4M0ZA

Crystal structure of itk in complex with compound 5 {4-(carbamoylamino)-1-(7-methoxynaphthalen-1-yl)-1h-pyrazole-3-carboxamide}
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
264
structure length
264
Chain Sequence
b'KWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Selectively targeting an inactive conformation of interleukin-2-inducible T-cell kinase by allosteric inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 264
sequence length 264
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m0zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m0zA01
4DFYA 1YDTE 5KMNA 3H10A 5KMJA 2W1ZA 3AGLA 4KABA 3PJ3A 4BDAA 4WUAA 5AADA 3GT8A 4MF0A 4F0FA 2IZRA 3KN6A 4XG8A 3ORZA 2B53A 4MHAA 1O6YA 1Z57A 4CVAA 3DBDA 3NSZA 4GYGA 3EFKA 2ITQA 3DGKA 1OVEA 2HK5A 3LFNA 4FZDB 3EN4A 3FQHA 3DCVA 3MA6A 4NIFB 1PMEA 3HA8A 3MPTA 1M2RA 2OXXA 4FSYA 3VBXA 3ZSIA 3FV8A 2YIQA 3IS5A 4B4LA 4FMQA 2I0HA 5DGZA 4BR3A 3S95A 4AFEA 3ANRA 3F5UA 3O2MA 2JIIA 4FSUA 3QLFA 3CKWA 5BPYA 3BI6A 1DM2A 1Q8UA 3R2YA 2W96B 4KIKB 4KIOA 3O23A 2YLEA 3QD4A 1Q99A 1Q3WA 5HD7A 3ZZEA 5KBRA 4AU8A 4QP6A 2BHEA 2OICA 3PP0A 3IW8A 3ITZA 4WKQA 2AC3A 2XB7A 4Y72A 5D12A 5AR7A 2X4ZA 5IH6A 3LVPA 4IQ6A 3MESA 3R9RA 2QQ7A 2BZKB 3AT2A 3O96A 4MXYA 3TIYA 4QMVA 3D7TA 2UZOA 1QPJA 2KTYA 3ACJA 3K5VA 4HYHA 4Z9LA 1OIYA 4IVCA 5F9EA 2IO6A 1XBBA 2BZHB 4FUXA 4X2KA 5C01A 4IIRA 2J6MA 3NVMB 3R7VA 3KB7A 1TQPA 3ALOA 3EL8A 3Q4ZA 2W1IA 4DBXA 2VZ6A 2Z7LA 4J7BA 4ZSEA 3D83A 3R7YA 4PMPA 2HY81 1OKYA 2PHKA 2YCSA 3GNIB 3SKCA 4ZTRA 3PRIA 1XR1A 4BKYA 4C34A 4DYMA 3GCUA 3RMFA 3QQFA 4G3DA 3NUAA 2CGUA 2W7XA 2ONLA 3HMOA 4A9SA 4F99A 2JBOA 2QONA 1CKPA 3WOWA 4MNEB 4DTKA 2Y6MA 4BBFA 5HESA 4XP2A 4DG0E 1VEBA 1T46A 4FTJA 3U55A 3CQUA 4M68A 4YPSA 3HNGA 4AOJA 3SXRA 1KOAA 4EH8A 3S3IA 4QPAA 3PIXA 4WG5A 4RFYA 4Z7HA 5E8UA 2XH5A 3B2WA 4MD9E 2PMIA 5EQEA 3JYAA 1Q8ZA 3CTQA 4IC7A 3FLSA 4W8DA 5HCYA 4EH7A 2Y7JA 3EHAA 5K4JA 4ZLOA 2OF2A 3COIA 4I93A 4DGMA 1JAMA 1OITA 3UIUA 5M56A 4E4LA 1H07A 2C5VA 4C4GA 1XKKA 4I1ZA 3PPKA 3G6GA 1S9IA 3N51A 4H3BA 3Q9ZA 2Z60A 4PNIA 4I24A 5EYDA 4L46A 3AGMA 2JFLA 1FMOE 2XBAA 3ALNA 5E8ZA 2C68A 2UZWE 1ZOEA 3EQFA 3MV5A 4AN2A 1M2PA 3R63A 3R8VA 2C3JA 3ORPA 3LMIA 4E5AX 2C3LA 3S1HA 5HORA 5FM3A 3TXOA 3LCKA 2PYWA 1W98A 2BFXA 1KV1A 3PRFA 1BUHA 4U80A 3DDQA 2NP8A 2VO6A 3R21A 5AAFA 3R8MA 1YDSE 2BROA 3GVUA 4TPTA 4D4RA 4G3EA 4FV3A 3KA0A 3ZLWA 3SG9A 5CU4A 4ASZA 2OGVA 2UW4A 1ZOGA 2PMLX 4XS2A 5DLSA 4D0XA 3NW6A 1GIJA 2F4JA 2QOCA 3KXGA 3LE6A 2CNQA 3NW7A 3AC2A 4PNKA 3BX5A 4I21A 3OT8A 2IVVA 3KXMA 1YXVA 4F09A 2OZAB 3A62A 4KS8A 5FDXA 3FC2A 4QYFA 3QKLA 2BRBA 3F3ZA 2HIWA 1JBPE 1STCE 4S32A 3QD2B 2GNFA 4EOJA 4QQCA 4P5QA 5BVFA 3ZRLA 4FKLA 2F49A 5DMZA 5M07A 2ITOA 4I0TA 2IN6A 3PG3A 3ZCLA 3DKFA 4RT7A 4HYUA 5AP5A 1IRKA 3ODZX 1H1QA 1YI6A 4FTCA 4PMSA 4UWCA 5CU6A 2WU7A 4IM2A 4KBCA 4KIKA 4M69A 4ZZOA 4EZ7A 1XH4A 2UW0A 2X2KA 1OPJA 5C8NA 1OI9A 3OCBA 3TI1A 4EHZA 2R7IA 2XA4A 4I92A 5HG5A 4HVIA 4OR5A 2J0LA 2WAJA 3KL8A 3RK7A 2GTNA 4BCHA 2WZJA 3WIKA 4AZVA 2FO0A 4YZBA 2X7OA 4B0GA 1IAHA 4FZ6A 1Y8YA 4F0GA 4R1YA 2XZSA 5BMMA 3PWDA 2Q0BA 2B1PA 2OG8A 5LJJA 3OT3A 5CQWA 3ZDUA 4I5HA 4EKLA 3UNJA 3LXKA 4IWQA 3NYXA 4EBVA 1WBVA 2W5HA 4PF4A 4XRLA 3AXWA 3ID6C 3CQWA 1YOLA 4W4VA 4ZTQA 3SHEA 4J8MA 5AP2A 4YZ9A 4A9RA 2HYYA 3PXYA 3PDTA 5FUTA 4GH2A 5LCKA 4FZ7A 2VRXA 4HVHA 2XKFA 3VUGA 2PVMA 4KWPA 4C02A 5IQEA 2Y9QA 3BV3A 4L6QA 3VIDA 4KS7A 4Y95A 5CU0A 1JQHA 2UZUE 4C3PA 2I0EA 4E6AA 2UZEA 1P2AA 5CEPA 2Y4IC 3PSCA 5HX6A 1K2PA 3V5PA 3ORNA 4EOIA 2G2FA 5CEMA 3BEAA 4QPMA 2YZLA 3BYSA 4QMTA 1V0OA 3MVHA 5FP6A 5HI2A 4BL1A 2WMWA 4U5JA 1R1WA 2I1MA 3HUCA 4FSNA 3FL5A 3BE9A 3LQ3A 4F7NA 4V04A 2PMNX 3LCTA 3ORKA 5EDPA 2HZ0A 4PDSA 3O8TA 2R3HA 4CTBA 3V5TA 3NIEA 4XYFA 3RAHA 1YXUA 2VAGA 5IF1A 1PKGA 2VWVA 3MY1A 4EKKA 3LFSA 2QOFA 4JDJA 2C1AA 3FJQE 3QYWA 4NFMA 3O50A 3TACA 2RKUA 3G5DA 4FC0A 4X2NA 5E7RA 3BYVA 4E93A 4LUEA 4YLKA 3SXSA 2F7EE 4YMJA 2I0YA 4EOLA 4UX9A 4H05A 3SQQA 5JGDA 1H8FA 5AP7A 1REKA 4AZWA 3F2RA 1QL6A 4AW1A 3TDVA 2QKRA 2PVKA 3MFRA 3Q32A 5FG8A 1H1SA 2RG5A 5CAOA 1OBDA 2OJJA 5DRDA 4QMSA 3IKAA 2P2IA 2AC5A 2X9FA 4XX9A 2FSLX 2QOOA 2BDFA 3GI3A 5DHJA 4BYJA 3D5UA 4F08A 5EHOA 2X9EA 5ETAA 1OGUA 5KKRC 4IM3A 5KX8A 3UOJA 2NNWB 1O9UA 3DB8A 4QTEA 1UU8A 4TWOA 2W06A 4J95A 4Y5HA 2EWAA 4FX3A 4EK5A 1RDQE 3Q2MA 3QA8A 2OZAA 2VX1A 1GY3A 3KY2A 5B0XA 1YOJA 3VWAA 5JFXA 4QP3A 4FIIA 3NLBA 1PMVA 3POOA 2BR1A 2WMRA 2Z7RA 3FY0A 4EUTA 2BIYA 3NZ0A 2OJ9A 2VO0A 3MFUA 1UKIA 2YCRA 3I0OA 4HGTA 4O7TA 2XCKA 5IEYA 3I5ZA 3O51A 1PMUA 2GNJA 1OKWA 3ET7A 3CXWA 4AT4A 2FSOX 2R0UA 4C2VA 3HECA 1P14A 2XJ1A 2UZBA 3QQGA 4TYGA 3ZHPC 1NW1A 4RRVA 3GP0A 2J50A 3QX2A 3VBQA 3C0IA 4MKCA 3UPZA 4OAUC 3EN5A 3TV6A 2BKZA 5GZ8A 3E63A 2OJFE 2UVZA 4LUDA 5L6PA 3UMWA 3DJ5A 3MVJA 3JXWA 1XH9A 4CTCA 5IQDA 3WZKA 4C36A 2YIWA 2JD5A 2JGZA 2QODA 2XIXA 4UYAA 3ORTA 5T3QA 2A0CX 5EHYA 1H25A 5HEZA 3OUKA 3ELJA 3JS2A 2C30A 3H9FA 3NUNA 4I23A 4LM5A 2OU7A 3NX8A 2YCFA 4IAAA 4D0WA 5JGAA 2XMYA 4U40A 2PVNA 3RPYA 3P1AA 3TCPA 3TZMA 1XBCA 4A9YA 3CGOA 3VUIA 2PVFA 2R0IA 4J98A 4PTEA 5C4LA 2YISA 2YJSA 3QTUA 4ID7A 