4U7ZA

Mitogen-activated protein kinase kinase (mek1) bound to g805
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
291
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure based design of novel 6,5 heterobicyclic mitogen-activated protein kinase kinase (MEK) inhibitors leading to the discovery of imidazo[1,5-a] pyrazine G-479.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 291
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u7zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u7zA01
4RA4A 1ZYSA 2IZTA 3RMFA 2C4GA 3HV7A 4YZMA 3EKNA 3EQDA 3NUXA 3UTOA 2BHHA 5CSWA 5K5NA 4YLKA 4O0YA 1BYGA 3BQRA 4IZ5A 5J7HA 1KSWA 4RX8A 5D1JA 5ANDA 4HNFA 3BYSA 4FSYA 2W5AA 3OF0A 3OMVA 4FV4A 3FMHA 3KMMA 5FLFA 4CRSA 1JSVA 4RJ8A 5CT7A 3SOCA 1Q61A 2VO3A 3UYTA 4QMZA 2CNVA 3QA0A 5B2LA 4MXAA 3TEIA 5JT2A 3D5WA 3MA6A 4O96A 4RWLA 4Z3VA 3Q32A 3BGPA 2GDOA 5FDXA 2UW3A 4H3BA 1ATPE 3LFQA 4WT6A 3W32A 3VQUA 4G2FA 3QHRA 4C59A 4AW1A 4D4YA 4ZLOA 4JLCA 2Y8OA 4KKGA 3KVXA 5L8JA 3TJCA 1Z5MA 2VWIA 4DFLA 3QGYA 1JWHA 4XOYA 1WBTA 3DKOA 2UUEA 5H2UA 4H1JA 1SMHA 4EKKA 2IVVA 3R1YA 2J5FA 4IM0A 4YSJA 2BALA 3LFAA 1PMUA 1BUHA 3QHWA 4V0GA 3PUPA 3ZXZA 4YJVA 4F9BA 5BUIA 3MH1A 3I1AA 5IQBA 1YHSA 4QTDA 4OAUC 5DT0A 4E1ZA 3R9NA 3TV6A 4A4LA 3NZ0A 4IMYA 2EXMA 2GSFA 4HPUE 4QTBA 2BCJA 4GU6A 5C8MA 5F1ZA 3RBWA 4RT7A 5CSHA 1NW1A 2C6TA 1VJYA 5AR7A 2KTYA 5HO8A 4IE9A 5M51A 4M0YA 2VX3A 5CSVA 5AV3A 4EZ5A 4NW6A 1XH4A 1MRYA 4F70A 2Y4IB 4FEWA 2J2IB 3C4XA 1E1XA 3KRWA 1YRPA 3CQEA 3F3ZA 4ZTHA 3EQCA 2XMYA 1KE8A 1YI4A 4GUBA 3BLHA 4FZDB 3VW6A 4O7LA 4CD0A 3M42A 2A4LA 1H1SA 2B52A 3LFSA 3WBLA 4BWKA 4LV8A 3MVLA 4I5HA 4QD6A 4WNOA 3HAMA 5KZ0A 3L8VA 3LZBA 4IADA 1UU8A 3K3IA 2FSOX 2HW6A 3DS6A 2Y9QA 3P23A 4E7WA 5J79A 3IK3A 3Q9WA 3R00A 5FWKK 3UVQA 2GQRA 1R78A 4FNXA 2Z60A 3BYUA 4LMNA 5IA2A 2R3KA 4MWHA 1QPCA 3PIYA 3H0YA 4PMMA 3RPYA 3VUKA 4AAAA 4QQJA 5M4UA 2JDSA 3VUIA 5H8BA 5KZIA 2OFUA 3PVBA 5E8UA 2JKOA 4I93A 4BZNA 3ALNA 4FIHA 4AGUA 3E62A 4ZSGA 5DR2A 4DTAA 3D2KA 4QT1A 1WFCA 1YOMA 3MV5A 4U80A 4AZWA 4QOXA 4X0MA 1P5EA 1Q8ZA 4E6QA 1H25A 1Q5KA 4QYYA 5CXHA 4QTEA 2W5BA 2W1IA 1O9UA 3FSFA 4TY1A 4M0ZA 5JSMA 3R9HA 4NJDA 4PY1A 4FV2A 2GNJA 4YJRA 2QOHA 3MB6A 4ANQA 4BTMA 1BI8A 4GEOA 3GQLA 4U97A 4Y5QA 3OEFX 2PUIA 5AX3A 1PXPA 4QP3A 3GQIA 4BTKA 3Q9ZA 3PIXA 2V5QA 5KKRB 2ITOA 3FY0A 3KVWA 3IKAA 3GU7A 2C3KA 5CAQA 3FLSA 3S2PA 2B0QA 3MH2A 3G6HA 2JDVA 4C61A 2IW9A 4CCBA 5JGDA 2E2BA 4D5KA 2WAJA 4OTIA 2OO8X 3W2CA 2V55A 4WKQA 3FKNA 4K11A 4R1VA 4HCVA 3R63A 4AQCA 3UDBA 2ZAZA 2YIXA 3ODZX 2JD5A 3HV3A 2OGVA 3DXPA 2NP8A 4GJ2A 4FEXA 5M56A 1M2RA 4IX3A 4O21A 3NUNA 3DAEA 4FF8A 4QQ5A 4BWXA 5LMKA 4BDIA 3OXTA 5BVNA 4U6RA 3ZZWA 4QMNA 2WQEA 3F66A 5HO7A 3PWDA 3AG9A 3PSBA 2P33A 3AMYA 1J1BA 3FMMA 2IZSA 3LCTA 3QF9A 2Y0AA 5E8VA 4EZ3A 2IW6A 5EHLA 4ZTNA 4Q5HA 2P0CA 4TRLA 5L6OA 4IWPA 4IACA 4CTBA 1E9HA 3AC1A 3G90X 1JNKA 3SX9A 3D7ZA 5HCXA 4F1MA 1REKA 2PVLA 4FV0A 2W5HA 4I0TA 2Z02A 2QG5A 4IAFA 1RW8A 3HMOA 3ROYA 3ALOA 4TL0A 4U40A 2UW4A 2B9FA 2PE1A 3LFNA 4YNOA 4EEVA 2Y4IC 4EHEA 4K77A 4YU2A 4OTGA 4XHKB 1LP4A 4LUEA 4M7IA 3I6UA 4QP4A 5ANKA 4EK6A 3LQ3A 2YAAA 1SNXA 3MY5A 4J7BA 4X2NA 4PP7A 2VUWA 4UEUA 4X3FA 2OXYA 2PPQA 5FGKA 4EH7A 4V0GB 2Y6MA 2JIUA 1BMKA 3NNUA 4KIPA 1S9JA 2BILB 3L8XA 1AD5A 3V04A 3WF7A 3KL8A 3GUBA 3RKBA 3AGMA 4YJUA 4AOJA 4F9WA 4R78A 3BU3A 3QAME 5ETAA 3R8MA 2PE2A 3SOAA 4AZSA 1H26A 2XH5A 3QCXA 2FO0A 3FY2A 2E9VA 4D1XA 1ZOEA 3JXWA 2BVAA 4JBPA 3RINA 4XJ0A 4DT9A 3R83A 1M2QA 1P14A 5M4IA 4YR8A 3QX2A 4G3CA 2ERKA 3O23A 2W1FA 1FOTA 5CI6A 4ENYA 1JKLA 2XIYA 4NIFA 4E3CA 2ITQA 2ZB1A 3HDNA 3UVRA 2OLCA 1STCE 3F5XA 2Y6OA 5AP6A 5DMZA 2I0YA 4QYGA 4WIHA 3Q60A 2W05A 4YC6A 4BIDA 5EHOA 4FK3A 4D2RA 4A9TA 2C5OA 3ODYX 1RJBA 2JC6A 3U6IA 4G6LA 4FTCA 3TI1A 4D1SA 4ERKA 4AGCA 3IW4A 4ZTLA 5E4HA 2QCSA 2C5NA 3KMUA 4G9CA 4C2WA 4O7NA 4GU9A 3DGKA 3PSCA 3IW6A 5KKRC 3LM0A 2YABA 3PYYA 4CKJA 4CV8A 3R8UA 4I6FA 5BUEA 2PVNA 2QLQA 4J8NA 3QQUA 3NYXA 5A6OA 5L2WA 3TT0A 2QURA 2C6IA 1ND4A 4I23A 3Q53A 2JLDA 3ORLA 3MH3A 4HCUA 3S3IA 2HWPA 3QGWA 2QOQA 3IQ7A 4C34A 5LJJA 1IASA 3G33A 2B54A 3JVSA 3S0OA 1V0PA 3NUUA 3FMJA 2YLFA 3VULA 3NCGA 3ZEWA 4C0TA 2QU6A 2HZIA 2QLUA 4PL5A 4NCTC 5IUGA 2R7IA 3FZSA 5LCJA 4FTQA 3DPKA 5T3QA 3ZO1A 3LAUA 1H07A 2PHKA 3AGLA 4JBVA 2FSMX 4OTFA 4S30A 2VO0A 4WO5A 3KRXA 4EONA 5EQYA 5FUTA 4D58A 5J9ZA 4FVPA 4MQ1A 2RG6A 1H24A 4CMUA 3P1AA 5E90A 4EYJA 2X9FA 1WVYA 4FR4A 3SC1A 5EYKA 4V01A 4GKHA 3SGCA 4GFGA 1Q8WA 3MW1A 3OTVA 3RPRA 5HX8A 3OCGA 4IDVA 4X2JA 4RBLA 5DLSA 4FSRA 4JBQA 2ZYBA 1ZOHA 3A99A 5ACKA 4MBLA 5HNBA 3KREA 5CAVA 5JH6A 4F64A 3H10A 4EHVA 2HOGA 2W1HA 2OF2A 3A4OX 4C3PA 3E8DA 4RRVA 5GJDA 3OVVA 4XG8A 3K5UA 2WMRA 2P3GX 1FPUA 3IOPA 5EM6A 5FP6A 3U4UA 2F4JA 3ULIA 4FKOA 2QOFA 2NO3A 4PL3A 3QTQA 4NFMA 4W8DA 2UZEA 3PXKA 4ZIMA 5HTIA 3UPZA 2YWVA 2HELA 3I7CA 3OZ6A 4YC8A 3CQUA 2XJ0A 4NM0A 5FDPA 3ULZA 2WTDA 4R3RA 4W4VA 3KXGA 2BZJA 3DKCA 3MDYA 2AUHA 5CU3A 3TUDA 2HZ0A 3C5UA 3CXWA 4YZNA 4M97A 1U5RA 3Q2MA 3O8PA 2J7TA 3OROA 4EBWA 1PMEA 4QMLA 5ICPA 2C5XA 4N57A 2Q0NA 3ROCA 2PUPA 4NW5A 4BBEA 4Z7GA 4M15A 