4U7ZA

Mitogen-activated protein kinase kinase (mek1) bound to g805
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
291
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure based design of novel 6,5 heterobicyclic mitogen-activated protein kinase kinase (MEK) inhibitors leading to the discovery of imidazo[1,5-a] pyrazine G-479.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 291
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u7zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u7zA01
3CBLA 4QPAA 4YJNA 3HNGA 4BCGA 2JKQA 2G01A 3RPVA 3GENA 4I93A 4WBOA 4FZ6A 3ZONA 5E9EA 1WZYA 4RIXB 3R8LA 4GSBA 4FV9A 4FSWA 2JDTA 3ITZA 2Z7LA 1XQZA 1BKXA 3LW0A 4JNWA 4RVKA 5H8GA 4EHGA 4EC9A 3R1YA 4UMPA 4EH2A 5AV1A 5HLNA 3PSBA 4RWJA 3C4CA 2XA4A 4LOQA 3SC1A 2OJIA 3HRBA 4MBJA 5CEQA 3L9NA 3TNQB 1RE8A 5L2SA 3LMIA 4BTMA 4WNOA 2W1EA 5DA3A 1Q5KA 4UEUA 4AUAA 3LCTA 4G3FA 4FSQA 4CRLA 1DI8A 1OKVA 3C4FA 3TL8A 3SG8A 4L3PA 4BTKA 2BKZA 3C0GA 5IQIA 4TNBA 3WIKA 1MRVA 2OICA 4X2GA 4NT4A 4F99A 1VEBA 2V22A 2XJ2A 3CE3A 5AMNA 5AR2A 3SHEA 2JC6A 3Q5ZA 2QKWB 2PULA 2IZUA 4AGDA 4CTCA 4F9WA 5CU4A 3O0GA 3G9NA 5AP5A 2W99B 3MFTA 3OCBA 2RFEA 4MVFA 1XWSA 2VGOA 5G6VA 2WOUA 3BGZA 5HD7A 4EK5A 2RG5A 2UZUE 4CV9A 2B55A 4MXCA 3P7CA 5BVFA 2JFMA 4F0IA 4MH7A 5A4QA 4JX3A 4YNOA 5BMSA 3A99A 3OCTA 3VF9A 2YCRA 3W33A 2XJ0A 4EOKA 4F0FA 1FVVA 3FLQA 5JGAA 1VYZA 5E1SA 3OP5A 3LCDA 4IB0A 4TRLA 2C5YA 2UZDA 1PXNA 5FP5A 3FL4A 4DYMA 2X9FA 1W8CA 4RQVA 5D41A 3UO4A 3F82A 4QMXA 5DT4A 2IVVA 4JAIA 4NUSA 3FEGA 4O7RA 5CXHA 4BVUA 3UOKA 2YCQA 4BHNA 2C0IA 4FG7A 4FT5A 3U8WA 3O8TA 4IDVA 3NIEA 4IANA 5EYCA 4MNEA 4GT5A 3EQFA 4ZZOA 3PE1A 2JBOA 2BHHA 4ID7A 4EQMA 4M0ZA 4H05A 5A6OA 4K33A 2JLDA 4FVQA 2ZM1A 4QTCA 4H3PA 5HCXA 3HEGA 4WSQA 3VO3A 1OBGA 4E4LA 3VC4A 2C6DA 3O96A 4IIRA 3KL8A 3H0YA 4IEBA 4PDOA 4ZSGA 2W1FA 5EHOA 2RFDA 4FKTA 3D14A 2JDOA 1H24A 1TKIA 4KWPA 4D5HA 1J1CA 1Q41A 4FKGA 2BFYA 2F57A 2GQGA 4NEUA 3G0FA 5DH3A 1MP8A 3UO6A 5AV0A 1UNGA 3R22A 4FNWA 2YZLA 1JVPP 2XK6A 1OUKA 1ZLTA 1RQQA 3QQJA 1WCCA 4R6VA 3FMHA 1UWHA 3QD4A 5HE3A 5M07A 4UB7A 2PPQA 3NEWA 1YHSA 4JOAA 3ZDIA 4DEDA 3KXZA 3EFKA 3EQGA 4AZTA 3P79A 3C5IA 5EHYA 2IN6A 2FSLX 4PY1A 3KXXA 2A27A 3R7EA 4FTUA 3UYSA 4BCNA 2VTQA 3Q9YA 4IB1A 4E26A 5BVOA 5M06A 4BWKA 3AMYA 4C37A 4AN9A 4EUTA 5CASA 2W1HA 2FSTX 5AV3A 2R0IA 2BHEA 2VTTA 1DS5A 4AOTA 2BZIB 4FV2A 4WG3A 2X4FA 2GTNA 2OJGA 4QMPA 4XYFA 4LGHA 5T68A 4X3FC 3W32A 5IA3A 1FPUA 1YOJA 3MPTA 3QTSA 4IAKA 4R3CA 1WVXA 2ITUA 4RWLA 3JVSA 4I1ZA 2GS7A 4RWKA 3EL7A 3TNIA 4TY1A 3UTOA 4PX6A 1GOLA 2O8YA 1P5EA 3EFWA 3DK3A 1NW1A 4AFJA 4F6WA 2IWIA 2BTRA 3RZFA 4EQUA 3LMHA 4R77A 4E5BA 2VWUA 2AC5A 5CU2A 2VX3A 2Z7RA 4M7IA 5M4IA 3WYXA 2C69A 1ZARA 2QODA 4I5CA 4ZY6A 4L9IA 3PSDA 5FQDC 3VS5A 5BVNA 2BR1A 4GU9A 4DEBA 3QF9A 4A4OA 5CALA 2HZ0A 4CFUA 5JK3A 5CU3A 4BYJA 2WO6A 1M2QA 5CANA 2VGPA 3ZSGA 3KRLA 3DS6A 5LCKA 4O0YA 3AMAA 3O23A 4C34A 3AT2A 3QTWA 4TXCA 1JKTA 4PRJA 2DQ7X 4O0WA 4XG6A 3QHRA 3FI8A 3E8NA 2ZM3A 4M15A 1YWVA 4EHZA 1J1BA 4QP6A 3Q4ZA 5DMZA 4IZ7A 2F2CB 5FD2A 4GK4A 3DCVA 5CSWA 3W2PA 2YA9A 4ZY4A 5CF4A 5IQDA 3VUTA 3OUKA 3N9XA 2X4ZA 3OS3A 2YDKA 2OJ9A 4N0SA 3U54A 3PY3A 5HG9A 1YHVA 3ZLXA 3MPMA 4XUFA 1OL6A 2UZWE 2OKRA 1RDQE 3EWHA 3UOJA 2WMXA 3QTQA 5EYKA 3G2FA 5IH5A 5J79A 2YACA 5HLPA 4B6LA 3UVRA 3HMIA 3VW6A 3PYYA 3ZH8A 2QQ7A 3CQWA 4E4NA 4AE9A 3C0IA 5I9WA 2YM8A 1M2PA 1OB3A 5T3QA 4CTBA 4I4FA 2R64A 5D10A 4EEVA 4N70A 4KNBA 2JGZA 3CD8A 4IACA 1VJYA 1SVEA 1QCFA 3F5PA 3PA5A 5FEDA 5KZ0A 2DWBA 3FMLA 3DNDA 3MJ2A 3G5DA 1PYXA 4FK3A 2C3IB 4EK4A 5KKRB 4ZMEA 1I09A 3R73A 5L8JA 4XG9A 4QMUA 4C61A 4KIQA 4DGMA 2XP2A 4H3BA 1GZNA 3Q5IA 4P5ZA 5ANIA 4DFLA 4CCBA 5A9UA 4NM7A 3ZO2A 2Q83A 3DY7A 3LJ2A 3PTGA 5LVPA 4ZTMA 5EK7A 5AP2A 5FDXA 3HP2A 2ZYBA 3ZEPA 3RK5A 4FT9A 4ZIMA 1JLUE 1V0OA 3MH1A 4RRVA 3PLAE 4QTDA 4ACCA 4V0GA 5HD4A 3UZTA 2VRXA 4C2WA 3D5WA 5G1XA 3ZSHA 5CU0A 4YLLA 4HYIA 4BDFA 2W17A 4AW0A 1J91A 3FJQE 4NKAA 3D7ZA 4AFEA 3CKWA 4BDEA 4G6OA 3CY2A 3RTPA 5HVJA 1M7NA 1ZZ2A 3BQCA 3KXHA 4JAJA 5CVFA 3LZBA 4AX8A 3KK9A 2WTWA 3N4TA 1WFCA 2UV2A 4QPSA 3F3WA 4ANMA 4BDKA 5E91A 3DOGA 1AGWA 4AF3A 1J7IA 2J0MB 2O0UA 2JIIA 2E9VA 2JKMA 3C4ZA 4QOXA 4WNMA 4YJSA 5J87A 4YP8A 3TV4A 4EKLA 1L8TA 2WTKB 2VO0A 2VX1A 5DN3A 5AX9A 2CKPA 3F66A 2QO2A 3QZFA 4U45A 4ZSJA 2QURA 1HCLA 2F49A 4ZK5A 4IB5A 3TZ9A 4C4EA 3WOWA 2WQMA 4D2VA 3V8WA 4BHZA 2ONLA 2X81A 5ITAA 3LE6A 5C4LA 3FL5A 2X6DA 4H58A 3REPA 1CSNA 3QZHA 3LFDA 4D9TA 5CEIA 4I21A 4J8NA 4HNFA 4O2ZA 2WMRA 4RBLA 1Q62A 1WVWA 4CRSA 4EZ7A 2VTOA 4RX7A 4YZDA 1ZOGA 4I20A 2IW8A 3POZA 3OBJA 3NNUA 2HY81 3P9JA 4XV9A 5K4IA 2XF0A 1XBBA 4DGGA 4OTWA 3DFAA 2XIYA 4ERWA 3R28A 5HBJA 2YDJA 4DBNA 3EN6A 4CFNA 3A4PA 1BI7A 2X1NA 3S1HA 3DTWA 2J2IB 4TYHB 2R3JA 4DAWA 4D4YA 3A7GA 4MXZA 4K6ZA 4NCTA 2XCHA 3W2CA 3F7ZA 4MF0A 1XHAA 3G90X 1Z5MA 2Y4IB 3DXNA 2QOIA 5EH0A 5AP4A 1WBPA 2X7OA 3P4KA 4NTSA 3TIZA 5HZNA 5FRIA 5LMKA 2QG7A 3FQHA 3FMMA 5DR2A 4BGQA 5HNIX 3LLAA 3BHHA 1YDSE 3BI6A 3ET7A 5CS6A 3HLLA 4BKYA 5BQ0A 3MVJA 5IQAA 5H8EA 2ERZE 5HEZA 4W8DA 1FGIA 5IQCA 4LRKA 1ZRZA 1XO2B 3UP2A 2Z7QA 