3D5XA 3I81A 1NA7A 3QA0A 4LOQA 4ONAA 4YSMA 4BI2A 4DN5A 3TUCA 2HZ4A 5GIOE 5FEEA 4O7WA 2IZUA 3PIZA 5CEQA 5D1JA 4QQJA 4MD7E 5L8JA 3R7EA 2UZTA 1UU9A 3IDPA 5HE1A 4FT9A 4RVKA 3PE2A 2XEYA 3P08A 5CEOA 5BVWA 2VTIA 5CTPA 4JAIA 4MYGA 4F65A 3OWPA 4UMRA 4JBPA 4CKJA 5IEXA 2DQ7X 2OJGA 5DEYA 4J52A 3Q52A 2YM4A 4RA4A 3IECA 2WIPA 4AA5A 2W1HA 1I09A 3EQRA 4FSTA 2B9HA 3DK7A 4MD8E 3AT4A 4TKSA 2YIRA 2OI4X 4LQMA 4TRLA 2F2CB 1OL1A 4EHVA 1WVWA 4UY9A 2W1EA 4RJ5A 1NVSA 2RL5A 2RIOA 4HVDA 1YWNA 2X2MA 4CFFA 3G51A 2GMXA 3BGPA 4HPTE 5CY3A 2OF4A 4I3ZA 1MQ4A 2EVAA 3TZ8A 2P3GX 2VX3A 3I7BA 4CZYB 2WQEA 4CCUA 5L8KA 3PPJA 4DC2A 4XMOA 3EYHA 5AUWA 4BGQA 5IA3A 4USDA 1TVOA 3R7IA 2XNOA 2YM5A 2C6DA 2C5NA 5ETCA 1Y6AA 2Y0AA 4NUSA 3CJFA 1YWRA 3IDCA 4FKTA 2UW9A 4TZRA 1H0WA 3ENHA 5IG1A 2IG7A 4RJ7A 5IQCA 4BFMA 4WHZA 3AMAA 2IWIA 5TE0A 3VUTA 3W2OA 4CYJA 5BVOA 2PULA 4ZY6A 3TZ7A 4BZNA 5M4FA 1FQ1B 1SMHA 4NJDA 5BVDA 5CVFA 5EYCA 4A4XA 4D9TA 2VTNA 4ZJJA 2WQOA 1UWHA 1XH6A 3BELA 3WZDA 2B0QA 4Y46A 3QGWA 4JVGA 2BIKB 5K4IA 3D2KA 2WTWA 1GOLA 3EQGA 3HRBA 4G16A 2XK9A 4KIPA 2ZDUA 1PMNA 1Z5MA 2QC6A 3E3PA 5C9CA 4BTJA 4DLJA 4O96A 1QPDA 2QR8A 2WTVA 4MXOA 1O6KA 4O0UA 4JIKA 3T8OA 3C4XA 1UNHA 5AUTA 2VU3A 4HZRA 2RFSA 1PXNA 3L9LA 4E26A 4CFMA 4A9TA 4AGCA 4A06A 4QQTA 5ETIA 1J7IA 4XP0A 4JQ8A 5M4UA 2V7OA 1WZYA 2WIHA 1IEPA 3BU6A 5D11A 4EOKA 3MFTA 1YRPA 3I1AA 3LM0A 4I5PA 5D10A 1IR3A 3K3JA 1J7LA 5L2IA 3TIZA 3KXXA 2RF9A 3QBNA 4BC6A 1KWPA 4F70A 3N9XA 5DNRA 1LEZA 2CCIA 4AN3A 4WSQA 4AXAA 1VYWA 3LZBA 3UBDA 2CKEA 2WQBA 4B8LA 4NU1A 4EWHA 2VGOA 3WF5A 3ZEPA 4ANLA 5AEPA 1PW2A 5L2TA 5HD4A 4QYEA 4HZSA 4QMNA 2OK1A 3VBTA 3NUUA 5D9HA 2C5YA 4QP1A 4YJOA 4E4XA 3QTXA 3A60A 4FUYA 4GKHA 2E9NA 5M51A 1NY3A 5KMIA 3D14A 3QUPA 3KXHA 2G2IA 4BDFA 4A4OA 4GU9A 4DEGA 5CI7A 2WKMA 3OZ6A 5DI1A 4II5A 4ACDA 3NNXA 4IADA 3W33A 4ANBA 1YWVA 3BHTA 3FI3A 5CEKA 2YZAA 3HV3A 1BI8A 3IOKA 4WOVA 3U54A 4O38A 4U9AA 1YHSA 3Q04A 3QX4A 1GIHA 3VS3A 2PUPA 3WILA 3L1SA 4DFXE 3VQUA 4TYJA 3VJNA 2YAKA 2J0MB 2OIDA 3HV4A 4Y8DA 1JOWB 1WAKA 4R3RA 2HOGA 4TY1A 5DH3A 3IW4A 3KXNA 2QLUA 3O8UA 3UNZA 5TT7A 4ANOA 4PL5A 5HIDA 4AAAA 4O0VA 3DQXA 4OTWA 3G33A 1VJYA 3DBCA 4FA2A 4QTCA 4LFIA 1GZKA 3LCOA 3Q4UA 4RLKA 3OC1A 5H2UA 3ZO2A 4BN1A 2IVUA 1R0PA 1U54A 1BLXA 3QRTA 4OW8A 3LPBA 4Z16A 4FICA 4OTIA 2CPKE 4D5HA 2J2IB 3FZPA 2H8HA 3L8PA 3GCQA 4K0YA 4OTPA 2QU5A 2HAKA 1GZ8A 3C4ZA 4L43A 4NFNA 4IC8A 1Q62A 2V7AA 4PL3A 4C2WA 4CV9A 2CKOA 2V5QA 3VBVA 3ZO1A 5JEBA 2GU8A 3BBWA 3HMMA 4I4EA 5HBEA 5KMMA 3PVWA 4FSRA 1MUOA 3EN9A 4FK6A 4EL9A 3EWHA 2UZNA 4IWPA 3C50A 4QTAA 3GU6A 3PYYA 4PQNA 3C4WA 1BX6A 4RVTA 4PL4A 3VC4A 2OSCA 2W9ZB 5M53A 3E8DA 2BRMA 3KK9A 4V0GB 2R64A 4YJUA 5L6WL 5DT0A 3CCNA 3R6XA 4JQEA 5CYIA 4DA5A 3DAKA 4FV9A 5HZNA 2ETKA 4IDTA 3VS7A 4G3GA 3Q6WA 2WTCA 5AUVA 3OMVA 4JL9A 4FNWA 4L8MA 5EFQA 4O0SA 3HDMA 2WMTA 2QLQA 4RWIA 4O0RA 4MEDA 2Q0NA 1PRYA 3E5AA 3MH3A 3PTGA 4JAJA 5EM5A 4DGGA 5CSPA 3ZM9A 3F5GA 2XK7A 2WO6A 4MWHA 2HW7A 4FEVA 5BYLA 5LVOA 5CAQA 4K33A 4RQKA 3UC3A 1ZZLA 4WA9A 2B9FA 2YM7A 1L3RE 3E3BX 4ASXA 5KO1A 4OUCA 2V62A 4UXLA 3AC8A 3DU8A 4TWCA 4UB7A 3FQEA 4FOBA 3V8SA 4EZ5A 2GHMA 3OXIA 3BU5A 5LXMA 2JKMA 2SRCA 1LR4A 4GV1A 2NRYA 4FTNA 3RTPA 4EYMA 4UMPA 4BIDA 3F3UA 3MPMA 4DF3A 3C51A 4YTHA 5IQFA 2BRGA 3V5LA 4C4JA 4XJ0A 3NGAA 4QRCA 3E7VA 2YN8A 4OTDA 4U81A 3LFFA 1GNGA 2YLFA 2ONLC 4BCFA 4P90A 4O7RA 3EZRA 3OHTA 4FIJA 2XRUA 2YCQA 3A7GA 3EQBA 4RIYB 4QMQA 2B7AA 2EXMA 5AV3A 4PWNA 3TKHA 3VRZA 5LVMA 2VTLA 4QTBA 1H00A 2Z7QA 4UMQA 5JFVA 3OVVA 3RK5A 3ZOSA 4BWKA 4IB1A 2OXYA 4D4SA 4D4YA 4AFJA 3C7QA 4ZZMA 5A3XA 4YO4A 1S9JA 2GNGA 1JPAA 1RE8A 4G9RA 1OM1A 5A4LA 3A4OX 5FBOA 2PUNA 1OZ1A 5G1XA 4WG4A 5IDPA 1M52A 3NNVA 4IH8A 4Y85A 4FG7A 5FXSA 1Q8WA 2UW8A 4S31A 5FTOA 1U4DA 5CXZA 3R7OA 3D0EA 3CD3A 3PJ2A 5CVHA 5L4QA 2QOBA 3G90X 2VN9A 2ZYBA 4XCUA 1FVTA 2VNYA 5M57A 2PUUA 2UZDA 4FI1A 4JRNA 4IAIA 3HMPA 1H0VA 1OL6A 4NH1A 4WT6A 3R7GA 2I7QA 1TQIA 2WU6A 3AD4A 4KIQA 4DEEA 2YFXA 5JQ5A 3QQKA 4C8BA 4JG8A 4S33A 4U42A 3U4UA 3QGYA 4QP2A 3ORIA 5HIBA 5E8XA 4D4VA 3W8LA 4F9BA 4KSPA 3MPAA 2WMUA 4R7IA 4GFOA 1KSWA 4Y83A 3RPRA 2XJ0A 3EZVA 5KCVA 1ZLTA 1ZMUA 3ROCA 2GPHA 2JDTA 1R78A 2PE1A 2W4KA 4R3CA 2JKKA 4NKSA 3UZPA 2OZOA 3FZTA 4J96A 4FNXA 4QTDA 3FLNC 4DGOA 3KULA 2H6DA 3DNDA 3DY7A 4K11A 3I7CA 5EKOA 3LFAA 2EXEA 3TZ9A 1ZAOA 3R1SA 3Q9YA 4JLCA 3PXFA 4LG4A 3I60A 2ZM1A 2FH9A 3E8EA 3F3TA 3HYHA 1FBNA 3KU2A 5JZNA 3ZRKA 4BGGA 1J3HA 1ZMVA 5A9UA 2VTPA 5A6OA 4BIEA 3GC9A 3Q4CA 3CGFA 4BIBA 5L2SA 5AR2A 2HW6A 4BBMA 4DT9A 1SVGA 5CSHA 5HIEA 3LJ2A 4A07A 4R78A 4LGGA 3ORMA 4IJ9A 5IU2A 3U9NA 3A8XA 3DTWA 3DK6A 2G01A 4GU6A 4K18A 3R8LA 4OBQA 3VBYA 3ZMMA 5L6OA 3JY9A 2E9VA 4BB4A 5EQPA 4NM3A 3VUMA 2BTSA 3V5JA 1MRYA 3OFMA 1H1WA 2VO7A 1W82A 4YP8A 3DFAA 4JOAA 1OKZA 2F57A 2W4OA 4HGSA 1UU3A 4C4EA 4O2ZA 5FEQA 1CKIA 5M09A 4AACA 5CZHA 3UP7A 2KULA 5LCJA 1ZYJA 3E62A 1YOMA 5B2LA 5IISA 3DKOA 3FYKX 2ERKA 4UMTA 4MQ2A 2XM9A 5BVNA 2C0OA 3ZU7A 3T9TA 4YTFA 1H01A 4F1TA 4TWPA 3W16A 4FVQA 3PUPA 4A7CA 2R4BA 3BLHA 5HX8A 4EONA 4F64A 4R5YA 3FMMA 1Q97A 4GMYA 4HGEA 2GSFA 4M8TA 3CC6A 3KVWA 3RHXA 3SA0A 2GQSA 3WYYA 2PPQA 4FTAA 