4DGLC 4E5WA 3QQKA 3EFJA 4BCFA 2FB8A 1Q24A 5HORA 2C6EA 3ZHPC 2X4ZA 4M14A 1KE5A 4DH7A 2CN5A 2W1EA 5L6WL 3NAXA 1UU9A 2VNWA 3DY7A 3PRIA 4FTIA 1GIIA 5CU6A 4OGRA 3KXHA 1HOWA 5EOLA 4NSTA 5HE2A 4BYJA 4RGJA 2XJ1A 5F95A 4FSMA 4G3GA 3QFVA 5E8SA 5KNJA 4P5ZA 5HBHA 3QZHA 1J1CA 4FSNA 5CX9A 5HLWA 1OECA 4J98A 4C62A 4PX6A 3TZ8A 1WBVA 5GZ8A 3ACJA 4QTCA 2YM7A 3DTCA 4TKSA 1WBPA 4F0IA 3RZFA 2PSQA 3VS0A 4JRVA 5JFWA 2QHMA 1ZY5A 2HCKA 3IONA 1OUYA 1M52A 5KHWA 2UW7A 4C58A 4KBKA 4KBAA 4GH2A 3EZVA 3HUCA 3QA8A 1Y6AA 2PY3A 5EM5A 5HCZA 3UQGA 4UWCA 4E4NA 1CMKE 1IG1A 3ZU7A 4BDCA 2XJ2A 3ORXA 3OWJA 4Y46A 3UIMA 2GNHA 3P7BA 1WZYA 3AD5A 2PVKA 4C35A 2UZUE 4UMPA 5CAPA 4BCJA 1GZ8A 2JBPA 5E91A 2QOKA 3QYWA 3O2MA 4ONAA 4AA0A 1K2PA 2ZMDA 4JG6A 3C9WA 3VNTA 2W17A 2QO2A 4U43A 4C33A 3LCKA 4M3QA 5BVOA 2O2UA 2I6LA 3ZSIA 4IHPA 4UX9A 4GIHA 5C27A 4B99A 3BRBA 3W10A 4M84A 4O27B 4FEQA 1KUTA 3LXLA 4HYIA 4JAIA 4TPTA 5LWNA 1R39A 4EHZA 3VBTA 2KULA 1YXTA 2X2KA 3HDMA 3NNVA 3R28A 3MIYA 4MCVA 3TZ9A 3R30A 4GYGA 5AIKA 2UV2A 5EM7A 1UNGA 3FPQA 4YURA 4L67A 5EYMA 3LJ0A 2QHNA 5L4QA 5CALA 5AP3A 4GUEA 3NUSA 3AMBA 3B2TA 5FBNC 1A9UA 2G01A 3NIZA 3QUPA 3G2FA 3CQWA 2PUUA 4X2KA 4XP3A 1FINA 4IANA 4X7QA 4XBRA 4C36A 2CMWA 3QYZA 3ZBFA 4AUAA 3R04A 2XP2A 1IA9A 4FG9A 1R3CA 1TKIA 3JPVA 4QMPA 4C4JA 3ZSGA 4P4CA 4O7TA 4U5JA 2EVAA 2OWBA 4A07A 3E92A 3RWQA 3PLAE 3BHTA 4D0XA 1OB3A 3GU5A 5HVKA 3TUCA 4U45A 2Z7QA 3TNPC 4JIKA 5EQPA 3L9LA 5CQWA 3O17A 3ENMA 4QMTA 4AW0A 4CFUA 2ITPA 4JL9A 4YHTA 4I6HA 4CFNA 4FKJA 2OH4A 3ZC5A 1WCCA 3LE6A 3HAVA 2VGOA 2XKFA 3BE9A 2OI4X 4MYGA 2WMWA 5DGZA 3PLSA 5GINE 4MVFA 4OTDA 3FJQE 3ZUUA 5HO6A 4EH4A 4YO4A 2GPHA 3I5NA 2BAQA 5EW9A 5ITAA 2OFVA 3SQQA 1Q4LA 4BTJA 2QOLA 3OWKA 2ZDUA 3Q2JA 2YCFA 5DNRA 2VZ6A 1U54A 3ZMMA 3QTUA 4QMMA 3FI3A 4MF1A 4D9TA 3MVMA 3QQJA 4AXAA 3GEQA 3Q4CA 2UVXA 4IWQA 3O50A 4C57A 1OKVA 3SW7A 3TZ7A 2VTSA 4DINA 2HENA 1G3NA 3GT8A 3PDTA 4G6OA 2W9ZB 4CZYB 1B6CB 5AUZA 3DK7A 4IIRA 5IU2A 2BUJA 4TZRA 2W06A 2YIQA 4G34A 4EORA 3QWKA 4RQKA 3CJFA 3HL7A 4RIWA 4EOKA 5KO1A 3BI6A 3OP5A 3E8CA 2BHEA 4I5MA 2BRHA 2W1DA 3D4QA 2XBAA 4YZCA 5FTQA 4EOIA 4DC2A 1PYXA 2VTTA 4RIYA 3QTSA 4O0TA 3RI1A 3QZGA 2ZM4A 3ORTA 3OUNB 5M09A 4E6CA 5KBQA 3COIA 2WEVA 3LMIA 3CGOA 3ATTA 4B0GA 4BHZA 3ELJA 5AM7A 3TZMA 2OJIA 4CSVA 3W2PA 2WZJA 2PZYA 3FC1X 3OHTA 3BWJA 1QMZA 1FMKA 3C5IA 3O71A 3LVPA 2PVYA 3SVVA 2B9JA 1OVEA 4IAYA 1PMNA 1Z9XA 5CZIA 3W1FA 3MPMA 3JYAA 2REIA 4LL5A 4DGMA 5IQEA 2GMXA 4IB1A 5IA5A 3ZO4A 1VZOA 3PSDA 2O65A 3IGOA 2XK4A 4WD5A 1XR1A 2BR1A 2RF9A 3BELA 4MK0A 3EN9A 4QYHA 3KGAA 3PJ1A 4FIEA 3PJ2A 4NFNA 2V22A 3ZEPA 4APCA 4FYNA 4TWNA 4ENXA 3ZCLA 5AEPA 2WMTA 4LOQA 3RPSA 3BIZA 3WZUA 4AW5A 3IPHA 4TWOA 4L8MA 1SZMA 4JG7A 4MNFA 3H3CA 3H4JA 5LVPA 4L53A 3HYHA 4BTFA 3F69A 4UYAA 5BVFA 2ZV9A 5CEQA 2YERA 2YN8A 3C4FA 5HIEA 4MBJA 3F5GA 3RTPA 2GHGA 3AD6A 3F3TA 4KSQA 5E8WA 1Q3DA 4OAVB 4O6LA 4PMSA 4RQVA 4IB0A 4KKHA 3VS6A 4EHGA 1WBSA 3GENA 4FOBA 3Q6UA 2GFCA 2VTQA 4DFBA 4OTWA 2OZOA 4IC7A 4P7EA 2PZ5A 4D2WA 3MSSA 5K0KA 2X9EA 1A06A 3V3VA 2WD1A 3CTJA 3G9LX 4H1MA 2WU7A 1LUFA 2XS0A 4MD8E 4X6QC 4QQTA 3HMMA 1SVGA 3ZH8A 4B8MA 3VJNA 5CSXA 3BYOA 4NTTA 4MXOA 2CLQA 4RSSA 3QTIA 5E8YA 4BI2A 5IA1A 1JOWB 3RK7A 4BVUA 5JMSA 3ITZA 3AQVA 4ZZOA 1NVSA 1UWHA 2VTMA 3FZPA 2VTPA 4O2PA 3WE4A 3WF6A 4KIOA 3NUYA 3RK9A 2EXCX 4B6LA 4HNIA 3PG3A 2CSNA 1OIQA 1OPLA 2QG7A 5IA3A 3F9NA 1HCLA 4ZSEA 4FT3A 1JSUA 2ZOQA 4CXAA 3VBWA 5LVMA 3KRLA 3TTIA 4LI5A 5L3AA 2PL0A 3D14A 3V6SA 4DT8A 2IVUA 1DS5A 1U59A 3UMWA 4DEEA 3IG7A 4FT9A 4RFMA 1NXKA 1SYKA 5K3YA 4EUTA 3MJ2A 4C8BA 4ASEA 2J0MB 5LVNA 3L8SA 4IM3A 5FTGA 1K9AA 2B1PA 3SRVB 1URCA 3EQBA 3EZRA 1GJOA 4O2ZA 3ANRA 4A9SA 3NW5A 2OJGA 4CKRA 2ZV7A 1M7NA 3V5JA 3KRJA 4UBAA 1RDQE 2WTVA 2WEIA 4ANSA 4IZAA 3JY9A 2HY81 4C38A 4CZTA 1OL6A 4Q9ZA 1LR4A 5AMNA 3W55A 4BCPA 4F6SA 5GJFA 4AZVA 4C3RA 1Q8UA 4R3CA 4DFZE 3ZRKA 3LCDA 4IB5A 3VBVA 4EWQA 5M07A 3M11A 2NPQA 2OIDA 3F6XA 1UKHA 3PP1A 3WOWA 4AWIA 1ZARA 1UA2A 3KMWA 3AT3A 2XNPA 3JY0A 4Z9LA 4IVAA 5CI7A 5ETIA 3LLAA 4NJ3A 3EN4A 4RJ5A 1DAYA 3LXKA 4O0WA 3UZPA 4ANOA 4Z16A 2VTRA 1Y8YA 1O6LA 4IAKA 4B9DA 5KMJA 3JUHA 4FG8A 4RC2A 3KCKA 2ONLC 4IW0A 4FZ6A 4BCGA 4NKSA 2IO6A 2NRYA 4RIWB 5HVYA 5CF6A 4OR5A 3POZA 2W7XA 3ZYAA 4X21A 3COHA 2QR7A 2YJRA 3FC2A 1W98A 3GCQA 2E9OA 2HXLA 4YLJA 2BPMA 4MXCA 5CNNA 2PVHA 4RIYB 3VF8A 2BAJA 1UNLA 4EWHA 2BROA 3R02A 4HCTA 3AMAA 5M08A 4DGGA 1PHKA 3LW0A 4FEUA 4U0IA 2C6LA 3G0EA 3WIGA 1FBNA 2W1CA 5GHVA 4RZVA 3JR1A 4OT6A 4IH8A 1J7LA 5IQHA 1M17A 4HPTE 1FMOE 4QQCA 3RK5A 4GVAA 4BCKA 3P9JA 2UW5A 4HYHA 1Q8YA 4D1ZA 5CY3A 5CENA 4GKIA 2OIQA 3BHYA 3IDCA 5D9HA 3OW3A 1J91A 4E4MA 1JKKA 3E7VA 4MXXA 4A9YA 2BTRA 1J3HA 4LL0A 2J0IA 1SVHA 2B9IA 4RWIA 4ACDA 4IJ9A 2YM6A 3DQWA 4M69B 4R5SA 2Z7RA 3VN9A 3WF8A 3R73A 4FUYA 5HG7A 4A7CA 2QQ7A 3WF5A 3ZTXA 2FA2A 5AR5A 5IUIA 5AR8A 5CAOA 4DLIA 3AOXA 4ACHA 2WXVA 4XV9A 2YIYA 3FI4A 3PXYA 4QPMA 5FM3A 4GSBA 1XH5A 3COMA 3DKGA 5J9YA 4DA5A 1P4FA 1KE6A 3NNXA 2GCDA 3Q96A 3IW8A 3E64A 5B2MA 5AAGA 1PF8A 1B39A 4BL1A 3QWJA 5CU4A 1VR2A 5HOAA 1FGKA 4FV6A 5AP4A 4ZJVA 2GNFA 2XRUA 2WTIA 4I5PA 4PTGA 4YJPA 