5GZ8A 4IM0A 3W2RA 2PZ5A 4G6NA 4KIKA 3ZO1A 4IFCA 3CD3A 1YXUA 3TWJA 3UBDA 4DH8A 2YWPA 5DHJA 3QYZA 3I60A 4L44A 2B53A 3FZRA 4C36A 3R9RA 5CNOA 3RBWA 2WEIA 3RM7A 1YOMA 4ITHA 2XNOA 3OTUA 3UYTA 4DA5A 2XIRA 1WBTA 4RA5A 3KRRA 4CQGA 3QQHA 4OR5A 1OIUA 3OY1A 5J9LA 3FI3A 3D83A 4QQCA 5EQPA 1CKPA 2RSVA 3ZM4A 2YCFA 4Z16A 4IXPA 4C3RA 4E6QA 4O2PA 1FVRA 1PMUA 3FZTA 1YXXA 2LGCA 5L8LA 3O8PA 5BVWA 4XRLA 4C7TA 4O6LA 4EOJA 2NP8A 2XZSA 4CGAA 3HRFA 3QCSA 1KE8A 3QALE 2OI4X 3H9RA 1JKKA 3GFEA 1NVQA 3DZOA 3OC1A 3NUSA 5LJJA 3ZBXA 2ITTA 5HI2A 3SRVA 5LWNA 1JNKA 1FINA 5ANKA 1LR4A 3KEXA 1UKIA 3U6IA 2GU8A 4BRXA 2NRUA 1Q8YA 2HIWA 2H34A 2QCSA 4FYOA 1JSUA 3FPQA 2Y6OA 4AZEA 4BDAA 4QQTA 4USFA 3UIMA 1J7UA 4PL3A 4AW2A 5C9CA 5BX0A 1H0WA 3T3UA 2R3HA 2PUPA 2UZTA 3BEGA 3E64A 4IZ5A 3NW5A 4YPSA 2WQEA 4NTTA 5DR9A 4EH7A 4OTIA 4IJPA 4O7TA 4Y73A 2A4LA 2BZJA 3LAUA 5JFVA 3GB2A 3FSFA 3Q52A 2C6TA 3Q2MA 4L53A 4O96A 4TN6A 3QXOA 3F5XA 3UIBA 3BBTB 5J1WA 3A8WA 3KREA 1UNHA 4RIXA 2C1AA 4BWPA 3OFMA 4CLJA 4O0RA 5A4EA 4RVMA 3QAME 3WF5A 5IQBA 4M97A 3A8XA 3LLTA 4PDSA 4CXAA 5L2TA 3MN3A 3R9DA 3Q4CA 2YN8A 3SQQA 5TKDA 2QOKA 1XH9A 4BI1A 4AN2A 2PMIA 1Y8GA 5B2MA 5GIPE 3ERKA 5L8KA 1A06A 3QTXA 4JIAA 3QCQA 4MBLA 4Q5EA 3TDWA 3NUYA 5IF1A 2E9PA 4FKQA 3E3PA 4L00A 5DWRA 2XK7A 4E20A 4FTCA 1H8FA 1Q61A 1YXTA 2OIQA 5ANGA 5FTOA 3DBCA 4BIDA 2UZNA 4Y8DA 4XG3A 3DKFA 3QBNA 4M68A 3OOMA 4HJOA 3WZJA 1CKJA 3PXZA 2QC6A 4G9CA 5K4JA 4CYJA 5C01A 2HXQA 3MB7A 3LCOA 5AUZA 5HKMA 3TNPC 4FV1A 4AA4A 2W4OA 1H1WA 1O6YA 2YLEA 3ZEWA 1G8AA 4D4SA 3R2YA 3BELA 5E8UA 3ZSIA 4XG8A 1APME 2CMWA 3A62A 3CXWA 3VQUA 4ASEA 4HVIA 2YCSA 4MXAA 5HU3A 4DGOA 3GOKA 3PY0A 4XOYA 4J8MA 3AD6A 2GTMA 2QKRA 2RG6A 3OEFX 3E8DA 4JBQA 5HCZA 2XK3A 3OW3A 3DV3A 4F4PA 3OT3A 2FSMX 1U59A 2VNWA 3FHRA 2BRNA 4G2FA 3VJOA 5JRSA 3V3VA 4RFMA 4Q5HA 3Q3BA 2GS6A 1YKRA 3SXRA 5E7RA 2EB3A 4YHJA 3IGGA 2YHVA 2P2HA 2YLFA 4YGAA 4EOSA 4HVGA 3P1AA 4IW0A 3NR9A 4FT7A 2JKKA 2PVKA 3DJ7A 3NZ0A 3R00A 4FSRA 3VBQA 4G34A 3ZZWA 4F0GA 5IEYA 4CV8A 3CEKA 4G6LA 3ZC5A 4C2VA 5JFSA 3MBLA 4LYNA 5JMSA 2QOHA 2VWYA 4WBBB 4U7ZA 2G2FA 4TPTA 4XS2A 5EYMA 4HZRA 3RAKA 5IDNA 5L4QA 5KMIA 4S33A 3VS1A 4TW9A 5DE2A 4ASZA 3LFFA 1QPJA 4L7FA 3DB6A 4DTBA 3NMUF 4BFMA 1MUOA 1H1PA 3FMEA 2F7EE 3MSSA 3HECA 4RZVA 3GOPA 4FG8A 4EH4A 3TV7A 2QLQA 1UU9A 4FNZA 4XNEA 3RK7A 3EFJA 4F9YA 3F2RA 1UA2A 4H3QA 1YXSA 3GU8A 4WRGA 4L7SA 3GC8A 4U79A 3UG1A 3AC2A 1Q3DA 3AC1A 3PP0A 2EXMA 4WOVA 3F5GA 1W84A 4W4WA 3ZYAA 2YZAA 5IUGA 3FV8A 4O38A 2W4KA 4DH7A 3V5PA 3DJ6A 5DIAA 2B1PA 2AC3A 3O7LB 2QOFA 3S4QA 3VS3A 5IA2A 2WQBA 4UALA 3EN7A 4O1PA 3MY5A 3PXQA 4C0TA 2OH4A 5HQ0A 5K0KA 2PZIA 2VWVA 1H01A 3E88A 3LXLA 3ZXTA 4CKRA 3C4EA 2R3GA 2JDRA 5CVGA 4ANSA 5DGZA 3SW4A 2BVAA 3NIZA 3II5A 4BCOA 4RJ7A 2XEZA 3TJCA 3VRZA 5HTIA 4IVCA 4O81A 3IOKA 3ALNA 4NJDA 2R3RA 2PMNX 3LFCA 5M44A 3EYGA 4FOCA 4JT3A 4BTJA 2VU3A 4IH8A 5L6PA 3Q9XA 4BICA 2VTSA 4S31A 4IC8A 2C3LA 4CCUA 2YFXA 3G6HA 1KE5A 2HZ4A 3KC3A 4FV4A 4FKVA 4YJOA 3HA8A 1BUHA 1PW2A 2E9NA 4IAIA 4RC2A 5C26A 3MFRA 2PE2A 4CEGA 4YO4A 3SG9A 4DFBA 2HYYA 3PLSA 4LUDA 3V6RA 3G6GA 4YSJA 2EUFB 4KA3A 1CMKE 1S9JA 3C0HA 3E7OA 4KD1A 1ZXEA 4PWNA 4JL9A 5DNRA 4EL9A 4FIGA 2G2HA 3UNKA 3RALA 1NA7A 3PIYA 1A9UA 2Q0NA 5HIEA 3VF8A 3ZC6A 4FGRA 4GU6A 3U9CA 4BKZA 1OKWA 3QU0A 4L43A 5CF8A 2P55A 3OOGA 5EOBA 3BV2A 4EK3A 2Y4IC 2VTMA 3C1XA 4QMQA 2UW7A 3PDTA 2YIRA 2ZVAA 3JS2A 4HZSA 4LOOA 4DEHA 3HRCA 4GUEA 4Q9SA 1DM2A 3VHKA 3R8MA 3NAYA 4RC4A 2B7AA 3U51A 3BHUA 3FLWA 4FODA 4IX5A 5CAOA 3PZEA 3QQKA 4NJ3A 1QPCA 2QI8A 4QRCA 4YJQA 4EK6A 5I9ZA 5H9BA 1Q8ZA 2OW3A 3PXYA 4NSTA 4P2KA 3TUDA 4PV0A 3SGCA 5CEMA 5KMKA 4X2FA 2W05A 4AOJA 5A6NA 1Q24A 4FEVA 2WU7A 3GGFA 3KA0A 4DF3A 3NVKI 2WMVA 5J5TA 4ENYA 4DGNA 5K0XA 4KS8A 4AW5A 5M55A 3GCSA 4ZMFA 1OPJA 1GAGA 3FC2A 3GP0A 4QMYA 4JDKA 4ZSEA 5EI8A 1IA9A 4V05A 3L8VA 2J5EA 4F7NA 3KCFA 3ACJA 3CTHA 2IPXA 2XYNA 2BAQA 3Q6UA 4GFOA 5JZJA 2OJFE 4GV1A 4JR7A 2PMOX 3IW7A 5BMMA 3D15A 4O7WA 4E5AX 1NXKA 2J90A 4AG8A 3ZRLA 3Q6WA 4DG3E 2ITXA 4RMZA 4DFZE 3E63A 4U6RA 3U4WA 1FOTA 4AU8A 4GVAA 5ICPA 4RIWA 1XH8A 1YI4A 2R7IA 3HV7A 3THBA 1WBSA 5IA1A 1KWPA 2XJ1A 3GCPA 2IVUA 3VUHA 5B7VA 1MRUA 5JGBA 3CP9A 1OM1A 3ZO3A 3ORIA 4FV8A 5CXZA 3I7CA 1YI6A 2FSOX 1PMEA 2G9XA 5E8SA 4FKLA 4B0GA 3ORNA 2XNBA 4RLLA 4GL9A 3RAIA 3KXGA 4ANQA 1XH5A 3DKOA 4R5YA 3TNWA 4DCAA 2JDVA 2VTIA 3FY2A 3Q60A 1F3MC 3NVMB 4ASXA 3FLYA 1QPDA 3LFBA 3NUUA 5DVRA 3W2OA 2PVHA 3NNXA 3AC3A 2WIHA 3MIYA 3GU6A 4QMSA 4LUEA 4R7HA 4PTGA 5CT0A 5JSMA 3AT4A 4A9UA 4CNHA 4QQ5A 4N6YA 4GEOA 4GFGA 1ZOEA 1OVEA 2CN8A 3EQIA 1PMVA 3MB6A 5E8ZA 2XK8A 5CQWA 1X8BA 2FGIA 3OXTA 3UO5A 2F2UA 3U4UA 4L45A 3BU5A 4C4IA 4G3GA 5BUJA 4FKUA 1KE6A 3R7YA 4JQ8A 2BZKB 3ZBFA 1PY5A 4LFIA 3EIDA 5I4NA 3R21A 3PJ3A 3VN9A 3G15A 1PXOA 1OKYA 3WZEA 2CNVA 2C5OA 1WVYA 2YM4A 4I6FA 4YJTA 3HDMA 5AR7A 4CZTA 5AADA 5LVNA 3UOLA 1ERKA 2OWBA 2EB2A 3PXFA 4EKKA 4R1VA 4Y46A 4UWYA 3TN8A 1XKKA 4AZFA 5KBRA 4GIHA 4R1YA 4EH9A 3SLSA 4PP7A 4UWBA 5HCYA 4FEXA 1IAHA 4DGLC 4D2RA 5EW3A 3P23A 5EQEA 3BHYA 2C6MA 4XV2A 3W16A 3VBWA 4E93A 2QONA 2IZRA 5BVDA 3CTJA 4BC6A 2R3KA 3E7VA 3IDPA 3QTIA 