5FWKK 2J5FA 4XG9A 3KMUA 3BPRA 4IZYA 5E8SA 2C0TA 3CPBA 4E4NA 3OF0A 4RIYA 1H28A 1R3CA 4GFMA 4JG7A 3UQFA 5H8EA 4FODA 5AP3A 4O86A 4BCMA 1ATPE 4H3PA 4X6RA 4EHGA 3FC1X 4NZWB 5AWMA 3WZJA 4F0IA 4O0TA 4M15A 4YZNA 4QMXA 5M4IA 2HZNA 3VBWA 4KBKA 4ZXTA 4FV7A 3I6WA 3A8WA 4MBIA 2FSMX 2JDRA 3CD8A 3QTZA 4QMWA 3ZLXA 2R3IA 5FLFA 4ZTMA 3KKVA 2X8IA 4IHPA 1B39A 4R77A 2FGIA 3BV2A 4WRSA 3GCPA 4BRXA 3RNIA 4H1MA 3FUPA 5BUJA 5F94A 3P5KA 3UGCA 3ZLSA 1WCCA 3BYMA 3QTIA 3DBQA 4JT3A 3RZFA 2LGCA 4FF8A 3LCDA 5AJQA 2XCHA 1Q3DA 1JKSA 2WGJA 1M2QA 4FEQA 1OPLA 3R9HA 1ZRZA 3O8PA 4BF2A 2J0JA 3QKMA 3PWYA 3FKNA 4AS0A 5JGBA 3WYXA 2XP2A 3JVSA 3LKMA 5HO6A 1SNXA 4QP7A 2C6EA 1CDKA 3NIZA 4NJ3A 1W7HA 2VWUA 4BDDA 4ANNA 4XLIA 1W84A 4E6DA 2PVYA 3MDYA 2O0UA 2CGWA 3FSFA 3LXPA 4ZAUA 1HCLA 2JDOA 3JVRA 4G3FA 2O5KA 4F4PA 3L8VA 1Y8GA 3LFEA 1Y91A 4F7SA 4RJ6A 3QWJA 4WD5A 5IKWA 5T68A 3H30A 4XV9A 4EOPA 4EQCA 5BX0A 2QR7A 4IDVA 3PJ1A 3FKOA 2X1NA 4CLIA 4PPAA 4MVFA 4O7LA 1KE7A 1Q61A 4YBJA 4LRJA 4AP7A 1FGKA 1P4OA 3ZFXA 3BHUA 5DFPA 4JX3A 1B38A 5BMSA 3F69A 4OBPA 4TYEA 4TL0A 3AMYA 2XNGA 2PY3A 3EOCA 4IVBA 2YJRA 3UE4A 3ZSGA 2CGXA 4BDIA 2BILB 2XYUA 3Q9XA 4QNAA 3S0OA 3ROYA 2B9JA 4F1MA 4G6NA 5CF5A 4N6YA 4NIFA 4KRCA 3LMHA 4ZOGA 3RKBA 4M14A 4UMUA 4FGRA 3UO5A 3A99A 2CKPA 5CASA 4CFUA 3ZSHA 2QO2A 4ZK5A 2YERA 3R28A 3NAYA 4QT1A 5DVRA 3RAKA 3KFAA 4XBUA 3LM5A 3WIGA 4PMMA 3UODA 3WF9A 3FDNA 3UIMA 5J9YA 4YNOA 2X2LA 2WTKC 2LAVA 3ZBXA 5AUZA 4YNEA 3VHKA 5FEDA 4FG9A 4R6VA 3TV7A 3BQCA 4G5PA 4O27B 1IA8A 4GG7A 2UVYA 3DDPA 3ZS5A 4L9IA 1BL7A 2X39A 5CWZA 1NVRA 5CEIA 1JKTA 4YZCA 4ANSA 2VWXA 4BGHA 4PX6A 4HCUA 3MVLA 3QAME 4N0SA 1IA9A 5I9YA 1NT2A 2BKKA 4XBRA 4AE9A 3NDMA 3VF8A 2QD9A 2WHBA 3G6HA 1YI4A 3TM0A 3QWKA 1UWJA 2JDSA 3WF7A 5J1VA 4DAWA 1YHVA 4CFNA 4QMZA 4YZDA 2W5AA 1PJKA 2XNMA 1OB3A 5CF6A 2R3QA 2QOQA 4RIOA 4RZVA 3ORLA 4N57A 5JFWA 3OW4A 3QD0A 4GEOA 4LOOA 4MXCA 4AOTA 4AW2A 5DG5A 3EFLA 3EQDA 4L42A 4O0YA 3NS9A 4IEBA 4OT5A 3PLAE 3PVUA 5E8TA 4C4FA 3ENMA 1WBOA 3DJ7A 4QNYA 2A19B 5IA2A 4QQ5A 4EH5A 2A1AB 3HMIA 4YC8A 4CNHA 5HVYA 4HOKA 4ZY4A 3K2LA 4EH6A 3PA5A 3EN6A 4MNEA 4D1ZA 2WFYA 4DEHA 3OTVA 1MQBA 3RHKA 4TNBA 3TNQB 4XH6A 2P4IA 5DR2A 2R3LA 4EZ3A 3FL4A 3F61A 4IZ5A 5CSWA 2QOKA 4IAFA 4L7FA 4RFZA 3HZTA 3VS5A 1XWSA 2VTMA 3DBFA 3IO7A 2FA2A 3NNWA 3OCTA 4LRKA 5DBXA 3TJCA 2PSQA 3LIJA 1F5QA 5G6VA 4FT3A 4DCEA 2BAKA 1ZMWA 3S4QA 2XYNA 5EW9A 2J4ZA 3CEKA 3GCVA 2HXQA 2XK3A 3I0QA 3OG7A 4O1OA 4I6QA 1SZMA 2BAQA 3DBEA 2XUUA 3SDJA 4C37A 5CLPA 5K3YA 2GNLA 2OIBA 2YWPA 2ERZE 4R1VA 2O64A 4NTSA 3Q5ZA 5EM6A 2PZYA 3I6UA 4MF1A 4R3PA 4W9WA 2WMVA 3EQCA 3ZXZA 2C6OA 3D5VA 5DA3A 4UWBA 4E5WA 3QKKA 2JKQA 3SVVA 3C4FA 1WVXA 4FT0A 3MIYA 4FV0A 2CNVA 2PVHA 3VW6A 2GHGA 3KXZA 2ITWA 3DA6A 3IW7A 1ZYSA 3O17A 3ZFMA 1JSTA 1PYEA 4FSZA 4BDCA 3UOLA 2RFDA 5AA8A 4D28A 4FKVA 5AM7A 4CQEA 5DIAA 4BCOA 3LFDA 5KZ0A 1HOWA 4F9WA 4NCTA 4X3FB 2R3GA 3WBLA 3R30A 3DZOA 3D9VA 4KINA 3M11A 3OWKA 3VS1A 4R7BA 1H4LA 2I40A 4G6OA 3LAUA 4I5CA 2NRUA 5CU2A 4NL0A 4RVLA 3IQ7A 4C58A 1TKIA 5LQFA 3KREA 4YLJA 3ZUVA 4D2WA 4O0WA 3TTIA 4I0RA 2E9PA 2CGVA 3P9JA 5F95A 1KV2A 5AAGA 4O7YA 3V5QA 5H8GA 3FZOA 1XHAA 3UTOA 5HICA 4XOZA 4C0TA 2J90A 4W8EA 2XIRA 4LOPA 4FIHA 5CU3A 4PDYA 5L8LA 2VWIA 5JH6A 3EL7A 3QCQA 3C13A 5EM8A 3AG9A 3FI4A 3QZFA 3TN8A 3FY2A 1UKHA 2QG7A 1DAWA 2CMWA 2C6MA 3PJCA 2OH0E 2BCJA 1SVHA 4FSWA 4M0YA 2W0JA 4IANA 4AF3A 3EQPA 4O2PA 4RJ8A 3RK9A 5GZAA 3TDWA 4U45A 3DV3A 3F5XA 3NYVA 3CR0A 3MBLA 3QF9A 5CVGA 5J9LA 3N4TA 5M4CA 4GK2A 5AV4A 1OL7A 3R0TA 4XG7A 3KEXA 4JJRA 4FV4A 5E92A 5I4NA 1LP4A 2XJ2A 5DOSA 4FIEA 3V8WA 5J7HA 5GINE 5KKRB 3MB6A 1W0XC 3KRJA 3FHRA 1U5QA 3QC4A 4H58A 1JKLA 4USEA 2WEIA 2ZM3A 1ND4A 1T45A 1M7NA 2X7GA 4J1RA 3EJ1A 4RLLA 5FRIA 3CSVA 5EW8A 4FNZA 2VTOA 2CHLA 4WNMA 4FTMA 3OBJA 3IPHA 3GENA 3GEQA 4EH3A 4DGLC 5FXRA 5A4EA 2PZIA 3UDBA 3R8ZA 3UG1A 2VWZA 5DT4A 5FM2A 4I94A 5KHWA 4GG5A 4ANMA 3V6SA 5AR8A 5HLNA 3R9NA 2JITA 4E1ZA 2R3NA 3VS0A 4DHFA 1LPUA 2C69A 3E92A 4I22A 3RI1A 5I9VA 4C4IA 4CQGA 3NPCA 4DG2E 2JBPA 2QOLA 1P4FA 4LL0A 4RC3A 2QCSA 2QHMA 3L9MA 2ZMDA 3P7BA 4I6BA 4C33A 4PP7A 5HU3A 4UEUA 5L2WA 1PF8A 2C3IB 4YJRA 4EH4A 1OIUA 1PXPA 3HA6A 3HL7A 5HLPA 5FTGA 4CG9A 5K9IA 3TNIA 1TQMA 4K9YA 1A06A 4P7EA 4RC4A 4X2JA 3UPXA 3OD6X 4M7IA 4YJSA 4KB8A 2PZ5A 2F7ZE 1X8BA 3O7LD 5ANEA 3RPSA 3L8SA 4TYHB 3S00A 2O3PA 2B54A 2WOUA 4OTGA 5D7AA 4F9YA 3B8RA 5HNBA 4ANQA 1UNLA 4BCIA 3ATTA 4RX5A 2OFUA 3R1NA 5H9BA 2AUHA 2QU6A 2HWPA 3UZTA 1CTPE 2ZV9A 5ANIA 4BDBA 4D2SA 1UV5A 3QU0A 4FZFB 4MK0A 3QTRA 5HTIA 3VULA 4KD1A 2BMCA 3DLSA 3AOXA 3CE3A 4CMUA 1VYZA 2HCKA 2VTTA 3V3VA 5ANDA 5CXHA 5I3OA 3LMGA 2X6DA 1KE9A 3OWLA 5BVEA 3U9CA 4FKIA 4E6QA 4FKGA 5JMSA 4RSSA 4ERKA 2B9IA 2BAJA 3F66A 4IW0A 3WE8A 4M66A 4DH5A 4YJVA 2YIYA 3R02A 4X3FA 3U51A 3RAIA 4JDKA 4AE6A 4YUQA 4YGAA 3W2RA 2YM8A 4X3JA 3W10A 4FKWA 5CNNA 3ZC6A 3FE3A 3KRWA 3R7UA 2R9SA 4LMNA 4BDKA 3L9PA 5AUYA 3VUKA 3R1YA 2YDKA 5IH5A 5AV2A 4GJ3A 4BHNA 3RCJA 4YPDA 5AUXA 4CT1A 3HAMA 4BHZA 4CEGA 4CKIA 4YU2A 4GFGA 1ZWSA 1PXMA 2R3RA 4RBLA 3W2CA 4I6FA 3Q2JA 4EWQA 5I5ZA 1WFCA 2HY0A 4OTRA 4E7WA 3QTSA 3LXLA 2X0GA 3GGFA 4FOCA 3U6JA 