4BCHA 3KN6A 4MKCA 5E92A 1FGIA 1UV5A 2VWZA 3DLZA 2RFNA 2RL5A 1YXUA 5I9YA 1UU3A 1JQHA 3EQIA 3IECA 4PL4A 2LGCA 4RX7A 4ZJJA 4L3PA 4QP8A 2C6KA 3C1XA 4WA9A 4BZOA 1PXMA 4YHJA 4QP7A 4EOLA 3F82A 3F2NA 4PPCA 5AP5A 3RPVA 5C03A 4PDPA 5T6KA 2OBJA 2PU8A 5GZ9A 3TG1A 4F99A 3KB7A 5LXMA 4IXPA 2WQOA 2WQMA 1WVWA 5K5XA 3V51A 1YKRA 1Y57A 3C4CA 4ALVA 3UIBA 3DDQA 2WTWA 2W1ZA 4DFNA 4D2VA 2JDOA 4ZMFA 3TACA 3CS9A 4QMQA 1PXIA 4KIKB 4BKJA 4TN6A 4NYEA 2RSVA 3NYOA 3LMGA 4EOSA 1JSTA 5KCVA 1CKIA 5I3RA 1G8SA 2NNWB 3TKUA 5CT0A 5AR4A 4I5CA 4WNPA 3SHEA 3U87A 4D4VA 4HVIA 2A19B 3IO7A 5AFVA 1WMKA 3TDVA 4FTRA 3QD3A 5FP5A 4DGNA 4HVDA 1JBPE 3THBA 2HZNA 4RVLA 4CNHA 3OY3A 1L8TA 2DUVA 4FIFA 3IW5A 4G5JA 3I7BA 3MN3A 3GCVA 2QC6A 4K0YA 3ORMA 4XG3A 4XV3A 1W82A 3RHKA 4HW7A 3DB6A 4C4FA 3II5A 5BYZA 4MD9E 5CASA 5JFSA 1OM1A 4IC8A 4N0SA 4BBFA 1ZWSA 2WELA 4FBXA 4O6EA 3QKLA 5D7VA 4H36A 3UODA 3M1SA 4NM7A 2GQSA 4E5AX 5E9EA 3GU6A 3I0QA 3W2OA 2ETMA 2YIWA 4FI1A 2X39A 3PY3A 1Q41A 3EL7A 4HJOA 5IMEA 4MNEA 3PJ8A 3CPBA 3PA4A 5D11A 4FV9A 3RPOA 3SDJA 1BLXA 3JVRA 3V5PA 4O82A 5L2TA 3WZDA 5EKOA 2E9PA 2XF0A 3OWLA 2H34A 5BX0A 3VJOA 3VQHA 3AC5A 2QKWB 3GXLA 3A8XA 4FV1A 4KINA 3T8OA 5A6NA 3ZLXA 1URWA 3G5DA 5DPVA 4Z55A 3D94A 4BIEA 5IDPA 3UQFA 2WGJA 4UN0C 4GG7A 4BI0A 3T9IA 5CAUA 4XRJA 5IQGA 2J0LA 2VTJA 3QL8A 5FBOA 4BCNA 4FV3A 3BLQA 3DBCA 4QPSA 5EI8A 4DN5A 4PWNA 4BZDA 4FTTA 3EN7A 2XNNA 3QZIA 3P86A 4UV0A 3EYHA 4M8TA 3HVCA 3NUPA 4W8EA 5DRBA 4XV2A 2ZV8A 1PXJA 3VBYA 4USEA 1KE7A 2YEXA 3EFKA 1Y8GA 3CTQA 3QBNA 2OZAB 3HP5A 3EWHA 3LXPA 2SRCA 3A7HA 2BZKB 4IAAA 4NT4A 3R8VA 2C68A 2G1TA 3PXFA 3VS1A 4AFJA 4AFEA 4O0SA 3R7OA 3E7OA 3MY0A 3UO6A 2F9GA 3D0EA 3DAKA 4MH7A 4RJ6A 4ALWA 2JIIA 4JI9A 3WZEA 4DG0E 3D15A 4OTQA 4O91A 4AGWA 1YHWA 3IS5A 3NX8A 4YZDA 1PXOA 5GNKA 3U9CA 3FLWA 3R01A 4F08A 3GCUA 4P90A 4PTCA 4AT4A 4YJQA 2I1MA 2GNLA 4Q5EA 3VF9A 3FXWA 2O8YA 2QNJA 3O8UA 4YTHA 1XBAA 4XLIA 3ZM4A 2F7EE 3G51A 4PMTA 1GZOA 2PVMA 3C4EA 4GFOA 3QKKA 1QPDA 3F3VA 5GJGA 3VUGA 2H9VA 4TTHB 4ZY6A 4AZFA 3UNKA 4LG4A 1Y6BA 3E3PA 3VS2A 5CQUA 2CCHA 2XRWA 3QKMA 3SD0A 4ANNA 4E20A 3WZJA 4QMUA 4PDSA 4L01A 2YCRA 1YI3A 4TWCA 3ZC6A 4K8AA 4EK5A 1F0QA 4ZSLA 3NWWA 4BDFA 3E93A 5DIAA 5E8ZA 3A4PA 1YWVA 3NVKI 5EYDA 4K2RA 2IVTA 1O6KA 4OUCA 3MBLA 4RPVA 3V8SA 3CSVA 2ITTA 4QMYA 2YZLA 3LIJA 5I9WA 1NVRA 4GL9A 5JK3A 4FKRA 4X3JA 1FVRA 3LCOA 3RALA 2IJMA 4M66A 4O38A 5AUVA 4FKIA 4QP6A 5T68A 4XX9A 5IUHA 2OICA 5KMOA 3V6RA 2FUMA 5HE0A 4KS8A 1RE8A 4HVGA 2VO6A 2GS2A 5HQ0A 1OKZA 3EHAA 3TIYA 3UIXA 4O0XA 5E8TA 2GS7A 3UJGA 3UC3A 3L9NA 2RGPA 3TCPA 2XM8A 3EYGA 3FSKA 4AN3A 4O0VA 3ANQA 3QUEA 5KMMA 3DV3A 4WSYA 3KA0A 4O0RA 3FLNC 3FYKX 5HLNA 2UW6A 4FIGA 3EL8A 4ITJA 4Y83A 1GZNA 4ZZMA 2EXEA 3V5QA 4L45A 2I0EA 4GT4A 3MPTA 2XNMA 5CEPA 2G15A 4F0GA 3UGCA 3PZEA 1VYWA 4G5PA 3W2QA 3TNHA 3W16A 5DVRA 2IN6A 4AU8A 5CNOA 4KS7A 4NKAA 3A8WA 4MBIA 2UZVA 3U55A 4JQ7A 5J1WA 2X2LA 3A7GA 3FMKA 5K4IA 1JKSA 5HG8A 2XK8A 3EQFA 2O3PA 2C3JA 1GIHA 2XNGA 3EFLA 4KD1A 4CKIA 1UU7A 4C37A 3SG8A 3I79A 3OUKA 5A4EA 2JITA 4XBUA 3QTRA 3DK3A 2XZSA 3MFUA 3AXWA 4FKPA 2XCKA 1CDKA 2XIRA 4YC3A 1ZXEA 5AX9A 5M55A 5AUTA 4R77A 4IWOA 4ASDA 3DA6A 4MNEB 5M53A 4FL2A 3ZRMA 3HMPA 4EOQA 1IAJA 4CV9A 2C3IB 4DLJA 4YO6A 4RVTA 4YTIA 4G3EA 5JKGA 4ORKA 2P55A 3FEGA 3R7YA 3PTGA 1GAGA 4MEDA 3DKFA 4QTAA 4CZUA 5A54A 1CM8A 4D2TA 2JGZA 2CGWA 1YOJA 4ZTMA 4MTAA 5J5SA 4AZTA 3O0GA 4BFMA 4IX4A 5J9LA 2UZOA 4AE9A 1ZMUA 3FHRA 2OSCA 5CANA 2ITWA 4DEIA 4FTOA 5JFVA 4FNZA 4KUJA 1FVTA 4TYGA 1LPUA 4I24A 2YITA 4RG0A 4XG2A 4WG5A 5HE1A 3R9DA 4KAOA 4CCUA 1OKYA 1KV2A 3NDMA 4K1BA 4YNEA 1XO2B 1OZ1A 2OH0E 3LQ5A 2X0GA 5C9CA 5BVWA 1ZMVA 2YCSA 4FX3A 3KF4A 5HEZA 1G8AA 2DWBA 4L42A 1H1QA 3DDPA 5H8EA 5J1VA 3RM6A 2ESMA 4FK6A 4PPAA 2YHVA 2Z2WA 3ZOSA 3EQHA 2VTOA 1EH4A 2G2HA 2ITVA 5FRIA 4W4WA 1DI8A 5DI1A 5EOBA 4DH5A 3RAKA 4WUAA 4NU1A 4ASZA 3C4ZA 4UXLA 4YTCA 4OBPA 4AOTA 4KA3A 5L2IA 2HAKA 5IEXA 1H1RA 1R0PA 3OY1A 2OJJA 5DRDA 4O7YA 2CCIA 2OKRA 4GS6A 2GQGA 2ONLA 4IZYA 2C0OA 4FL3A 4J1RA 4DTKA 1PXKA 4IAZA 4M67A 5DYJA 4IBMA 4F7JA 3A60A 2BRMA 3NAYA 3BGQA 3AC2A 2YM3A 3LLTA 4KRCA 5JZJA 2WHBA 4FSWA 2EB2A 3BV3A 1A48A 3TUBA 3C0IA 4UY9A 3LFEA 3HMIA 3BE2A 2J5EA 4RJ7A 5HIBA 2X6DA 4H39A 1YQJA 3Q52A 4II5A 4USDA 3HRBA 4U79A 4O81A 4WUNA 4AF3A 1DM2A 2X6EA 2W4KA 4FNWA 4NK9A 4U3ZA 4N6ZA 3PXZA 4QMWA 1XHAA 5A14A 5EI2A 4TYJA 5HNGA 3EB0A 2J0KA 2UZWE 2WFYA 4TXCA 5I5ZA 3KXZA 3E3BX 3LHJA 1UWJA 4AX8A 3QD0A 3PPJA 3QXPA 4Y8DA 2XKCA 3TN8A 2RIOA 4EC8A 3CEKA 2X1NA 3VRZA 4EOJA 1XKKA 4RVMA 4U8ZA 3NW7A 5L8LA 3N4VA 3GBZA 3DQXA 5DEWA 3H30A 2X81A 3MY1A 2AC5A 4PRJA 4RMZA 3Q9XA 5B0XA 1PW2A 2XVDA 3KEXA 2E9NA 2J50A 1K3AA 3BYVA 4L52A 4NUSA 2IWIA 4WG3A 1CTPE 2C6DA 5DFPA 3NMUF 2R3QA 5LMAA 3S4QA 4F1TA 3A62A 3R22A 2O5KA 3UBDA 3P7CA 4CEGA 5KMKA 3O8TA 3UQCA 1M2PA 2B9HA 3FBVA 4K9YA 5DEYA 3O96A 4ZSAA 5LVLA 2R3IA 2QU5A 4U3YA 5EDRA 3OCSA 2CNUA 5C01A 5CWZA 5CF4A 2WKMA 2JKMA 1REJA 2X7GA 3VC4A 5EG3A 1W84A 2CDZA 3KCFA 1QL6A 5DHJA 3TV4A 5ETFA 3UG2A 5BVDA 4FSUA 3SRVA 1U46A 4I4FA 2IPXA 4NM5A 4OTRA 3K2LA 5B2KA 5I4NA 3EJ1A 3K5VA 1XBCA 4RJ3A 3SLSA 4FTJA 5FD2A 