4K1BA 4W8EA 4TYHA 3V51A 2IVSA 4ACMA 1CKIA 3VVHA 2RKUA 4GKHA 5KMMA 4HPUE 3R6XA 2VAGA 4B9DA 1SYKA 5C03A 2V7AA 4OTGA 4ANLA 4NM3A 3P78A 4EI4A 3BYMA 4QYFA 2I7QA 3R83A 4J71A 3ZZEA 3KQ7A 2Z8CA 4IWDA 5KX8A 3VBYA 4M84A 3PIXA 4DEGA 5BUEA 5EI6A 5C27A 4KKHA 5A4CA 3ZLSA 2C5NA 2BRHA 4ZS4A 5LVOA 3NGAA 4WNKA 3DAKA 3NNVA 2NO3A 3KGAA 4UZDA 3WZDA 4YC3A 3QRKA 2H6DA 3RWPA 4EUUA 5IZFA 5KHXA 2GQRA 4Z3VA 2VTRA 4YZCA 4EHEA 4MTAA 3BYSA 3EKNA 2XNGA 4JBOA 4JQ7A 3E3BX 3FDNA 4J7BA 4NYEA 2YJRA 3Q4TA 4L6QA 4UZHA 2CKQA 4D2TA 1P4OA 4KAOA 3PP1A 3LCKA 5CSVA 3LFNA 3NLBA 4YC6A 1GIJA 3PPZA 4O0VA 4WD5A 4XP0A 3OUNB 3R71A 4ZTLA 2EXEA 1JPAA 3IECA 3GNIB 5CI6A 3WZKA 2CKEA 3DXPA 1W0XC 3Q32A 3KRJA 3UQCA 1OECA 1PXIA 3ZFXA 3FSKA 4ZLOA 2VNYA 2YM7A 1OZ1A 3KXNA 4C35A 3UPZA 3BHVA 2JAVA 3CSVA 2WMUA 1H00A 3OWJA 4OTPA 3AGMA 2A1AB 4EOQA 2XEYA 4RFZA 2C6LA 4TWCA 2H8HA 2VO3A 5H2UA 3O71A 3QRUA 3QWJA 4WUAA 4MXXA 2YIQA 3RGFA 4IQ6A 2OXXA 4BL1A 2F7XE 5GJDA 3RWQA 4XRJA 4YLKA 4KB8A 4AT5A 5KMLA 5LQFA 3MY1A 3D2KA 5FDPA 5JH6A 1PHKA 4JDIA 3FUPA 4RA4A 2OSCA 1JSVA 4CKIA 3CKXA 3PY1A 2W1GA 2ONLC 4GK3A 3WZUA 4JRVA 5ETAA 3R7VA 2GNHA 3DBDA 4TKSA 5J8IA 3K54A 3BWJA 4K9YA 4PMMA 4QMMA 2GCDA 3VS6A 1GIIA 3GU4A 4AGUA 5LCJA 2PY3A 4UMTA 3KULB 3EJ1A 4WKQA 5BNJA 4QNAA 4JRNA 4O1OA 4YMJA 1LPUA 5KCVA 4U5JA 1E1VA 4V04A 2YITA 4OBQA 5HO6A 3Q9ZA 4R3RA 3VUDA 2UW4A 1XH6A 3NCGA 3P7BA 4K18A 4NCTC 3IW4A 4KSQA 2PE1A 5I3RA 4CFFA 4ZLYA 4PL5A 3W2QA 3QTZA 5HO8A 4OBOA 4XP2A 4CFWA 4M13A 4LI5A 5LMKC 5D12A 4A9RA 4DLIA 2OFVA 3MWUA 3WE4A 5HTCA 4TWNA 4ACHA 1UNLA 3KF4A 3UNZA 2R3QA 3CJFA 5J7HA 5M53A 4ZXTA 2C6IA 1M2RA 2VWIA 4R7BA 3PJ8A 1NVRA 3GBZA 2C6OA 5E8TA 4YC8A 2WZJA 2BIYA 2AYPA 2I40A 1U46A 4FIFA 4G5PA 4OGRA 3CR0A 3C4XA 3R9HA 4DG0E 4PP9A 5HLWA 2GPHA 1OMWA 4F7JA 4QO9A 3HDNA 4DEEA 1U5QA 4YURA 2HENA 4PDPA 4MWHA 3SDJA 4D4RA 1H4LA 2ZDTA 3FWQA 4J96A 4JBVA 5M08A 3PRIA 3BCEA 5I9YA 4D2WA 1PXPA 1H07A 3JYAA 4AGWA 4FKRA 3TZ7A 2VD5A 1ZYJA 4H1MA 2C47A 4EHVA 1TQMA 3IW6A 1H25A 2YJSA 2YM5A 4ASDA 3F3TA 3FKNA 4G3CA 3ORMA 5EDPA 4ZOGA 3PRFA 4LL5A 4BR3A 1Y57A 5IPJA 4RIWB 2XIXA 4M66A 2G1TA 4FL1A 2SRCA 1ZMUA 1JSTA 5FTQA 2BAKA 2QOCA 5E92A 4Z7GA 3R8PA 5LVMA 3UZRA 3NW6A 3ZUUA 1F5QA 4PMSA 4DN5A 3VWAA 2C0OA 2X8DA 1XH4A 3NUAA 3IS5A 4EOMA 2YEXA 5GINE 2RFSA 4QP2A 2ZMCA 3SW7A 1ZWSA 3ANRA 4L01A 2UW5A 1WBOA 3OWKA 5FEEA 3PG1A 2I0YA 2XBJA 3QTUA 3O7LD 3MDYA 4LL0A 5K5NA 1CDKA 1OIRA 2EU9A 2UVYA 3FC1X 3K3IA 3RI1A 4AOIA 4E6CA 2I1MA 4IX4A 3C7QA 4NK9A 4BIBA 5IQHA 4RPVA 5BVKA 3ALOA 2QOOA 5AP6A 4QP4A 1OPKA 3VAPA 2BAJA 2O63A 4ARKA 2P0CA 4YNEA 1W7HA 3FZ1A 4CLIA 2HAKA 3MY0A 3RZBA 2PVYA 1KE9A 4BCIA 3RKBA 3F61A 4FKWA 3V04A 3Q2JA 3A61A 4MD8E 4F08A 2GHLA 5BVEA 3L1SA 4W9WA 5FGKA 2J50A 3MA3A 3QGWA 4BI2A 3LM0A 2R3PA 3MI9A 4GW8A 4S2ZA 4X3JA 3P5KA 4JQEA 4BDGA 2IZSA 2OFUA 3AGLA 3T3VA 3DJ5A 5DT3A 4F63A 2WU6A 4NFMA 4P7EA 4ALVA 3V5TA 3ZHPC 3HAMA 4YTIA 2E9OA 5EM7A 3ZTXA 4ZY5A 5EQYA 3PZHA 4TT7A 3UIUA 5IEXA 2XS0A 3U6JA 2B4SB 3SV0A 3QRIA 2XB7A 3NYOA 3WE8A 4NH1A 2QVSE 5KZIA 4I24A 2R9SA 3ELJA 4D5KA 1P2AA 3LXNA 3PJ2A 4TWOA 2WEVA 2CHLA 3A7FA 3QYWA 2R3NA 1AD5A 1SVGA 4Q9ZA 4E6AA 2PK9A 2WMTA 3FLNC 2KULA 4GFMA 4RGJA 3QC4A 5AP1A 3BE9A 4I22A 4E1ZA 5IH4A 3FHIA 4RJ6A 2OIBA 4CMOA 4APCA 3VRYA 2FH9A 3RP9A 1YI3A 3FPMA 2X2KA 3AXWA 3BZ3A 4FV0A 1O6LA 2PVJA 4EBWA 5IUHA 5B2LA 4LGDA 4UX9A 3L9MA 5EW9A 2BFXA 4W9XA 1REKA 2UW8A 4N4SA 4M0YA 3C4WA 5EHLA 3UC3A 4GMYA 1GZOA 4MXOA 1UU3A 3AT3A 3IGOA 5AV4A 3DBFA 3PUPA 4QP1A 2G15A 3NUNA 4BF2A 3HVCA 1OGUA 3BKBA 4FT3A 3R7UA 1NY3A 3I81A 4IE9A 5I3OA 3EN4A 3RPSA 2XK4A 2X9EA 3JXWA 3QA0A 4M8TA 4U81A 3V5LA 4MYGA 4GCJA 4ZZNA 4I94A 4MF1A 4AXAA 4D2PA 5HU9A 2PVRA 3MFSA 4RZWA 5A46A 3QQLA 3BLRA 5IA4A 3I6UA 1Q97A 2R3OA 2C3JA 5JRQA 4I6QA 4RIYB 5D7AA 4K11A 1OPLA 2QHMA 5A4LA 3FMKA 3UVQA 5FXQA 4G3DA 2ETRA 5ETCA 3C5UA 4RX5A 5FM3A 3TNHA 5JFWA 2Z60A 4S34A 5JT2A 3LFSA 3P86A 2DYLA 4A9SA 3G9LX 5C1QB 5J9ZA 3N51A 5K5XA 4MQ2A 2X7FA 4FE2A 4PDYA 5BYLA 4B4LA 2B9JA 5HG5A 4KKGA 4B99A 4IWQA 2BUJA 3CJGA 4GJ2A 2OGVA 2V55A 3R02A 1R39A 3E8EA 3QQGA 5HNBA 3BBWA 3RNIA 4EOOA 4YU2A 4U41A 5HICA 5J9YA 3KXMA 1E9HA 3VQHA 4C4FA 5CAPA 3CIKA 3VUIA 5JKGA 4AZVA 2R3LA 2FO0A 4JDJA 4KIOA 3ZMMA 5HTBA 5FUTA 3PG3A 5CU6A 4LRMA 4UXQA 2R3MA 5AUTA 4EONA 4M69B 1DAWA 5CAVA 4A07A 4AAAA 4H39A 4NIFB 4U44A 5HBHA 5M4CA 2WMQA 3ENMA 1O6KA 3DLSA 1YRPA 4MK0A 3VBXA 1EH4A 3FKOA 4O91A 5AUVA 2ZB1A 3MFUA 3M42A 4HYUA 5BPYA 3UPXA 3F5UA 3KK8A 3TTJA 2WB8A 5GNKA 2UUEA 2X39A 3UODA 3NUPA 4AP7A 2J9MA 4OTFA 2W1ZA 3DZQA 4O7YA 2ZJWA 3AOXA 4GIIA 4RJ3A 4GJ3A 1QPEA 2RF9A 1PRYA 3VBVA 4FTJA 3CPCA 3DKCA 4FIIA 4RVTA 5EKOA 1MQ4A 2P3GX 3W8QA 4F9CA 5HVKA 2ETKA 4UN0C 3IK3A 2J0IA 1M7QA 3OW4A 4EH5A 3BWFA 3RINA 1H1QA 4FTTA 4A4LA 4D58A 4BB4A 5EOLA 3GC0A 2C68A 3Q04A 4I3ZA 4RX9A 4XG2A 1PF8A 5GZ9A 5M4UA 4YSMA 1IASA 4IMYA 3F88A 4E4XA 3EL8A 3HUBA 3PXRA 4ZAUA 3L8PA 2V0DA 3OY3A 4F09A 2GFCA 4LQMA 2Y0AA 3OMVA 3BU6A 2GDOA 4WT6A 5LARA 2PSQA 3QKMA 4Y5HA 5HIBA 4FEWA 4DHFA 5E90A 4WG4A 3R1QA 4BGHA 3M1SA 4FTAA 4CT1A 2I0HA 2C1BA 3KN6A 3KKVA 4H1JA 4II5A 3HYHA 4WNPA 4YTFA 3RCJA 4ANBA 4E3CA 4JBPA 5FXRA 