3AC5A 3CY3A 1Q8YA 1YXXA 4B8MA 3F2NA 5EOLA 4AZTA 2B4SB 3SW7A 2W9FB 3ZUUA 3ATSA 4QP4A 4FBXA 5FP5A 1DS5A 4M67A 2JAVA 4XLVA 1GAGA 4JG6A 5JN2A 3VHEA 4L7SA 3GXLA 5AR4A 3QRUA 3W2SA 2PL0A 4E4MA 4HNIA 3RWQA 3ZEWA 3V04A 1YI3A 4JNWA 4RIXB 3V8TA 4ALVA 2OLCA 4W4XA 4D2PA 4OTFA 2R2PA 4OAVB 3G2FA 2GCDA 4K77A 4YJTA 3UP2A 2JFMA 4QMMA 4Y73A 3ZC5A 1H26A 4KKGA 2BDWA 1FINA 3QL8A 3I5NA 4FSMA 4H1JA 3ZUTA 5AM6A 5TF9A 1IAJA 4GT4A 3FLYA 3FWQA 2ZOQA 3E87A 3MH2A 2BHHA 2BALA 4Q5EA 4IB3A 4NW6A 4I41A 4CZTA 4E8AA 2OJIA 3UQCA 1JVPP 4BZOA 3HDNA 3LFBA 1OUYA 4I6HA 3TG1A 3HKOA 2PUIA 1MRVA 3REPA 3NRMA 2YA9A 3CQEA 3EMGA 3R73A 3QTQA 3RM6A 5DYJA 3V51A 4OBOA 3NAXA 4O84A 3MGYA 2F7XE 4CLJA 3BCEA 5KE0A 2W05A 2XS0A 4ZSJA 3Q53A 4O81A 1Q41A 3VUDA 1DI8A 5CT7A 1GZNA 4C59A 2X81A 1YXSA 4IXPA 4O83A 3UOHA 2QVSE 3E8CA 2IVSA 4H36A 3PY3A 1CSNA 4XP3A 4YJQA 4AZFA 5CANA 3E93A 2WTJA 4TYHA 1WVYA 4AT3A 2GQGA 4YURA 5LMKA 2PU8A 3F7WA 1PXOA 5CX9A 1JKKA 3HUBA 4AG8A 1IG1A 1ZYLA 4NM7A 4GW8A 1YVJA 1JSUA 3GB2A 3A7HA 4IX6A 1FVRA 4ORKA 5EYMA 5J87A 2RFEA 3C4CA 5F20A 3VS4A 4D2TA 4JBOA 1H08A 3ULIA 1RJBA 3ETAA 4FEUA 2V55A 1R0EA 4HGLA 5AP0A 1V0PA 4YTCA 3UOKA 3OUNB 2ZV2A 1UVRA 3D7ZA 1V0BA 4U41A 4IAKA 5F4NA 4FZAB 3ZFYA 3UO4A 3LLAA 3FBVA 4C3RA 1XBAA 4GIIA 2CN8A 5LWMA 2GFSA 3UO6A 3MY5A 3QFVA 3JY0A 4FV1A 5TO8A 5FDPA 1JWHA 3UNKA 3HLLA 2VTHA 4JBQA 3C5UA 3CP9A 2XK8A 4RX9A 3B2TA 4S2ZA 4WNPA 4BCGA 3U4WA 2VTAA 1Q8TA 3QUDA 4B99A 4C3FA 3UZRA 4N6ZA 4CCBA 3DZQA 1YXTA 4QYGA 1CM8A 3U87A 4ZSAA 4HYSA 3R71A 3FYJX 2R3MA 4QPSA 4HCTA 5HVKA 3S2PA 4F9CA 3KC3A 5KBQA 1O6LA 4L44A 4YLLA 4FEWA 3BRBA 5JKGA 5EH0A 5CAVA 2WD1A 5IDNA 5E90A 1G5SA 2B52A 3BHHA 5E8WA 3FI2A 3VF9A 4X7QA 3JR1A 2OKRA 2XKCA 2ZV8A 4R7HA 4ZIMA 2EB3A 4ZLYA 3CTHA 4RZWA 1J91A 1Y57A 3QD3A 3SOCA 3D5WA 3FZRA 3C4EA 3TNPC 5L2QA 3RJCA 4CFXA 1XJDA 4DEDA 4EHEA 4YHJA 4JR7A 5J5SA 1IASA 2WELA 3DPKA 3NUPA 4K6ZA 5GZ9A 2ITUA 2A4LA 5B2MA 3VVHA 1FVVA 2AYPA 3T9IA 4FG8A 3ZZWA 4WBBB 1UA2A 2YITA 3R2BA 4BWPA 5EOBA 5CALA 3EKNA 3QYZA 2P2HA 1H24A 3G9NA 2GHLA 5J9ZA 3N4VA 4HVGA 4WO5A 2RGPA 3D7TB 4GRBA 4C61A 4PP9A 2VX0A 4UN0C 3UMXA 4FV8A 3HMNA 3FZ1A 4RIXA 5M44A 4DCAA 5B2KA 3VNTA 5EQYA 5AIKA 5K5NA 2WPAA 5AUUA 4IB0A 3GU4A 5AFVA 1ZARA 2W4JA 4FTKA 4EOQA 1UU7A 3GU7A 4BDGA 1ZOHA 3H0YA 4X21A 4FL3A 4ZTNA 3VAPA 4L68A 5E9EA 4UWYA 3PP1A 4ACHA 4EORA 4AQCA 4QP8A 4D1XA 2J7TA 3DLZA 3PZEA 2W99B 3GU5A 4Q2AA 4ACGA 4GJ2A 3FSKA 1WBSA 5DRBA 4O82A 4GVJA 4EK8A 2Q83A 3GQLA 3PY0A 4FKJA 1WBTA 2O2UA 3FMJA 4HYIA 4D9UA 2PK9A 2X8EA 3EFJA 3HAVA 3IW6A 1R39A 4G6LA 4U3ZA 4U7ZA 5AR3A 3NWWA 5TOZA 2FYSA 4FK3A 5AA9A 1GZOA 5IPJA 5EW3A 3CPCA 3PJ8A 3MYGA 3QCSA 1KUTA 2J5EA 4RX8A 2IZTA 4ALUA 1Y6BA 4JBVA 5BQ0A 4P4CA 2GNIA 2A27A 2QOIA 5HKMA 5LMBA 4FIGA 2EU9A 4D1SA 4GSBA 5DR9A 3IGGA 1F0QA 4IM0A 3PSBA 2WMXA 4NTTA 4B6LA 4G31A 4JS8A 4XG2A 2E9UA 3VS2A 4YTIA 4DINA 1REJA 5C1QB 3PY1A 4V05A 2YIXA 3ACKA 3KQ7A 1U5RA 2PTKA 3K5UA 2BRNA 4V0GA 3KMWA 3LJ1A 4GUBA 4B9DA 5CQUA 2UW3A 4DH1A 3TJDA 4XRJA 5HVJA 3CJGA 2C6KA 2JIVA 2REIA 4ZSLA 3CKXA 3P78A 4O21A 4O7VA 4UZHA 3OTUA 3FMDA 2QURA 5EM7A 4Z55A 1OBGA 5B7VA 5IMXA 5H3QA 2EUFB 5ACBC 5DEWA 3UVPA 3B8QA 2DYLA 4ENXA 4QMYA 2GS2A 4JDIA 2XIZA 4KSQA 2VGPA 2W1GA 5C4KA 4BI1A 4GS6A 1G3NA 4MH7A 1XH5A 2Z8CA 3F88A 4M0ZA 4DBNA 4I0SA 3KRXA 4U79A 2W1DA 4BCKA 3H3CA 4KAOA 4FYOA 4BKZA 1OIQA 4L00A 2BZJA 3T3VA 5J95A 5AP4A 2X8DA 3GU8A 3P0MA 3VRYA 2Z7SA 3AD5A 2ZVAA 4EOSA 1Z9XA 3NCZA 4A4LA 5DE2A 5HBJA 3QHRA 4DFBA 1Q4LA 3V01A 4Q9ZA 3MIAA 2OXDA 3FMEA 5IZFA 3OOMA 3OXZA 4L67A 3E7OA 2C5XA 4O6EA 2PZPA 4NT4A 4M69B 5T6KA 4HVSA 2X4FA 4FV5A 4AT5A 5E91A 4F7JA 1SNUA 1EH4A 4TNDA 5KZIA 3BKBA 3FKLA 4RG0A 3HV5A 4BBEA 4XG3A 3HP2A 3W8QA 4FTOA 1VZOA 1Q5KA 2BDJA 2PVRA 1WBWA 2WQNA 3BHYA 4FKRA 1K3AA 3G0FA 4GT3A 5KUPA 1P5EA 4IAYA 4KKEA 2XIYA 4CYIA 5HTCA 2PE0A 3D2IA 2JLDA 5JK3A 3SG8A 3AC3A 5EI8A 1U46A 3BGZA 1KOBA 2WB8A 4OT6A 3LQ8A 2C47A 2WTDA 4RPVA 3TKIA 3DS6A 4EJNA 3AD6A 5IUIA 3TV4A 3U6HA 1PHKA 2XBJA 3SRVB 4J53A 4MBJA 2PWLA 2DUVA 4KRDA 5BNJA 3LJ0A 3PXKA 5EK7A 4BVUA 3TUDA 4G17A 4XOYA 4J71A 5F1ZA 4K8AA 4PV0A 5I0BA 3UVRA 3KGAA 5LVNA 2F2UA 3TUBA 3E64A 3MB7A 3PZHA 1OPKA 5CF8A 3DNEA 4RWKA 2GS6A 2W1FA 5ETFA 5K5XA 5AP6A 2WEVA 3TEIA 3QQHA 5C8KA 3M42A 4BY9E 4C57A 3R04A 4FKSA 4EK4A 3RWPA 5A6NA 5J1WA 5I3RA 4G1WA 4GK4A 2F9GA 3ANQA 4J99A 2IW9A 3DTCA 5H8BA 4NCTC 4F6WA 4EOMA 5A4TA 4PMTA 3NYNA 4JRVA 4CMTA 4YC3A 5DWRA 1FPUA 1YQJA 3LW0A 3NUSA 4GK3A 2JKOA 4GUEA 4K2RA 4GCJA 3TWJA 2WQMA 5IA5A 4DLIA 3Q6UA 3TL8A 3BQRA 4D5KA 2ETMA 4QOXA 2YACA 2ZJWA 1OIRA 4RWJA 4W4YA 4DTBA 4CRSA 2CJMA 3PVGA 4HJOA 3VN9A 4FT7A 4DITA 3WZEA 5L3AA 1G8SA 5HG8A 4IVDA 4KBAA 3FQSA 3TNHA 2HXLA 5CI6A 5HO7A 4FNYA 3I79A 3OCSA 3P7AA 4MX9A 4MXXA 5HNGA 3P7CA 5DT3A 3NEWA 3PVBA 3FMHA 4HPUE 3FLZA 1ZXEA 3E88A 4YC6A 5EG3A 2R3OA 2JC6A 4FGBA 3OXTA 1JSVA 3GFWA 3L8XA 3MVMA 2QO7A 4WIHA 4FR4A 3UIXA 2YEXA 3IOPA 1FGIA 5IQAA 4JXFA 3NUXA 4BZDA 2ACXA 3LLTA 1OL2A 2Y4PA 3A2CA 3TNWA 3PE1A 3WF6A 5FD2A 3H9OA 3DQWA 3QQJA 4IAZA 1M7QA 4J97A 2XIKA 4TXCA 5C27A 4DEBA 5HU9A 3EQIA 3MJ1A 4ZY5A 4BCQA 4AZSA 4BCPA 4CFWA 2WXVA 2XRWA 3DAJA 3LHJA 3MH0A 5EI2A 4MQ1A 