4ZZNA 2XK6A 3KULB 3PFQA 4K6ZA 3NUAA 4EKLA 4MXYA 1XH8A 4FICA 3D5VA 5FEQA 4AACA 2X8IA 3COKA 2PVRA 4UZDA 2GNGA 3QRUA 2WO6A 5AUWA 5IDNA 5L2QA 4YLLA 4GT3A 2UVYA 5AP1A 3UO5A 4D9UA 3DK6A 4U44A 3F61A 2FSLX 3N4UA 4C4HA 4WSQA 4BYIA 5JQ8A 4DBXA 1OIYA 3LCSA 3U9NA 1GIJA 5A46A 4CYIA 3QCYA 3MA3A 2C1AA 3OOGA 4BIBA 2I0HA 2ITNA 3KFAA 4ANLA 4ZTQA 2W1GA 2PMIA 1IA8A 4L7SA 2QI8A 2Y7JA 3N9XA 2CHLA 2DYLA 3EMGA 2C30A 5LCKA 3R7EA 4LMUA 5HHWA 2C3LA 3ATSA 2V7AA 3R1NA 1QPEA 4Y72A 3TKHA 4YBJA 3QLFA 1KWPA 3I0OA 3JS2A 2ETRA 4GT5A 2VTHA 3F3UA 4X6RA 5A4LA 2ERZE 5HBJA 2VU3A 1Q97A 4JX3A 2BMCA 3ZO3A 2Y4PA 4D4SA 3FWQA 4FKQA 2FYSA 2R7BA 1OIUA 3FE3A 5AJQA 5HBEA 4TWPA 2IVSA 3WIKA 4UMRA 5A9UA 1F3MC 3QQLA 3MPAA 4W9WA 5AR3A 3OXZA 5LARA 2XEYA 4ZXTA 1ZMWA 4ALUA 2IZUA 3CBLA 2CKEA 3H0ZA 3IDBA 3NLBA 3QALE 4G16A 2YIRA 2A0CX 3T3VA 3AC4A 4QMSA 3BU5A 3GC9A 3V5WA 3CKXA 3UZRA 4FKVA 4G17A 4ID7A 5IKWA 3WARA 3Q5ZA 4AOIA 3VAPA 2CGUA 3Q4ZA 4KNBA 1H0WA 3DBDA 2CPKE 3QQHA 4QMVA 4WHZA 1H8FA 2QKRA 2PVFA 4WRSA 4YZ9A 2J9MA 2BIKB 1GY3A 2XEZA 3DJ6A 5AP0A 3VRYA 5CLPA 4M69A 5IA0A 2C69A 2PYWA 3EFWA 3P08A 3NS9A 3DLSA 2BFXA 3PG1A 5HLPA 5DN3A 4DEBA 2WTJA 4J95A 2G2FA 3FMLA 3Q4TA 1OPJA 2W96B 3KU2A 1XH9A 3R7GA 4RVKA 3V01A 3DT1A 1UKIA 4CFWA 3PVWA 4KB8A 4FYOA 4XP2A 4AE6A 1RQQA 5E8XA 2ITXA 4WNKA 5AV4A 3KXMA 5IISA 4BCOA 3OWPA 2ZVAA 2WMBA 5HKMA 3SXFA 4EH5A 4FV7A 4J97A 2BTSA 4TT7A 4OLIA 4PDOA 4DTBA 3BEAA 5FXQA 5J8IA 2R3LA 4WRGA 5HU3A 4HVSA 2A27A 2XUUA 1WBWA 1V0OA 3N4TA 4BI1A 4UZHA 4YJTA 2WIPA 3DXNA 4ZY4A 2YFXA 4W4XA 3F2RA 4G3DA 3FXXA 2VGPA 4YJSA 4RWKA 4S31A 2ITUA 4L3JA 4EOMA 2PK9A 5EM8A 3UNZA 4U9AA 3QQGA 3WI6A 1FQ1B 2WQBA 3W33A 4EQCA 3VS3A 3WE8A 3ET7A 3NEWA 4I41A 3DB8A 3NNWA 4RLLA 3SXRA 3QU0A 3DAJA 4N4SA 5FXSA 5JN2A 5HU9A 1PKDA 2CGVA 3AC8A 4RWJA 5F4NA 5TT7A 4Y5HA 2OG8A 5IMXA 4KIKA 3PVGA 2OF4A 4JOAA 2BZHB 4F6WA 3NVMB 4BDJA 4NEUA 3OXIA 1CKPA 4L68A 3CY2A 3HV6A 2CLXA 5HESA 4DGOA 3LQ8A 4DEGA 5GIPE 2P4IA 5FEDA 5BMSA 2B55A 5TKDA 2I40A 5DR9A 3GU4A 2F2UA 1T46A 3BCEA 3EQPA 4U81A 1ZYJA 2WMUA 2ZDTA 3ENHA 5JGBA 4ZK5A 5EQEA 4W4YA 2ETKA 3MTLA 3P79A 4V04A 3GVUA 3CD3A 4X2FA 5EW3A 4IQ6A 3AC3A 4DFYA 3CLYA 3ZFYA 2EB3A 3VUMA 4BWPA 4FT5A 5EW8A 5HICA 3RGFA 3SKCA 4HGSA 3B8QA 3IOKA 5AA9A 4C2VA 1P4OA 4EK4A 1OL7A 2XKEA 2GS6A 2WNTA 3MVJA 3EKKA 2YM8A 1PRYA 2YM5A 5HE3A 4UYNA 3CJGA 3MH0A 5M4FA 3U54A 2R3RA 5A4CA 4JR7A 4PPBA 3PPZA 3L9MA 4CFVA 3RAIA 2JFLA 4JQEA 4L46A 3E8NA 3VS4A 3VHKA 3VVHA 2YWPA 3H9FA 5BYLA 2JBOA 4RJ4A 5FG8A 3T9TA 1X8BA 3VWAA 4G31A 2PTKA 4YUQA 4USFA 2W9FB 4U42A 4R7HA 1UNHA 3K3JA 5CEOA 2R3OA 2HIWA 5H8GA 4PQNA 3FZTA 3WYYA 3DZQA 1T45A 3FZ1A 2QOBA 2WMAA 3NYVA 2O64A 3OTUA 3MS9A 3R71A 5CU0A 5HTBA 3S00A 4ACCA 3AT4A 3C4WA 2C5YA 3HGKA 3LJ2A 5CZHA 3W2SA 5HZNA 4E4XA 2CKOA 3QRIA 3SV0A 2YA9A 4CVAA 4H3QA 5D7AA 3SAYA 3NSZA 3U6HA 4BR3A 3R9RA 4P5QA 4F65A 4DG3E 2VTIA 2R3JA 3A7IA 3KXNA 3R1QA 4OTPA 5DR6A 4YP8A 3UVPA 2R4BA 1U5QA 2OZAA 4AW2A 3L1SA 4FZ7A 4DEDA 2R0IA 3QRTA 3ZSHA 2GTNA 4EJ7A 4LGGA 1YW2A 4HGEA 5I9ZA 3EQRA 3E8EA 3FHIA 3F5UA 2BDWA 4R1YA 4F63A 2EUFB 2FSTX 1BL6A 2ZB0A 4QMXA 4DH1A 5GZAA 4RFZA 4I22A 1YOLA 4ERWA 2YCQA 3BLRA 4L7FA 3FLQA 4WG4A 3D5UA 5DA3A 4MWIA 4CYJA 4IFCA 4E93A 4GJ3A 4O7WA 2BRBA 2ZV2A 3DTWA 5DOSA 4I1ZA 4K18A 2FH9A 4DYMA 3DXQA 3LXNA 1OI9A 3R6XA 4AA4A 4BB4A 5K4JA 2X4FA 3UYSA 4B7TA 3O7LB 4IVDA 3VS7A 4EUUA 5A4QA 2EU9A 5I9XA 1YI6A 2RKUA 4BY9E 2QOIA 2FVDA 3BZ3A 4I21A 5E1EA 3RNIA 5E1SA 5TR6A 4FT0A 4OBOA 2QD9A 4UMTA 5ANOA 5IEVA 4JT3A 5LQFA 3ETAA 5IQFA 2JFMA 4IM2A 3ORKA 1XH6A 3TNQB 5CSPA 3MTFA 5EDPA 4AZEA 2HW7A 2VAGA 3QRKA 4GCJA 5L6PA 4EJNA 1BI7A 2YDJA 3FKOA 2HYYA 3TM0A 2O63A 4G6NA 2VRXA 3MWUA 5DWRA 4V05A 1GNGA 4JBOA 3BBTB 1I09A 3GC8A 3ORIA 4FL1A 3UG1A 2DQ7X 3NIEA 4WBOA 1Q3WA 2VWXA 4DAWA 3LFCA 3ZFXA 1PXNA 4W9XA 1PMVA 4KIQA 4RIXB 4XLVA 3ZXTA 4HOKA 2QONA 3NRMA 1PXLA 3PZHA 3PY1A 4JX7A 3EN5A 4RC4A 5TE0A 3LFDA 4APPA 1UVRA 4LFIA 2GHMA 4CQGA 4PNKA 3MIAA 3VIDA 3LM5A 1LEWA 1AGWA 4JR3A 4EOPA 3PE1A 2Z8CA 1CSNA 3UNJA 2VWBA 4DG2E 3RM7A 4ZOGA 2WMSA 2VWWA 4IAIA 3ZZEA 3I6WA 3OT8A 4EQMA 3CGFA 5EYCA 4F1OA 4LOOA 2C0IA 2PWLA 3T3UA 2GHLA 3NPCA 3HRFA 2JKQA 4B8LA 4TNDA 4IB3A 5HVJA 4O7ZA 3L8PA 4HYSA 4MF0A 2R2PA 3DJ5A 3L9PA 1TVOA 1YXVA 5D41A 3QD2B 4GK2A 3PXQA 4C4EA 1I44A 3NW6A 2ZM3A 4ZLZA 3TKIA 4BN1A 3IW7A 4GW8A 5CF5A 4QRCA 4Q2AA 2VX1A 5AADA 3B8RA 4O1OA 3UC4A 3U6JA 2XA4A 3HRCA 4BDGA 3FUPA 4LM5A 2J4ZA 4CMTA 3UOLA 3HMNA 4NH1A 2P2IA 4UMQA 2VN9A 5J95A 2BFYA 4NM3A 3BU6A 5ANJA 4YTFA 5JEBA 5FXRA 3ORPA 3QRJA 3C50A 1VEBA 4QMOA 3UZTA 3F2AA 4O84A 4JDIA 3HEGA 2RG5A 2HXQA 4WBBB 4O0UA 2QO9A 1PJKA 2GFSA 2XNOA 2VO7A 3BBWA 1W0XC 3H9RA 3OCTA 3OS3A 3PXRA 4M12A 5JRSA 3U4WA 3EN6A 3I4BA 2ITYA 4R5YA 1OKWA 3OCBA 4EK3A 5IA4A 1YDRE 4BDAA 1H28A 2BZIB 5JFXA 3HZTA 2GU8A 2R3NA 1GOLA 4CT1A 2BKKA 3ERKA 3MI9A 4BF2A 2R5TA 3FLZA 3BEGA 3ZLSA 4FKUA 2PZIA 5FQDC 3UE4A 5K9IA 2QODA 4LGHA 3G15A 1ZYCA 5IZFA 1Q62A 4DITA 3GCSA 4O7SA 3GFEA 3UO4A 4BHNA 4DF3A 2XK9A 3FL4A 1XJDA 2OJ9A 3QZFA 5M4CA 3MESA 2Z7SA 4QPAA 1PY5A 2X7FA 3WF9A 5L2SA 4KWPA 2IG7A 5IQCA 1M7QA 5HD4A 1ZLTA 3KK8A 3KN5A 5IG1A 4O1PA 5IH4A 