K54A 2XK6A 2XJ0A 4FT7A 2DS1A 1J91A 5JGAA 5KBRA 4CT1A 3ORPA 4U42A 3UP7A 3N51A 2QO9A 1MP8A 4BCJA 2QOHA 5GZ8A 1OL7A 4QYEA 4J8MA 3QF9A 5HTBA 3HRFA 3OWKA 3OP5A 3DDPA 5KBQA 5F9EA 3NW7A 2Y4IB 5KE0A 2C69A 3ZSIA 5DFPA 3BEGA 3NIZA 2HK5A 3W2CA 4AA4A 3V5PA 4L46A 4F70A 3EYGA 3VBXA 3AGLA 2J0IA 1Q99A 4ACCA 3R0TA 4NL0A 2CN8A 4AZWA 3Q9ZA 4OTIA 4WUAA 2BROA 3QTZA 4GYGA 2YEXA 5IZFA 4C57A 2W1CA 4NKSA 1AD5A 3KMUA 3PRFA 4I5PA 4AFEA 3F88A 3Q04A 1JLUE 2VO3A 3KXHA 4LMUA 5IQEA 2YDKA 3DZOA 2XEYA 3QBNA 4ID7A 4FSWA 3DKOA 5HI2A 3RCDA 3RNIA 1PF8A 3RVGA 4D4SA 2F9GA 3SAYA 2FGIA 3FKOA 4R5SA 3DK3A 4YLJA 3UIMA 3I1AA 3UMWA 4XNEA 2C6MA 2G9XA 2PULA 4XX9A 4ZTHA 3ODZX 4OBQA 5AR2A 4O27B 5E4HA 1PJKA 1ZOGA 3PUPA 2XNPA 5K9IA 4ANQA 4EH6A 1FGIA 2UW3A 3HV7A 4NZWB 2VTQA 4I0TA 4L45A 5EHLA 1M14A 4F6SA 5EKOA 3FKLA 2IZTA 4NW5A 1CSNA 4W4WA 3A7FA 4YP8A 4JG7A 4RQVA 4LI5A 5HD4A 1WVXA 3U55A 2XF0A 1URWA 4FV5A 4HYUA 3WZJA 3L9LA 2W4JA 1U59A 4XS2A 3QTRA 1YI6A 1TQIA 4LGDA 4EBVA 1Q8WA 2G15A 3H9FA 5DR2A 4GT4A 4MHAA 1WFCA 2YCRA 4TRLA 4DYMA 2PVJA 4FI1A 2XBJA 3LFEA 3F2AA 4FKJA 5FDXA 5E1EA 3VC4A 4ENYA 3P5KA 4EC9A 3FL4A 3R7GA 2WMAA 4GEOA 3VS7A 2XEZA 2R7IA 1IAJA 1U5RA 2YM3A 1Q8TA 1RE8A 2XNEA 2PVLA 1IASA 2GHLA 4KBAA 1SNXA 2EU9A 3D9VA 3QXPA 4JBQA 3RHXA 4B8LA 2XIRA 3W2SA 5BVKA 5CEQA 1MQBA 1WAKA 3R01A 4FOCA 2B52A 2OWBA 5JQ5A 5CT0A 3P0MA 4EZ7A 1O6KA 3ACJA 5D7AA 4BIBA 5J9ZA 4FR4A 3HAVA 3FQSA 5DE2A 1H00A 4BCGA 3IW8A 3R63A 3DA6A 4TKSA 4ASDA 1OIUA 5AAFA 2WMVA 3R9RA 3TKUA 2YM8A 5EQYA 4EKLA 3QWJA 1ATPE 4ZP5A 2XCHA 3QA8A 3F3UA 1Y6AA 3R04A 5AUWA 4D2TA 4CFFA 3A8WA 3S00A 4YTCA 3DCVA 3A8XA 3PIZA 3BX5A 3QA0A 3ZU7A 5KX8A 2QHNA 4FEXA 3CCNA 2BRGA 4GVJA 2EXMA 3H30A 5CU2A 4BCPA 4LQMA 4M68A 4D2RA 5E91A 3NAYA 4DC2A 2EXCX 3GFWA 4BDGA 4E3CA 2WTWA 2XIZA 3QZFA 3DNEA 5FBNC 4WIHA 5C9CA 3V51A 5J9YA 2IVSA 4XHKB 3AC2A 4HGLA 2RKUA 3CPCA 4KSPA 2OF2A 1A9UA 2BFXA 2VWYA 5AP6A 4E8AA 3WOWA 4JL9A 2HZNA 3ZONA 3FLSA 2B53A 5I9YA 3TJCA 4C0TA 5HU3A 3KEXA 5AUTA 3KCKA 4H36A 5A6NA 2A27A 4I92A 4Y5HA 5HE3A 1DAYA 4FSZA 3JR1A 2VWBA 2O0UA 4BIDA 4S34A 3RGFA 2O63A 2EWAA 4XG9A 3PY1A 1OIYA 4MK0A 2OO8X 3R2YA 2X6DA 4AN3A 2VV9A 3R8LA 2YM5A 3C0HA 1NVQA 3DTCA 4E20A 5K0XA 2X8IA 3SQQA 3UVQA 3SA0A 4NT4A 2HCKA 1ZYCA 2O8YA 4NCTA 3AD5A 3FPQA 2J5EA 1HCLA 2BPMA 2GFSA 2O3PA 2X2KA 3PE1A 3R02A 4GT5A 3FZTA 3I79A 4GJ3A 4KRDA 4YZMA 3FYKX 4LUEA 3AT4A 5KZ0A 2FO0A 4B99A 2QOBA 2ZM3A 2UZTA 3ITZA 3R9NA 4V01A 1KSWA 4ZEGA 4EUUA 3ANQA 4CKJA 5BYLA 1FVVA 4Q5HA 5ITAA 5EYMA 1CM8A 1OECA 4I3ZA 3RAWA 5IH6A 4X2NA 3SLSA 4R77A 3BYOA 3E7VA 3LFAA 3QD3A 3LCDA 4TWCA 3TNHA 3DPKA 4TTHB 5EI2A 5AV0A 5AFVA 3NEWA 4BF2A 2ZV8A 3HEGA 2FSTX 4RLKA 5IQBA 4FYOA 4ASXA 3MY0A 4DG3E 3O7LD 3OUKA 4U8ZA 2QR8A 4M7IA 3DK6A 3EWHA 3F5GA 3II5A 4OTGA 3RPSA 4CTBA 2PVRA 4WA9A 5HVKA 1ZY4A 3LFFA 3CGOA 3PJ1A 4YMJA 2FUMA 3EQPA 4AT3A 4EH8A 5FTGA 4DA5A 2VWIA 1XWSA 3VS3A 4A9SA 5JMSA 4PY1A 4BVUA 1REJA 3V5QA 5JK3A 3RTPA 5M4UA 3LKMA 2QOQA 3AT3A 4DINA 3U6JA 4U3YA 4ZAUA 4IJPA 2R3JA 5BUEA 5AR5A 4AE9A 3KVWA 1SMHA 4QTBA 1XH5A 1UWJA 3OOGA 1IRKA 5EQPA 4YR8A 3K3IA 3PVGA 1GIHA 3RAIA 4N57A 4X6QC 4ZSGA 4ASEA 3ZBXA 3D5UA 2OJFE 3GP0A 2C3JA 2YLFA 4FOBA 2JKQA 2V7AA 2OXYA 4AX8A 4JDIA 1J1BA 4IZ5A 5J7BA 1VYZA 2ZM1A 3EQDA 3N4UA 3D83A 5CASA 2W05A 4EYJA 4DGLC 4IEBA 2JDSA 4G3EA 4MD7E 4IZAA 4E5BA 4DH3A 2H8HA 5CENA 4PL3A 4DF3A 2WTJA 3SX9A 3DS6A 5E9EA 3CR0A 2B9FA 4BN1A 3RK5A 4RIWB 2R3PA 1A48A 4N4SA 5L8KA 1DAWA 2IZRA 3QUPA 1RJBA 2B1PA 2VO7A 3KRXA 5J1WA 2YM4A 4GT3A 2YWPA 4M67A 3QRTA 3DZQA 1OL5A 3C1XA 5AX3A 3ERKA 4N70A 4HZRA 2QKRA 2WNTA 5FM2A 1ZOHA 4JRVA 3FZ1A 1UU3A 3F3TA 4FKTA 3V5LA 3FI2A 3MI9A 4IB5A 4F63A 4O0XA 4V0GB 3NYOA 5FWKK 3KY2A 2VN9A 4FSTA 3R73A 4ALUA 2AUHA 5L6OA 3GC0A 4XRLA 3A4OX 2OH4A 3FC1X 3W8QA 2ZV2A 4QPSA 4V04A 4FV2A 4F99A 4DCEA 4O7SA 2BCJA 3KFAA 4IJ9A 3ZUUA 1FPUA 3QTXA 2O64A 4HVIA 4AGUA 2X0GA 5EW3A 3NWWA 5CAOA 4BFMA 3WF8A 3UNZA 4G6OA 4F7LA 2RG5A 2JKMA 3L9NA 4I5CA 1PRYA 3FI8A 3NNVA 3EIDA 4BR3A 4EH4A 4KUJA 2BTRA 2XNNA 4O2PA 5EFQA 3HMIA 3LMGA 3VHKA 4QQTA 4C62A 3VBWA 4RC3A 2HWPA 2VU3A 2VX1A 5CVGA 2DQ7X 5CANA 5IQIA 2I0YA 1EH4A 4LV8A 4QP6A 4QOXA 4YZCA 4XLIA 3REPA 4ASZA 4CRLA 3BE9A 5CY3A 2BRHA 2PVFA 3P23A 5HO6A 2BILB 4F0GA 3T9TA 3G9LX 2W17A 3QQKA 4W8EA 3PVUA 1ZMWA 3H0ZA 3SOAA 4JDHA 3EL7A 3MIYA 4IFCA 1Q4LA 2X2LA 4TPTA 1YDSE 3ORXA 2JC6A 3I6UA 4USEA 3TNPC 4G9CA 3OEFX 4Z9LA 5GZ9A 4XCUA 1Q62A 4JJRA 4FIEA 4QNYA 4D2WA 1PXIA 1FMKA 1FGKA 3DLSA 3SV0A 3V5JA 3QQUA 3W1FA 5HZNA 5CWZA 4WSYA 