4LMUA 5I9WA 5A14A 1XQZA 3MJ2A 1PXLA 2YHVA 4FVPA 5JZJA 1QCFA 4O1PA 4A9UA 5BUEA 3COKA 5FBNC 3QZIA 3A4PA 3M2WA 2BPMA 5HE0A 2X7FA 4CT2A 4WNOA 2ETRA 3KRRA 4FEXA 2CLXA 4BI0A 3WE4A 1J1CA 5I9UA 1MP8A 2CCHA 2XKEA 2J9MA 5LOHA 2B55A 3RM7A 4FV6A 4FE2A 3A7IA 4ACMA 4APCA 3MTLA 2O8YA 4O7ZA 4USFA 2R3KA 4MBLA 4DFNA 2ITPA 4B7TA 3IW5A 4F9AA 3JPVA 3K3IA 4E6CA 4FKOA 2C3KA 4YSJA 3KF4A 2WNTA 3F6XA 4I4FA 4L53A 4L3PA 2CDZA 5ANJA 4PUZA 4KA3A 4LV5A 3UYTA 5M06A 3SV0A 2VD5A 5AR5A 4CKRA 3BIZA 1CMKE 2WTKB 4FSQA 4PY1A 4S30A 4WG3A 2YM6A 1QPCA 4TN6A 4CRLA 3U6IA 3QXPA 4EYJA 2VNWA 4EI4A 4Z3VA 3SRVA 3EFWA 2XEZA 4RFMA 1SM2A 3O7LB 4HCVA 4OTQA 4U3YA 5HLWA 3AMBA 4IE9A 3OY3A 4Q5HA 3BGQA 1A9UA 4CMOA 3FHIA 2YWVA 3G9LX 3RAWA 2ITYA 4XEYA 5ICPA 1NVQA 5ANKA 4DT8A 3QUEA 1WBNA 3THBA 4FTTA 1XH7A 4W4WA 5DPVA 4AUAA 1VR2A 2BUJA 4NYEA 3FXZA 3UYSA 3PG1A 1OMWA 4P2KA 5KNJA 4QMLA 2HELA 2OIQA 3KVXA 1ZY4A 5BVKA 3V5WA 4MNFA 3UC4A 2V22A 4PTCA 5CENA 5KHXA 4C62A 4GIHA 2ZV7A 3QQUA 4FL2A 4X3FC 4ZTSA 2E2BA 3CBLA 3OWJA 4RJ4A 5I9ZA 5AIRA 5IUHA 3OEFX 3QQLA 2YAAA 3MS9A 3MFSA 3HEGA 4RX7A 5DR6A 5AX9A 3IGOA 3Q96A 2FUMA 3R01A 2R7BA 2HZIA 3TTJA 2JAMA 4MAOA 4L3JA 4QMPA 4CFVA 1W8CA 3OW3A 3C1XA 4YHTA 1J7UA 5IH4A 3DKGA 3LFCA 3R83A 1E9HA 3EB0A 4IX4A 5HQ0A 5IQHA 2VV9A 3G0EA 4ZMFA 2ITNA 2Y4IB 4N4SA 3FMNA 2GNHA 5ANGA 5EDRA 4M97A 4XNEA 1K9AA 2XNBA 3PPZA 3D94A 2GDOA 3W32A 2UVXA 3QLGA 5M55A 3U8WA 3EYGA 1ZY5A 3H9RA 3OY1A 2OW3A 3IG7A 4EC9A 2FVDA 1FMKA 4D2VA 4ZTLA 3FPMA 2XKDA 5EKNA 1PXJA 4LGHA 2BVAA 2XNEA 3V6RA 3QCYA 4ZJVA 2IJMA 2UZVA 3QRKA 4CD0A 2JDVA 4FTQA 3ZYAA 4CXAA 3GOPA 4YZMA 5ITAA 1APME 1AGWA 4L52A 2UZLA 5KMKA 2UUEA 3BLRA 4F63A 1FOTA 2OFVA 4EC8A 3FMKA 4IX3A 5HG7A 3A7JA 5CT0A 2FB8A 2PVJA 4LL5A 4DFUA 3RPOA 4EOOA 4P5ZA 4X2FA 5JRQA 3VW8A 4FTLA 4G3CA 5JFSA 4AOIA 3F7ZA 2ITTA 4TT7A 3FXWA 4O7NA 5HE2A 3KCKA 3MW1A 4DE4A 3F9NA 4L3LA 2QG5A 3F2AA 4D58A 1W83A 4U8ZA 5CAUA 4I20A 2QHNA 4X2GA 4F6SA 3GOKA 2BRHA 3E8NA 5BYZA 2W5BA 3HV7A 4FVRA 3BE2A 4BWXA 4U0IA 2X6EA 4EK6A 5CS6A 3SD0A 4MTAA 2C1BA 3O0GA 4ZLZA 5KMLA 4BCJA 1ZYCA 1OUKA 1AQ1A 3MN3A 3QRJA 4IVAA 3C0HA 3KCFA 3C0GA 5AV0A 4DFZE 4FTRA 4FYNA 3ZH8A 3BHVA 3W1FA 4XV3A 4PPCA 3NR9A 3P4KA 3KMMA 2EXCX 4H39A 3SW4A 5J79A 2BFYA 3GBZA 4U97A 2RSVA 3VS6A 5LMKC 4DEAA 5I9XA 4RC2A 3OBGA 4JIAA 2UW6A 3FEGA 5C26A 4FIFA 3ZO4A 4APPA 3L9NA 2QKWB 4DEIA 4M12A 5J8IA 3UJGA 1G8AA 3FXXA 1ZZ2A 4DH3A 4EEVA 2Y6OA 4UBAA 2EB2A 5GJDA 5IUGA 1BYGA 2E9OA 4PDPA 5IQGA 3F82A 4AZEA 3SOAA 2VTQA 3ZBFA 2VWBA 4QMUA 5BUIA 3P23A 4L45A 3SC1A 3POZA 3MSSA 4NKAA 2C6LA 5HTBA 2RG6A 4GVAA 4AWIA 4LYNA 1PXKA 4O22A 3LFQA 1PYXA 4K1BA 3N4UA 2GQRA 4RA5A 3HX4A 2C5OA 3KN5A 4TWNA 1U54B 1A48A 3IONA 4OLIA 4QP9A 5GHVA 2XK4A 4ERWA 3QC9A 4GKIA 5M08A 5IQIA 2J0KA 3BYOA 4EBWA 3CY2A 4ITIA 3BWFA 3H0ZA 3P79A 3RP9A 4CSVA 5HNIX 3DXNA 4IX5A 3W2QA 1ERKA 4NM0A 4M3QA 5EDQA 2ZB1A 4RQVA 2DWBA 2WMSA 3MI9A 5GJGA 4G9CA 2W17A 3R1QA 3FI8A 3SGCA 3KK8A 4F7LA 5E8VA 2XK6A 3CIKA 5GNKA 3OS3A 4QMOA 4G34A 2WMAA 5JQ8A 3CS9A 3HRFA 4IZAA 2FSTX 3A61A 2XNPA 1WMKA 4BTKA 2NPQA 5HO8A 3AC4A 3OEZA 4DFLA 4W9XA 5D41A 3MWUA 4YBKA 2A2AA 3NMUF 4JQ7A 2I6LA 3ZM4A 4NK9A 1OL5A 4FV2A 4AGDA 3HGKA 5CAPA 3QALE 3WI6A 3F3WA 4Z7GA 2I0VA 5ANOA 3BBTB 4AGUA 3WF8A 3ULZA 2G2HA 3VQHA 1JNKA 4KUJA 2OWBA 4GT5A 4DG3E 4IACA 5IA1A 4RMZA 2GTMA 1AD5A 3ZRMA 2R5TA 3PLSA 4IB5A 3RVGA 4ITHA 2G9XA 2GS7A 2O65A 4O91A 3ZDIA 2CSNA 4UXQA 2VO3A 2PMOX 2CKQA 3RZBA 2OBJA 4F1OA 4E73A 1YDRE 3VO3A 1GIIA 3ZONA 1YKRA 2C4GA 3DAEA 3VUHA 1URCA 3EKKA 3T3UA 1BKXA 1GJOA 4IBMA 4IFGA 4MWIA 5JSMA 1LUFA 1I44A 2VWWA 3EN7A 5HHWA 5K0KA 4WSYA 4ZMEA 2G15A 4R5SA 4EH2A 3D4QA 4F6UA 2Z2WA 4R8QA 3GUBA 3QHWA 3MTFA 1DI9A 3DK3A 3FZSA 2VUWA 3LQ5A 3ORXA 4JDHA 3UIBA 3G15A 1PY5A 4LI5A 5TR6A 3AT3A 2P0CA 1KE5A 2ITZA 3FPQA 3AQVA 1LEWA 4TW9A 4ZP5A 4XUFA 4V01A 1H27A 3M1SA 3NYOA 3PXZA 4DGNA 1Q24A 4EK3A 2W1CA 3LXNA 3ZO3A 2CLQA 2UW5A 4AW0A 1ZYDA 5J7BA 3C9WA 4AX8A 5AP1A 3QXOA 4E3CA 5FXQA 3A7FA 1SYKA 3LCSA 4MXZA 4E5BA 1KE6A 4WRGA 4FTUA 3BU3A 4NW5A 1DAYA 4UALA 4IFCA 4H3QA 4AW5A 4AN9A 4HW7A 2Z02A 4XHKB 3DJ6A 5JRSA 4LGDA 2ITXA 3PSDA 4FL1A 3OP5A 4O7SA 5A4QA 4IWDA 4ZJIA 3SXFA 3OOGA 3PFQA 3UG2A 4EQMA 4GL9A 1XH8A 4FTIA 4ZSGA 4E20A 3C5IA 4Y5QA 1XO2B 3KF7A 1URWA 3R8PA 3BEGA 2QNJA 3RBWA 3BLQA 2IW6A 3DB6A 5A54A 1U59A 1PKDA 4ZEGA 3NW5A 5C03A 2R3PA 5IEVA 1KE8A 2IVTA 1BI7A 3NUYA 5FGKA 4PTGA 4KNBA 4TYIA 1UNGA 2XVDA 3DFCB 3Q4TA 2VTRA 1CKJA 3FLWA 3K54A 5AX3A 3ZTXA 2YDIA 3QCXA 4PPBA 4BDEA 2CNUA 5CZIA 4QYYA 5CSVA 4U43A 3DKCA 4ALWA 5LVLA 3HV6A 2Y8OA 3QZHA 3PIYA 4KKHA 5C8MA 2J51A 3RINA 4XV2A 2H9VA 3Q3BA 1M14A 4EQUA 3I4BA 4UV0A 3RCDA 4ITJA 4ZTHA 1SVEA 4BICA 3NCGA 4YJPA 3R8UA 4O6LA 1QMZA 4ENYA 3RALA 5LMAA 3HVCA 2XF0A 3JUHA 4RIWB 5CSXA 4I5MA 3BZ3A 2NO3A 2CN5A 3KULB 4CV8A 3R9DA 2ESMA 2OO8X 5AAEA 2YM3A 2J0IA 4QD6A 3Q60A 4EH9A 2XM8A 2DS1A 5IA4A 1M17A 4XV1A 4IJPA 3H4JA 5E1EA 2BZIB 4BCNA 5HCZA 5A46A 5IA0A 3GC0A 4FT5A 5K0XA 3COMA 2R3JA 5EYKA 2C6TA 4LV8A 4X6QC 3RNYA 5ACKA 4DH8A 3QZGA 4AA4A 4D55A 3NNUA 4ZS4A 2ZM4A 5HG9A 2C0IA 5CF4A 3BYUA 1QPEA 3PA4A 4U44A 3SX9A 4YO6A 3GC7A 1MRUA 1L8TA 5GIPE 1H1RA 5E8YA 2QO9A 