3FI8A 1MQBA 5H9BA 3HA6A 1J7UA 3ZM9A 5GIOE 4ZTRA 4FSZA 1H08A 1SNUA 2OXDA 3GCPA 5G6VA 2GNIA 2BDJA 3GP0A 2YAKA 4LOPA 4S2ZA 5ANIA 5I0BA 2BIYA 4OT5A 2PVJA 2VWUA 5IH6A 5EFQA 5AAFA 4JNWA 5AA8A 5J87A 4IX6A 4EC9A 3F3WA 3UOKA 1KOAA 2R9SA 5F9EA 5JRQA 2XM9A 3BQCA 4LRJA 3CIKA 4J8MA 5AP7A 1ZYLA 4BDHA 4EK8A 5AP2A 4S34A 4KRDA 3A2CA 2PZRA 3P4KA 4IFGA 1SVEA 3LFBA 4LRKA 4TW9A 5L8KA 1Z57A 2F49A 4Z7HA 3CKWA 5J5TA 4OTHA 4XEYA 3VW8A 4FUXA 2DS1A 4OBQA 5CYIA 5D12A 1KOBA 4CLIA 3R7IA 4TYEA 3FKLA 1XBBA 2VTLA 4AN2A 3QC9A 4NWMA 4UWBA 3NYNA 1P2AA 3F88A 4L9IA 4MX9A 1XWSA 1HCKA 4RC3A 5EHYA 3ZO2A 1L3RE 4I92A 2G9XA 4FKSA 3VBQA 3SXSA 1DAWA 3GU8A 4EH2A 1ZAOA 5BMMA 3F7WA 4UALA 3WILA 1W7HA 4BCMA 5ANGA 5EI6A 4FTKA 4GRBA 3DNDA 2J0JA 3C0HA 2H8HA 4FEVA 4Y73A 3HX4A 5BNJA 4RZWA 3U51A 4M68A 4F4PA 4JDJA 4HZSA 4YPDA 4EZ7A 4D0WA 4R8QA 3GC7A 3MB7A 2UZBA 3TWJA 2PZPA 4IVCA 4YJOA 5TOZA 4BDBA 5KMIA 5LWMA 2C6MA 3CY3A 2A1AB 3ZUVA 5C8KA 3I60A 5H3QA 4LGDA 2Z7LA 3LJ1A 4FODA 1CKJA 2YZAA 3HUBA 4FTAA 2ZJWA 4DEHA 4YSMA 3RWPA 2WB8A 5IF1A 4ACGA 4PTEA 2R3FA 1H0VA 3BHUA 4DFXE 2CGXA 3ZLWA 2PUNA 3LMHA 5DBXA 2PE0A 4GK4A 3HNGA 4QO9A 2ZM1A 4RX9A 5CVFA 3SG9A 1OITA 2PULA 4C02A 4FZAB 5DT3A 4A06A 4FTUA 4LRMA 4J71A 3FZRA 2XK3A 3QTZA 5CTPA 5KHXA 4XYFA 4CQEA 4FGBA 4HVHA 2C5VA 5C4KA 5AWMA 4BRXA 1ZYDA 2OK1A 5CXZA 3KULA 5HTCA 2IZRA 3I81A 4I20A 4E6DA 2JDRA 5DT4A 3G0FA 5EH0A 3HECA 5CF8A 4ACMA 3ORZA 3DBQA 1BL7A 4QYEA 3C0GA 4ZTSA 3DJ7A 2FGIA 3OBJA 5HGIA 2YLEA 2V7OA 3HKOA 5HG5A 4AN9A 2B4SB 4GYIA 4ZAUA 3DZOA 1V0BA 3GB2A 1APME 4OW8A 5JZNA 3R8LA 5J7BA 3ACKA 4KSPA 4U41A 4L3LA 3ZDUA 2OXXA 3QQFA 5C1QB 2C6OA 2XCHA 3FQEA 2JAMA 3PP0A 4XS2A 1JAMA 4F9CA 4RX5A 4GMYA 3QXOA 4PNIA 4F09A 5JQ5A 1H4LA 4GK3A 5AM6A 2VWYA 1OL2A 2R0UA 4I6QA 4FC0A 4XP0A 3DOGA 2PMLX 4FKLA 4L43A 4E6AA 5KBRA 4O7VA 1IAHA 4G1WA 5E7RA 1YXXA 4HZRA 4ZLYA 3RHXA 3C7QA 2QVSE 4C4IA 4L00A 5AV2A 3PA5A 3V5TA 1H1WA 2UW9A 3RCJA 3SW4A 3K54A 4FTLA 5IQDA 1SM2A 2J6MA 2WMVA 4AG8A 3D9VA 3FXZA 3ZONA 1AQ1A 2OW3A 4KKEA 3RP9A 3ZBXA 5A3XA 1WBNA 3KQ7A 1KE9A 4ITHA 3EOCA 3BX5A 4MXZA 4XMOA 3WYXA 3FMNA 3CCNA 4XRLA 3OC1A 2X8DA 2UW8A 3EQGA 3GFWA 3P7AA 4KBCA 5CEIA 2B53A 2UZNA 4ANBA 2ACXA 2F57A 4NTSA 3ZFMA 4BCIA 3FMEA 5ANEA 4XOZA 3RAHA 2QOCA 3VUHA 4GFMA 3HA8A 4U7ZA 5CVGA 3BHHA 4JQ8A 1YDSE 2F7ZE 5BVEA 4R6VA 4IX5A 1ZOGA 4X3FB 1OIRA 4E26A 2CJMA 3KK9A 4FT7A 4EL9A 4JS8A 1BKXA 2R64A 2XYUA 3QCQA 4CFFA 5HCYA 4UB7A 2UZLA 3PE2A 4R7IA 4BCQA 1OBDA 2B7AA 3H9OA 3NGAA 3PRFA 3PVUA 3MGYA 1MRVA 2QR8A 4A4XA 2JKKA 2R3PA 2X8EA 4FTNA 4BGGA 3FDNA 4YZBA 4F7LA 3V8TA 1YHVA 3FQSA 4ZS0A 3TIZA 5CS6A 2W4JA 4A4OA 4BGQA 2QO7A 2RFEA 1H01A 1H00A 3FAAA 3Q04A 4NIFB 2OJFE 4MHAA 3R2BA 5BPYA 2XYNA 4TYHA 4R7BA 4ZEGA 1G5SA 2VNYA 3ZUTA 3I5ZA 3PJ3A 4XG6A 5IPJA 3TV7A 4O86A 3CTHA 2J90A 2PMNX 1ERKA 4TYIA 4FTMA 4RA5A 3TTJA 4O83A 3ZDIA 3BWFA 2RFDA 4DCEA 2XIZA 4YBKA 4G3FA 2VX0A 5EDQA 3BHVA 4E73A 4GV1A 5DE2A 4I0RA 2AYPA 4FA2A 4DFUA 4ARKA 3A61A 3QUDA 2WU6A 3PA3A 1OGUA 3FMDA 4MD7E 4E8AA 3N51A 4D28A 5AV1A 3W8LA 4J53A 1ZZLA 1W8CA 4ZMEA 2YJSA 3OT3A 1R1WA 2O0UA 3CPCA 4L44A 5C26A 4BC6A 3RJCA 1NVQA 4GG5A 3RAWA 2RFSA 3NCZA 5BQ0A 3HLLA 3OOMA 4XG9A 4HGTA 4ZJIA 4IVBA 4FKTA 2XIXA 4JXFA 3LPBA 3Q4UA 3D7TA 1R0EA 4FVRA 2WTCA 5M44A 4F6UA 5CEKA 5LMKC 2CKPA 1V1KA 2WPAA 5AUXA 2UZDA 5CU2A 2JDTA 3A7FA 4DH8A 4CGAA 3R0TA 4PP9A 3GOPA 5BVKA 4I94A 3V8WA 4CTCA 4IEBA 5K0XA 1IEPA 3NR9A 5LMBA 2C0TA 4J96A 2VTNA 4D55A 5CEMA 1NY3A 2HWOA 4GIIA 2P2HA 4XNEA 5EK7A 5I3OA 4FSTA 5HIDA 5HNIX 2VV9A 2E9UA 3P0MA 3PY0A 5AR2A 3D5XA 1PKGA 3IGGA 3CD8A 3R8PA 3D2IA 4XG4A 5DG5A 4J99A 4ANMA 3CE3A 3EIDA 3D83A 5AAEA 4H3PA 5FEEA 1OPKA 2W99B 1BX6A 3GOKA 3PWYA 5HI2A 4I4EA 3WZKA 4CMOA 2CNQA 5D10A 1NA7A 4FVQA 4BKYA 3BYMA 1ZY4A 4I0SA 3VHEA 4AGDA 4D2PA 3LFFA 3FV8A 3QX4A 4LQMA 3F7ZA 4FKGA 4D5HA 5BYYA 1LEZA 4P2KA 4YHFA 2XK7A 3DCVA 4X3FC 2C47A 3AT2A 3TNIA 5AUYA 2F2CB 5FM2A 4E4LA 4R3PA 3ZS5A 2XBJA 3DNEA 4CFXA 1H27A 3R9OA 2YACA 3DU8A 4J52A 3KXXA 5FTOA 3ZRLA 3AD4A 2WTKB 3E88A 4EH9A 4XCUA 1E1VA 2BAKA 1O6YA 3QCSA 3E63A 3W2RA 3M2WA 4WOVA 4F7SA 2UVZA 3TDWA 3PJCA 4QYFA 3E87A 4H58A 3OW4A 5AV0A 3C51A 2HZ4A 1WAKA 5TF9A 4FNYA 4EOOA 4FG7A 2QOOA 5M06A 3A7JA 3PPKA 5KE0A 1YWRA 2F7XE 3TL8A 5HX6A 3VUTA 3POOA 2I7QA 1OBGA 2G2IA 2XNEA 2CN8A 1JKTA 2HY0A 2XKDA 4EI4A 3E5AA 1IRKA 4QNYA 4BICA 3P5KA 3VO3A 4JVGA 3CC6A 4FSQA 3BV2A 4JDHA 2V62A 2W0JA 5DH3A 2BRNA 4H05A 2JAVA 4F7NA 4BDKA 3PIZA 4I6BA 4AT5A 2BKZA 4FV8A 5HD7A 1MUOA 3QC4A 2OU7A 4ZSJA 4N70A 4IJPA 4LYNA 3HV5A 1Q99A 4DE4A 4EBVA 4TNBA 4CLJA 4EH8A 1DI9A 4EYMA 2I0VA 1FVVA 2W4OA 2XB7A 4Y85A 4DEAA 5KUPA 3OBGA 3CP9A 4YPSA 3UIUA 5IEYA 3S1HA 2WOTA 4C3FA 4PUZA 4EH3A 3FI2A 3G9NA 4BBMA 3KY2A 4CFMA 4EH6A 2WQNA 5LOHA 3KKVA 2Q0BA 2WOUA 4JRNA 4L6QA 4RIOA 3SA0A 4TYHB 1M14A 4Y95A 3Q6WA 2X7OA 2UW0A 4HGLA 4DCAA 1OUKA 3QD4A 2WMXA 3GGFA 1XH7A 5C4LA 4YJNA 3RVGA 1H1PA 3FLYA 2BRGA 3F5PA 3FYJX 1Q8TA 4FV5A 1QCFA 2YM4A 3GNIB 1JPAA 4QP1A 4UXQA 5ACBC 1YWNA 4Q9SA 3R7VA 1OL5A 1YDTE 3BGZA 4ASXA 5I9VA 1YXSA 3QTWA 4G9RA 3EH9A 5JGAA 3UMXA 4FE2A 1TQIA 3S95A 3G6GA 4AT3A 3BKBA 3P78A 1JLUE 3MJ1A 4HYUA 2J51A 