4UWCA 5AAFA 2XYUA 3QKKA 2UZBA 3B8RA 5ANOA 2UZLA 3IPHA 3Q53A 4ITIA 5CLPA 3PFQA 1QL6A 1ZAOA 1QMZA 2GNJA 4UMRA 2OZOA 4BZOA 3S2PA 2UW0A 3PA3A 4KABA 4ORKA 4FTMA 3TZ8A 1U4DA 3HV4A 3MJ1A 4QYEA 4I0RA 4CKJA 4BDIA 3SOCA 3BYUA 3UP7A 3IG7A 2ETMA 3I6WA 2W1CA 5GZAA 1G8SA 5LVLA 3JUHA 3IKAA 2ITQA 3HV6A 4FIEA 5AUXA 4B7TA 2B9FA 2C3KA 4KINA 3UVPA 2PVFA 3RPRA 4AW1A 4F70A 3DTCA 2BILB 2XNPA 2A19B 3L8XA 5EYDA 4TWPA 4EWQA 2JITA 1FVTA 3PPJA 4PMTA 2BROA 4PQNA 4FL2A 4X2NA 4HGLA 4EQCA 1U54B 3EZRA 4UYAA 5KKRC 4C33A 2OK1A 5AUWA 2QHNA 2ITVA 5EDQA 5HORA 3DGKA 4M14A 5CAQA 4C4JA 4JVGA 3TXOA 3MVLA 4FEUA 3VNTA 5L6OA 2GHGA 1JWHA 2PE0A 3BQRA 2PVMA 2W06A 4FZAB 4YPDA 3NYVA 4I0TA 3C13A 3QLFA 5F95A 5HG7A 5BYZA 1J3HA 2HXLA 2VTJA 3I5ZA 3R9NA 3AC5A 4DLJA 4EWHA 1MQBA 1WBNA 3Q4UA 4WG5A 2VTNA 2Z2WA 3PA4A 1OL2A 3DK6A 4OT5A 4XG7A 4WRSA 4AT4A 5I0BA 3KMWA 3H0ZA 4QYHA 2CPKE 3KCKA 4CQEA 3ZM9A 5TT7A 5KBQA 2WNTA 2B9HA 2XKCA 4FF8A 2WGJA 2YERA 3U9NA 4CG9A 4BIEA 3RCDA 4FT0A 4RG0A 4KBCA 4QTEA 2P33A 5DT0A 1ZYDA 3GC7A 3QX2A 3W55A 4OAVB 1F0QA 5DG5A 1XBAA 2JEDA 3EN5A 3ORKA 3QHWA 4MKCA 5JQ5A 5C4KA 1YQJA 3R2BA 2WTKC 1YXVA 2FVDA 1ZYSA 3TKUA 4FTIA 2YAKA 3ZO4A 2WTIA 4FKOA 4LV5A 3ROCA 5FLFA 3QQUA 5IQGA 3QWKA 3ZUVA 3EQDA 4FSNA 3PIZA 5M4FA 1R78A 4O7LA 3HGKA 3JY0A 4PL4A 4R8QA 2J0LA 3H9OA 3O50A 4M3QA 3ZS5A 4X7QA 4ACDA 4CZYB 2QNJA 4DTKA 2KTYA 4FSMA 4QMZA 3I1AA 1U5RA 5CZIA 4IZYA 1KUTA 4X3FB 3O8UA 3KULA 4FG9A 2ITPA 5ANJA 4NWMA 4TYIA 1VYWA 4JX7A 5DRDA 1PXLA 5F20A 3SX9A 3TUBA 5FTGA 2HWOA 4WUNA 3G33A 3UMXA 2QLUA 3LIJA 5F94A 3UOHA 4RT7A 2ZV8A 4DH1A 3COKA 4UBAA 3QD2B 5KUPA 3QLGA 1YDTE 3QTRA 5IQFA 1O9UA 3FXWA 4IJ9A 1KV2A 5AV2A 3FLZA 3KU2A 4FVRA 3RM6A 2E2BA 4MHAA 4Y72A 3VUGA 5KO1A 4BBFA 4D1SA 3V5WA 2XCKA 5IA5A 5CENA 1H1RA 2WOTA 2QU5A 4CSVA 4RLKA 3I5NA 4IB3A 4TZRA 5EI2A 2CN5A 1OI9A 4XV3A 3COIA 2HW7A 3B2TA 5F9EA 3NDMA 3HAVA 5DPVA 2CGUA 3IDCA 5CEPA 2BRMA 2X6EA 4CMTA 4MCVA 4XV1A 2E9UA 4BYIA 5JEBA 3GQLA 3NCZA 5KNJA 4W4XA 2X2LA 1L3RE 2GNGA 4QPMA 5H3QA 3G51A 5HHWA 2ZAZA 4UXLA 5CTPA 3L9PA 5HIDA 2C5VA 3M11A 3UNJA 3BV3A 5AX3A 2XM9A 4F1MA 3O51A 3G0EA 1SZMA 2WTDA 2WTJA 4RSSA 5HE0A 4DFYA 2GHMA 5CSPA 1OIYA 4ZLZA 4XG4A 3UGCA 5LOHA 4DG2E 2WAJA 2HCKA 4PF4A 1G3NA 4EH8A 2WIPA 3DLZA 2ZV7A 1IA8A 3TUCA 3TJDA 5HG8A 3LKMA 2BZHB 1SVHA 2QG5A 3E87A 3LCSA 4FKSA 2Y4PA 2J6MA 1H08A 3COHA 3OVVA 5A3XA 4QP7A 3EQRA 1BI8A 5E4HA 4R5SA 2UW9A 4IFGA 5HOAA 3QGYA 4QMLA 5DEWA 3TACA 4D0WA 4LRJA 1BL7A 4FYNA 4BWXA 3VS0A 4FSYA 3A7IA 2OH0E 3GCQA 5CNNA 5B0XA 3BHTA 3PXKA 4FZDB 5K3YA 2C0TA 4E6DA 3ZLYA 1B38A 2J4ZA 5DR6A 4IAYA 4RJ4A 3PVBA 2QR7A 4HYHA 5CQUA 4YBJA 2CJMA 4CT2A 4JIKA 4HPTE 4NW6A 3PSCA 2R4BA 1K9AA 2I0VA 2JDSA 5AIKA 3D5XA 3ETAA 4IVDA 5D9HA 4LMUA 5F1ZA 2OLCA 4L8MA 4ZTHA 1YWRA 1FQ1B 2OIDA 5I9XA 1XR1A 3VS7A 3SXFA 3SA0A 3NAXA 4XLIA 2ZV2A 5KE0A 3TV6A 4O84A 5E8YA 2XKFA 1Q99A 3ORXA 2YIXA 1PXKA 4I92A 2I6LA 2NNWB 4YJRA 4YHFA 4GS6A 4YLJA 4JG6A 3VS2A 3OROA 4L3LA 3OCGA 5CSXA 3TCPA 1K2PA 4FICA 1URWA 3WILA 3CQEA 5C8KA 5FM2A 2WMSA 5AWMA 1GNGA 1KOBA 5I5ZA 2YM3A 3F69A 3TT0A 3E8CA 5M56A 5M57A 3MVHA 3U6HA 4O0SA 4XHKB 4DT9A 5HO7A 2BMCA 2OXYA 4ZJJA 4DEAA 3HV5A 1GZKA 4NM0A 1OUYA 4U43A 3CPBA 3ZDUA 3CS9A 3L8SA 4L46A 4LMNA 3WF8A 4FV3A 1PMNA 3QA8A 4K8AA 3S00A 3HUCA 4X6RA 1H26A 5ACBC 1W82A 5J5SA 2W96B 4KUJA 5AAGA 1TQPA 3S3IA 3V5QA 4DC2A 3D0EA 1OIQA 3I79A 4W4VA 4GG7A 4QD6A 2YAAA 4XP3A 3V5JA 5CYIA 5HBEA 5IG1A 5LWMA 2BKKA 2ITOA 3DBQA 3F2AA 4QP3A 2OZAB 4U42A 3ZUTA 1ZYLA 1VR2A 4KSPA 1OKZA 4A7CA 4F1TA 4TYGA 2BIKB 2XM8A 5CWZA 2WMWA 5AP7A 2O3PA 4FOBA 1JQHA 2P2IA 2Y7JA 3R9OA 1V1KA 3BPRA 5IH6A 2LAVA 4D0XA 5IA0A 3TG1A 4J95A 2YISA 4OW8A 5IDPA 2Y6MA 2XKDA 4P90A 4YZBA 4C58A 3DFCB 3KFAA 3CGOA 3OHTA 1H0VA 4RJ8A 1YHWA 1T46A 3LQ5A 1Y8YA 2W7XA 3CGFA 1URCA 1UKHA 3F2NA 4IAFA 1PYEA 4FTNA 1XBCA 1ZY5A 3FBVA 1WMKA 2JBPA 3A7JA 4FTLA 5EFQA 4YO6A 5DFPA 3UE4A 3VULA 4CFXA 2PZRA 4MBIA 4E7WA 1J7LA 4I41A 4TYJA 4UMQA 4DH3A 1ZMVA 5CSHA 4C59A 1FMKA 4CVAA 1Q4LA 2PZPA 3DT1A 4A06A 4C4HA 5CAUA 3PJ1A 3BU3A 3ORZA 3HMMA 3HMOA 4H36A 3OWPA 5HE1A 1TVOA 3NS9A 3GI3A 4FSUA 3VW8A 3GUBA 5LMBA 3ATSA 3JVRA 3PVGA 1YWNA 3I7BA 5CF5A 2WQOA 2W9ZB 5K9IA 1WBVA 4EZ3A 3MESA 2C30A 4FNXA 4J52A 4DTAA 4GK2A 5ETFA 3QXPA 3R01A 4ZS0A 1FBNA 2V5QA 4I4EA 4FIJA 1M17A 4RIYA 4ALUA 4DITA 3GT8A 4IAAA 3RMFA 3T8OA 4FX3A 4Z55A 4FSTA 5IU2A 2RGPA 5FWKK 3ZXZA 4Y83A 2VTAA 4FZ7A 4UMUA 4F65A 2UW3A 3LFQA 3RPYA 4BI0A 4KBKA 4QMOA 4O27B 4YTHA 4ANOA 2WFYA 2F7ZE 3SAYA 4BGGA 4C3PA 1BYGA 3F3UA 3IOPA 4CMUA 4TNDA 4LOPA 3ZLWA 1IR3A 3OTVA 4Y85A 4HVDA 3LXKA 5CF6A 3WF9A 3F6XA 3H10A 4EOIA 2IG7A 4ONAA 4FNYA 4BDBA 1UWJA 4BKJA 2XIKA 3BEAA 4FTQA 5IMEA 3NUXA 4IBMA 3DA6A 3EQCA 1I44A 4EH3A 4M69A 4IX3A 5DBXA 2JIVA 2X2MA 3F3ZA 4NIFA 5JGDA 4O0UA 3JY9A 3QUPA 4P5QA 4A9YA 5J1VA 4RWIA 2PUUA 3EN9A 5IEVA 4B8LA 4K2RA 4ZSAA 3S0OA 1B39A 3L9LA 5DI1A 3E62A 3WI6A 3ODYX 2VWZA 2XUUA 4G31A 3RPOA 4D1XA 5J95A 4F1OA 2X0GA 5AA8A 5E8WA 2Q0BA 2H9VA 4ZZMA 3ATTA 4PUZA 3BGQA 3RAWA 2W0JA 2HOGA 4PTEA 2JFLA 4PMPA 2W5HA 2DUVA 2UVZA 4L68A 3K5UA 2R3FA 4U97A 3AMBA 4GH2A 1E1XA 3D7TA 4C8BA 2XK9A 2CNQA 3NNWA 2PUIA 