3ERKA 5HGIA 2VTSA 3IDBA 2UW7A 4BKJA 4O0XA 5J5TA 3Q9WA 3BWJA 3CTJA 3GC8A 2VTJA 5TKDA 3SAYA 4UYNA 4OGRA 4PDOA 1V1KA 2H96A 1H1PA 4EUUA 4NSTA 2PE2A 4FKPA 4ARKA 2WTIA 3FLQA 4XG4A 4RVMA 3COHA 1WBPA 3R00A 1OECA 4MXAA 2HENA 4IWOA 5DN3A 4M84A 4D2RA 3VJOA 4DTAA 5HBHA 4TTHB 4MCVA 4CG8A 2UV2A 5LVPA 3R22A 3GCSA 3PA3A 5CNOA 3HP5A 3W55A 2QI8A 2RFNA 3MH1A 5E1SA 1HCKA 5AMNA 4N70A 4CGAA 4YJNA 4WBOA 3P86A 3TT0A 2ITVA 3UQGA 4G2FA 3MA3A 5FQDC 3EH9A 5BYYA 2JEDA 2O63A 4IZ7A 5LWNA 3OCGA 4L01A 3WZUA 4QO9A 2IW8A 1E1XA 4AGWA 4J8NA 5FTQA 3FMLA 2IPXA 1JLUE 2WMBA 1BL6A 1YW2A 3SLSA 4ASEA 5HOAA 5IQBA 3Q5IA 2PZRA 5GJFA 1E1VA 4BTFA 4QYHA 3GFEA 3LOKA 4CZUA 1RQQA 2PVLA 3MY0A 2JIUA 2R3FA 1B6CB 2GFCA 3EIDA 2BTRA 4C7TA 3DXQA 5LARA 2ZDTA 1J1BA 3EQHA 2QOHA 3PXRA 4YR8A 4BYIA 2WOTA 4ZZNA 4WNKA 4BDHA 3RGFA 1NXKA 5EI6A 3NVKI 4U6RA 3QRIA 3GQIA 5JT2A 4BTMA 3II5A 3HRCA 3IK3A 3QTWA 3DT1A 3PXQA 4JI9A 3CLYA 3ZLYA 4BDJA 5HCXA 4ACCA 4FKUA 4RJ3A 1OKVA 4S34A 3UVQA 4NEUA 3DXPA 2P55A 5AV1A 3ZXTA 4C38A 4AA0A 2OH4A 4DH7A 4JR3A 5HE3A 4PRJA 3R9OA 4EJ7A 4LRMA 4IMYA 1F3MC 2ZB0A 3RPVA 4G5JA 2P33A 5KMOA 3TKUA 2ZMCA 4C4HA 2IZSA 4FKQA 2YABA 5A4CA 3F3VA 4X0MA 4M13A 4WUNA 4YHFA 3DOGA 2V0DA 2XNNA 2VWYA 1BMKA 3KRLA 4ASDA 5IMEA 4XG6A 4JX7A 2ZAZA 1RW8A 3W18A 3AC1A 1PXIA 4RGJA 3ODYX 2YDJA 5E4HA 4HNFA 5EHLA 3OROA 4Q9SA 3FAAA 4NM5A 3O71A 2H34A 3D15A 4NWMA 2C6IA 4RIWA 4C35A 4GYIA 3F5PA 4RWLA 4ZS0A 1YHWA 2G1TA 2WMQA 4OTHA 4UZDA 3W2PA 2HWOA 3WARA 5D7VA
chains in the Genus database with same CATH superfamily
4DFYA 1YDTE 5KMNA 4DDGA 3H10A 5KMJA 2W1ZA 3AGLA 4KABA 3PJ3A 4BDAA 4WUAA 5AADA 3GT8A 4MF0A 4F0FA 2IZRA 3KN6A 4XG8A 3ORZA 2B53A 4MHAA 1O6YA 1Z57A 4CVAA 3DBDA 3NSZA 4GYGA 3EFKA 2ITQA 3DGKA 1OVEA 2HK5A 3LFNA 2IF8A 4FZDB 3EN4A 3FQHA 3DCVA 3MA6A 4NIFB 1PMEA 3HA8A 3MPTA 1M2RA 2OXXA 4FSYA 3VBXA 3ZSIA 3FV8A 2YIQA 3IS5A 4B4LA 4FMQA 2I0HA 5DGZA 4BR3A 3S95A 4AFEA 3ANRA 3F5UA 3O2MA 2JIIA 4FSUA 3BLAA 3QLFA 3CKWA 5BPYA 3BI6A 1DM2A 1Q8UA 3R2YA 2W96B 4KIKB 4KIOA 3O23A 2YLEA 3QD4A 1Q99A 1Q3WA 5HD7A 3ZZEA 5KBRA 4AU8A 4QP6A 2BHEA 2OICA 3PP0A 3IW8A 4FRFA 3ITZA 4WKQA 2AC3A 2XB7A 4Y72A 5D12A 5AR7A 2X4ZA 5IH6A 3LVPA 4IQ6A 3MESA 3R9RA 2QQ7A 2BZKB 3AT2A 3O96A 4MXYA 3TIYA 4QMVA 3D7TA 2UZOA 1QPJA 2KTYA 3ACJA 3K5VA 4HYHA 4Z9LA 1OIYA 4IVCA 5F9EA 2IO6A 1XBBA 2BZHB 4FUXA 4X2KA 5C01A 4IIRA 2J6MA 3NVMB 3R7VA 3KB7A 1TQPA 3ALOA 3EL8A 3Q4ZA 2W1IA 4DBXA 2VZ6A 2Z7LA 4J7BA 4ZSEA 3D83A 3R7YA 4PMPA 2HY81 1OKYA 2PHKA 2YCSA 3GNIB 3SKCA 4ZTRA 3PRIA 1XR1A 4BKYA 4C34A 4DYMA 3GCUA 3RMFA 3QQFA 4G3DA 3NUAA 2CGUA 2W7XA 2ONLA 3HMOA 4A9SA 4F99A 2JBOA 2QONA 1CKPA 3WOWA 4MNEB 4DTKA 2Y6MA 4BBFA 5HESA 4XP2A 4DG0E 1VEBA 1T46A 4FTJA 3U55A 3CQUA 4M68A 4YPSA 3HNGA 4AOJA 2XARA 4AQKA 3SXRA 1KOAA 4EH8A 3S3IA 4QPAA 3PIXA 4WG5A 4RFYA 4Z7HA 5E8UA 2XH5A 3B2WA 4MD9E 3KIOC 2PMIA 5EQEA 3JYAA 1Q8ZA 3CTQA 4IC7A 3FLSA 4W8DA 5HCYA 4EH7A 2Y7JA 3EHAA 5K4JA 4ZLOA 2OF2A 3COIA 4I93A 4DGMA 1JAMA 1OITA 3UIUA 5M56A 4E4LA 1H07A 2C5VA 4C4GA 1XKKA 4I1ZA 3PPKA 3G6GA 1S9IA 3N51A 4H3BA 3Q9ZA 2Z60A 4PNIA 4I24A 5EYDA 4L46A 3AGMA 2JFLA 1FMOE 2XBAA 3ALNA 5E8ZA 2C68A 2UZWE 1ZOEA 3EQFA 3MV5A 4AN2A 1M2PA 3R63A 3R8VA 2C3JA 3ORPA 3LMIA 4E5AX 2C3LA 3S1HA 5HORA 5FM3A 3TXOA 3LCKA 2PYWA 1W98A 2BFXA 1KV1A 3PRFA 1BUHA 4U80A 3DDQA 2NP8A 4QDVA 2VO6A 3R21A 5AAFA 3R8MA 1YDSE 2BROA 3GVUA 4TPTA 4D4RA 4G3EA 4FV3A 3KA0A 3ZLWA 3SG9A 5CU4A 4ASZA 2OGVA 2UW4A 1ZOGA 2PMLX 4XS2A 5DLSA 4D0XA 3NW6A 1GIJA 3BL9A 2F4JA 2QOCA 3KXGA 3LE6A 2CNQA 3NW7A 3AC2A 4PNKA 3BX5A 4I21A 3OT8A 2IVVA 3KXMA 1YXVA 4F09A 2OZAB 3A62A 1W2FA 4KS8A 5FDXA 3FC2A 4QYFA 3QKLA 2BRBA 3F3ZA 2HIWA 1JBPE 1STCE 4S32A 3QD2B 2GNFA 4EOJA 4QQCA 4P5QA 5BVFA 3ZRLA 4FKLA 2F49A 5DMZA 5M07A 2ITOA 4I0TA 2IN6A 3PG3A 3ZCLA 3DKFA 4RT7A 4HYUA 5AP5A 1IRKA 3ODZX 1H1QA 1YI6A 4FTCA 4PMSA 4UWCA 5CU6A 2WU7A 4IM2A 4KBCA 4KIKA 4M69A 4ZZOA 4EZ7A 1XH4A 2UW0A 2X2KA 1OPJA 5C8NA 1OI9A 3OCBA 3TI1A 4EHZA 2R7IA 2XA4A 4I92A 5HG5A 4HVIA 4OR5A 2J0LA 2WAJA 3KL8A 3RK7A 2GTNA 4BCHA 2WZJA 3WIKA 4AZVA 2FO0A 4YZBA 2X7OA 4B0GA 1IAHA 4FZ6A 1Y8YA 4F0GA 4R1YA 2XZSA 5BMMA 3PWDA 2Q0BA 2B1PA 2OG8A 5LJJA 3OT3A 5CQWA 2X0OA 4BJJB 3ZDUA 4I5HA 4EKLA 3UDSA 3UNJA 3LXKA 4IWQA 3NYXA 4EBVA 1WBVA 2W5HA 4PF4A 4XRLA 3AXWA 3ID6C 3CQWA 1YOLA 4W4VA 4ZTQA 4DHZA 3SHEA 4J8MA 5AP2A 4YZ9A 4A9RA 2HYYA 3PXYA 3PDTA 5FUTA 4GH2A 5LCKA 4FZ7A 2VRXA 4HVHA 2XKFA 3VUGA 2PVMA 4KWPA 4C02A 5IQEA 2Y9QA 3BV3A 4L6QA 3VIDA 4KS7A 4Y95A 5CU0A 1JQHA 2UZUE 4C3PA 2I0EA 4E6AA 2UZEA 1P2AA 5CEPA 2Y4IC 3PSCA 5HX6A 1K2PA 3V5PA 3ORNA 4EOIA 2G2FA 5CEMA 3BEAA 4QPMA 2YZLA 3BYSA 4QMTA 1V0OA 3MVHA 5FP6A 5HI2A 4BL1A 2WMWA 4U5JA 1R1WA 2I1MA 3HUCA 4FSNA 3FL5A 3BE9A 3LQ3A 4F7NA 4V04A 2PMNX 3LCTA 3ORKA 5EDPA 2HZ0A 4PDSA 3O8TA 2R3HA 4CTBA 3V5TA 3NIEA 4XYFA 3RAHA 1YXUA 2VAGA 5IF1A 1PKGA 2VWVA 3MY1A 4EKKA 3LFSA 2QOFA 4JDJA 2C1AA 3FJQE 3QYWA 4NFMA 3O50A 3TACA 2RKUA 3G5DA 4FC0A 4X2NA 5E7RA 3BYVA 4E93A 4LUEA 4YLKA 3SXSA 2F7EE 4YMJA 2I0YA 4EOLA 4UX9A 4H05A 3SQQA 5JGDA 1H8FA 5AP7A 1REKA 4AZWA 3F2RA 1QL6A 4AW1A 3TDVA 2QKRA 2PVKA 3MFRA 3Q32A 5FG8A 1H1SA 2RG5A 5CAOA 1OBDA 2OJJA 5DRDA 