4FOCA 3OG7A 4JDKA 3DFCB 4XV1A 4BDDA 2AC3A 4NL0A 5BUJA 3MFTA 4IWDA 3LKMA 3FZOA 2JEDA 5TO8A 2A2AA 3W18A 4BGHA 2VWVA 4S32A 4N6YA 4JAJA 5F94A 2VTAA 4RIXA 4IZ7A 1QPJA 4A9RA 3D7TB 4F0FA 3UOHA 3O7LD 3VS5A 2HK5A 4QP9A 1OL1A 2IW8A 3TXOA 3UOJA 4PMPA 2H6DA 3HV4A 4ZY5A 1ZZ2A 4QP2A 1S9IA 3KRRA 5B7VA 3RCDA 3MFRA 4A9UA 2UZTA 5AIRA 4FIIA 3MYGA 4K33A 3B2WA 3ZLYA 4C4GA 5EKNA 2YDIA 2YISA 3QTXA 4YGAA 2NRUA 3HP2A 1Y91A 3O51A 5A4TA 5LVOA 4X2GA 3MVHA 3TNWA 3MFSA 2R3HA 4FKWA 4RLKA 5G1XA 4BKZA 4MAOA 4FMQA 3GI3A 2WTKC 5IQIA 3DBFA 1XQZA 4DHFA 4GVJA 1W83A 1WBOA 4KABA 3VBXA 4E5BA 5AUUA 4O7RA 2H96A 2PMOX 4RFYA 3LOKA 3U8WA 4CG9A 1JVPP 2BDFA 2OIBA 2R3MA 4D2SA 2VD5A 4EQUA 1J7IA 3R1SA 4PF4A 4QNAA 2LAVA 2XIKA 4NZWB 4DH3A 3R21A 4F9AA 4AS0A 4CRLA 1YVJA 2X2MA 3Q5IA 1VYZA 4O22A 4JJRA 1IR3A 4PV0A 4S33A 3UP7A 4BDEA 1OMWA 1WVXA 3DFAA 2WIHA 3OD6X 4UWYA 5KMNA 1PYEA 4FZFB 1U54B 3UP2A 4JG8A 4AP7A 3Q9YA 1U4DA 2ITZA 2CKQA 4CG8A 2Q83A 1TQPA 5KMLA 2V0DA 4ZS4A 4WNMA 3QLGA 1NT2A 4XG7A 2ZMCA 4XH6A 4FGRA 5C8NA 4LUDA 3Q3BA 2R3GA 3OEZA 3UPXA 3OFMA 3DBEA 5F20A 1F5QA 3RZBA 4CT2A 3C13A 4JIAA 4DBNA 2EWAA 3FL5A 3KF7A 5HG9A 3VUDA 4IDTA 4YMJA 3ID6C 1ZRZA 1B38A 3R2YA 4C7TA 4F9YA 3FQHA 5ETCA 3R8ZA 3FPMA 3CR0A 3V5LA 4B4LA 3BPRA 2YDKA 3GC0A 3KC3A 5I9UA 4FIJA 4UMUA 3IDPA 3TJDA 1KV1A 4AA5A 4ZP5A 1MP8A 3ORNA 1MQ4A 4LV5A 4D4RA 4M13A 4MQ2A 1GZKA 3R7UA 5IQAA 4I3ZA 2GTMA 3W8QA 5IH5A 4PDYA 5KX8A 1TQMA 5M57A 1MRUA 2JIVA 4NCTA 5CVHA 2C1BA 4XUFA 2XNBA 3REPA 3RNYA 2WMQA 4ITIA
chains in the Genus database with same CATH superfamily
4RA4A 1ZYSA 2IZTA 3RMFA 2C4GA 3HV7A 4YZMA 3EKNA 3EQDA 3NUXA 3UTOA 2BHHA 5CSWA 5K5NA 4YLKA 3PFYA 4O0YA 1BYGA 3BQRA 4IZ5A 5J7HA 1KSWA 4RX8A 5D1JA 5ANDA 4HNFA 3BYSA 4FSYA 2W5AA 3OF0A 3OMVA 4FV4A 3FMHA 3KMMA 5FLFA 4CRSA 1JSVA 4RJ8A 5CT7A 3SOCA 1Q61A 2VO3A 3UYTA 4QMZA 2CNVA 3QA0A 5B2LA 4MXAA 3TEIA 5JT2A 3D5WA 3MA6A 4O96A 4RWLA 4Z3VA 3Q32A 3BGPA 2GDOA 5FDXA 2UW3A 4H3BA 1ATPE 3LFQA 4WT6A 3W32A 3VQUA 4G2FA 3QHRA 4C59A 4AW1A 4D4YA 4ZLOA 4JLCA 2Y8OA 4KKGA 3KVXA 5L8JA 3TJCA 1Z5MA 2VWIA 4DFLA 3QGYA 1JWHA 4XOYA 1WBTA 3DKOA 2UUEA 5H2UA 4H1JA 1SMHA 4EKKA 2IVVA 3R1YA 2J5FA 4IM0A 4YSJA 2BALA 3LFAA 1PMUA 1BUHA 3QHWA 4V0GA 3PUPA 3ZXZA 4YJVA 4F9BA 5BUIA 3MH1A 3I1AA 5IQBA 1YHSA 4QTDA 4OAUC 5DT0A 4E1ZA 3R9NA 3TV6A 4A4LA 3NZ0A 4IMYA 2EXMA 2GSFA 4HPUE 4QTBA 2BCJA 4GU6A 5C8MA 5F1ZA 3RBWA 4RT7A 5CSHA 1NW1A 2C6TA 1VJYA 5AR7A 2KTYA 5HO8A 4IE9A 5M51A 4M0YA 2VX3A 5CSVA 5AV3A 4EZ5A 4NW6A 1XH4A 1MRYA 4F70A 2Y4IB 4FEWA 2J2IB 3C4XA 1E1XA 3KRWA 1YRPA 3CQEA 3F3ZA 4ZTHA 3EQCA 2XMYA 1KE8A 1YI4A 4GUBA 3BLHA 4FZDB 3VW6A 4O7LA 4CD0A 3M42A 2A4LA 1H1SA 2B52A 3LFSA 3WBLA 4BWKA 4LV8A 3MVLA 4I5HA 4QD6A 4WNOA 3HAMA 5KZ0A 3L8VA 3LZBA 4IADA 1UU8A 3K3IA 2FSOX 2HW6A 3DS6A 2Y9QA 3P23A 4E7WA 5J79A 3IK3A 3Q9WA 3R00A 5FWKK 3UVQA 2GQRA 1R78A 4FNXA 2Z60A 3BYUA 4LMNA 5IA2A 2R3KA 4MWHA 1QPCA 3PIYA 3H0YA 4PMMA 3RPYA 3VUKA 4AAAA 4QQJA 5M4UA 2JDSA 3VUIA 5H8BA 5KZIA 2OFUA 3PVBA 5E8UA 2JKOA 4I93A 4BZNA 3ALNA 4FIHA 4AGUA 3E62A 4ZSGA 5DR2A 4DTAA 3D2KA 4QT1A 1WFCA 1YOMA 3MV5A 4U80A 4AZWA 4QOXA 4X0MA 1P5EA 1Q8ZA 4E6QA 1H25A 1Q5KA 4QYYA 5CXHA 4QTEA 2W5BA 2W1IA 1O9UA 3FSFA 4TY1A 4M0ZA 5JSMA 3R9HA 4NJDA 4PY1A 4FV2A 2GNJA 4YJRA 2QOHA 3MB6A 4ANQA 4BTMA 1BI8A 4GEOA 3GQLA 4U97A 4Y5QA 3OEFX 2PUIA 5AX3A 1PXPA 4QP3A 3GQIA 4BTKA 3Q9ZA 3PIXA 2V5QA 5KKRB 2ITOA 3FY0A 3KVWA 3IKAA 3GU7A 2C3KA 5CAQA 3FLSA 3S2PA 2B0QA 3MH2A 3G6HA 2JDVA 4C61A 2IW9A 4CCBA 5JGDA 2E2BA 4D5KA 2WAJA 4OTIA 2OO8X 3W2CA 2V55A 4WKQA 3FKNA 4K11A 4R1VA 4HCVA 3R63A 4AQCA 3UDBA 2ZAZA 2YIXA 3ODZX 2JD5A 3HV3A 2OGVA 3DXPA 2NP8A 4GJ2A 4FEXA 5M56A 1M2RA 4IX3A 4O21A 3NUNA 3DAEA 4FF8A 4QQ5A 4BWXA 5LMKA 4BDIA 3OXTA 5BVNA 4U6RA 3ZZWA 4QMNA 2WQEA 3F66A 5HO7A 3PWDA 3AG9A 3PSBA 2P33A 3AMYA 1J1BA 3FMMA 2IZSA 3LCTA 3QF9A 2Y0AA 5E8VA 4EZ3A 2IW6A 5EHLA 4ZTNA 4Q5HA 2P0CA 4TRLA 5L6OA 4IWPA 4IACA 4CTBA 1E9HA 3AC1A 3G90X 1JNKA 3SX9A 3D7ZA 5HCXA 4F1MA 1REKA 2PVLA 4FV0A 2W5HA 4I0TA 2Z02A 2QG5A 4IAFA 1RW8A 3HMOA 3ROYA 3ALOA 4TL0A 4U40A 2UW4A 2B9FA 2PE1A 3LFNA 4YNOA 4EEVA 2Y4IC 4EHEA 4K77A 4YU2A 4DHIB 4OTGA 4XHKB 1LP4A 4LUEA 4M7IA 3I6UA 4QP4A 5ANKA 4EK6A 3LQ3A 2YAAA 1SNXA 3MY5A 4J7BA 4X2NA 4PP7A 2VUWA 4UEUA 4X3FA 2OXYA 2PPQA 5FGKA 4EH7A 4V0GB 2Y6MA 2JIUA 1BMKA 3NNUA 4KIPA 1S9JA 2BILB 3L8XA 1AD5A 3V04A 3WF7A 3KL8A 3GUBA 4JMQA 3RKBA 3AGMA 4YJUA 4AOJA 4F9WA 4R78A 3BU3A 3QAME 5ETAA 3R8MA 2PE2A 3SOAA 4AZSA 1H26A 2XH5A 3QCXA 2FO0A 3FY2A 2E9VA 4D1XA 1ZOEA 3JXWA 2BVAA 4JBPA 3RINA 4XJ0A 4DT9A 3R83A 1M2QA 1P14A 5M4IA 4YR8A 3QX2A 4G3CA 2ERKA 3O23A 2W1FA 1FOTA 5CI6A 4ENYA 1JKLA 2XIYA 4NIFA 4E3CA 2ITQA 2ZB1A 3HDNA 3UVRA 2OLCA 1STCE 3F5XA 2Y6OA 5AP6A 5DMZA 2I0YA 4QYGA 4WIHA 3Q60A 2W05A 4YC6A 4BIDA 5EHOA 4FK3A 4D2RA 4O4DA 4A9TA 2C5OA 3ODYX 1RJBA 2JC6A 3U6IA 4G6LA 4FTCA 3TI1A 4D1SA 4ERKA 4AGCA 3IW4A 4ZTLA 5E4HA 2QCSA 2C5NA 3KMUA 4G9CA 4C2WA 4O7NA 4GU9A 3DGKA 3PSCA 3IW6A 5KKRC 3LM0A 2YABA 3PYYA 4CKJA 4CV8A 3R8UA 4I6FA 5BUEA 2PVNA 2QLQA 4J8NA 3QQUA 3NYXA 5A6OA 5L2WA 3TT0A 2QURA 2C6IA 1ND4A 4I23A 3Q53A 2JLDA 3ORLA 3MH3A 4HCUA 