1JOWB 2XKEA 3VRYA 2WMWA 1JWHA 3I81A 1UA2A 4AU8A 4XP3A 3DB6A 3R28A 4IC8A 2X4ZA 3C50A 1R3CA 4U79A 4YC8A 3TTJA 3ZLXA 5I9VA 3ORNA 1T45A 2Y0AA 3PFQA 2UVYA 2KULA 2PY3A 3EQFA 4L44A 4IMYA 4PUZA 3OS3A 5HNBA 5B2MA 2W96B 3AG9A 4EOOA 5M44A 3DFAA 4RWKA 3VJOA 4U97A 4JT3A 2ZVAA 4PMSA 3VAPA 1XH8A 1H0VA 4DBXA 3F82A 5EHOA 3ODYX 4AACA 3G2FA 3AQVA 4DH1A 4F4PA 3OVVA 2I0VA 3UC3A 1OUKA 5D41A 4DT8A 4J7BA 4HGSA 2P4IA 4QMLA 4JBOA 3DBDA 5IMEA 5IMXA 4IX4A 4ANBA 5ACKA 4JI9A 4D4RA 3QFVA 3HV5A 1OKYA 5DVRA 3LHJA 3ZS5A 3FMKA 3RJCA 3VN9A 5IH4A 2JAVA 3CC6A 1I44A 3BU6A 2W1EA 4FTAA 5FP5A 3LFDA 4FKUA 4O22A 3KC3A 3R8UA 3RALA 3RWPA 4EK6A 2C1BA 5ANIA 5HNIX 4A9TA 5EG3A 3F3VA 4XH6A 5KO1A 4EONA 5J9LA 3I7CA 2W06A 3EN5A 1CKPA 1G3NA 2XMYA 3C51A 3ZLYA 3LIJA 3QGYA 3POOA 4NFMA 2WO6A 3OMVA 3VBYA 3GB2A 3MB7A 1XR1A 3IPHA 5L6WL 3HV4A 4J97A 2JDOA 2FSLX 4FG7A 3ZDUA 3G6HA 5J87A 5E8SA 4EJ7A 1RW8A 3OXIA 1B39A 5CZHA 3FKNA 3K5UA 2VTRA 4FKGA 3POZA 4FV7A 2OFVA 5E90A 3GCPA 3BIZA 3CKWA 4G17A 3G0EA 3CS9A 4FK6A 2UZNA 5AP2A 4A4XA 3CGFA 3K5VA 3CP9A 3BQRA 3E3BX 1V0OA 2XJ2A 1ZYDA 2VTPA 4B4LA 3PXRA 3RNYA 1ZYLA 5CSHA 2XNOA 3IW5A 5FLFA 2V62A 5DRBA 1OBGA 2VGPA 3EQRA 3TDVA 3KRRA 2WTDA 5IQCA 4P90A 3O8UA 3E63A 4GU9A 4M69B 3SG9A 4CGAA 4U80A 4F0IA 1M2QA 1GOLA 4MWHA 1JKLA 2Z60A 1NW1A 4EKKA 4IAFA 2JDVA 2R0IA 3IS5A 4RWJA 4TN6A 3VUGA 3CD3A 2VTOA 3NUNA 3QHWA 3ULZA 4WOVA 4RIWA 5KHXA 2ZM4A 4Y46A 1ND4A 4IACA 4RJ3A 5K0KA 4BDDA 3A60A 1H1RA 3TDWA 3ZEPA 3BV2A 1YHSA 4KB8A 4A9YA 1JQHA 2OFUA 4X3FB 5IDNA 4I41A 2C30A 2X8DA 5ETIA 4BTMA 3P86A 4E4LA 3ALNA 1Z57A 5LVOA 2E9NA 4NM0A 4H3BA 3WZEA 3FMMA 4ZY4A 4V0GA 3UP2A 4CCUA 3ENHA 1YRPA 4AOIA 1JPAA 4JG6A 2W9FB 5AJQA 1WZYA 2C5OA 3BWJA 3ZSGA 4W9XA 5IA5A 4DCAA 3VS6A 1SYKA 3ZRKA 2B4SB 5IKWA 2P2HA 5LARA 1ZY5A 4FTKA 3IECA 2GNFA 2VTHA 3ORTA 4O1PA 2CNUA 5AUVA 4L68A 4FTMA 4Z3VA 1GY3A 4FTQA 4XG3A 4EOSA 3QKKA 2GDOA 1OKZA 1ZOEA 2GNHA 5LJJA 2I7QA 3NUPA 2ZB1A 3OF0A 3ZO3A 3PSCA 3FMEA 3GXLA 4FIFA 5CVFA 2J0LA 3R6XA 3GC7A 4OAUC 5FEQA 3ZZWA 3HDMA 1OUYA 3W2OA 1H1WA 2HXQA 4YGAA 3WF6A 5KHWA 3HYHA 3PPKA 2JIIA 4DFUA 4JRNA 4WHZA 3U54A 4ZTNA 3O50A 1XKKA 3ZCLA 2QLUA 4CEGA 3PJ2A 4DGOA 3ZO1A 4DE4A 1APME 3CXWA 4ZTRA 3SDJA 5KMIA 4K9YA 2BKKA 3ZM9A 4U6RA 4RWLA 4IB0A 3JXWA 2RF9A 2FSOX 1U46A 4QMPA 3TNQB 1NA7A 3QUDA 5EH0A 3QRUA 4JS8A 4J8NA 2C0IA 4RJ5A 5KCVA 3BV3A 3QTUA 3OC1A 4MBLA 5G6VA 3AOXA 5TO8A 4ZLYA 3C4FA 5K4JA 3NVMB 2X9FA 4CG9A 4UY9A 3RBWA 4CV8A 3TI1A 4RG0A 5DMZA 1UKHA 2UW7A 2GNGA 3LJ0A 2VTAA 4U41A 4XYFA 3HRCA 3C4CA 3KQ7A 3CE3A 3PP0A 2OGVA 2PE2A 2QODA 2BAKA 4FSMA 3IW6A 3WYYA 3SHEA 4ACDA 1ZMUA 3UOJA 5EQEA 2WMSA 2W99B 4RX8A 3BGQA 3BQCA 1YDTE 4BHZA 1SVHA 4O7RA 2A0CX 1IG1A 5E7RA 4QMNA 3UG2A 1KV1A 4YBKA 1J7IA 4ALWA 1VZOA 3PG3A 4XEYA 2HELA 2I40A 4DEHA 4RIYB 4I6QA 3U51A 4FUXA 4QTEA 3LXLA 4G2FA 1GZ8A 4ANMA 1B38A 1PMEA 2ZV7A 3Q9XA 2YABA 4GFMA 4CYJA 4RBLA 5A14A 4ORKA 3ZBFA 4FKPA 1HCKA 2OI4X 3JPVA 2X2MA 4JAIA 4ZS0A 4D5KA 4Y5QA 3O8TA 2HWOA 2C6OA 3PPJA 1PXPA 1VR2A 3W2PA 2I0EA 4C4HA 5M56A 5AWMA 5HKMA 3R8MA 5EM8A 4L9IA 5FQDC 4FTCA 5G1XA 2OJIA 2NRYA 3ELJA 3IGOA 3KVXA 4LOQA 4U0IA 2GHMA 5DLSA 1ZZ2A 2YITA 4TYHB 4EL9A 5CU0A 5DNRA 1OIQA 3WZUA 4D4YA 5M57A 1YI4A 4XV2A 3FLQA 1H1PA 3CJFA 4AG8A 4QP8A 2WMRA 4BDEA 4A4OA 2WGJA 1Z9XA 2J51A 2YJRA 1XH4A 3PRIA 5DT3A 4GKHA 1V1KA 3FI3A 3KRWA 4LM5A 1BL6A 1KE7A 4TYEA 4AW2A 4BHNA 4PNKA 2YM6A 2VWXA 3QALE 5M53A 3GEQA 3G9NA 3VBTA 1G8AA 4CFMA 2W1HA 4FTIA 3TUBA 2ITWA 3ZZEA 1H27A 3BYSA 4BL1A 4FSQA 3OROA 5E8TA 3R71A 4H3PA 4ZXTA 3GUBA 3V04A 4BCHA 5DGZA 5F94A 3BLHA 4RJ4A 3EYHA 4S2ZA 2BHHA 4ZOGA 3WYXA 5CSVA 3Q9WA 5LMBA 4AXAA 5FTQA 3S4QA 5KKRB 4IHPA 3NGAA 3DKCA 1BL7A 4M69A 2PWLA 2VTSA 2FH9A 3M11A 4L53A 1F0QA 1YOMA 3PLSA 1WBVA 2W9ZB 2RFNA 3HL7A 3MVHA 5DEYA 3VULA 3FC2A 2UUEA 2XK7A 4DFXE 5AA8A 1PXJA 3RINA 1J7UA 2YAKA 3OFMA 4QMMA 4DITA 1JKKA 4HPUE 3RPYA 2ERKA 5LWNA 5A4EA 2BIKB 2HYYA 2CN5A 2Z8CA 3RM6A 4D2SA 2A2AA 5C1QB 4FZ6A 2Y4PA 5CXHA 5CQUA 4X3FA 3UPZA 1TQPA 3IOKA 5E8YA 4Y73A 3MVJA 3VW6A 2OJGA 4AGDA 4AN9A 4FEWA 1QMZA 5JFVA 3KKVA 4L52A 2XK3A 1H0WA 1YXVA 4ANSA 1STCE 3A4PA 2YDJA 4FV0A 4QD6A 4D2VA 4EHEA 2R3QA 5CF6A 5AUXA 4GIIA 3PDTA 3G15A 4BGGA 4YHJA 2OG8A 2J6MA 5EDRA 3ZH8A 3IW7A 2XNGA 4QMTA 3LOKA 4IAYA 3RCJA 1BX6A 3FSFA 3PP1A 4L3PA 3NYXA 1LPUA 4G9RA 4CV9A 4ENXA 5L3AA 4FYNA 1UU8A 4ACMA 4ZSLA 5K5XA 3OZ6A 4O1OA 4OW8A 5AUUA 3AC8A 4QP3A 4ITHA 1KE8A 3AMAA 3ZSHA 4U43A 1GZOA 2OSCA 4EH9A 4QYYA 4IZ7A 3P4KA 5KNJA 4BKZA 4CZUA 5HO8A 4H39A 1OBDA 2BR1A 