2R0UA 4OUCA 3TKIA 5GJFA 4AN3A 4BZNA 1H1SA 4AE6A 3IW8A 4G9RA 4JI9A 2QOLA 2C4GA 1A48A 3DQWA 3GQIA 5HGIA 4JDHA 3D94A 2WTCA 4P4CA 3F3VA 3KF7A 4D2SA 5A54A 3P7AA 4U9AA 4DE4A 3R1SA 2HZIA 3TEIA 4HCTA 5LXMA 4D4VA 2IO6A 4Y95A 4ZTQA 3FXXA 1IAJA 3MVMA 4AWIA 3SD0A 2FB8A 2OXDA 4ZEGA 3MW1A 3DDQA 4DCEA 2IZTA 3LJ0A 3OXIA 4BCPA 4CD0A 5BUIA 5LMAA 3HZTA 4YR8A 4PPCA 4EH6A 1OL7A 3MA6A 1BLXA 3EMGA 4O7VA 3LXPA 4CZUA 4X2JA 2PVLA 1YOLA 3NX8A 4BDHA 2WKMA 5AUUA 4HVSA 4MD7E 4W4YA 3IONA 2YDIA 3DNEA 5D1JA 2R5TA 3FZPA 3IDBA 3GXLA 4DH5A 3QC9A 4QTAA 4AA5A 2PHKA 3FI4A 4JLCA 2ITYA 4ZJVA 3LJ1A 5AR3A 4BTFA 1S9IA 1UU7A 4FKJA 4TYEA 2RFNA 1TQIA 4E5WA 1KE7A 4OT6A 4C62A 2VWXA 4Z7HA 2Z02A 5ETIA 4FR4A 3OZ6A 4OAUC 3F7WA 1XH7A 2FA2A 2CNUA 4IWOA 3OT8A 3QX4A 1WBWA 3AQVA 4FK6A 5HX8A 3HKOA 4IAZA 4PNKA 4FUXA 5KMJA 4J1RA 4G5JA 2O64A 3ENHA 4K0YA 2BALA 3R30A 2BRBA 2HZNA 4X2KA 4FA2A 2PYWA 5KHWA 3BLQA 2PWLA 3A2CA 2B9IA 4IWPA 4N57A 4NM5A 3AG9A 4M67A 4HCUA 1DAYA 4BCFA 2GQSA 2W5BA 2YM6A 4FKIA 2WD1A 4A9TA 4DBXA 1U54A 3IO7A 2HK5A 4IZAA 2UVXA 4RC3A 4LV8A 4IX6A 4YBKA 4XOZA 2QD9A 4RVLA 4KBAA 2GNIA 1Q8TA 4Q2AA 3QUDA 3ZOSA 4BZDA 3SOAA 3R04A 4KRCA 5CI7A 1P14A 3FZOA 4X6QC 4ZSLA 4AQCA 2QOBA 2YIWA 3NYNA 3QKLA 4FV5A 4QMVA 2PUNA 4HNIA 3R7OA 3KMUA 3V8TA 4EK8A 5AP3A 2P4IA 2V62A 3MYGA 2O2UA 4XX9A 2Y9QA 1UVRA 2Y8OA 3MH2A 3QUEA 4HCVA 5TF9A 2IJMA 2J7TA 4MQ1A 5D11A 4APPA 5EM5A 3LVPA 2PL0A 4ITJA 5BYYA 1Y91A 3CQUA 3ACKA 3JPVA 3U87A 3O2MA 5FP6A 3CLYA 5HESA 2JD5A 3VHEA 3DU8A 2ITZA 3VIDA 2ZMDA 4XEYA 4YHTA 4HGEA 1H28A 2YABA 4O83A 5GIOE 3DB8A 2J5FA 3PWYA 4CG8A 2HY0A 2B0QA 4ZTNA 4ENXA 2OG8A 3OF0A 4O21A 4D1ZA 4R78A 2Z7SA 3K5VA 1VZOA 4BBMA 4I5MA 2XIZA 4USEA 3EQHA 3W2SA 3KY2A 3DAJA 4XMOA 3WBLA 4QYYA 3GU7A 3ZFMA 4MEDA 3FY0A 2V7OA 1V0PA 2CCHA 4FGBA 2QO7A 4AZSA 1LP4A 3QRJA 4RFYA 1KOAA 3FLSA 4NFNA 2OJJA 2HWPA 2G2IA 3HMPA 4DFUA 3H30A 1SNUA 2NPQA 1FMOE 2W4JA 3R0TA 4DT8A 3EB0A 3NWWA 3TIYA 4FTOA 4O0XA 5AR4A 4DFXE 3ZRMA 2WMAA 2F4JA 3FQSA 4ERKA 4EZ5A 5HE2A 3K2LA 2REIA 5EDRA 4BDCA 4Z9LA 4U3ZA 5AA9A 4GVJA 2GFSA 5CT7A 4X3FA 4EJ7A 4BBEA 2ZV9A 3GU5A 3W1FA 5CZHA 4CYIA 1LEZA 2A2AA 2VZ6A 3EZVA 1WAKA 4OBPA 3D4QA 1Q8UA 5FG8A 4X0MA 3F9NA 4KS7A 2B54A 4BCHA 3ZCLA 4AS0A 2BCJA 3UIXA 2FUMA 4G1WA 4EOLA 5AM7A 4YUQA 3EQBA 4AZWA 3MPAA 3P08A 3KN5A 3VUKA 2NRYA 3DDPA 4FL3A 3LOKA 4IM3A 3BE2A 4UYNA 4S32A 4A4XA 5C8NA 2CGWA 2J51A 2VWWA 4U40A 1DI9A 4MNEB 4XH6A 2XMYA 3BX5A 4N6ZA 5FBNC 1HCKA 4ZJIA 3V6SA 3ORPA 3QFVA 5JN2A 5HVYA 4BCKA 2EWAA 4JG8A 5L2IA 3H4JA 1K3AA 2XBAA 3NSZA 3I4BA 4HOKA 3QD0A 5M51A 4D9UA 3KB7A 3ULZA 4D28A 4I23A 2X7GA 4I0SA 3KRWA 4LGGA 3A4OX 4F9AA 5FBOA 4KRDA 4FVPA 4EOPA 4L67A 2R2PA 5D7VA 4HGSA 3UC4A 4RIOA 3WYYA 4JR3A 3LM5A 4GRBA 5FEQA 1Z9XA 4G16A 4G3EA 4UV0A 2C6EA 1MRYA 4E8AA 2VTPA 3UZPA 2BRGA 2AUHA 3BYOA 3VUMA 5TE0A 3EHAA 4MNFA 2QOQA 3TZMA 1R0EA 2QR8A 4WA9A 3BYVA 3GVUA 4USDA 3VJNA 3A60A 2F9GA 3TI1A 3SXSA 3N4VA 3T9TA 1Y6AA 4LM5A 3TM0A 1PKDA 5HNGA 5E8XA 1PXMA 1ZOHA 4J97A 3TKHA 5IMXA 1OL1A 3EYHA 3KRXA 3MGYA 1PJKA 4U3YA 3BRBA 5CY3A 2JAMA 3V8SA 2OU7A 2XKEA 2UZVA 2VTLA 1BMKA 4IADA 4IDTA 2UW6A 4L42A 4YJPA 2CCIA 3RHXA 3UQGA 4J99A 3MTFA 3LMGA 1NT2A 1BX6A 3AD4A 2H96A 3WARA 4MX9A 4DINA 2XNNA 4AA0A 5IQEA 3BLHA 2OO8X 3OG7A 2X8EA 3D7TB 3DKGA 2BDJA 4C02A 5E8VA 4IM2A 4QP9A 5CVHA 2GSFA 4ZP5A 3FAAA 5EM8A 2QU6A 4ZTSA 4BN1A 3UDBA 2WHBA 5L6WL 4QP8A 2I0EA 5B2KA 1G5SA 2PU8A 3OEZA 3GC9A 4MXYA 3VBTA 3ZFYA 4QNYA 3FKLA 3PVUA 5TO8A 2JIUA 2PVNA 2XNEA 3AC8A 3IW5A 4PPAA 4PNIA 2VWBA 5AUYA 3EH9A 5JQ8A 3S95A 1RW8A 4F64A 3HP5A 4FMQA 2XRWA 3FMJA 1BL6A 3LQ8A 2UZOA 4OTRA 1IEPA 3PE2A 3W8LA 4BCJA 3ANQA 2YWVA 5JFXA 4EJNA 1OBDA 3LHJA 4JG7A 2ERKA 3E5AA 5DYJA 4O0TA 4CFVA 1OITA 3FYKX 4IVAA 3MH3A 3W18A 4HGTA 4BCMA 3EQPA 4TL0A 4O6EA 5AAEA 2WMBA 1P4FA 1REJA 5EKNA 1V0BA 4C4GA 5AR8A 2EXCX 4HYSA 3JR1A 4DFNA 3O17A 3CTQA 3OD6X 5I9VA 1M52A 3GCUA 2FYSA 2OBJA 1Y6BA 3CY3A 5CX9A 3HA6A 3ID6C 2OZAA 2XNMA 4IVBA 4K77A 4QYGA 4C38A 4D55A 5AFVA 4QT1A 4XBRA 4GKIA 2BPMA 3GEQA 3MIAA 5J7BA 3LFAA 2C6KA 3P0MA 3RK9A 4FSZA 4IC7A 1W83A 2ZB0A 5ACKA 4FUYA 5T6KA 4F9BA 3OXZA 3QL8A 3FYJX 2PMLX 4AT3A 4FIHA 2R3IA 4PPBA 4OTHA 2CLXA 2WPAA 4XJ0A 3UG2A 4X21A 3H9FA 3SKCA 4R7IA 4QQJA 4M12A 1R3CA 2GNFA 3AC4A 4YZNA 4FTRA 4JJRA 4O22A 1HOWA 1NVSA 3FMDA 2PZYA 5E1EA 4YZ9A 4QTBA 1FGKA 4FEQA 4GUBA 3R8UA 3RJCA 4F6UA 4FC0A 4FV7A 2QO9A 4EYJA 1OL5A 3RHKA 4JS8A 2ZDUA 4FTKA 2X8IA 1YDRE 4FI1A 4QMNA 5A4TA 5AM6A 3C9WA 4I5HA 3E93A 2ZM4A 2CLQA 3QQFA 4V0GB 4Y5QA 3CCNA 1YW2A 2A0CX 3FI2A 1YVJA 4I5PA 4RX8A 4NW5A 4B8MA 2IW9A 3BGPA 3B2WA 1JAMA 4O86A 5DEYA 2ESMA 3DPKA 3LFEA 3NYXA 2VO7A 2HW6A 1JOWB 1Q8WA 3MH0A 3NW7A 4OTDA 1Z57A 3RNYA 3TTIA 2OF2A 2GS2A 4GG5A 4FKPA 4C3FA 3COMA 5TOZA 2XRUA 3KVXA 1CTPE 2B52A 4HW7A 2EVAA 5IKWA 3ZRKA 3R7GA 1KSWA 1ZY4A 1IRKA 1ZMWA 3FE3A 3PJCA 1PKGA 1PXJA 3R8VA 3BIZA 5L3AA 3U55A 3K3JA 2CGVA 2PTKA 2BDWA 3DQXA 3H3CA 3ODZX 4ALWA 1ZYCA 2VX0A 2VUWA 4BDDA 4O7NA 3T9IA 2W1IA 4V01A 3CC6A 1Q3WA 3NPCA 3R1NA 3C50A 1GIHA 4ACGA 1CM8A 3OWLA 3DBEA 4I6BA 3W10A 2CDZA 3FMNA 1ATPE 2VTHA 4YZMA 2CKOA 2GNLA 3OBGA 2HELA 3IQ7A 2O5KA 2GMXA 2IW6A 