3S3IA 2HWPA 3QGWA 2QOQA 3IQ7A 4C34A 5LJJA 1IASA 3G33A 2B54A 3JVSA 3S0OA 1V0PA 3NUUA 3FMJA 2YLFA 3VULA 3NCGA 3ZEWA 4C0TA 2QU6A 2HZIA 2QLUA 4PL5A 4NCTC 5IUGA 2R7IA 3FZSA 5LCJA 4FTQA 3DPKA 5T3QA 3ZO1A 3LAUA 1H07A 2PHKA 3AGLA 4JBVA 2FSMX 4OTFA 4S30A 2VO0A 4WO5A 3KRXA 4EONA 5EQYA 5FUTA 4D58A 5J9ZA 4FVPA 4MQ1A 2RG6A 1H24A 4CMUA 3P1AA 5E90A 4EYJA 2X9FA 1WVYA 4FR4A 3SC1A 5EYKA 4V01A 4GKHA 3SGCA 4GFGA 1Q8WA 3MW1A 3OTVA 3RPRA 5HX8A 3OCGA 4IDVA 4X2JA 4RBLA 5DLSA 4FSRA 4JBQA 2ZYBA 1ZOHA 3A99A 5ACKA 4MBLA 5HNBA 3KREA 5CAVA 5JH6A 4F64A 3H10A 4EHVA 2HOGA 2W1HA 2OF2A 3A4OX 4C3PA 3E8DA 4RRVA 5GJDA 3OVVA 4XG8A 3K5UA 2WMRA 2P3GX 1FPUA 3IOPA 5EM6A 5FP6A 3U4UA 2AQXA 2F4JA 3ULIA 4FKOA 2QOFA 2NO3A 4PL3A 3QTQA 4FRFA 4NFMA 4W8DA 2UZEA 3PXKA 4ZIMA 5HTIA 3UPZA 2YWVA 2HELA 3I7CA 3OZ6A 4YC8A 3CQUA 2XJ0A 4NM0A 5FDPA 3ULZA 2WTDA 4R3RA 4W4VA 3KXGA 2BZJA 3DKCA 3MDYA 2AUHA 5CU3A 3TUDA 2HZ0A 3C5UA 3CXWA 4YZNA 4M97A 4BJJB 1U5RA 3Q2MA 3O8PA 2J7TA 3OROA 4EBWA 1PMEA 4QMLA 5ICPA 2C5XA 4N57A 2Q0NA 3ROCA 2PUPA 4NW5A 4BBEA 4Z7GA 4M15A 4DGLC 4E5WA 3QQKA 3EFJA 4BCFA 2FB8A 1Q24A 5HORA 2C6EA 3ZHPC 2X4ZA 4M14A 1KE5A 4DH7A 2CN5A 2W1EA 5L6WL 3NAXA 1UU9A 2VNWA 3DY7A 3PRIA 4FTIA 1GIIA 5CU6A 4OGRA 2X0PA 1HOWA 3KXHA 4NSTA 5EOLA 5HE2A 4BYJA 4RGJA 2XJ1A 5F95A 4FSMA 4G3GA 3QFVA 5E8SA 5KNJA 4P5ZA 5HBHA 3QZHA 1J1CA 4FSNA 5CX9A 5HLWA 1OECA 4J98A 4C62A 4PX6A 3TZ8A 1WBVA 5GZ8A 3ACJA 4QTCA 2YM7A 3DTCA 4TKSA 1WBPA 4F0IA 3RZFA 2PSQA 3VS0A 4JRVA 5JFWA 2QHMA 1ZY5A 2HCKA 3IONA 1OUYA 1M52A 5KHWA 2UW7A 4C58A 4KBKA 1XMMA 4KBAA 4GH2A 3EZVA 3HUCA 3QA8A 1Y6AA 2PY3A 5EM5A 5HCZA 3UQGA 4UWCA 4E4NA 1CMKE 1IG1A 3ZU7A 4BDCA 2XJ2A 3ORXA 3OWJA 4Y46A 3UIMA 2GNHA 3P7BA 1WZYA 3AD5A 2PVKA 4C35A 2UZUE 4UMPA 5CAPA 3W0PA 4BCJA 1GZ8A 2JBPA 5E91A 2QOKA 3QYWA 3O2MA 4ONAA 4AA0A 1K2PA 2ZMDA 4JG6A 3C9WA 3VNTA 2W17A 2QO2A 4U43A 4C33A 3LCKA 4M3QA 5BVOA 2O2UA 2I6LA 3ZSIA 4IHPA 4UX9A 4GIHA 5C27A 4B99A 3BRBA 3W10A 4M84A 4O27B 4FEQA 1KUTA 3LXLA 4HYIA 4JAIA 4TPTA 5LWNA 4I6LA 1R39A 4EHZA 3VBTA 3W0NA 2KULA 1YXTA 2X2KA 3HDMA 3NNVA 3R28A 3MIYA 4MCVA 3TZ9A 3UDSA 3R30A 4GYGA 5AIKA 2UV2A 5EM7A 1UNGA 3FPQA 4YURA 4L67A 5EYMA 3LJ0A 2QHNA 5L4QA 5CALA 5AP3A 4GUEA 3NUSA 3AMBA 3B2TA 5FBNC 1A9UA 2G01A 3NIZA 3QUPA 3G2FA 3CQWA 2PUUA 4X2KA 4XP3A 1FINA 4IANA 4X7QA 4XBRA 4C36A 2CMWA 3QYZA 3ZBFA 4AUAA 3R04A 2XP2A 1IA9A 4FG9A 1R3CA 1TKIA 3JPVA 4QMPA 4C4JA 3ZSGA 4P4CA 4O7TA 4U5JA 2EVAA 2OWBA 4A07A 3E92A 3RWQA 3PLAE 3BHTA 2IF8A 4D0XA 1OB3A 4DHJA 3GU5A 5HVKA 3TUCA 4U45A 2Z7QA 3TNPC 4JIKA 5EQPA 3L9LA 5CQWA 3O17A 3ENMA 4QMTA 4AW0A 4CFUA 2ITPA 4JL9A 4YHTA 4I6HA 4CFNA 4FKJA 2OH4A 3ML1A 3ZC5A 1WCCA 3LE6A 3HAVA 2VGOA 2XKFA 3BE9A 2OI4X 4MYGA 2WMWA 5DGZA 3PLSA 5GINE 4MVFA 4OTDA 3FJQE 3ZUUA 5HO6A 4EH4A 4YO4A 2GPHA 3I5NA 2BAQA 5EW9A 5ITAA 2OFVA 3SQQA 1Q4LA 2ZFYA 4BTJA 2QOLA 3OWKA 2ZDUA 3Q2JA 2YCFA 5DNRA 2VZ6A 1U54A 3ZMMA 3QTUA 4QMMA 3FI3A 4MF1A 4D9TA 3MVMA 3QQJA 4AXAA 3GEQA 3Q4CA 2UVXA 4IWQA 3O50A 4C57A 1OKVA 3SW7A 3TZ7A 2VTSA 4DINA 2HENA 1G3NA 2XAOA 3GT8A 3PDTA 4G6OA 2W9ZB 4CZYB 1B6CB 5AUZA 3DK7A 4IIRA 5IU2A 2BUJA 4TZRA 2W06A 2YIQA 4G34A 4EORA 3QWKA 4RQKA 3CJFA 3HL7A 4RIWA 2XALA 4EOKA 5KO1A 3BI6A 3OP5A 3E8CA 2BHEA 4I5MA 2BRHA 2W1DA 3D4QA 2XBAA 4YZCA 5FTQA 4EOIA 4AQKA 4DC2A 1G8KA 1PYXA 2VTTA 4RIYA 3QTSA 4O0TA 3RI1A 3QZGA 2ZM4A 3ORTA 3OUNB 5M09A 4E6CA 5KBQA 3COIA 2WEVA 3LMIA 3CGOA 3ATTA 4B0GA 4BHZA 3ELJA 5AM7A 3TZMA 2OJIA 4CSVA 3W2PA 2WZJA 2PZYA 3FC1X 3OHTA 3BWJA 1QMZA 1FMKA 3C5IA 3O71A 3LVPA 2PVYA 3SVVA 2B9JA 1OVEA 4IAYA 1PMNA 1Z9XA 5CZIA 3W1FA 3MPMA 3JYAA 2REIA 4LL5A 4DGMA 5IQEA 2GMXA 4IB1A 5IA5A 3ZO4A 1VZOA 3PSDA 2O65A 3IGOA 2XK4A 4WD5A 1XR1A 2BR1A 2RF9A 3BELA 4MK0A 3EN9A 4QYHA 3KGAA 3PJ1A 4FIEA 3PJ2A 4NFNA 2V22A 3ZEPA 4APCA 4FYNA 4TWNA 4ENXA 3ZCLA 5AEPA 2WMTA 4LOQA 3RPSA 3BIZA 3WZUA 4AW5A 3IPHA 4TWOA 4L8MA 1SZMA 4JG7A 4MNFA 3H3CA 3H4JA 5LVPA 4L53A 3HYHA 4BTFA 3NFGB 3F69A 4UYAA 5BVFA 2ZV9A 5CEQA 2YERA 2YN8A 3C4FA 5HIEA 4MBJA 3F5GA 3RTPA 2GHGA 3AD6A 3F3TA 4KSQA 5E8WA 1Q3DA 4OAVB 4O6LA 4PMSA 4RQVA 4IB0A 4KKHA 3VS6A 4EHGA 1WBSA 3GENA 4FOBA 3Q6UA 2GFCA 2VTQA 4DFBA 4OTWA 2OZOA 4IC7A 4P7EA 2PZ5A 4D2WA 3MSSA 5K0KA 2X9EA 1A06A 3V3VA 2WD1A 3CTJA 3G9LX 4H1MA 2WU7A 1LUFA 2XS0A 4MD8E 4X6QC 4QQTA 3HMMA 1SVGA 3ZH8A 4B8MA 1OGYA 3VJNA 5CSXA 4DDGA 3BYOA 4NTTA 4MXOA 2CLQA 4RSSA 3QTIA 5E8YA 4BI2A 5IA1A 1JOWB 3RK7A 4BVUA 5JMSA 3ITZA 3AQVA 4ZZOA 1NVSA 1UWHA 2VTMA 3FZPA 2VTPA 4O2PA 3WE4A 3WF6A 4KIOA 3NUYA 3RK9A 2EXCX 4B6LA 4HNIA 3PG3A 2CSNA 1OIQA 1OPLA 2QG7A 5IA3A 3F9NA 3AKJA 1HCLA 4ZSEA 4FT3A 1JSUA 2ZOQA 4CXAA 3VBWA 5LVMA 3KRLA 3TTIA 4LI5A 5L3AA 2PL0A 3D14A 3V6SA 4DT8A 2IVUA 1DS5A 1U59A 3UMWA 4DEEA 3IG7A 4FT9A 4RFMA 1NXKA 1SYKA 5K3YA 4EUTA 3MJ2A 4C8BA 4ASEA 2J0MB 5LVNA 3L8SA 4IM3A 5FTGA 1K9AA 2B1PA 3SRVB 1URCA 3EQBA 3EZRA 1GJOA 4O2ZA 3ANRA 4A9SA 3NW5A 2OJGA 4CKRA 2ZV7A 1M7NA 3V5JA 3KRJA 4UBAA 1RDQE 2WTVA 2WEIA 4ANSA 4IZAA 3JY9A 2HY81 4C38A 4CZTA 1OL6A 4Q9ZA 1LR4A 5AMNA 3W55A 4BCPA 4F6SA 5GJFA 4AZVA 4C3RA 1Q8UA 4R3CA 4DFZE 3ZRKA 3LCDA 4IB5A 3VBVA 4EWQA 5M07A 3M11A 2NPQA 2OIDA 