4IQ6A 3FWQA 4S32A 1R39A 3R8PA 3ROCA 3UGCA 4QP1A 4S31A 2PZRA 5IQFA 2I6LA 5BMSA 5ETCA 4GV1A 2WTIA 3AD4A 3LCKA 4HVHA 4EOLA 5CF5A 5TR6A 3LFCA 3EQGA 2J50A 3FMDA 3QL8A 4TT7A 3QZIA 4EQMA 1NVRA 5BPYA 5H9BA 4TY1A 3VF8A 3HRBA 2QR7A 4HVGA 2P33A 3IDPA 4YJRA 3RPOA 1U5QA 4EOKA 1HOWA 4RC4A 3UYTA 3VUHA 2XS0A 4EHZA 4BGHA 3R7VA 3QRIA 2IO6A 3JVSA 4FV4A 4OTDA 3Q4UA 2YERA 4DFZE 4NU1A 4A9UA 4O0RA 1PKDA 3FLYA 5IUIA 3TNWA 3FQEA 1ZYSA 5M4FA 4I4EA 2Z2WA 3BLRA 4EK5A 4FT9A 4N6ZA 5CAPA 3BI6A 3Q96A 5AP5A 5AX9A 5I3OA 4AZFA 4DLIA 4KIKB 4EQCA 4F7NA 2H96A 4K8AA 1XQZA 2UZLA 3DV3A 4K0YA 3QCXA 3KRJA 5IUGA 2OZOA 5L2WA 1UNGA 3QRJA 4WBBB 2WB8A 4EOQA 1QPCA 1W0XC 2UW4A 4JNWA 3F2NA 4I23A 3ORLA 3NUXA 3LFSA 5C26A 5C01A 5DH3A 1CDKA 4OUCA 4FT5A 5I9WA 2PMIA 4RIYA 1M2PA 3D14A 4FTJA 4BTKA 2BALA 4KRCA 3HAMA 5DT0A 4JXFA 4QP2A 4OTWA 4F1OA 5AV4A 1UKIA 4LRJA 4PPCA 2ONLC 3FMHA 4GSBA 1A06A 2FA2A 2VTTA 3EQHA 4PV0A 2FVDA 5AIKA 3V3VA 4U45A 1OPKA 3H4JA 5GINE 2ITQA 5AIRA 1TVOA 1WCCA 4S30A 4QYHA 4QMOA 3GNIB 3QTIA 5EI8A 4C4FA 3MFRA 1Q24A 3EKKA 3Q6WA 4TYHA 1GNGA 2CLXA 3L9PA 4CTCA 1S9JA 2X7FA 3EKNA 4JIAA 4RC2A 3LM5A 4UEUA 2W5HA 4H05A 3BGZA 2JBPA 3Q2MA 2CKOA 2C6EA 4ZMEA 3G90X 4HGTA 2ITTA 3MV5A 4BIEA 4CCBA 2NRUA 4DFBA 3IQ7A 4J52A 3O7LB 3RK9A 4OT6A 4AUAA 3V8SA 1WBSA 3TG1A 4ZTLA 3VHEA 3CSVA 4FE2A 4KKEA 2BFYA 3CY3A 5CI7A 2QOOA 5CEIA 4EHVA 1NVSA 3LCSA 4WO5A 3WZDA 3UC4A 3GCVA 2CGUA 2CGVA 2OKRA 3MFTA 1XBBA 4BTJA 2YM7A 2W7XA 3PJ3A 5HIBA 5CEPA 4NWMA 1XJDA 4FV8A 2OK1A 5C4LA 3F69A 3I7BA 2LGCA 4M15A 4TZRA 2X4FA 2VO6A 3F7ZA 5AEPA 4FV3A 4Q9SA 2YLEA 2WTKC 4DH5A 2WEIA 4GVAA 5JH6A 3UZRA 1QPDA 2B9HA 2F7EE 3HKOA 3QD0A 4MD8E 3KXGA 4O21A 2IPXA 4BWKA 4CQGA 2B9JA 4NW6A 1URCA 4JX3A 1H8FA 3HGKA 4KBCA 4AZTA 4FUYA 3ZO4A 2P3GX 3WILA 4E6CA 2X6EA 1IAHA 4PWNA 3S1HA 4PPAA 3ENMA 4MNEB 4FSNA 2UW6A 2BHEA 4CKRA 3HMNA 3ORZA 4RJ8A 4TXCA 3SXSA 2PUUA 3HA6A 4NK9A 5TKDA 4PTGA 3HV3A 3SKCA 1PXNA 3WF9A 4FICA 4O2ZA 3GFEA 2VTIA 2CMWA 3R2BA 4O6LA 2EB3A 3QTWA 3RPVA 3UQGA 3ZUVA 3P79A 2P0CA 4EH5A 2HZIA 3R7YA 3NW5A 1YXXA 3OY3A 1V0BA 5F4NA 4D55A 4RVLA 3DLZA 4FKRA 3ZLWA 3QD4A 1WBOA 3NYVA 4NTTA 4Z16A 5BUIA 4JVGA 3MWUA 4RVMA 4FZDB 3L8VA 2UZBA 4LG4A 4FKQA 4KIQA 4OTRA 3V01A 4CRSA 2H6DA 3BU5A 4XV1A 5AR4A 1TQMA 1W8CA 4NH1A 3GT8A 4NJDA 4BDCA 4EH3A 5DBXA 1YKRA 3FMLA 3OWLA 3MFSA 3GOKA 2I0HA 3LM0A 4JBVA 4MXCA 2ZAZA 1DI9A 4OTPA 4B9DA 1Q5KA 3VBQA 4G3DA 4ITJA 3EHAA 4LV5A 5JQ8A 3IG7A 2AC3A 2IN6A 4O96A 2PVKA 4ZZMA 4L6QA 3R21A 4I6HA 4GFOA 4FG8A 4Y85A 5I5ZA 3MESA 3PA4A 5H8BA 4YSJA 3P9JA 4YJTA 4OAVB 4NEUA 1OPLA 4XP0A 4UB7A 1E9HA 4O38A 4WG5A 4HGEA 1YI3A 2PVHA 1PMNA 3FPMA 5KZIA 2ESMA 4PF4A 4IVCA 3BWFA 2X7OA 2WU6A 1ZWSA 2UW9A 4YJPA 3I6WA 1DI8A 5HD7A 5D1JA 4FKIA 3QTQA 1FQ1B 1YXSA 2B7AA 5FRIA 3WIKA 5FBOA 5IUHA 5KMOA 3C4ZA 5HG8A 2WOTA 5LVLA 5K4IA 4ZY6A 1E1XA 3EN4A 3FAAA 4JLCA 1YVJA 4PPBA 3L8PA 3BLQA 4KIKA 1W98A 5CEKA 4XBUA 4O0UA 5A6OA 4DTKA 2O5KA 2WQOA 3ZC6A 4GUEA 3ZMMA 1M17A 4RWIA 3JY9A 4WNOA 4P5ZA 1R1WA 4YTHA 3AC3A 3RAHA 3MDYA 4JDKA 4DTAA 4BZNA 4J96A 5AMNA 5KUPA 5FXQA 1OL6A 2QU6A 2HW7A 2JIVA 5BUJA 1SVGA 4LRMA 4Z7GA 1DM2A 4TNBA 1BYGA 2EB2A 4K6ZA 2PPQA 3ATSA 3C4XA 5EDQA 4IDVA 3G6GA 4E6DA 2PZPA 3EQIA 3FZPA 3EZRA 4D0WA 5IEYA 1U4DA 3I4BA 3GU8A 4FKLA 4X3JA 3DXPA 4I24A 2CCHA 3KA0A 4W4YA 5DR9A 4Q5EA 5HLNA 2X1NA 4AAAA 4ERWA 1Q8UA 4WUNA 2C0TA 4UN0C 5FEEA 3ZEWA 5T6KA 3EFJA 4E4XA 3OWJA 4C2VA 1CMKE 3COIA 5HCYA 2QO2A 4FVPA 4G3CA 3P7BA 5EW8A 4Y95A 3DT1A 5HBEA 5HLWA 1BUHA 3RWQA 5HGIA 3CKXA 4FG9A 3T3VA 4RLLA 2VWWA 4UX9A 1H1QA 3NNUA 3VVHA 3V5TA 3C4EA 4FSYA 4KKHA 2CKQA 1Q3DA 4Z7HA 4O7LA 2LAVA 4MCVA 4BY9E 3GCSA 2BDWA 4YBJA 4YHTA 3ZYAA 4WG4A 4DFNA 5JRSA 4DN5A 3MYGA 1YQJA 1ZAOA 3LXKA 4JDJA 4E4MA 3PA5A 4ZJVA 2XVDA 3MJ1A 3UTOA 3KULB 4EEVA 3BYMA 1Y57A 3GOPA 2VNYA 2VTJA 4BCIA 5FUTA 5GNKA 3E8DA 4C59A 4CMTA 3R9HA 5IQDA 3PXFA 1KWPA 2XP2A 2YACA 3C0GA 5E8WA 3QX2A 1MQ4A 5M4CA 1PXOA 2WIHA 4L00A 4RFZA 4MNFA 2PUNA 4HYSA 4JQEA 1PKGA 2YCQA 3TM0A 4F1MA 3C4WA 3Q53A 3D5XA 3PZEA 1WVYA 4BRXA 1PYEA 4XOYA 2C6KA 2CLQA 1NY3A 4CMOA 4IB3A 4JG8A 2HZ4A 3FZRA 3BHVA 2XBAA 4I4FA 4M0ZA 4X2FA 2R5TA 4YLLA 2BVAA 5IA2A 5LMKA 4EOJA 1AQ1A 1XHAA 3SD0A 1QPEA 5E8XA 5HESA 2BZIB 3RHKA 4JQ7A 2HXLA 4O0SA 3QQHA 3C9WA 3IONA 1U54B 3TEIA 2WTKB 1BI8A 1P4FA 3K2LA 4IANA 2BDFA 4MNEA 2CGWA 4FKSA 2W1ZA 2UVXA 2OBJA 4C61A 4HJOA 4IZYA 5HORA 5GHVA 5TE0A 2OH0E 4F1TA 4DG2E 3MFUA 2OIDA 2EVAA 5H8GA 2YJSA 1JKSA 4YJSA 3D5VA 4ERKA 4FA2A 5FXRA 4LRKA 4MQ2A 4XG7A 1ERKA 5LMAA 3CQUA 