4QMSA 3IKAA 2P2IA 2AC5A 2X9FA 4XX9A 2FSLX 2QOOA 2BDFA 3GI3A 5DHJA 4BYJA 3D5UA 4F08A 5EHOA 2X9EA 5ETAA 1OGUA 5KKRC 4IM3A 5KX8A 3UOJA 2NNWB 1O9UA 3DB8A 4QTEA 1UU8A 4TWOA 2W06A 4J95A 4Y5HA 2EWAA 4FX3A 4EK5A 1RDQE 3Q2MA 3QA8A 2OZAA 2VX1A 1GY3A 3KY2A 5B0XA 1YOJA 3VWAA 5JFXA 3W0NA 4QP3A 4FIIA 3NLBA 1PMVA 3POOA 2BR1A 2WMRA 2Z7RA 3FY0A 4EUTA 2BIYA 3NZ0A 2OJ9A 2VO0A 3MFUA 1UKIA 2YCRA 3I0OA 4HGTA 4O7TA 2XCKA 5IEYA 3I5ZA 3O51A 1PMUA 2GNJA 1OKWA 3ET7A 3CXWA 4AT4A 2FSOX 2R0UA 4C2VA 3HECA 1P14A 2XJ1A 2UZBA 3QQGA 4TYGA 3ZHPC 1NW1A 4RRVA 3GP0A 2J50A 3QX2A 3VBQA 3C0IA 4MKCA 3UPZA 4OAUC 3EN5A 3TV6A 2BKZA 5GZ8A 3E63A 2OJFE 2UVZA 4LUDA 5L6PA 3UMWA 3DJ5A 3MVJA 3JXWA 1XH9A 4CTCA 5IQDA 3WZKA 4C36A 2YIWA 2JD5A 2JGZA 1XMLA 2QODA 2XIXA 4UYAA 3VONA 3ORTA 5T3QA 2A0CX 5EHYA 1H25A 5HEZA 3OUKA 3ELJA 3JS2A 2C30A 3H9FA 3NUNA 4I23A 4LM5A 3W0RA 2OU7A 3NX8A 2YCFA 4IAAA 4D0WA 5JGAA 2XMYA 4U40A 2PVNA 3RPYA 3P1AA 3TCPA 3TZMA 1XBCA 4A9YA 3CGOA 3VUIA 2PVFA 2R0IA 4J98A 4PTEA 5C4LA 2YISA 2YJSA 3QTUA 4ID7A 3D5XA 3I81A 1NA7A 3QA0A 4LOQA 4ONAA 4YSMA 4BI2A 4DN5A 3TUCA 2HZ4A 5GIOE 5FEEA 4O7WA 2IZUA 3PIZA 5CEQA 5D1JA 4QQJA 4MD7E 4O4FA 5L8JA 2UZTA 1UU9A 3IDPA 5HE1A 3R7EA 4FT9A 4RVKA 3PE2A 2XEYA 3P08A 5CEOA 5BVWA 2VTIA 5CTPA 4JAIA 4MYGA 4F65A 3OWPA 4UMRA 4JBPA 4CKJA 5IEXA 2DQ7X 2OJGA 5DEYA 4J52A 2XANA 3Q52A 2YM4A 4RA4A 3IECA 2WIPA 4AA5A 2W1HA 1I09A 3EQRA 4FSTA 2B9HA 3DK7A 4MD8E 3AT4A 4TKSA 2YIRA 2OI4X 4LQMA 4TRLA 2F2CB 1OL1A 4EHVA 1WVWA 4UY9A 2W1EA 4RJ5A 1NVSA 2RL5A 2RIOA 4HVDA 1YWNA 2X2MA 4CFFA 3G51A 2GMXA 3BGPA 4HPTE 5CY3A 2OF4A 4I3ZA 1MQ4A 2EVAA 3TZ8A 2P3GX 2VX3A 3I7BA 4CZYB 2WQEA 4CCUA 5L8KA 3PPJA 4DC2A 4XMOA 3EYHA 5AUWA 4BGQA 5IA3A 4USDA 2XAOA 1TVOA 3R7IA 2XNOA 2YM5A 2C6DA 2C5NA 5ETCA 1Y6AA 2Y0AA 4NUSA 3CJFA 1YWRA 3IDCA 4FKTA 2UW9A 4TZRA 1H0WA 3ENHA 5IG1A 2IG7A 4RJ7A 5IQCA 4BFMA 4WHZA 3AMAA 2IWIA 5TE0A 3VUTA 3W2OA 4CYJA 5BVOA 2PULA 4ZY6A 3TZ7A 4BZNA 5M4FA 1FQ1B 1SMHA 4NJDA 5BVDA 5CVFA 5EYCA 4A4XA 4D9TA 2VTNA 4ZJJA 2WQOA 1UWHA 1XH6A 3BELA 3WZDA 2B0QA 4Y46A 3QGWA 4JVGA 2BIKB 5K4IA 3D2KA 2WTWA 1GOLA 3EQGA 3HRBA 4G16A 2XK9A 4KIPA 2ZDUA 1PMNA 1Z5MA 2QC6A 3E3PA 5C9CA 3UOKA 4BTJA 4O96A 1QPDA 2QR8A 2WTVA 4MXOA 1O6KA 4O0UA 4JIKA 3T8OA 3C4XA 1UNHA 5AUTA 2VU3A 4HZRA 2RFSA 1PXNA 3L9LA 4E26A 4CFMA 4A9TA 4AGCA 4A06A 4QQTA 5ETIA 1J7IA 4XP0A 4JQ8A 5M4UA 2V7OA 1WZYA 2WIHA 1IEPA 3BU6A 5D11A 4EOKA 3MFTA 1YRPA 3I1AA 3LM0A 4I5PA 5D10A 1IR3A 3K3JA 1J7LA 5L2IA 3TIZA 3KXXA 2RF9A 3QBNA 4BC6A 1KWPA 4F70A 3N9XA 5DNRA 1LEZA 2CCIA 4AN3A 4WSQA 4AXAA 1VYWA 3LZBA 3UBDA 2CKEA 2WQBA 4B8LA 4NU1A 4EWHA 2VGOA 3WF5A 3ZEPA 4ANLA 5AEPA 1PW2A 5L2TA 5HD4A 4QYEA 4HZSA 4QMNA 2OK1A 3VBTA 3NUUA 5D9HA 2C5YA 4QP1A 4YJOA 4E4XA 3QTXA 3A60A 4FUYA 4GKHA 2E9NA 5M51A 1NY3A 5KMIA 3D14A 3QUPA 3KXHA 2G2IA 4BDFA 4A4OA 4GU9A 4DEGA 5CI7A 2WKMA 3OZ6A 5DI1A 4II5A 4ACDA 3NNXA 4IADA 3W33A 4ANBA 1YWVA 3BHTA 3FI3A 5CEKA 2YZAA 3HV3A 1BI8A 3IOKA 4WOVA 3U54A 4O38A 4U9AA 1YHSA 3Q04A 3QX4A 1GIHA 3VS3A 2PUPA 3WILA 3L1SA 4DFXE 3VQUA 4TYJA 3VJNA 2YAKA 2J0MB 2OIDA 3HV4A 4Y8DA 1JOWB 1WAKA 4R3RA 2HOGA 4TY1A 5DH3A 3IW4A 3KXNA 2QLUA 3O8UA 3UNZA 5TT7A 4ANOA 4PL5A 5HIDA 4AAAA 4O0VA 3DQXA 4OTWA 3G33A 1VJYA 3DBCA 4FA2A 4QTCA 4LFIA 1GZKA 3LCOA 3Q4UA 4RLKA 3OC1A 5H2UA 3ZO2A 4BN1A 2IVUA 1R0PA 1U54A 1BLXA 3QRTA 4OW8A 3LPBA 4Z16A 4FICA 4OTIA 2CPKE 4D5HA 2J2IB 3FZPA 2H8HA 3L8PA 3GCQA 4K0YA 4OTPA 2QU5A 2HAKA 1GZ8A 3C4ZA 4L43A 4NFNA 4IC8A 1Q62A 2V7AA 4PL3A 4C2WA 4CV9A 2CKOA 2V5QA 3VBVA 3ZO1A 5JEBA 2GU8A 3BBWA 3HMMA 4I4EA 5HBEA 5KMMA 3PVWA 4FSRA 1MUOA 3EN9A 4FK6A 4EL9A 3EWHA 2UZNA 4IWPA 3C50A 4QTAA 3GU6A 3PYYA 4PQNA 3C4WA 1BX6A 4RVTA 4PL4A 3VC4A 2OSCA 2W9ZB 5M53A 3E8DA 3UDZA 2BRMA 3KK9A 4V0GB 2R64A 4YJUA 5L6WL 5DT0A 3CCNA 3R6XA 4JQEA 5CYIA 4DA5A 3DAKA 4FV9A 5HZNA 2ETKA 4IDTA 3VS7A 4G3GA 3Q6WA 2WTCA 5AUVA 3OMVA 4JL9A 4FNWA 4L8MA 5EFQA 4O0SA 3HDMA 2WMTA 2QLQA 4FJVA 4RWIA 4O0RA 4MEDA 2Q0NA 1PRYA 3E5AA 3MH3A 3PTGA 4JAJA 5EM5A 4DGGA 5CSPA 3ZM9A 3F5GA 2XK7A 2WO6A 4MWHA 2HW7A 4FEVA 5BYLA 5LVOA 5CAQA 4K33A 4RQKA 3UC3A 1ZZLA 4WA9A 2B9FA 2YM7A 1L3RE 3E3BX 4ASXA 5KO1A 4OUCA 2V62A 4UXLA 3AC8A 3DU8A 4TWCA 4UB7A 3FQEA 4FOBA 3V8SA 4EZ5A 2GHMA 3OXIA 3BU5A 5LXMA 2JKMA 2SRCA 1LR4A 4GV1A 2NRYA 4FTNA 3RTPA 4EYMA 4UMPA 4BIDA 3F3UA 3MPMA 4DF3A 3C51A 4YTHA 5IQFA 2BRGA 3V5LA 4C4JA 4XJ0A 3NGAA 4QRCA 3E7VA 2YN8A 4OTDA 4U81A 3LFFA 1GNGA 2YLFA 2ONLC 4BCFA 4P90A 4O7RA 3EZRA 3OHTA 4FIJA 2XRUA 2YCQA 3A7GA 3EQBA 4RIYB 4QMQA 2B7AA 2EXMA 5AV3A 4PWNA 3TKHA 3VRZA 5LVMA 2VTLA 4QTBA 1H00A 2Z7QA 4UMQA 5JFVA 3OVVA 3RK5A 3ZOSA 4BWKA 4IB1A 2OXYA 4D4SA 4D4YA 4AFJA 3C7QA 4ZZMA 5A3XA 4YO4A 1S9JA 2GNGA 1JPAA 1RE8A 4G9RA 1OM1A 5A4LA 3A4OX 5FBOA 2PUNA 3W0SA 1OZ1A 5G1XA 4WG4A 5IDPA 1M52A 3NNVA 4IH8A 4Y85A 4FG7A 5FXSA 1Q8WA 2UW8A 4S31A 5FTOA 1U4DA 5CXZA 3R7OA 3D0EA 3CD3A 3PJ2A 5CVHA 5L4QA 2QOBA 3G90X 2VN9A 2ZYBA 4XCUA 1FVTA 2VNYA 5M57A 2PUUA 3NFGB 2UZDA 4FI1A 4JRNA 1ST4A 4IAIA 3HMPA 1H0VA 4F78A 1OL6A 4NH1A 4WT6A 3R7GA 2I7QA 1TQIA 2WU6A 3AD4A 4KIQA 4DEEA 2YFXA 5JQ5A 3QQKA 4C8BA 4JG8A 4S33A 4U42A 1VLRA 3U4UA 3QGYA 4QP2A 3ORIA 