3F6XA 1UKHA 3PP1A 3WOWA 4AWIA 1ZARA 1UA2A 3KMWA 3AT3A 2XNPA 3JY0A 4Z9LA 4IVAA 5CI7A 5ETIA 3LLAA 4NJ3A 3EN4A 4RJ5A 1DAYA 3LXKA 4O0WA 3UZPA 4ANOA 4Z16A 2VTRA 1Y8YA 1O6LA 4IAKA 4B9DA 5KMJA 4QDVA 3JUHA 4FG8A 4RC2A 3KCKA 2ONLC 4IW0A 4FZ6A 4BCGA 4NKSA 2IO6A 2NRYA 4RIWB 5HVYA 5CF6A 4OR5A 3POZA 2W7XA 3ZYAA 4X21A 3COHA 2QR7A 2YJRA 3FC2A 1W98A 3GCQA 2E9OA 2HXLA 4YLJA 2BPMA 4MXCA 5CNNA 2PVHA 4RIYB 3VF8A 2BAJA 1UNLA 4EWHA 2BROA 3R02A 4HCTA 3AMAA 5M08A 4DGGA 1PHKA 3LW0A 4FEUA 4U0IA 2C6LA 3G0EA 3WIGA 1FBNA 2W1CA 5GHVA 4RZVA 3JR1A 4OT6A 4IH8A 1J7LA 5IQHA 1M17A 4HPTE 1FMOE 4QQCA 3RK5A 4GVAA 4BCKA 3P9JA 2UW5A 4HYHA 1Q8YA 4D1ZA 5CY3A 5CENA 4GKIA 2OIQA 3BHYA 3IDCA 5D9HA 3OW3A 1J91A 4E4MA 1JKKA 3E7VA 4MXXA 3W0OA 4A9YA 2BTRA 1J3HA 4LL0A 2J0IA 1SVHA 2B9IA 4RWIA 4ACDA 4IJ9A 2YM6A 3DQWA 4M69B 4R5SA 2Z7RA 3VN9A 3WF8A 2X0QA 3R73A 4FUYA 5HG7A 2QQ7A 4A7CA 3WF5A 3ZTXA 2FA2A 5AR5A 5IUIA 5AR8A 5CAOA 4DLIA 3AOXA 4ACHA 2WXVA 4XV9A 2YIYA 3FI4A 3PXYA 4QPMA 5FM3A 4GSBA 1XH5A 3COMA 3DKGA 5J9YA 4DA5A 1P4FA 1KE6A 3NNXA 2GCDA 3Q96A 3IW8A 3E64A 5B2MA 5AAGA 1PF8A 1B39A 4BL1A 3QWJA 5CU4A 1VR2A 5HOAA 1FGKA 4FV6A 5AP4A 4ZJVA 2GNFA 2XRUA 2WTIA 4I5PA 4PTGA 4YJPA 4BCHA 3KN6A 4MKCA 5E92A 1FGIA 1UV5A 2VWZA 3DLZA 3W0SA 2RFNA 2RL5A 1YXUA 5I9YA 1UU3A 1JQHA 3EQIA 3IECA 4PL4A 2LGCA 4RX7A 4ZJJA 4L3PA 4QP8A 2C6KA 3C1XA 4WA9A 4BZOA 1PXMA 4YHJA 4QP7A 4EOLA 3F82A 3F2NA 4PPCA 5AP5A 3RPVA 5C03A 4PDPA 5T6KA 2OBJA 2PU8A 5GZ9A 3TG1A 4F99A 3KB7A 5LXMA 4IXPA 2WQOA 2WQMA 1WVWA 5K5XA 3V51A 1YKRA 1Y57A 3C4CA 4ALVA 3UIBA 3DDQA 2WTWA 2W1ZA 4DFNA 4D2VA 2JDOA 4ZMFA 3TACA 3CS9A 4QMQA 1PXIA 4KIKB 1TFFA 4BKJA 4TN6A 4NYEA 2RSVA 3NYOA 3LMGA 4EOSA 1JSTA 5KCVA 1CKIA 5I3RA 1G8SA 2NNWB 3TKUA 5CT0A 5AR4A 4I5CA 4WNPA 3SHEA 3U87A 4D4VA 4HVIA 4DDIA 2A19B 3IO7A 5AFVA 1WMKA 3TDVA 4FTRA 3QD3A 5FP5A 4DGNA 4HVDA 1JBPE 3THBA 2HZNA 4RVLA 4CNHA 3OY3A 1L8TA 2DUVA 4FIFA 3IW5A 1TZDA 4G5JA 3I7BA 3MN3A 3GCVA 2QC6A 4K0YA 3ORMA 4XG3A 4XV3A 1W82A 3RHKA 4HW7A 3DB6A 4C4FA 3II5A 5BYZA 4MD9E 5CASA 5JFSA 1OM1A 4IC8A 4N0SA 4BBFA 1ZWSA 2WELA 4FBXA 4O6EA 3QKLA 5D7VA 4H36A 3UODA 3M1SA 4NM7A 1XMLA 4E5AX 2GQSA 3GU6A 3I0QA 3W2OA 5E9EA 2ETMA 2YIWA 4FI1A 2X39A 3PY3A 1Q41A 3EL7A 4HJOA 5IMEA 4MNEA 3PJ8A 3CPBA 3PA4A 5D11A 4FV9A 3RPOA 3SDJA 1BLXA 3JVRA 3V5PA 4O82A 5L2TA 3WZDA 5EKOA 2E9PA 2XF0A 3OWLA 2H34A 5BX0A 3VJOA 3VQHA 3AC5A 2QKWB 3GXLA 3A8XA 4FV1A 4KINA 3T8OA 5A6NA 3ZLXA 1URWA 3G5DA 5DPVA 4Z55A 3D94A 4BIEA 5IDPA 3UQFA 2WGJA 4UN0C 4GG7A 4BI0A 3T9IA 5CAUA 4XRJA 5IQGA 2J0LA 2VTJA 3QL8A 5FBOA 4BCNA 4FV3A 3BLQA 3DBCA 4QPSA 5EI8A 4DN5A 4PWNA 4BZDA 4FTTA 3EN7A 2XNNA 3QZIA 3P86A 4UV0A 3EYHA 4M8TA 3HVCA 3NUPA 4W8EA 5DRBA 4XV2A 2ZV8A 1PXJA 3VBYA 4USEA 1KE7A 2YEXA 3EFKA 1Y8GA 3CTQA 4BJJA 3QBNA 2OZAB 3HP5A 3EWHA 3LXPA 2SRCA 3A7HA 2BZKB 4IAAA 4NT4A 3R8VA 2C68A 2G1TA 3PXFA 3VS1A 4AFJA 4AFEA 4O0SA 3R7OA 3E7OA 3MY0A 3UO6A 2F9GA 3D0EA 3DAKA 4MH7A 4RJ6A 4ALWA 2JIIA 4JI9A 3WZEA 4DG0E 3D15A 4OTQA 4O91A 4AGWA 1YHWA 3IS5A 3NX8A 4YZDA 1PXOA 5GNKA 3U9CA 3FLWA 3R01A 4F08A 3GCUA 4P90A 4PTCA 4AT4A 4YJQA 2I1MA 2GNLA 4Q5EA 3VF9A 3FXWA 2O8YA 2QNJA 3O8UA 4YTHA 1XBAA 4XLIA 3ZM4A 2F7EE 3G51A 4PMTA 1GZOA 2PVMA 3C4EA 4GFOA 3QKKA 1QPDA 3F3VA 5GJGA 3VUGA 2H9VA 4TTHB 4ZY6A 4AZFA 3UNKA 4LG4A 1Y6BA 3E3PA 3VS2A 5CQUA 2CCHA 2XRWA 3QKMA 3SD0A 4ANNA 4E20A 4DHZA 3WZJA 4QMUA 4PDSA 4L01A 2YCRA 1YI3A 4TWCA 3ZC6A 4K8AA 4EK5A 1F0QA 4ZSLA 3NWWA 4BDFA 3E93A 5DIAA 5E8ZA 3A4PA 1YWVA 3NVKI 5EYDA 4K2RA 2IVTA 1O6KA 4OUCA 3MBLA 4RPVA 3V8SA 3CSVA 2ITTA 4QMYA 2YZLA 3LIJA 5I9WA 1NVRA 4GL9A 5JK3A 4FKRA 4X3JA 1FVRA 3LCOA 3RALA 2IJMA 4M66A 4O38A 5AUVA 4FKIA 4QP6A 5T68A 4XX9A 5IUHA 2OICA 5KMOA 3V6RA 2FUMA 5HE0A 4KS8A 1RE8A 4HVGA 2VO6A 2GS2A 5HQ0A 1OKZA 1ST4A 3EHAA 3TIYA 3UIXA 4O0XA 5E8TA 2GS7A 3UJGA 3UC3A 3L9NA 2RGPA 3TCPA 2XM8A 3EYGA 3FSKA 4AN3A 4O0VA 3ANQA 3QUEA 5KMMA 3DV3A 4WSYA 3KA0A 4O0RA 3FLNC 3FYKX 5HLNA 2UW6A 4FIGA 3EL8A 4ITJA 4Y83A 1GZNA 4ZZMA 2EXEA 3V5QA 4L45A 2I0EA 4GT4A 3MPTA 2XNMA 5CEPA 2G15A 4F0GA 3UGCA 3PZEA 1VYWA 4G5PA 3W2QA 3TNHA 3W16A 5DVRA 2IN6A 4AU8A 5CNOA 4QEBA 4KS7A 4NKAA 3A8WA 4MBIA 2UZVA 3U55A 4JQ7A 4O4FA 5J1WA 2X2LA 3A7GA 3FMKA 5K4IA 1JKSA 5HG8A 2XK8A 3EQFA 2O3PA 2C3JA 1GIHA 2XNGA 3EFLA 4KD1A 4CKIA 1UU7A 4C37A 3SG8A 3I79A 3OUKA 5A4EA 2JITA 4XBUA 3QTRA 3DK3A 2XZSA 3MFUA 3AXWA 4FKPA 2XCKA 1CDKA 2XIRA 4YC3A 1ZXEA 5AX9A 5M55A 5AUTA 4R77A 4IWOA 4ASDA 3DA6A 4MNEB 5M53A 4FL2A 3ZRMA 3HMPA 4EOQA 1IAJA 4CV9A 2C3IB 4DLJA 4YO6A 4RVTA 4YTIA 4G3EA 5JKGA 4ORKA 2P55A 3FEGA 3R7YA 3PTGA 1GAGA 4MEDA 3DKFA 4QTAA 4CZUA 5A54A 1CM8A 4D2TA 2JGZA 2CGWA 1YOJA 4ZTMA 4MTAA 5J5SA 4FJVA 1VLRA 4AZTA 3O0GA 4BFMA 4IX4A 5J9LA 2UZOA 4AE9A 1ZMUA 3FHRA 2OSCA 5CANA 2ITWA 4DEIA 4FTOA 5JFVA 4FNZA 4KUJA 1FVTA 4TYGA 1LPUA 4I24A 2YITA 4RG0A 4XG2A 4WG5A 5HE1A 3R9DA 4KAOA 4CCUA 1OKYA 1KV2A 3NDMA 4K1BA 4YNEA 1XO2B 1OZ1A 2OH0E 3LQ5A 2X0GA 5C9CA 5BVWA 1ZMVA 2YCSA 4FX3A 3KF4A 5HEZA 1G8AA 2DWBA 4AAYA 4L42A 1H1QA 3DDPA 5H8EA 5J1VA 3RM6A 2ESMA 4FK6A 4PPAA 2YHVA 2Z2WA 3ZOSA 3EQHA 2VTOA 1EH4A 2G2HA 2ITVA 5FRIA 4W4WA 1DI8A 5DI1A