3D4QA 4A7CA 3LQ5A 1O9UA 3R7EA 3DQXA 3ROYA 3MA3A 3R30A 4WG3A 3EH9A 4AWIA 3ZXZA 3LQ3A 5J79A 4HCUA 3BZ3A 4AOTA 3V5WA 2BIYA 1J3HA 2R3MA 4IAAA 2QOKA 2E9PA 1ZXEA 5EYKA 4ACGA 4C33A 5HTCA 4ANOA 4I6FA 5AM7A 4EK3A 3R1YA 2C0OA 4M3QA 3A7HA 5DA3A 3MJ2A 5IU2A 3QC4A 1OI9A 5HOAA 3IKAA 2BKZA 5F1ZA 3KXNA 3PA3A 4DFLA 3E88A 3FXXA 1J7LA 3BHHA 5JN2A 5AAEA 4C3RA 4YZ9A 2R64A 2WMBA 3MY1A 4D5HA 2YHVA 1OGUA 4PL5A 2J2IB 4RVTA 4APCA 2V22A 4KAOA 4Q2AA 4Y8DA 4QP9A 2VRXA 2WEVA 3O23A 4KS8A 4DH7A 4YO4A 3RZBA 3NCZA 5KMMA 3OCGA 4BDFA 2IVUA 4FIHA 3C5UA 3TIYA 5HQ0A 2B9IA 2PU8A 3ZUTA 3G33A 4YNEA 4F9BA 4YJOA 4FT3A 4R5YA 3KN6A 3U4UA 3VS2A 4DGNA 5BVDA 4BCQA 4BI1A 3I0QA 3PXYA 3BYUA 3BPRA 3TZ7A 1VYWA 2DUVA 3FI4A 3BRBA 3OBJA 1YWVA 2F4JA 4NIFB 4N6YA 4BB4A 2C6LA 2R0UA 3FV8A 4QP4A 2W5AA 4MXXA 1JSVA 3EQCA 2OJ9A 3MH0A 2GNIA 2REIA 4GJ2A 3L8XA 3QWKA 4AA0A 2PK9A 2YZAA 3F61A 3OY1A 1JBPE 1I09A 4G3GA 4DHFA 3TZMA 4NUSA 4XOZA 5DHJA 3MW1A 4RGJA 4FNXA 2Y8OA 4F9CA 2YDIA 4FTTA 4YUQA 3TUDA 2JITA 5ANJA 2NO3A 4WNPA 2G1TA 5CAUA 5AP1A 1JAMA 3O96A 2HW6A 2W0JA 4D4VA 3N4TA 1Y6BA 2HIWA 2ITUA 3NNWA 3GBZA 5FG8A 3PVWA 3R9OA 3Q5ZA 4PRJA 4F0FA 1W83A 4K2RA 4BCMA 4YPDA 4IW0A 4KKGA 5EW9A 1ZYJA 1H28A 4BI0A 4X6RA 1XBCA 4L3JA 3D2KA 2WKMA 3Q5IA 4O82A 4FTUA 3FXZA 2X39A 3TN8A 3EMGA 3LJ2A 4ZS4A 3R1QA 5IQHA 2ONLA 3JS2A 3VWAA 3MPAA 5HCXA 3U9NA 5AV3A 2E2BA 2J0KA 4MXOA 2GS7A 2Z7SA 3OHTA 4NTSA 4L7FA 1V0PA 4C37A 4YU2A 2G01A 4NCTC 4I0RA 3CIKA 4YJUA 4C4JA 5JFSA 5H8EA 4YC3A 5DT4A 4MH7A 4FEUA 2BZJA 5GIOE 4EK4A 4DTBA 3KULA 5BYZA 4YJQA 4GKIA 1UNLA 3E62A 3TNIA 4KIOA 4F08A 4AZEA 1YOJA 3MTFA 3P7CA 5FGKA 5M4IA 2R3KA 4EK8A 3NIEA 3TV6A 5FDPA 4FZFB 4OTHA 1Q41A 5DYJA 2QG7A 4FTRA 4O7ZA 4G16A 3BHTA 3L1SA 5CAQA 2ITXA 3HDNA 4Q9ZA 2Y9QA 2VGOA 1QCFA 2AC5A 4KNBA 4B6LA 2PYWA 4ANNA 2C5XA 5E8VA 3LCOA 2V7OA 3P78A 3BCEA 3KREA 3PWDA 4YTFA 3DKFA 2BDJA 2EXEA 3OUNB 3FHIA 4IVBA 4BYJA 1U54A 2IW9A 1T46A 4M13A 4GYIA 3VQUA 4IX6A 5E8UA 2Y6OA 5HVYA 4BDBA 5TT7A 2EUFB 4BZOA 4F6WA 5A9UA 4CLJA 5EKNA 4J95A 4TWOA 3GU5A 5L6PA 3VRZA 4X7QA 3ZFMA 5EOBA 3VUIA 4PTEA 1E1VA 5FM3A 4D1XA 3VQHA 3PXZA 4CFVA 4CKIA 3E8NA 4FKOA 5HE1A 4FGBA 4HYIA 3D2IA 3CJGA 2XM9A 4L8MA 4PTCA 5AAGA 3NVKI 3KB7A 2VTNA 2PHKA 2BAJA 4O0YA 2OJJA 2XIYA 3NPCA 1ZLTA 4GG5A 4IVAA 5BVFA 2QOCA 4QQ5A 3RK7A 3RM7A 4J99A 5HU9A 3PZHA 1K9AA 1ZZLA 4HCVA 4F09A 4JQ8A 3G5DA 4JIKA 5CVHA 3O71A 2ETRA 2OICA 4BI2A 4FV1A 4UYNA 3FLNC 2H9VA 3QQLA 4YJVA 5KMLA 5BVWA 5EM7A 4DBNA 5AV2A 4QYGA 2UZWE 4LFIA 3VUKA 3UIBA 4C36A 2R9SA 4BICA 4DAWA 4U3ZA 4EI4A 3GCQA 3ID6C 3E92A 2ITPA 2X8EA 1L3RE 5L2SA 4O6EA 3LVPA 3U6HA 1QL6A 1KOBA 3GU7A 4YPSA 3NNXA 4M14A 5FP6A 5A4CA 5F20A 4C38A 3CBLA 3QXOA 4W4VA 4GMYA 5C8NA 4O7YA 1IA9A 3B8RA 2XKDA 3FY0A 2FB8A 2W1GA 4IM2A 4YC6A 2W5BA 4DFYA 4GS6A 3V6SA 4TL0A 1KV2A 3C13A 3PTGA 3DBQA 2V55A 2Z7QA 1MRUA 3KN5A 2VTMA 3O17A 4BZDA 1YXTA 5HCZA 3F3ZA 3UVPA 2CKPA 3H9OA 3F66A 5GZAA 4OGRA 3R9DA 3ZLSA 2QQ7A 5CSPA 5IA1A 2J9MA 3Q4CA 5IQGA 4YJNA 4IWPA 3DAEA 3HUBA 5GJFA 4R78A 3HMMA 4UBAA 4USDA 2CJMA 4PDPA 4NIFA 4D9UA 5M07A 4FZAB 4MQ1A 5LVPA 3FYJX 3FMNA 4P5QA 2ITOA 2CGXA 3VIDA 3ZOSA 3DJ6A 1H26A 3W55A 2GNLA 2WMQA 3FMJA 2UW0A 2WD1A 5ANOA 3KU2A 2WIPA 2CPKE 4YLKA 2RFDA 4FKWA 5JT2A 5K5NA 4HW7A 3UO6A 3UOHA 2FYSA 2GS2A 5FD2A 4F9AA 2YAAA 3PIXA 3LMHA 3ZRMA 2QO7A 3EB0A 1NT2A 5DRDA 1Y8GA 5CU4A 3TUCA 3OT8A 2OIBA 4RFYA 2GQRA 3EOCA 4O0TA 4DT9A 4H3QA 5IQAA 3FLWA 4XUFA 5EK7A 1PXLA 3R7UA 2WTCA 3CY2A 3DJ7A 1FMOE 2RL5A 3O51A 3QX4A 1FINA 4J53A 3OW3A 5CSWA 4YHFA 2WMUA 4OR5A 4RX7A 3OBGA 4RJ7A 3ZFYA 4G5JA 4X2GA 3GI3A 2VZ6A 3V6RA 4RA4A 1MRYA 2QVSE 2UZOA 3E3PA 3FZSA 3PSDA 4GH2A 3TZ9A 4Y72A 2J7TA 4IXPA 1OL1A 2PMNX 2UVZA 2O65A 5ICPA 2JIUA 4KSQA 4R1VA 4A9RA 2XIXA 3FLZA 4G1WA 4I22A 2Z7RA 1WBNA 1LP4A 1YHWA 2PE0A 3COHA 4XV3A 3Q2JA 5C8KA 5H2UA 4M84A 5AUZA 4ZSEA 5ETFA 3KK9A 2IJMA 3BHYA 5AR3A 3ZDIA 3MA6A 5C8MA 3QLFA 5HIEA 3B2TA 4KINA 5EM5A 2B55A 2PL0A 4MF0A 2R3IA 4FC0A 4QMWA 1XO2B 1AGWA 4NM3A 4AS0A 3QQFA 3V8TA 3JUHA 4D1SA 4U81A 5BVNA 3R8VA 4X2KA 5CNOA 5EDPA 3MVLA 2G2HA 4BDKA 4XMOA 4A06A 3MY5A 5LQFA 2X7GA 1XH6A 4K11A 1M52A 2HAKA 3MS9A 3NYNA 2Z02A 5LWMA 3OTUA 2G2FA 1IA8A 2VX0A 2UZEA 4IIRA 3W2RA 2YN8A 4BCOA 3GVUA 4FBXA 4EOPA 2GFCA 4HNFA 3WZKA 1GIIA 1H4LA 3PIYA 3EN6A 5CZIA 5I4NA 2BRNA 4UMRA 4RRVA 4M66A 2XKFA 3NR9A 3TV4A 3OCTA 3CTQA 3UQCA 3LW0A 2OLCA 4UMQA 3NW6A 1OITA 3LJ1A 2F2UA 5EM6A 3SOCA 4D28A 5IF1A 1DS5A 1PMUA 2IVTA 4F6UA 4IX5A 3UDBA 4C4EA 2PVNA 5LOHA 4ARKA 4D58A 1PW2A 4AT4A 3P1AA 4KS7A 