3AD5A 5ANDA 4YJUA 5AIRA 5DOSA 5DRBA 1GZ8A 2OF4A 4EORA 2WELA 4NU1A 4WSYA 1RJBA 2RL5A 3DK7A 3LQ3A 4BY9E 4NL0A 4J98A 4RJ5A 1B6CB 2VN9A 4U8ZA 4EC8A 1KV1A 2J0JA 4TTHB 3V01A 4I6HA 3QZIA 5TR6A 1M14A 5CEOA 4O82A 1W98A 4UY9A 4XLVA 3HMNA 3EKKA 2W9FB 5L2QA 3RVGA 4AGCA 3FQEA 4F7LA 5HX6A 4O7SA 5AEPA 5AJQA 4KIPA 5GJGA 4ANNA 3WIGA 2W1DA 1AQ1A 4NZWB 3D5VA 4YJVA 5DLSA 3ROYA 1UV5A 4MAOA 3POOA 4AACA 3KMMA 1GY3A 3FXZA 4E73A 4OLIA 2VO6A 3WF7A 1GJOA 1T45A 3D5UA 4L52A 4C57A 2BDFA 4KKEA 5EM6A 3HX4A 4F6SA 2C5XA 3SVVA 5GHVA 2JKOA 2W5AA 1LUFA 1R1WA 2RIOA 1JKSA 1JKLA 3M2WA 3PWDA 4WHZA 3R7IA 2WQNA 5A14A 5I9UA 5L2WA 3DXQA 2XH5A 4QMTA 3MV5A 3MS9A 3ZU7A 3HL7A 2BTSA 1ZZLA 4GT3A 5IISA 4KIKB 1SMHA 3GFWA 5F4NA 1UU8A 4NKSA 1R0PA 2WTVA 4YTCA 3GCVA 3C51A 4L3JA 2YIYA 3MTLA 5FXSA 1XJDA 1STCE 2J0KA 3A7HA 2XVDA 3B8QA 4EBVA 3Q96A 3Q9WA 3UMWA 1SM2A 3KVWA 3LPBA 4MD9E 2CSNA 4BCQA 4U0IA 2ZOQA 5KMNA 4GYIA 2CGXA 4GYGA 3I0OA 4GT4A 5EG3A 4E4MA 4ZTRA 5IUIA 4XCUA 5C8MA 3ORTA 4OTQA 2R7BA 3WF6A 4WIHA 3QRTA 2O65A 3EOCA 4J53A 5AR5A 4HVHA 3UQFA 3N4UA 4G17A 4LG4A 3DAEA 4DEIA 4JXFA 4PTCA 4MWIA 4XBUA 3HV3A 3R63A 1JBPE 4IHPA 3ORLA 3QCXA 5JZNA 4FZFB 1ND4A 5CEKA 3QCYA 3EFLA 2WXVA 4R3PA 3SRVB 3PPKA 3D9VA 3I0QA 5ANEA 3PVWA 4CFMA 5H8BA 1IG1A 3E92A 4EYMA 5KMOA 2DS1A 3VS4A 3D2IA 3UJGA 3ULIA 5EW8A 5AP0A 2ACXA 2ITWA 4O7ZA 4FBXA 1SNXA 4S30A 4U80A 3QZGA 4FV6A 3R8ZA 3TDVA 4QMWA 5M09A 4RQKA 4F7SA 3OCSA 3QD3A 3FZSA 3NRMA 4WO5A 2IVTA 2UZEA 2VV9A 1LEWA 3RAHA 2ITNA 4BDJA 1H27A
chains in the Genus database with same CATH superfamily
3CBLA 4QPAA 4YJNA 3HNGA 4BCGA 2JKQA 2G01A 3RPVA 3GENA 4I93A 4WBOA 4FZ6A 3ZONA 5E9EA 1WZYA 4RIXB 3R8LA 4GSBA 4FV9A 4FSWA 2JDTA 3ITZA 2Z7LA 1XQZA 1OGYA 1BKXA 3LW0A 4JNWA 4RVKA 5H8GA 4EHGA 4EC9A 3R1YA 4UMPA 4EH2A 5AV1A 5HLNA 3PSBA 4RWJA 3C4CA 2XA4A 4LOQA 3SC1A 2OJIA 3HRBA 4MBJA 5CEQA 3L9NA 3TNQB 1RE8A 5L2SA 3LMIA 4BTMA 4WNOA 2W1EA 5DA3A 1Q5KA 4UEUA 4AUAA 3LCTA 4G3FA 4FSQA 4CRLA 1DI8A 1OKVA 3C4FA 3TL8A 3SG8A 4L3PA 4BTKA 2BKZA 3C0GA 5IQIA 4TNBA 3WIKA 1MRVA 2OICA 4X2GA 4NT4A 4F99A 1VEBA 2V22A 2XJ2A 3CE3A 5AMNA 5AR2A 3SHEA 2JC6A 3Q5ZA 2QKWB 2PULA 2IZUA 4AGDA 4CTCA 4F9WA 5CU4A 3O0GA 3G9NA 5AP5A 2W99B 3MFTA 3OCBA 2RFEA 4MVFA 1XWSA 2VGOA 5G6VA 2WOUA 3BGZA 5HD7A 4EK5A 2RG5A 2UZUE 4CV9A 2B55A 4MXCA 3P7CA 5BVFA 2JFMA 4F0IA 4MH7A 5A4QA 4JX3A 4YNOA 5BMSA 3A99A 3OCTA 3VF9A 2YCRA 3W33A 3UDSA 2XJ0A 4EOKA 4F0FA 1FVVA 3FLQA 5JGAA 1VYZA 5E1SA 3OP5A 3LCDA 4IB0A 4TRLA 2C5YA 2UZDA 1PXNA 5FP5A 3FL4A 4DYMA 2X9FA 1W8CA 4RQVA 5D41A 3UO4A 3F82A 4QMXA 5DT4A 2IVVA 4JAIA 4NUSA 3FEGA 4O7RA 5CXHA 4BVUA 3UOKA 2YCQA 4BHNA 2C0IA 4FG7A 4FT5A 3U8WA 3O8TA 4IDVA 3NIEA 4IANA 5EYCA 4MNEA 4GT5A 3EQFA 4ZZOA 3PE1A 2JBOA 2BHHA 1W2FA 4ID7A 4M0ZA 4EQMA 4H05A 5A6OA 4K33A 2JLDA 4FVQA 2ZM1A 4QTCA 4H3PA 5HCXA 3HEGA 4WSQA 3VO3A 1OBGA 4E4LA 3VC4A 2C6DA 3O96A 4IIRA 3KL8A 3H0YA 4IEBA 4PDOA 4ZSGA 2W1FA 5EHOA 2RFDA 4FKTA 3D14A 2JDOA 1H24A 1TKIA 4KWPA 4D5HA 1J1CA 1Q41A 4FKGA 2BFYA 2F57A 2GQGA 4NEUA 3G0FA 5DH3A 1MP8A 3UO6A 3ML1A 5AV0A 1UNGA 3R22A 4FNWA 2YZLA 1JVPP 2XK6A 1OUKA 1ZLTA 1RQQA 3QQJA 1WCCA 4R6VA 3FMHA 1UWHA 3QD4A 5HE3A 5M07A 4UB7A 2PPQA 3NEWA 1YHSA 4JOAA 3ZDIA 4DEDA 3KXZA 3EFKA 3EQGA 4AZTA 3P79A 3C5IA 5EHYA 2IN6A 2FSLX 4PY1A 3KXXA 2A27A 3R7EA 4FTUA 3UYSA 4BCNA 2VTQA 3Q9YA 4IB1A 4E26A 5BVOA 5M06A 4BWKA 3AMYA 4C37A 4AN9A 4EUTA 5CASA 2W1HA 2FSTX 5AV3A 2R0IA 2BHEA 2VTTA 1DS5A 4AOTA 2BZIB 4FV2A 4WG3A 2X4FA 2GTNA 2OJGA 4QMPA 4XYFA 4LGHA 5T68A 4X3FC 3W32A 5IA3A 1FPUA 1YOJA 3MPTA 3QTSA 4IAKA 4R3CA 1WVXA 2ITUA 4RWLA 3JVSA 4I1ZA 2GS7A 4RWKA 3EL7A 3TNIA 4TY1A 3UTOA 4PX6A 1GOLA 2O8YA 1P5EA 3EFWA 3DK3A 1NW1A 4AFJA 4F6WA 2IWIA 2BTRA 3RZFA 4EQUA 3LMHA 4R77A 4E5BA 2VWUA 2AC5A 5CU2A 2VX3A 2Z7RA 4M7IA 5M4IA 3WYXA 2C69A 1ZARA 2QODA 4I5CA 4ZY6A 4L9IA 3PSDA 5FQDC 3VS5A 5BVNA 2BR1A 4GU9A 4DEBA 3QF9A 4A4OA 5CALA 2HZ0A 2X0QA 4CFUA 5JK3A 5CU3A 4BYJA 2WO6A 1M2QA 5CANA 2VGPA 3ZSGA 3KRLA 3DS6A 5LCKA 4O0YA 3AMAA 3O23A 4C34A 3AT2A 3QTWA 4TXCA 1JKTA 4PRJA 2DQ7X 4O0WA 4XG6A 3QHRA 3FI8A 3E8NA 2ZM3A 4M15A 1YWVA 4EHZA 1J1BA 4QP6A 3Q4ZA 5DMZA 4IZ7A 2F2CB 5FD2A 4GK4A 3DCVA 5CSWA 3W2PA 2YA9A 4ZY4A 5CF4A 5IQDA 3VUTA 3OUKA 3W0NA 3N9XA 2X4ZA 3OS3A 2YDKA 2OJ9A 4N0SA 3U54A 3PY3A 5HG9A 1YHVA 3ZLXA 3MPMA 4XUFA 1OL6A 2UZWE 2OKRA 1RDQE 1W2CA 3EWHA 3UOJA 2WMXA 1VLRA 3QTQA 5EYKA 3G2FA 5IH5A 5J79A 2YACA 5HLPA 4B6LA 3UVRA 3HMIA 3VW6A 3PYYA 3ZH8A 2QQ7A 3CQWA 4E4NA 4AE9A 3C0IA 5I9WA 2YM8A 1M2PA 1OB3A 5T3QA 4CTBA 4I4FA 2R64A 5D10A 4EEVA 4N70A 4KNBA 2JGZA 3CD8A 4IACA 1VJYA 1SVEA 1QCFA 3F5PA 3PA5A 4O4CA 5FEDA 5KZ0A 2DWBA 3FMLA 3DNDA 3MJ2A 3G5DA 1PYXA 4FK3A 2C3IB 4EK4A 5KKRB 3AKLA 1I09A 3R73A 5L8JA 4ZMEA 4XG9A 4QMUA 4C61A 4KIQA 4DGMA 2XP2A 4H3BA 1GZNA 3Q5IA 4P5ZA 5ANIA 4DFLA 3W0MA 4CCBA 5A9UA 4NM7A 3ZO2A 2Q83A 3DY7A 3LJ2A 3PTGA 5LVPA 3Q2JA 4ZTMA 5EK7A 5AP2A 5FDXA 3HP2A 2ZYBA 3ZEPA 3RK5A 4FT9A 4ZIMA 1JLUE 1V0OA 3MH1A 4RRVA 3PLAE 4QTDA 4ACCA 4V0GA 5HD4A 3UZTA 2VRXA 4C2WA 3D5WA 5G1XA 3ZSHA 5CU0A 4YLLA 4HYIA 4BDFA 2W17A 4AW0A 1J91A 3FJQE 4NKAA 3D7ZA 4AFEA 3CKWA 4BDEA 4G6OA 3CY2A 