5HIBA 5E8XA 4D4VA 3W8LA 3BL7A 4F9BA 4KSPA 3MPAA 2WMUA 4R7IA 4GFOA 1KSWA 4Y83A 3RPRA 3AKLA 2XJ0A 3EZVA 5KCVA 1ZLTA 1ZMUA 3ROCA 2GPHA 2JDTA 1R78A 2PE1A 2W4KA 4R3CA 2JKKA 4NKSA 3UZPA 2OZOA 3FZTA 4J96A 4FNXA 4QTDA 3FLNC 4DGOA 3KULA 2H6DA 3DNDA 3DY7A 4K11A 3I7CA 5EKOA 3LFAA 2EXEA 3TZ9A 1ZAOA 3R1SA 3Q9YA 4JLCA 3PXFA 4LG4A 3I60A 2ZM1A 2FH9A 3E8EA 3F3TA 3HYHA 1FBNA 3PFYA 3KU2A 5JZNA 3ZRKA 4BGGA 1J3HA 1ZMVA 4DHIB 5A9UA 2VTPA 5A6OA 4BIEA 3GC9A 3Q4CA 3CGFA 4BIBA 5L2SA 5AR2A 2HW6A 4BBMA 4DT9A 1SVGA 5CSHA 5HIEA 3LJ2A 4A07A 4R78A 4AXEA 4LGGA 3ORMA 4IJ9A 5IU2A 3U9NA 3A8XA 3DTWA 3DK6A 2G01A 4GU6A 4K18A 3R8LA 4OBQA 3VBYA 3ZMMA 5L6OA 3JY9A 2E9VA 4BB4A 5EQPA 4NM3A 3VUMA 2BTSA 3V5JA 1MRYA 3OFMA 1H1WA 2VO7A 1W82A 4YP8A 3DFAA 4JOAA 1OKZA 2F57A 2W4OA 4HGSA 1UU3A 4C4EA 4O2ZA 5FEQA 1CKIA 5M09A 4AACA 5CZHA 3UP7A 2KULA 5LCJA 1ZYJA 3E62A 1YOMA 5B2LA 5IISA 3DKOA 3FYKX 2ERKA 4UMTA 4MQ2A 2XM9A 5BVNA 2C0OA 3ZU7A 3T9TA 4YTFA 1H01A 4F1TA 4TWPA 3W16A 4FVQA 3PUPA 4A7CA 2R4BA 3BLHA 5HX8A 4EONA 4F64A 4R5YA 3FMMA 1Q97A 4GMYA 4HGEA 2GSFA 4M8TA 3CC6A 3KVWA 3RHXA 3SA0A 2GQSA 3WYYA 2PPQA 4FTAA 5FWKK 2J5FA 4XG9A 3KMUA 3BPRA 4IZYA 5E8SA 2C0TA 3CPBA 4E4NA 3OF0A 4RIYA 3TYKA 1H28A 1R3CA 4GFMA 4JG7A 3UQFA 5H8EA 4FODA 5AP3A 4O86A 4BCMA 1ATPE 4H3PA 4X6RA 4EHGA 3FC1X 4NZWB 5AWMA 3WZJA 4F0IA 4O0TA 4M15A 4YZNA 4QMXA 5M4IA 2HZNA 3VBWA 4KBKA 4ZXTA 4FV7A 3I6WA 3A8WA 4MBIA 2FSMX 2JDRA 3CD8A 3QTZA 4QMWA 3ZLXA 2R3IA 5FLFA 4ZTMA 3KKVA 2X8IA 4IHPA 1B39A 4R77A 2FGIA 3BV2A 4WRSA 3GCPA 4BRXA 3RNIA 4AXFA 4H1MA 3FUPA 5BUJA 5F94A 3P5KA 3UGCA 3ZLSA 1WCCA 3BYMA 3QTIA 3DBQA 4JT3A 3RZFA 2LGCA 4FF8A 3LCDA 5AJQA 2XCHA 1Q3DA 1JKSA 2WGJA 1M2QA 4FEQA 1OPLA 3R9HA 1ZRZA 3O8PA 4BF2A 2J0JA 3QKMA 3PWYA 3FKNA 4AS0A 5JGBA 3WYXA 2XP2A 3JVSA 3LKMA 5HO6A 1SNXA 4QP7A 2C6EA 1CDKA 3NIZA 4NJ3A 1W7HA 2VWUA 4BDDA 4ANNA 4XLIA 1W84A 4E6DA 2PVYA 3MDYA 2O0UA 2CGWA 3FSFA 3LXPA 4ZAUA 1HCLA 2JDOA 3JVRA 4G3FA 2O5KA 4F4PA 3L8VA 1Y8GA 3LFEA 1Y91A 4F7SA 4RJ6A 3QWJA 4WD5A 5IKWA 5T68A 3H30A 4XV9A 4EOPA 4EQCA 5BX0A 1XMMA 2QR7A 4IDVA 3PJ1A 3FKOA 2X1NA 4CLIA 4PPAA 4MVFA 4O7LA 1KE7A 1Q61A 4YBJA 4LRJA 4AP7A 1FGKA 1P4OA 3ZFXA 3BHUA 5DFPA 4JX3A 1B38A 5BMSA 3F69A 4OBPA 4TYEA 4TL0A 3AMYA 2XNGA 2PY3A 3EOCA 4IVBA 2YJRA 3UE4A 3ZSGA 2CGXA 4BDIA 2BILB 2XYUA 3Q9XA 4QNAA 3S0OA 3ROYA 2B9JA 4F1MA 4G6NA 5CF5A 4N6YA 4NIFA 4KRCA 3LMHA 4ZOGA 3RKBA 4M14A 4UMUA 4FGRA 3UO5A 3A99A 2CKPA 5CASA 4CFUA 3ZSHA 2QO2A 4ZK5A 2YERA 3R28A 3NAYA 4QT1A 5DVRA 3RAKA 3KFAA 4XBUA 3LM5A 3WIGA 4PMMA 3UODA 4O4DA 3WF9A 3FDNA 3UIMA 5J9YA 4YNOA 2X2LA 2WTKC 2LAVA 3ZBXA 5AUZA 4YNEA 3VHKA 5FEDA 4FG9A 4R6VA 3TV7A 3BQCA 4G5PA 4O27B 1IA8A 4GG7A 2UVYA 3DDPA 3ZS5A 4L9IA 1BL7A 2X39A 5CWZA 1NVRA 5CEIA 1JKTA 4YZCA 4ANSA 2VWXA 4BGHA 4PX6A 4HCUA 3MVLA 3QAME 4N0SA 1IA9A 5I9YA 1NT2A 2BKKA 4XBRA 4AE9A 3NDMA 3VF8A 2QD9A 2WHBA 3G6HA 1YI4A 3TM0A 3QWKA 1UWJA 2JDSA 3WF7A 5J1VA 4DAWA 1YHVA 4CFNA 4QMZA 4YZDA 2W5AA 1PJKA 2XNMA 1OB3A 5CF6A 2R3QA 2QOQA 4RIOA 4RZVA 3ORLA 4N57A 2NYAA 5JFWA 3OW4A 3QD0A 4GEOA 4LOOA 4MXCA 4AOTA 4AW2A 1OGYA 5DG5A 3EFLA 3EQDA 4L42A 4O0YA 3NS9A 4IEBA 4OT5A 3PLAE 3PVUA 5E8TA 4C4FA 3ENMA 1WBOA 3DJ7A 4QNYA 2A19B 5IA2A 4QQ5A 4EH5A 2A1AB 3HMIA 4YC8A 4CNHA 5HVYA 4HOKA 4ZY4A 3K2LA 3NFFB 4EH6A 3PA5A 3EN6A 4MNEA 4D1ZA 2WFYA 4DEHA 3OTVA 1MQBA 3RHKA 4TNBA 3TNQB 4XH6A 2P4IA 5DR2A 2R3LA 4EZ3A 3FL4A 3F61A 4IZ5A 5CSWA 2QOKA 4IAFA 4L7FA 4RFZA 3HZTA 3VS5A 1XWSA 2VTMA 3DBFA 3IO7A 2FA2A 3NNWA 3OCTA 4LRKA 5DBXA 3TJCA 2PSQA 3LIJA 1F5QA 5G6VA 4FT3A 4DCEA 2BAKA 1ZMWA 3S4QA 2XYNA 5EW9A 2J4ZA 3CEKA 3GCVA 2HXQA 2XK3A 3I0QA 3OG7A 4O1OA 4I6QA 1SZMA 2BAQA 3DBEA 2XUUA 3SDJA 4C37A 5CLPA 5K3YA 1ST0A 3UDTA 2GNLA 2OIBA 2YWPA 2ERZE 4R1VA 2O64A 4NTSA 3Q5ZA 5EM6A 2PZYA 3I6UA 4MF1A 4R3PA 4W9WA 2WMVA 3EQCA 3ZXZA 2C6OA 3D5VA 5DA3A 4UWBA 4E5WA 3QKKA 2JKQA 3SVVA 3C4FA 1WVXA 4FT0A 3MIYA 4FV0A 2CNVA 1G8KA 2PVHA 3VW6A 2GHGA 3KXZA 2ITWA 3DA6A 3IW7A 1ZYSA 3O17A 3ZFMA 1JSTA 1PYEA 4FSZA 4BDCA 3UOLA 2RFDA 5AA8A 4AXDA 4D28A 4FKVA 5AM7A 4CQEA 5DIAA 4BCOA 3LFDA 5KZ0A 1HOWA 4F9WA 4NCTA 4X3FB 2R3GA 3WBLA 3R30A 3DZOA 3D9VA 4KINA 3M11A 3OWKA 3VS1A 4R7BA 1H4LA 2I40A 4G6OA 3LAUA 4I5CA 2NRUA 5CU2A 4NL0A 4RVLA 3IQ7A 4C58A 1TKIA 5LQFA 3KREA 4YLJA 3ZUVA 4D2WA 4O0WA 3TTIA 4I0RA 2E9PA 2CGVA 3P9JA 5F95A 1KV2A 5AAGA 4O7YA 3V5QA 5H8GA 3FZOA 1XHAA 3UTOA 5HICA 4XOZA 4C0TA 2J90A 4W8EA 1TZDA 2XIRA 4LOPA 4FIHA 5CU3A 4PDYA 5L8LA 2VWIA 5JH6A 3EL7A 3QCQA 3C13A 5EM8A 3AG9A 3FI4A 3QZFA 3TN8A 3FY2A 1UKHA 2QG7A 1DAWA 2CMWA 2C6MA 3PJCA 2OH0E 2BCJA 1SVHA 4FSWA 4M0YA 2W0JA 4IANA 4AF3A 3EQPA 4O2PA 4RJ8A 3RK9A 5GZAA 3TDWA 4U45A 3DV3A 3F5XA 3NYVA 3CR0A 3MBLA 3QF9A 5CVGA 5J9LA 3N4TA 5M4CA 4GK2A 5AV4A 1OL7A 3R0TA 4XG7A 3KEXA 4JJRA 4FV4A 5E92A 5I4NA 1LP4A 2XJ2A 5DOSA 4FIEA 3V8WA 5J7HA 5GINE 5KKRB 3MB6A 1W0XC 3KRJA 3FHRA 1U5QA 3QC4A 4H58A 1JKLA 4USEA 4BJJA 2WEIA 2ZM3A 1ND4A 1T45A 1M7NA 2X7GA 4J1RA 3EJ1A 4RLLA 5FRIA 3CSVA 5EW8A 4FNZA 3W0OA 2VTOA 1W2DA 2CHLA 4WNMA 4FTMA 3OBJA 3IPHA 3GENA 3GEQA 4EH3A 4DGLC 4DLJA 5A4EA 5FXRA 2PZIA 3UDBA 3R8ZA 3UG1A 2VWZA 5DT4A 5FM2A 4I94A 5KHWA 4GG5