2YIXA 4X0MA 2E9UA 4C8BA 4AGWA 4KA3A 3GC9A 5ACBC 4CFWA 3GU4A 4O7WA 5I9ZA 5JGBA 3MBLA 4NM7A 4ZTMA 4E6QA 1OKVA 1CKIA 3AMBA 2RFEA 3Q6UA 3SG8A 4JBPA 4GG7A 1SVEA 4QT1A 3FXWA 4M12A 5AR7A 3SW4A 2A4LA 4EH7A 2ZDUA 2JGZA 2HY81 5D7VA 2W1DA 1WBPA 3FQHA 3RKBA 3LCTA 4QTDA 3FEGA 4DEDA 3QKMA 2RIOA 5M08A 4YZBA 1W7HA 1YXUA 3DGKA 4A4LA 4ACHA 2JDRA 1PYXA 4WT6A 4MBIA 2JFLA 2PUIA 4FF8A 2C5VA 4USFA 3A62A 3DTWA 3HX4A 3SRVB 4C3FA 4QTAA 5AUYA 1K3AA 3UG1A 4ALVA 5JFXA 4H58A 2XNBA 5HE2A 3ACKA 3GGFA 3LFQA 4C4GA 4M0YA 1IR3A 4H1JA 4CMUA 3DAJA 4WNMA 1UU9A 3RMFA 3WI6A 1MRVA 3P7AA 4GUBA 4UV0A 4R1YA 4LOPA 2Q0BA 4WRGA 2VWVA 2Q83A 4KD1A 3HUCA 3PWYA 5BVEA 3R83A 4XG2A 4I6BA 4BKJA 4AF3A 2JBOA 1GJOA 4ZMFA 3SXRA 1OIRA 2C6DA 5EOLA 3OCSA 1LEZA 4AW5A 4CD0A 3HMPA 3UNKA 4E7WA 2WFYA 2FSMX 4XLVA 4EOMA 4EH2A 3OXTA 4ZTSA 3LXNA 5AP4A 3MVMA 1W84A 2JAMA 3G0FA 4TWPA 4AQCA 4N0SA 5HNGA 4AW0A 2QLQA 3EJ1A 3LLAA 2R2PA 4AP7A 1Q8YA 5CU3A 4G31A 3OXZA 4R7IA 4V05A 5J8IA 3R00A 2IZSA 3FZOA 4QNAA 5TF9A 3RZFA 4QQJA 4FMQA 5K3YA 3TT0A 4EOIA 4DH8A 4EZ3A 2RG6A 3EN7A 3CLYA 3KGAA 3NX8A 3UO4A 4F7JA 5BNJA 1PXKA 2IW8A 3MSSA 2ZMCA 3AC1A 3SW7A 3W16A 3ORMA 2GQSA 1YW2A 2PVMA 3O8PA 3LPBA 4FNYA 4ZJIA 1ZRZA 5A54A 3GQIA 3OD6X 2OZAB 4I0SA 1JVPP 1WBTA 3F7WA 4C3PA 1XH7A 3NCGA 4C34A 2F7ZE 4K77A 2W1FA 3A2CA 2PVYA 4O0VA 4KBKA 4QO9A 1VJYA 4IDTA 4CQEA 5E92A 2WELA 3W2QA 4BCKA 2F2CB 1H08A 4K1BA 3O2MA 4OBOA 4MXAA 4QMVA 3E93A 2ITVA 1M7NA 3U87A 2UZVA 3JY0A 5ANGA 5I9UA 2Y7JA 4TYGA 3RPRA 3UNJA 4FL2A 4XG4A 4ZZNA 2CNQA 3ANRA 4XRJA 3QAME 4IH8A 4CG8A 2XK9A 4D0XA 4HOKA 5EYCA 2ITNA 4Y83A 2G2IA 3DB8A 4TYIA 1UNHA 3QD2B 2ITYA 4O91A 3M1SA 5DOSA 3NLBA 2VWUA 4CVAA 4O7TA 2JFMA 3IDCA 5ETAA 5JKGA 3COMA 3EQBA 3HV6A 3KF4A 2UV2A 2E9VA 2WOUA 4PQNA 4O86A 2R3HA 2WZJA 4FGRA 3A99A 3OCBA 3Q9YA 4I93A 4FIGA 5HICA 3UBDA 3UIUA 2PZ5A 2CNVA 4QMZA 1KE6A 4EUTA 3KXXA 4HVDA 3F9NA 2C6IA 3ZC5A 5DI1A 3ORKA 4GU6A 5A46A 2JEDA 4UALA 3VO3A 1KE5A 1PHKA 2AYPA 5HLPA 3UQFA 4RZVA 2C1AA 5AP3A 3U4WA 4F64A 3QUEA 5HEZA 2CCIA 4FVRA 4AA5A 3R1NA 2XYNA 4BCNA 4D9TA 2GS6A 5BVOA 2R3OA 4O7VA 1H01A 2B54A 3CTHA 3W18A 3PSBA 1WBWA 3H0YA 2GQGA 3PLAE 3TL8A 1OB3A 1SZMA 4RIOA 2XK4A 3IOPA 3NDMA 4D1ZA 3QC9A 3FE3A 4IWQA 2GPHA 4PDOA 5T68A 1UU7A 4EWHA 3HLLA 1GAGA 4YZNA 3QLGA 4RFMA 5JZJA 2VAGA 1LEWA 5DWRA 3OT3A 4FZ7A 4I94A 5JGDA 3S95A 3I5NA 4PDSA 4HZSA 3OEZA 2WMTA 5AA9A 3L9MA 2BRBA 2H34A 4CZTA 2WHBA 5BMMA 1Y8YA 5CAVA 3DBEA 5B2KA 3DJ5A 3NUUA 4TWNA 5DN3A 1Q61A 3ATTA 4UZDA 2F49A 4BC6A 3Q32A 4ZSJA 4C58A 3DDQA 2J5FA 3A7GA 5D10A 4FK3A 5IISA 2WU7A 2OXDA 2ZB0A 4RMZA 3VJNA 2PTKA 5JRQA 4PL4A 4CZYB 1R0EA 2C5NA 4PMMA 2R3RA 3C7QA 1G5SA 3OG7A 1PMVA 4WSQA 3LE6A 5D11A 3UPXA 5KMKA 3ZRLA 5L8LA 4O7NA 4PP9A 4X3FC 3AGMA 4EHGA 2VD5A 3DXNA 4R7BA 3CQEA 4U44A 3SRVA 2R3GA 3NSZA 4E5AX 3Q52A 4UWYA 4C2WA 4ZY5A 3EL8A 3ORIA 2PE1A 3T8OA 4FV9A 3T9IA 3WARA 1H07A 4HYHA 4ZSAA 2QD9A 3MH1A 2IWIA 4FODA 4Z55A 2HY0A 1GZKA 3KK8A 5M51A 4H1MA 3QGWA 4MX9A 2PSQA 4NSTA 4TW9A 3LFNA 2VWZA 4AT5A 4RVKA 4BDJA 4DEAA 3F5PA 3G51A 2ETMA 3C5IA 2VO0A 4YZDA 2GMXA 3QZGA 2CHLA 4NKAA 4QMYA 3QTSA 3NAXA 4CFNA 4XG8A 3WBLA 3FUPA 1X8BA 4A07A 3JVRA 4HNIA 1FVTA 4KIPA 3D7TB 2C3KA 2DWBA 1MUOA 5J7HA 4LL0A 3UJGA 4MKCA 3HECA 3TKHA 5HTIA 1R0PA 4EJNA 4CNHA 4NJ3A 4XJ0A 4BGQA 5CLPA 2GSFA 3MTLA 2NPQA 4YO6A 3AC5A 3W10A 5CNNA 4JOAA 4FIIA 3TIZA 4AW1A 4D2PA 3LFBA 2YIYA 3U8WA 4B7TA 2QU5A 5A4LA 4IADA 2JKOA 3NS9A 3RI1A 2YCFA 3T3UA 2YCSA 3N4VA 2J0MB 3AD6A 4MTAA 3FBVA 2YZLA 4NM5A 4B0GA 1G8SA 3VS0A 4IWDA 5ANEA 4TNDA 1H1SA 3E8EA 4MXZA 4I1ZA 4RSSA 2OZAA 3R8ZA 4IE9A 4UXQA 4CFUA 5I3RA 3NZ0A 4MAOA 5IEVA 4RJ6A 1FBNA 4FIJA 3EFKA 3PE2A 3TCPA 4P2KA 4IBMA 5JZNA 3U9CA 4JAJA 4WNKA 3ULIA 3PYYA 5KMJA 3DQWA 4FX3A 1XH9A 3IO7A 4NYEA 5C03A 5FTOA 4MF1A 4DLJA 2QURA 1S9IA 3CD8A 3FSKA 3BU3A 2RFSA 4L67A 1JNKA 4OLIA 2X9EA 4E1ZA 1REKA 3WE8A 5DG5A 4IFGA 1FVRA 1LUFA 4K33A 3UOLA 3Q60A 4RX5A 4R7HA 4I5HA 1BLXA 4FSUA 2WQMA 3MH3A 2R7BA 5DR6A 5AP7A 3UZTA 2XIKA 3LZBA 3Q4TA 4ZLZA 2Z7LA 3MPTA 2BRMA 4AOJA 3PY0A 3F2RA 4GK3A 4BDHA 3KF7A 2WMXA 5CSXA 4GIHA
chains in the Genus database with same CATH superfamily