3RTPA 5HVJA 1M7NA 1ZZ2A 3BQCA 3KXHA 4JAJA 5CVFA 3LZBA 4AX8A 3KK9A 2WTWA 3N4TA 1WFCA 2UV2A 4QPSA 3F3WA 4ANMA 4BDKA 5E91A 3DOGA 1AGWA 4AF3A 1J7IA 2J0MB 2O0UA 2JIIA 2E9VA 2JKMA 3C4ZA 4QOXA 4WNMA 4YJSA 4DHIB 5J87A 4YP8A 3TV4A 4EKLA 1L8TA 2WTKB 2VO0A 2VX1A 5DN3A 5AX9A 2CKPA 3F66A 2QO2A 3QZFA 4U45A 4ZSJA 2QURA 1HCLA 2F49A 4ZK5A 4IB5A 3TZ9A 4C4EA 3WOWA 2WQMA 4D2VA 3V8WA 4BHZA 2ONLA 2X81A 5ITAA 3LE6A 5C4LA 3FL5A 2X6DA 4H58A 3REPA 1CSNA 3QZHA 3LFDA 4D9TA 5CEIA 4I21A 4J8NA 4HNFA 4O2ZA 2WMRA 4RBLA 1Q62A 1WVWA 4CRSA 4EZ7A 2VTOA 4RX7A 4YZDA 1ZOGA 4I20A 2IW8A 3POZA 3OBJA 3NNUA 2HY81 3P9JA 4XV9A 5K4IA 2XF0A 1XBBA 4DGGA 4OTWA 3DFAA 2XIYA 4ERWA 3R28A 5HBJA 2YDJA 4DBNA 3EN6A 4CFNA 3A4PA 1BI7A 2X1NA 3S1HA 3DTWA 2J2IB 4TYHB 2R3JA 4DAWA 4D4YA 3A7GA 4MXZA 4K6ZA 4NCTA 2XCHA 3W2CA 3F7ZA 4MF0A 1XHAA 3G90X 1Z5MA 2Y4IB 3DXNA 2QOIA 5EH0A 5AP4A 1WBPA 2X7OA 2XANA 3P4KA 4NTSA 3TIZA 5HZNA 5FRIA 5LMKA 2QG7A 3FQHA 3FMMA 5DR2A 4BGQA 5HNIX 3LLAA 3BHHA 1YDSE 3BI6A 3ET7A 5CS6A 3HLLA 4BKYA 5BQ0A 3MVJA 5IQAA 5H8EA 2ERZE 5HEZA 4W8DA 1FGIA 5IQCA 4LRKA 1ZRZA 1XO2B 3UP2A 2Z7QA 5GZ8A 2IF8A 4IM0A 3W2RA 2PZ5A 4G6NA 4KIKA 1TFFA 3ZO1A 2X0OA 4IFCA 3CD3A 1YXUA 3TWJA 3UBDA 4DH8A 2YWPA 5DHJA 3QYZA 3I60A 4L44A 2B53A 3FZRA 4C36A 3O5AA 3R9RA 5CNOA 3RBWA 2WEIA 3RM7A 1YOMA 4ITHA 2XNOA 3OTUA 3UYTA 4DA5A 2XIRA 1WBTA 4RA5A 3KRRA 4CQGA 3W0RA 3QQHA 4OR5A 1OIUA 3OY1A 5J9LA 3FI3A 3D83A 4QQCA 5EQPA 1CKPA 2RSVA 3ZM4A 2YCFA 4Z16A 4IXPA 4C3RA 4AXFA 4E6QA 4O2PA 1FVRA 1PMUA 3FZTA 1YXXA 2LGCA 5L8LA 3O8PA 5BVWA 4XRLA 4C7TA 4O6LA 4EOJA 2NP8A 2XZSA 4CGAA 3HRFA 3QCSA 1KE8A 3QALE 2OI4X 3H9RA 1JKKA 3GFEA 1NVQA 3DZOA 3OC1A 4AXEA 3NUSA 5LJJA 3ZBXA 2ITTA 5HI2A 3SRVA 5LWNA 1JNKA 1FINA 5ANKA 1LR4A 1ST4A 3KEXA 1UKIA 3U6IA 2GU8A 4BRXA 2NRUA 1Q8YA 2HIWA 2H34A 2QCSA 4FYOA 1JSUA 3FPQA 2Y6OA 4AZEA 4BDAA 4QQTA 4USFA 3UIMA 1J7UA 4PL3A 4AW2A 5C9CA 5BX0A 1H0WA 3T3UA 2R3HA 2PUPA 2UZTA 3BEGA 3E64A 4IZ5A 3NW5A 4YPSA 2WQEA 4NTTA 5DR9A 4QDEA 4EH7A 4OTIA 4IJPA 4O7TA 4Y73A 2A4LA 2BZJA 3LAUA 5JFVA 3GB2A 3FSFA 3Q52A 2C6TA 3Q2MA 4L53A 4O96A 4TN6A 3QXOA 3F5XA 3UIBA 3BBTB 5J1WA 3A8WA 3KREA 1UNHA 4RIXA 2C1AA 4BWPA 3OFMA 4CLJA 4O0RA 5A4EA 4RVMA 3QAME 3WF5A 5IQBA 4M97A 3A8XA 3LLTA 4PDSA 4CXAA 5L2TA 3MN3A 3R9DA 3Q4CA 2YN8A 3SQQA 5TKDA 2QOKA 1XH9A 4BI1A 4AN2A 2PMIA 1Y8GA 5B2MA 5GIPE 3ERKA 5L8KA 1A06A 3QTXA 4JIAA 3QCQA 4MBLA 4Q5EA 3TDWA 3NUYA 5IF1A 2E9PA 4FKQA 3E3PA 4L00A 5DWRA 2XK7A 4E20A 4FTCA 1H8FA 1Q61A 1YXTA 2OIQA 5ANGA 5FTOA 3DBCA 4BIDA 2UZNA 4Y8DA 4XG3A 3DKFA 3QBNA 4M68A 3OOMA 4HJOA 3WZJA 1CKJA 3PXZA 2QC6A 4G9CA 5K4JA 4CYJA 3UDTA 5C01A 2HXQA 3MB7A 3LCOA 5AUZA 5HKMA 4LV7A 3TNPC 4FV1A 4AA4A 2W4OA 1H1WA 1O6YA 2YLEA 3ZEWA 1G8AA 4D4SA 3R2YA 3BELA 5E8UA 3ZSIA 4XG8A 1APME 2CMWA 3A62A 3CXWA 3VQUA 4ASEA 4HVIA 2YCSA 4MXAA 5HU3A 4DGOA 3GOKA 3PY0A 4XOYA 4J8MA 3AD6A 2GTMA 2QKRA 2RG6A 3OEFX 3E8DA 4JBQA 5HCZA 2XK3A 3OW3A 3DV3A 4F4PA 3OT3A 2FSMX 1U59A 2VNWA 3FHRA 2BRNA 4G2FA 3VJOA 5JRSA 3V3VA 4RFMA 4Q5HA 3Q3BA 2GS6A 1YKRA 3SXRA 5E7RA 2EB3A 4YHJA 3IGGA 2YHVA 2P2HA 2YLFA 4YGAA 4EOSA 4HVGA 3P1AA 4IW0A 3NR9A 4FT7A 2JKKA 2PVKA 3DJ7A 3NZ0A 3R00A 4FSRA 3VBQA 4G34A 3ZZWA 4F0GA 5IEYA 4CV8A 3CEKA 4G6LA 3ZC5A 4C2VA 5JFSA 3MBLA 4LYNA 5JMSA 2QOHA 2VWYA 4WBBB 4U7ZA 2G2FA 4TPTA 4XS2A 5EYMA 4HZRA 3RAKA 5IDNA 5L4QA 5KMIA 4S33A 3VS1A 4TW9A 5DE2A 4ASZA 3LFFA 1QPJA 4L7FA 3DB6A 4DTBA 3NMUF 4BFMA 1MUOA 1H1PA 3FMEA 2F7EE 3MSSA 3HECA 4RZVA 3GOPA 4FG8A 4EH4A 3TYKA 3TV7A 2QLQA 1UU9A 4LDTA 4FNZA 4XNEA 3RK7A 3EFJA 4F9YA 3F2RA 1UA2A 4H3QA 1YXSA 3GU8A 4WRGA 4L7SA 3GC8A 4U79A 3UG1A 3AC2A 1Q3DA 3AC1A 3PP0A 2EXMA 4WOVA 3F5GA 1W84A 4W4WA 3ZYAA 2YZAA 5IUGA 3FV8A 4O38A 2W4KA 4DH7A 3V5PA 3DJ6A 5DIAA 2B1PA 2AC3A 3O7LB 2QOFA 3S4QA 3VS3A 5IA2A 2WQBA 4UALA 3EN7A 4O1PA 3MY5A 3PXQA 4C0TA 2OH4A 5HQ0A 5K0KA 2PZIA 2VWVA 1H01A 3E88A 3LXLA 3ZXTA 4CKRA 3C4EA 2R3GA 2JDRA 5CVGA 4ANSA 5DGZA 3SW4A 2BVAA 3NIZA 3II5A 4BCOA 4RJ7A 2XEZA 3TJCA 3VRZA 5HTIA 4IVCA 4O81A 3IOKA 3ALNA 4NJDA 2R3RA 2PMNX 3LFCA 5M44A 3EYGA 4FOCA 4JT3A 4BTJA 2VU3A 4IH8A 5L6PA 3Q9XA 4BICA 2VTSA 4S31A 4IC8A 2C3LA 4CCUA 2YFXA 3G6HA 1KE5A 2HZ4A 3KC3A 4FV4A 4FKVA 4YJOA 3HA8A 1BUHA 1PW2A 2E9NA 4IAIA 4RC2A 5C26A 3MFRA 2PE2A 4CEGA 4YO4A 3SG9A 4DFBA 2HYYA 3PLSA 4LUDA 3V6RA 3G6GA 4YSJA 2EUFB 4KA3A 1CMKE 1S9JA 3C0HA 3E7OA 4KD1A 1ZXEA 4PWNA 4JL9A 5DNRA 4EL9A 4FIGA 2G2HA 3UNKA 3RALA 1NA7A 3PIYA 1A9UA 2Q0NA 5HIEA 3VF8A 3ZC6A 4FGRA 4GU6A 3U9CA 4BKZA 1OKWA 3QU0A 4L43A 5CF8A 2P55A 3OOGA 5EOBA 3BV2A 4EK3A 2Y4IC 2VTMA 3C1XA 4QMQA 2UW7A 3PDTA 2YIRA 2ZVAA 3JS2A 4HZSA 4LOOA 4DEHA 3HRCA 4GUEA 4Q9SA 1DM2A 3VHKA 3R8MA 3NAYA 4RC4A 2B7AA 3U51A 3BHUA 3FLWA 4FODA 4IX5A 5CAOA 3PZEA 3QQKA 4NJ3A 1QPCA 2QI8A 4QRCA 4YJQA 4EK6A 5I9ZA 5H9BA 1Q8ZA 2OW3A 3PXYA 4NSTA 4P2KA 3TUDA 4PV0A 3SGCA 5CEMA 5KMKA 4X2FA 2W05A 4AOJA 5A6NA 1Q24A 4FEVA 2WU7A 3GGFA 3KA0A 4DF3A 3NVKI 2WMVA 5J5TA 4ENYA 4DGNA 5K0XA 4KS8A 4AW5A 5M55A 3GCSA 4ZMFA 1OPJA 1GAGA 3FC2A 3GP0A 4QMYA 4JDKA 4ZSEA 5EI8A 4AQKA 1IA9A 4V05A 3L8VA 2J5EA 4F7NA 3KCFA 1G8JA 3ACJA 3CTHA 2IPXA 2XYNA 2BAQA 3Q6UA 4GFOA 