2XB7A 5HBJA 3IW4A 5HO7A 1ZMVA 2OXXA 3COKA 2UW5A 4RPVA 2P55A 3IGGA 2QOFA 4QMSA 2WQEA 3KRLA 3BE2A 4BDAA 2ETKA 3BBTB 3QQJA 2RSVA 2YFXA 3W32A 4CT2A 5IEXA 3PXQA 4S33A 4W9WA 4LYNA 4ZLOA 2JKKA 2WQBA 4RIXB 4MWIA 1W82A 2QNJA 3OTVA 3OWPA 5B0XA 3TJDA 4W8DA 5KMNA 3E8CA 4UYAA 3UYSA 1O6LA 3CQWA 4UZHA 5BQ0A 2CSNA 4BJJB 4G5PA 1PXMA 4F9WA 3D94A 5GJDA 5C27A 5L2IA 2QONA 2YIWA 4J1RA 3QQGA 2A19B 1UWHA 2R4BA 3EFWA 3D15A 3PJ8A 1YWRA 4APPA 3FL5A 2O2UA 5L2TA 1SM2A 1GZNA 3HP2A 3AKLA 4YSMA 3ZHPC 1JSUA 2JD5A 3D7ZA 3KMMA 3NRMA 3NUAA 5AV1A 5J1VA 2V0DA 3BYVA 3GQLA 3LXPA 4I5MA 5HIDA 3ZTXA 4BDIA 1QPJA 5IA4A 3ETAA 5FXSA 1OL2A 4FTNA 3E64A 4L43A 4MD9E 4AFJA 4CXAA 2XA4A 5CI6A 5M06A 4ZTQA 2Q0NA 3GCUA 2Y6MA 3SC1A 2R3LA 3F5UA 4MEDA 4AN2A 2VNWA 1VEBA 5LCKA 2GCDA 3EN9A 3MH2A 4GL9A 3FY2A 2P2IA 3R7IA 5J5SA 4HCTA 3GU6A 5KKRC 2ZJWA 4E26A 4RZWA 3ZFXA 4DGGA 2QHMA 3B2WA 4QPAA 1Q97A 3HMOA 2YISA 5HG7A 4AZVA 4FEVA 1RQQA 2C47A 3FDNA 3KXZA 3LLTA 1BI7A 3ET7A 2YIQA 5CYIA 1OPJA 4LOOA 4C35A 1CKJA 2R3NA 4CLIA 2XK8A 4JX7A 5DIAA 5BYYA 3BEAA 3BELA 3MPMA 1Y91A 4XG6A 3PVBA 3S0OA 1FOTA 3DFCB 2UW8A 4FTLA 3S3IA 3DOGA 4DEGA 3R7OA 2W4KA 2ZDTA 4ZJJA 3I60A 3L8SA 4WBOA 4DEBA 5GIPE 4DG0E 3E87A 2KTYA 2PZIA 2E9OA 2BZKB 1H24A 3R1SA 2WPAA 5CS6A 3LAUA 1M2RA 1Q8ZA 4OT5A 2ACXA 1LR4A 3W8LA 5ANDA 3C0IA 2XKCA 1BMKA 3DKGA 5F95A 4ITIA 5HE0A 3TTIA 4E5WA 3VS4A 5M09A 4XV9A 3RP9A 4YNOA 5BX0A 2BMCA 4RX9A 4UMPA 2J4ZA 3BBWA 1WMKA 3KXMA 3Q4ZA 3TZ8A 5CU6A 5FEDA 4AE6A 3VS5A 3NUSA 2QOIA 3DU8A 4EYMA 4FT0A 1Q3WA 4DEIA 4PDYA 4LMNA 3VS1A 5IDPA 2PZYA 5AM6A 2F7XE 4YTIA 5AR8A 2J0JA 3CEKA 1OVEA 3DAKA 2XZSA 2QKWB 3D7TA 3ZXTA 5DPVA 3K3JA 3TWJA 4IAKA 2GTMA 2HOGA 1CTPE 1ZARA 5L4QA 4QRCA 3QCYA 2GNJA 3AXWA 2JDTA 4IM3A 3KMWA 3EZVA 2C68A 2OIQA 4FL3A 4UWBA 3WIGA 4JR3A 4MBJA 4R8QA 5JSMA 3H10A 5EI6A 3R22A 4IAZA 3AT2A 4CSVA 4E93A 5HHWA 4PP7A 4IX3A 5C4KA 2OW3A 4LL5A 2WTVA 4I20A 4F9YA 4X2JA 2VUWA 5E8ZA 4GW8A 3I5ZA 1OM1A 2XH5A 3BHUA 4B8MA 5LCJA 2C4GA 3QYZA 2Y4IC 4MXYA 3UE4A 3DBFA 4EQUA 2ZOQA 4J98A 2YWVA 1SNUA 1WVWA 3CPBA 3HA8A 4E4NA 4YURA 4G6NA 4AGCA 4O0WA 5IA3A 5IH5A 3QYWA 5D12A 3VBVA 5I0BA 5J5TA 5AADA 4JMQA 5AP0A 3HP5A 4OTFA 2CDZA 5LVNA 3I0OA 2IW6A 4QTCA 3VUDA 2OF4A 2I1MA 2XNMA 4G6LA 4ZZOA 1P2AA 3D0EA 4QQCA 5HVJA 3LMIA 2NNWB 4ZK5A 2XJ1A 5DEWA 3QHRA 3UZPA 4L01A 5T3QA 4DGMA 4FJVA 3AMYA 2QG5A 3DK7A 5A4QA 3PXKA 3U6IA 4CFXA 2XYUA 4L42A 4C4IA 3TKIA 4J71A 3H9RA 3UVRA 5CEMA 4GFGA 4BKYA 2ERZE 1Z5MA 2CKEA 4FVQA 2WXVA 2HENA 4U7ZA 4QMQA 4O84A 5J95A 5ANKA 1NXKA 3A7IA 3P08A 4XP2A 5L2QA 5GJGA 2X81A 4E6AA 4DDIA 5B2LA 4GCJA 3TACA 4O81A 4R3PA 4QP7A 2C3IB 1OKWA 2IVVA 3D5WA 5A3XA 3QCSA 4G34A 4FKVA 4RA5A 3TXOA 2XCKA 4QEBA 1UV5A 3KL8A 3E7OA 3Q3BA 5D9HA 3M42A 3TV7A 3EFLA 1KE9A 5JFWA 2X0PA 4RIXA 3M2WA 3ALOA 3A7JA 3WF5A 4RT7A 4WRSA 5LVMA 4M8TA 3PJCA 5I9XA 2A1AB 2HZ0A 1F5QA 2VX3A 4E73A 3HVCA 4W4XA 5LXMA 4IVDA 4BJJA 4KWPA 5A4TA 4R6VA 5CF8A 2AQXA 4U9AA 5M55A 4RQKA 4PMTA 4UXLA 3QRKA 4EWQA 1K2PA 3DBCA 2YIRA 5E1SA 4LGHA 4R3RA 1YHVA 2DYLA 4IWOA 4QMXA 3GENA 4DHZA 4WD5A 3UMXA 4BBEA 2GHGA 1TKIA 2QOLA 2UZUE 3QU0A 4FL1A 2IF8A 2OU7A 3WE4A 2IG7A 1W2FA 3HZTA 3AC4A 3MGYA 4AZSA 3IDBA 4UMUA 2ZMDA 3S2PA 4DDGA 1IEPA 5H3QA 2NP8A 4ZIMA 4QYFA 3F6XA 4OTQA 1YDRE 2J90A 4NFNA 4EBWA 3WF7A 3LQ8A 3GC8A 2XUUA 3OOMA 2UZDA 4FTOA 1OZ1A 3A61A 3QZHA 4FSRA 2QC6A 3JYAA 3PY3A 4GK4A 4IB1A 4CYIA 2GU8A 3O0GA 2ZV9A 2XAMA 4QPMA 4UMTA 4ANLA 4IAIA 1JSTA 1XBAA 2PUPA 3PPZA 3MB6A 4JR7A 5CXZA 3QKLA 1J1CA 5LMKC 1OMWA 4PNIA 3IK3A 5IG1A 2F57A 5CX9A 4M97A 3PG1A 5TOZA 2C5YA 3ZO2A 5JEBA 2W1IA 4X21A 1R78A 2W4OA 3V8WA 2IZUA 2XRUA 2V5QA 5HX6A 1JKTA 4HPTE 3FJQE 5HG5A 4FEQA 4L3LA 4OBPA 4DEEA 4XBRA 2B0QA 2ITZA 2C6TA 4IM0A 4PMPA 2PMOX 2QI8A 4O83A 3SXFA 5CT7A 5CF4A 3SVVA 4HVSA 2GTNA 4TYJA 1YWNA 4K18A 1P14A 2WQNA 2WAJA 2BAQA 4EC8A 5CALA 4LUDA 5L8JA 3VNTA 2R3FA 3MN3A 5IPJA 4UWCA 2SRCA 3VW8A 4F65A 3UIXA 3CTJA 4FV6A 4QMUA 4BWPA 3H3CA 5HBHA 4FNWA 5EHYA 3ZM4A 1L8TA 2BZHB 3UODA 3N9XA 4MYGA 5EYDA 5CQWA 3MIAA 2VTLA 4F7SA 2PMLX 5CTPA 3VUMA 3UO5A 3FHRA 2ZYBA 1P4OA 5HG9A 1GIJA 2YA9A 1P5EA 4BBFA 2XM8A 3DXQA 3SGCA 2XRWA 1KUTA 2BUJA 3QCQA 4BWXA 3THBA 4GK2A 4MVFA 1O6YA 4PX6A 2RGPA 4WKQA 1PY5A 4IC7A 2JLDA 4P7EA 4EZ5A 3RAKA 4FNZA 2BTSA 1B6CB 4R3CA 3VF9A 3OW4A 1KOAA 4GRBA 3E5AA 1H25A 3B8QA 3KCFA 3DY7A 3DNDA 4C7TA 5CEOA 3W33A 3NMUF 4BYIA 3HNGA 3NUYA 3F3WA 4BBMA 3VUTA 1UVRA 4QDEA 1M7QA 2C3LA 4EORA 1RDQE 4BTFA 5B7VA 1BKXA 4KABA 2QCSA 5HX8A 3BKBA 4U40A 4BCFA 4G3FA 3UOKA 4U5JA 3BGPA 1YOLA 3F5XA 4LGGA 5IA0A 4C02A 4L7SA 4P4CA 4II5A 1F3MC 4ONAA 4I21A 3K54A 2XK6A 2XJ0A 4FT7A 2DS1A 1J91A 5JGAA 5KBRA 4CT1A 4AXEA 3ORPA 4U42A 3UP7A 3N51A 2QO9A 1MP8A 4BCJA 2QOHA 5GZ8A 1OL7A 4QYEA 4J8MA 3QF9A 5HTBA 3HRFA 3OWKA 3OP5A 3DDPA 5KBQA 3W0SA 5F9EA 3NW7A 2Y4IB 5KE0A 2C69A 3ZSIA 5DFPA 3BEGA 3NIZA 2HK5A 3W2CA 4AA4A 3V5PA 4L46A 4F70A 3EYGA 1TFFA 3VBXA 3AGLA 2J0IA 1Q99A 4ACCA 3R0TA 4NL0A 2CN8A 4AZWA 3Q9ZA 4OTIA 4WUAA 2BROA 3QTZA 4GYGA 2YEXA 5IZFA 4C57A 2W1CA 4NKSA 1AD5A 3KMUA 3PRFA 4I5PA 4AFEA 3F88A 3Q04A 1JLUE 2VO3A 3KXHA 4LMUA 5IQEA 2YDKA 3DZOA 2XEYA 3QBNA 4ID7A 4FSWA 3DKOA 5HI2A 3RCDA 3RNIA 1PF8A 3RVGA 4D4SA 2F9GA 3SAYA 2FGIA 3FKOA 4AAYA 4R5SA 3DK3A 4YLJA 3UIMA 3I1AA 3UMWA 4XNEA 2C6MA 2G9XA 2PULA 4XX9A 4ZTHA 3ODZX 4OBQA 5AR2A 3W0PA 4O27B 5E4HA 1PJKA 1W2CA 1ZOGA 3PUPA 2XNPA 5K9IA 4ANQA 4EH6A 1FGIA 2UW3A 3HV7A 4NZWB 2VTQA 4I0TA 4L45A 5EHLA 1M14A 4F6SA 5EKOA 3FKLA 2IZTA 4NW5A 1CSNA 4W4WA 3A7FA 4YP8A 4JG7A 4RQVA 4LI5A 5HD4A 1WVXA 3U55A 2XF0A 1URWA 4FV5A 4HYUA 3WZJA 3L9LA 2W4JA 1U59A 4XS2A 3QTRA 1YI6A 1TQIA 2X0QA 4LGDA 4EBVA 1Q8WA 2G15A 3H9FA 5DR2A 4GT4A 4MHAA 1WFCA 2YCRA 4TRLA 4DYMA 2PVJA 4FI1A 2XBJA 3LFEA 3F2AA 4FKJA 5FDXA 5E1EA 3VC4A 4ENYA 3P5KA 4EC9A 3FL4A 3R7GA 2WMAA 4GEOA 3VS7A 2XEZA 2NYAA 2R7IA 1IAJA 1U5RA 2YM3A 1Q8TA 1RE8A 2XNEA 2PVLA 1IASA 2GHLA 4KBAA 1SNXA 2EU9A 3D9VA 3QXPA 4JBQA 3RHXA 4B8LA 2XIRA 3W2SA 5BVKA 5CEQA 1MQBA 1WAKA 3R01A 4FOCA 2B52A 2OWBA 5JQ5A 5CT0A 3P0MA 4EZ7A 1O6KA 3ACJA 5D7AA 4BIBA 5J9ZA 4FR4A 3HAVA 3FQSA 5DE2A 1H00A 4BCGA 3IW8A 3R63A 3DA6A 4TKSA 4ASDA 1OIUA 5AAFA 2WMVA 3R9RA 3TKUA 2YM8A 5EQYA 4EKLA 3QWJA 1ATPE 4ZP5A 2XCHA 3QA8A 3F3UA 1Y6AA 3R04A 5AUWA 4D2TA 4CFFA 3A8WA 3S00A 4YTCA 3DCVA 3A8XA 3PIZA 3BX5A 3QA0A 3ZU7A 5KX8A 2QHNA 4FEXA 3CCNA 2BRGA 4GVJA 2EXMA 3H30A 5CU2A 4BCPA 4LQMA 4M68A 4D2RA 5E91A 3NAYA 4DC2A 2EXCX 3GFWA 4BDGA 4E3CA 2WTWA 2XIZA 3QZFA 3DNEA 5FBNC 4WIHA 5C9CA 3V51A 5J9YA 2IVSA 3W0MA 4XHKB 3AC2A 4HGLA 2RKUA 3CPCA 4KSPA 2OF2A 1A9UA 2BFXA 2VWYA 5AP6A 4E8AA 3WOWA 4JL9A 2HZNA 3ZONA 3FLSA 2B53A 5I9YA 3TJCA 4C0TA 5HU3A 3KEXA 5AUTA 3KCKA 4H36A 5A6NA 2A27A 4I92A 4Y5HA 5HE3A 1DAYA 4FSZA 3JR1A 2VWBA 2O0UA 4BIDA 4S34A 3RGFA 2O63A 2EWAA 4XG9A 3PY1A 1OIYA 4MK0A 2OO8X 4DHJA 3R2YA 2X6DA 4AN3A 2VV9A 3R8LA 2YM5A 3C0HA 1NVQA 3DTCA 4E20A 5K0XA 2X8IA 3SQQA 3UVQA 3SA0A 4NT4A 2HCKA 1ZYCA 2O8YA 4NCTA 3AD5A 3FPQA 2J5EA 1HCLA 2BPMA 2GFSA 2O3PA 2X2KA 3PE1A 3R02A 4GT5A 3FZTA 3I79A 4GJ3A 4KRDA 4YZMA 3FYKX 4LUEA 3AT4A 5KZ0A 2FO0A 4B99A 2QOBA 2XARA 2ZM3A 2UZTA 3ITZA 3R9NA 4V01A 1KSWA 4ZEGA 4EUUA 3ANQA 4CKJA 5BYLA 1FVVA 4Q5HA 5ITAA 5EYMA 1CM8A 1OECA 4I3ZA 3RAWA 5IH6A 4X2NA 3SLSA 4R77A 3BYOA 2X0OA 3E7VA 3LFAA 3QD3A 3LCDA 4TWCA 3TNHA 3DPKA 4TTHB 5EI2A 5AV0A 5AFVA 3NEWA 4BF2A 2ZV8A 3HEGA 2FSTX 4RLKA 5IQBA 4FYOA 4ASXA 3MY0A 4DG3E 3O7LD 3OUKA 4U8ZA 2A98A 2QR8A 3DK6A 3EWHA 3F5GA 3II5A 4M7IA 4OTGA 3RPSA 4CTBA 2PVRA 4WA9A 5HVKA 1ZY4A 3LFFA 3CGOA 3PJ1A 1G8JA 4YMJA 2FUMA 3EQPA 4AT3A 4EH8A 5FTGA 4DA5A 2VWIA 1XWSA 3VS3A 4A9SA 5JMSA 4PY1A 4BVUA 1REJA 3V5QA 5JK3A 3RTPA 5M4UA 2ZFYA 3LKMA 2QOQA 3AT3A 4DINA 3U6JA 4U3YA 4ZAUA 4IJPA 2R3JA 5BUEA 5AR5A 4AE9A 3KVWA 1SMHA 4QTBA 1XH5A 1UWJA 3OOGA 1IRKA 5EQPA 4YR8A 3TMOA 3K3IA 3PVGA 1GIHA 3RAIA 4N57A 4X6QC 4ZSGA 4ASEA 3ZBXA 3D5UA 2OJFE 3GP0A 2C3JA 2YLFA 4FOBA 2JKQA 2V7AA 2OXYA 4AX8A 4JDIA 1J1BA 4IZ5A 5J7BA 1VYZA 2ZM1A 3EQDA 3N4UA 3D83A 5CASA 2W05A 4EYJA 4DGLC 4IEBA 2JDSA 4G3EA 4MD7E 4IZAA 4E5BA 4DH3A 2H8HA 5CENA 4PL3A 4DF3A 2WTJA 3SX9A 3DS6A 5E9EA 3CR0A 2B9FA 4BN1A 3RK5A 4RIWB 2R3PA 1A48A 4N4SA 5L8KA 1DAWA 2IZRA 3QUPA 1RJBA 3BL9A 2B1PA 2VO7A 3KRXA 5J1WA 2YM4A 4GT3A 2YWPA 4M67A 3QRTA 3DZQA 1OL5A 3C1XA 5AX3A 3ERKA 4N70A 4HZRA 2QKRA 2WNTA 5FM2A 1ZOHA 4JRVA 3FZ1A 1UU3A 3F3TA 4FKTA 3V5LA 3FI2A 3MI9A 4IB5A 4F63A 4O0XA 4V0GB 3NYOA 5FWKK 3KY2A 2VN9A 4FSTA 3R73A 4ALUA 2AUHA 5L6OA 3GC0A 4XRLA 3A4OX 2OH4A 3FC1X 3W8QA 2ZV2A 4QPSA 4V04A 4FV2A 4F99A 4DCEA 4O7SA 2BCJA 3KFAA 4IJ9A 3ZUUA 1FPUA 3QTXA 2O64A 4HVIA 4AGUA 2X0GA 5EW3A 3NWWA 5CAOA 4BFMA 3WF8A 3UNZA 4G6OA 4F7LA 3KIOC 2RG5A 2JKMA 3L9NA 4I5CA 1PRYA 3FI8A 3NNVA 3EIDA 4BR3A 4EH4A 4KUJA 2BTRA 2XNNA 4O2PA 5EFQA 3HMIA 3LMGA 3VHKA 4QDVA 4QQTA 4C62A 3VBWA 4RC3A 2HWPA 2VU3A 2VX1A 5CVGA 2DQ7X 5CANA 5IQIA 2I0YA 1EH4A 4LV8A 4QP6A 4QOXA 4YZCA 4XLIA 3REPA 4ASZA 4CRLA 3BE9A 5CY3A 2BRHA 2PVFA 3P23A 5HO6A 2BILB 4F0GA 3T9TA 3W0QA 3G9LX 2W17A 3QQKA 4W8EA 3PVUA 1ZMWA 3H0ZA 3SOAA 4JDHA 3EL7A 3MIYA 4IFCA 1Q4LA 2X2LA 4TPTA 1YDSE 3ORXA 2JC6A 3I6UA 4USEA 3TNPC 4G9CA 3OEFX 4Z9LA 5GZ9A 4XCUA 1Q62A 4JJRA 4LDTA 4FIEA 4QNYA 4D2WA 1PXIA 1FMKA 1FGKA 3DLSA 3SV0A 3V5JA 3QQUA 3W1FA 5HZNA 5CWZA 4WSYA 1JOWB 2XKEA 3VRYA 2WMWA 1JWHA 3I81A 1UA2A 4AU8A 4XP3A 3DB6A 3R28A 4IC8A 2X4ZA 3C50A 1R3CA 4U79A 4YC8A 3TTJA 3ZLXA 5I9VA 3ORNA 1T45A 2Y0AA 3PFQA 2UVYA 