5JZJA 2OJFE 4GV1A 4JR7A 2PMOX 3IW7A 5BMMA 3D15A 4O7WA 4E5AX 1NXKA 2J90A 3W0OA 4AG8A 3ZRLA 3Q6WA 4DG3E 2ITXA 4RMZA 4DFZE 2AQXA 3E63A 4U6RA 3U4WA 1FOTA 4AU8A 4GVAA 5ICPA 4RIWA 1XH8A 1YI4A 2R7IA 3HV7A 3THBA 1WBSA 5IA1A 1KWPA 2XJ1A 3GCPA 2IVUA 3VUHA 5B7VA 1MRUA 5JGBA 3CP9A 1OM1A 3ZO3A 3ORIA 4FV8A 5CXZA 3I7CA 1YI6A 2FSOX 1PMEA 2G9XA 5E8SA 4FKLA 4B0GA 3ORNA 2XNBA 4RLLA 4GL9A 3RAIA 3KXGA 4ANQA 4O4FA 1XH5A 3DKOA 4R5YA 3TNWA 4DCAA 2JDVA 2VTIA 3FY2A 3Q60A 1F3MC 3NVMB 4ASXA 3FLYA 1QPDA 3LFBA 3NUUA 5DVRA 2XALA 3W2OA 2PVHA 3NNXA 3AC3A 2WIHA 3MIYA 3GU6A 4QMSA 4LUEA 4R7HA 4QDVA 4PTGA 5CT0A 5JSMA 3AT4A 4A9UA 4CNHA 4QQ5A 4N6YA 4GEOA 4GFGA 1ZOEA 1OVEA 2CN8A 3EQIA 1PMVA 3MB6A 5E8ZA 2XK8A 5CQWA 1X8BA 2FGIA 3OXTA 3UO5A 2F2UA 3U4UA 4L45A 3BU5A 4C4IA 4G3GA 5BUJA 4FKUA 1KE6A 3R7YA 4JQ8A 2BZKB 3ZBFA 1PY5A 4LFIA 3EIDA 5I4NA 3R21A 3PJ3A 3VN9A 3G15A 1PXOA 1OKYA 3WZEA 2CNVA 2C5OA 1WVYA 2YM4A 4I6FA 2IEWA 3HDMA 4YJTA 5AR7A 4CZTA 5AADA 3UOLA 1ERKA 5LVNA 2OWBA 2EB2A 3PXFA 4EKKA 4R1VA 4Y46A 4UWYA 3TN8A 1XKKA 4AZFA 5KBRA 4GIHA 4R1YA 4EH9A 3SLSA 4PP7A 4UWBA 5HCYA 4FEXA 1IAHA 4DGLC 4D2RA 5EW3A 3P23A 5EQEA 3BHYA 2C6MA 4XV2A 3W16A 3VBWA 4E93A 2QONA 2IZRA 5BVDA 3CTJA 4BC6A 2R3KA 3E7VA 3IDPA 3QTIA 4K1BA 4W8EA 4TYHA 3V51A 2IVSA 4ACMA 1CKIA 3VVHA 2RKUA 4GKHA 5KMMA 4HPUE 3R6XA 2VAGA 4B9DA 1SYKA 5C03A 2V7AA 4OTGA 4ANLA 4NM3A 3P78A 4EI4A 3BYMA 4QYFA 2I7QA 3R83A 4J71A 3ZZEA 3KQ7A 2Z8CA 4IWDA 5KX8A 3VBYA 4M84A 4AXDA 3PIXA 4DEGA 5BUEA 5EI6A 5C27A 4KKHA 5A4CA 3ZLSA 2C5NA 2BRHA 4ZS4A 5LVOA 3NGAA 4WNKA 3DAKA 3NNVA 2NO3A 3KGAA 4UZDA 3WZDA 4YC3A 3QRKA 2H6DA 3RWPA 4EUUA 5IZFA 5KHXA 2GQRA 4Z3VA 2VTRA 4YZCA 4EHEA 4MTAA 3BYSA 3EKNA 2XNGA 4JBOA 4JQ7A 3E3BX 3FDNA 4J7BA 4NYEA 2YJRA 3Q4TA 4L6QA 4UZHA 2CKQA 4D2TA 1P4OA 4KAOA 3PP1A 3LCKA 5CSVA 3LFNA 3NLBA 4YC6A 1GIJA 3PPZA 4O0VA 4WD5A 4XP0A 3OUNB 3R71A 4ZTLA 2EXEA 1JPAA 3IECA 3GNIB 5CI6A 3WZKA 2CKEA 3DXPA 1W0XC 3Q32A 3KRJA 3UQCA 1OECA 3P5JC 1PXIA 3ZFXA 3FSKA 4ZLOA 2VNYA 2YM7A 1OZ1A 3KXNA 4C35A 3UPZA 3BHVA 2JAVA 3CSVA 2WMUA 1H00A 3OWJA 4OTPA 3AGMA 2A1AB 4EOQA 2XEYA 4RFZA 2C6LA 4TWCA 2H8HA 2VO3A 5H2UA 3O71A 3QRUA 3QWJA 4WUAA 4MXXA 2YIQA 3RGFA 4IQ6A 2OXXA 4BL1A 2F7XE 5GJDA 3RWQA 4XRJA 4YLKA 4KB8A 4AT5A 5KMLA 5LQFA 3UDZA 3MY1A 3D2KA 5FDPA 5JH6A 1PHKA 4JDIA 3FUPA 4RA4A 2OSCA 1JSVA 4CKIA 3CKXA 3PY1A 2W1GA 2ONLC 4GK3A 3WZUA 4JRVA 5ETAA 3R7VA 2GNHA 3DBDA 4TKSA 5J8IA 3K54A 3BWJA 4K9YA 4PMMA 4QMMA 2GCDA 3VS6A 1GIIA 3GU4A 4AGUA 5LCJA 2PY3A 4UMTA 3KULB 3EJ1A 4WKQA 5BNJA 4QNAA 4JRNA 4O1OA 4YMJA 1LPUA 5KCVA 4U5JA 1E1VA 4V04A 2YITA 4OBQA 5HO6A 3Q9ZA 4R3RA 3VUDA 2UW4A 1XH6A 3NCGA 3P7BA 4K18A 4NCTC 3IW4A 4KSQA 2PE1A 5I3RA 4CFFA 4ZLYA 4PL5A 3W2QA 3QTZA 5HO8A 4OBOA 4XP2A 4CFWA 4M13A 4LI5A 5LMKC 5D12A 4A9RA 4DLIA 2OFVA 3MWUA 3WE4A 5HTCA 4TWNA 4ACHA 1UNLA 3KF4A 3UNZA 2R3QA 3CJFA 5J7HA 5M53A 4ZXTA 2C6IA 1M2RA 2VWIA 4R7BA 3PJ8A 1NVRA 3GBZA 2C6OA 5E8TA 4YC8A 2WZJA 2BIYA 2AYPA 2I40A 1U46A 4FIFA 4G5PA 4OGRA 3CR0A 3C4XA 3R9HA 4DG0E 4PP9A 5HLWA 2GPHA 1OMWA 4F7JA 4QO9A 3HDNA 4DEEA 1U5QA 4YURA 2HENA 4PDPA 4MWHA 3SDJA 4D4RA 1H4LA 2ZDTA 3FWQA 4J96A 4JBVA 5M08A 3PRIA 3BCEA 5I9YA 4D2WA 1PXPA 1H07A 3JYAA 4AGWA 4FKRA 3TZ7A 2VD5A 1ZYJA 4H1MA 2C47A 4EHVA 1TQMA 3IW6A 1H25A 2YJSA 2YM5A 4ASDA 3F3TA 3FKNA 4G3CA 3ORMA 5EDPA 4ZOGA 3PRFA 4LL5A 3AKJA 4BR3A 1Y57A 5IPJA 4RIWB 2XIXA 4M66A 2G1TA 4FL1A 2SRCA 1ZMUA 1JSTA 5FTQA 2BAKA 2QOCA 5E92A 4Z7GA 3R8PA 5LVMA 3UZRA 4DDIA 3NW6A 3ZUUA 1F5QA 4PMSA 4DN5A 3VWAA 2C0OA 2X8DA 1XH4A 3NUAA 3IS5A 4EOMA 2YEXA 5GINE 2RFSA 4QP2A 2ZMCA 3SW7A 1ZWSA 3ANRA 4L01A 2UW5A 1WBOA 3OWKA 5FEEA 3PG1A 2I0YA 2XBJA 3QTUA 3O7LD 3MDYA 4LL0A 5K5NA 1CDKA 1OIRA 2EU9A 2UVYA 3FC1X 3K3IA 3RI1A 4AOIA 4E6CA 2I1MA 4IX4A 3C7QA 4NK9A 4BIBA 5IQHA 4RPVA 5BVKA 3ALOA 2QOOA 5AP6A 4QP4A 1OPKA 3VAPA 2BAJA 2O63A 4ARKA 2P0CA 4YNEA 1W7HA 3FZ1A 4CLIA 2HAKA 3MY0A 3RZBA 2PVYA 1KE9A 4BCIA 3RKBA 3F61A 4FKWA 3V04A 3AKKA 3A61A 4MD8E 4F08A 2GHLA 5BVEA 3L1SA 4W9WA 5FGKA 2J50A 3MA3A 3QGWA 4BI2A 3LM0A 2R3PA 3MI9A 4GW8A 4S2ZA 4X3JA 3P5KA 4JQEA 4BDGA 2IZSA 2OFUA 3AGLA 3T3VA 3DJ5A 5DT3A 4F63A 2WU6A 4NFMA 4P7EA 4ALVA 3V5TA 3ZHPC 3HAMA 4YTIA 2E9OA 5EM7A 3ZTXA 4ZY5A 5EQYA 3PZHA 4TT7A 3UIUA 5IEXA 2XS0A 3U6JA 2B4SB 3SV0A 3QRIA 2XB7A 3NYOA 3WE8A 4NH1A 2QVSE 5KZIA 4I24A 2R9SA 3ELJA 4D5KA 1ST0A 1P2AA 3LXNA 3PFYA 3PJ2A 4TWOA 2WEVA 2CHLA 3A7FA 3QYWA 4AAYA 2R3NA 1AD5A 1SVGA 4Q9ZA 4E6AA 2PK9A 2WMTA 3FLNC 2KULA 4GFMA 4RGJA 3QC4A 5AP1A 3BE9A 4I22A 4E1ZA 5IH4A 3FHIA 4RJ6A 2OIBA 3BLAA 4CMOA 4APCA 3VRYA 2FH9A 3RP9A 1YI3A 3FPMA 2X2KA 3AXWA 3BZ3A 4FV0A 1O6LA 2PVJA 4O4BB 4EBWA 5B2LA 5IUHA 4LGDA 4UX9A 3L9MA 5EW9A 2BFXA 4W9XA 1REKA 2UW8A 4N4SA 4M0YA 3C4WA 5EHLA 3UC3A 4GMYA 1GZOA 4MXOA 1UU3A 3AT3A 3IGOA 5AV4A 3DBFA 3PUPA 4QP1A 2G15A 3NUNA 4BF2A 3HVCA 1OGUA 3BKBA 4FT3A 3R7UA 2AEGA 1NY3A 3I81A 4IE9A 5I3OA 3EN4A 3RPSA 2XK4A 2X9EA 3JXWA 3QA0A 4M8TA 4U81A 3V5LA 4MYGA 4GCJA 4ZZNA 4I94A 4MF1A 4AXAA 4D2PA 5HU9A 2PVRA 3MFSA 4RZWA 5A46A 3QQLA 3BLRA 5IA4A 3I6UA 1Q97A 2R3OA 2C3JA 5JRQA 4I6QA 4RIYB 5D7AA 4K11A 1OPLA 2QHMA 5A4LA 3FMKA