2KULA 2PY3A 3EQFA 4L44A 4IMYA 4PUZA 3OS3A 5HNBA 5B2MA 2W96B 3AG9A 4EOOA 5M44A 3DFAA 4RWKA 3VJOA 4U97A 4JT3A 2ZVAA 4PMSA 3VAPA 1XH8A 1H0VA 4DBXA 3F82A 5EHOA 3ODYX 4AACA 3G2FA 3AQVA 4DH1A 4F4PA 3OVVA 2I0VA 3UC3A 1OUKA 5D41A 4DT8A 4J7BA 4HGSA 2P4IA 4QMLA 4JBOA 3DBDA 5IMEA 5IMXA 4IX4A 4ANBA 5ACKA 4JI9A 4D4RA 3QFVA 3HV5A 1OKYA 5DVRA 3LHJA 3ZS5A 3FMKA 3RJCA 3VN9A 5BV3A 5IH4A 2JAVA 3CC6A 1I44A 3BU6A 2W1EA 4FTAA 5FP5A 3LFDA 4FKUA 4O22A 3KC3A 3R8UA 3RALA 3RWPA 4EK6A 2C1BA 5ANIA 5HNIX 4A9TA 5EG3A 3F3VA 4XH6A 5KO1A 4EONA 5J9LA 3I7CA 2W06A 3EN5A 1CKPA 1G3NA 2XMYA 3C51A 3ZLYA 3LIJA 3QGYA 3POOA 4NFMA 2WO6A 3OMVA 3VBYA 3GB2A 3MB7A 1XR1A 3IPHA 5L6WL 3HV4A 4J97A 2JDOA 2FSLX 4FG7A 3ZDUA 3G6HA 5J87A 5E8SA 4EJ7A 1RW8A 3OXIA 1B39A 5CZHA 3FKNA 3K5UA 2VTRA 4FKGA 3POZA 4FV7A 2OFVA 5E90A 3GCPA 3BIZA 3CKWA 4G17A 3G0EA 3CS9A 4FK6A 2UZNA 5AP2A 4A4XA 3CGFA 3K5VA 3CP9A 3BQRA 3E3BX 1V0OA 2XJ2A 1ZYDA 2VTPA 4B4LA 3PXRA 3RNYA 1ZYLA 5CSHA 2XNOA 3IW5A 5FLFA 2V62A 5DRBA 1OBGA 2VGPA 3EQRA 3TDVA 3KRRA 2WTDA 5IQCA 4P90A 3O8UA 3E63A 4GU9A 4M69B 3SG9A 4CGAA 4U80A 4F0IA 1M2QA 1GOLA 4MWHA 1JKLA 2Z60A 1NW1A 4EKKA 4IAFA 2JDVA 2R0IA 3IS5A 4RWJA 4TN6A 3VUGA 3CD3A 2VTOA 3NUNA 3QHWA 3ULZA 4WOVA 4RIWA 5KHXA 2ZM4A 4Y46A 1ND4A 4IACA 4RJ3A 5K0KA 4BDDA 3A60A 1H1RA 3TDWA 3ZEPA 3BV2A 1YHSA 4KB8A 4A9YA 1JQHA 2OFUA 4X3FB 5IDNA 4I41A 2C30A 2X8DA 5ETIA 4BTMA 3P86A 4E4LA 3ALNA 1Z57A 5LVOA 2E9NA 4NM0A 4H3BA 3WZEA 3FMMA 4ZY4A 4V0GA 3UP2A 4CCUA 3ENHA 1YRPA 4AOIA 1JPAA 4JG6A 2W9FB 5AJQA 1WZYA 2C5OA 3BWJA 3ZSGA 4W9XA 5IA5A 4DCAA 3VS6A 1SYKA 3ZRKA 2B4SB 5IKWA 2P2HA 5LARA 1ZY5A 4FTKA 3IECA 2GNFA 2VTHA 3ORTA 4O1PA 2CNUA 5AUVA 4L68A 3P5JC 4FTMA 4Z3VA 1GY3A 4FTQA 1TZDA 4XG3A 4EOSA 3QKKA 2GDOA 1OKZA 1ZOEA 2GNHA 5LJJA 2I7QA 3NUPA 2ZB1A 3OF0A 3ZO3A 3PSCA 3FMEA 3GXLA 4FIFA 5CVFA 2J0LA 3R6XA 3GC7A 4OAUC 5FEQA 3ZZWA 3HDMA 1OUYA 3W2OA 1H1WA 2HXQA 4YGAA 3WF6A 5KHWA 3HYHA 3PPKA 2JIIA 4DFUA 4JRNA 4WHZA 3U54A 4ZTNA 3O50A 1XKKA 3ZCLA 2QLUA 4CEGA 3PJ2A 4DGOA 3ZO1A 4DE4A 1APME 3CXWA 4ZTRA 3SDJA 5KMIA 4K9YA 2BKKA 3ZM9A 4U6RA 4RWLA 4IB0A 3JXWA 2RF9A 2FSOX 1U46A 4QMPA 3TNQB 1NA7A 3QUDA 5EH0A 3QRUA 4JS8A 4J8NA 2C0IA 4RJ5A 5KCVA 3BV3A 3QTUA 3OC1A 4MBLA 5G6VA 3AOXA 5TO8A 4ZLYA 3C4FA 5K4JA 3NVMB 2X9FA 4CG9A 4UY9A 3RBWA 4CV8A 3TI1A 4RG0A 5DMZA 1UKHA 3O5AA 2UW7A 2GNGA 3LJ0A 2VTAA 4U41A 4XYFA 3HRCA 3C4CA 3KQ7A 3CE3A 3PP0A 2OGVA 2PE2A 2QODA 2BAKA 4FSMA 3IW6A 3WYYA 3SHEA 4ACDA 1ZMUA 3UOJA 5EQEA 2WMSA 2W99B 4RX8A 3BGQA 3BQCA 1YDTE 4BHZA 1SVHA 4O7RA 2A0CX 1IG1A 5E7RA 4QMNA 3UG2A 1KV1A 4YBKA 1J7IA 4ALWA 1VZOA 3PG3A 4XEYA 2HELA 2I40A 4DEHA 4RIYB 4I6QA 3U51A 4FUXA 4QTEA 3LXLA 4G2FA 1GZ8A 4ANMA 1B38A 1PMEA 2ZV7A 3Q9XA 2YABA 4GFMA 4CYJA 4RBLA 5A14A 4ORKA 3ZBFA 4FKPA 1HCKA 2OI4X 3JPVA 2X2MA 4JAIA 4ZS0A 4D5KA 4Y5QA 3O8TA 2HWOA 2C6OA 3PPJA 1PXPA 1VR2A 3W2PA 2I0EA 4C4HA 5M56A 5AWMA 5HKMA 3R8MA 5EM8A 4L9IA 5FQDC 4FTCA 5G1XA 2OJIA 2NRYA 3ELJA 3IGOA 3KVXA 4LOQA 4U0IA 2GHMA 5DLSA 1ZZ2A 2YITA 4TYHB 4EL9A 5CU0A 5DNRA 1OIQA 3WZUA 4D4YA 5M57A 1YI4A 4XV2A 3FLQA 1H1PA 3CJFA 4AG8A 4QP8A 2WMRA 4AXDA 4BDEA 4A4OA 2WGJA 1Z9XA 2J51A 2YJRA 1XH4A 3PRIA 5DT3A 4GKHA 1V1KA 3FI3A 3KRWA 4LV7A 4LM5A 1BL6A 1KE7A 4TYEA 4AW2A 4BHNA 4PNKA 2YM6A 2VWXA 3QALE 5M53A 3GEQA 3G9NA 3VBTA 3TYKA 1G8AA 4CFMA 2W1HA 4FTIA 3TUBA 2ITWA 3ZZEA 1H27A 3BYSA 4BL1A 4FSQA 3OROA 5E8TA 3R71A 4H3PA 4ZXTA 3GUBA 3V04A 4BCHA 5DGZA 5F94A 3BLHA 4RJ4A 3EYHA 4S2ZA 2BHHA 4ZOGA 3WYXA 5CSVA 3Q9WA 5LMBA 4AXAA 5FTQA 3S4QA 5KKRB 4IHPA 3NGAA 3DKCA 1BL7A 4M69A 2PWLA 2VTSA 2FH9A 3M11A 4L53A 1F0QA 1YOMA 3PLSA 1WBVA 2W9ZB 2RFNA 3HL7A 3MVHA 5DEYA 3VULA 3FC2A 2UUEA 2XK7A 4DFXE 5AA8A 1PXJA 3RINA 1J7UA 2YAKA 3OFMA 4QMMA 4DITA 1JKKA 4HPUE 3RPYA 2ERKA 5LWNA 5A4EA 2BIKB 2HYYA 2CN5A 2IEWA 2Z8CA 3RM6A 4D2SA 2A2AA 5C1QB 4FZ6A 2Y4PA 5CXHA 5CQUA 4X3FA 3UPZA 1TQPA 3IOKA 5E8YA 4Y73A 3MVJA 3VW6A 2OJGA 4AGDA 4AN9A 4FEWA 1QMZA 5JFVA 3KKVA 4L52A 2XK3A 1H0WA 1YXVA 4ANSA 1STCE 3A4PA 2YDJA 4FV0A 4QD6A 4D2VA 4EHEA 2R3QA 5CF6A 5AUXA 4GIIA 3PDTA 3G15A 4BGGA 4YHJA 2OG8A 2J6MA 5EDRA 3ZH8A 3IW7A 2XNGA 4QMTA 3LOKA 4IAYA 3RCJA 1BX6A 3FSFA 3PP1A 4L3PA 3NYXA 1LPUA 4G9RA 4CV9A 4ENXA 5L3AA 4FYNA 1UU8A 4ACMA 4ZSLA 5K5XA 3OZ6A 4O1OA 4OW8A 5AUUA 3AC8A 4QP3A 4ITHA 1XMLA 1KE8A 3AMAA 3ZSHA 4U43A 1GZOA 2OSCA 4EH9A 4QYYA 4IZ7A 3P4KA 5KNJA 4BKZA 4CZUA 5HO8A 4H39A 1OBDA 2BR1A 4IQ6A 3FWQA 4S32A 1R39A 3R8PA 3ROCA 3UGCA 4QP1A 4S31A 2PZRA 5IQFA 2I6LA 5BMSA 5ETCA 4GV1A 2WTI