2UW3A

Structure of pka-pkb chimera complexed with 5-methyl-4-phenyl-1h- pyrazole
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of Inhibitors of Protein Kinase B Using Fragment-Based Lead Discovery
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 106
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw3A02
4ASDA 4FSYA 3JPVA 3GU7A 5I3OA 4LRJA 2DYLA 4BVUA 3ZO4A 3VF9A 2PWLA 1PMVA 4TYJA 5CWZA 5AV3A 4E26A 2FSTX 3RPOA 5IUGA 3RM6A 4YBKA 1SVGA 3OZ6A 4IC8A 2YA9A 4NKAA 1J7IA 4RSSA 1WBPA 4XBRA 2GPHA 3BU6A 4PQNA 5FM3A 3SHEA 4A06A 3I7BA 5IZFA 3R04A 3QLFA 3ZEWA 4UMPA 4A07A 2VTOA 2FSMX 4DH5A 4FT0A 4QYFA 3R00A 2OFUA 3RPSA 3UVRA 4K33A 4O83A 1WBTA 2IZUA 3M2WA 1J3HA 2WAJA 4QPAA 5KZIA 4L46A 2YWVA 4S34A 4CYJA 4HZRA 4TWNA 5IQIA 4FV5A 3UO5A 3NYXA 4EOLA 3R1NA 5IA3A 3D9VA 4O0RA 3Q2JA 4IWQA 3S95A 4FSNA 3WE8A 4ZLYA 2F7XE 5KE0A 4JBVA 4FGRA 1E1XA 3CGOA 5M57A 1KUTA 4JBOA 3EQCA 1OB3A 2FGIA 1JWHA 2PE1A 3NW6A 4L3LA 3UBDA 5TOZA 4BCFA 2VX0A 1OL7A 3VUHA 4LGGA 3PSDA 5HG7A 3GU5A 3ZLYA 1K2PA 2WTDA 5KX8A 3FMMA 3A62A 2Z7QA 3FKNA 3P7BA 4EORA 1Y6BA 3WZEA 5K3YA 1O6KA 2OXYA 2I0VA 1IA8A 4K1BA 4Q5HA 4JX3A 3NMUF 1CKJA 4B99A 3CC6A 3FXXA 4L43A 3D5WA 3HRCA 5L6OA 3UNKA 4DFBA 5FGKA 5KMNA 3QUPA 3FHRA 3TIZA 3N4TA 1JOWB 5IA1A 4H05A 2PY3A 4Z7HA 3CTQA 2B4SB 4FTJA 4RMZA 4BIBA 1SYKA 4I5HA 3QD3A 5KCVA 1UWHA 1M14A 2Y4IC 2PK9A 4U41A 2QCSA 3MPAA 1PXJA 3LFCA 3QCQA 4DEIA 4C3RA 4M69A 4BDIA 4BDCA 3BRBA 3K2LA 4O0TA 4ZTQA 2IVUA 4W8EA 5AIKA 2OW3A 3DXPA 4GW8A 3FI2A 2BDWA 4KS7A 5BPYA 1ZMUA 4QP7A 3DAEA 4O7TA 4I5CA 4XS2A 5FRIA 1VYWA 4QQTA 4LRKA 5IQHA 1WVYA 3VS0A 5HBHA 3FY0A 2QR7A 3KK9A 4O0UA 4C62A 4F64A 2QO7A 3D94A 3C50A 3BU3A 3RJCA 3FEGA 3OC1A 4JDIA 4J95A 5FXSA 2BILB 2WKMA 5KMJA 2W4OA 4UYAA 5CU2A 3A8WA 3VBXA 3KCKA 4L6QA 1QL6A 4O96A 2GNLA 4RIXB 3VUTA 3HYHA 2REIA 4IEBA 4QT1A 3Q3BA 3QUDA 2C5VA 4FIFA 2XBJA 3ORMA 5DA3A 5ANOA 3OT8A 3V01A 1YDSE 4PTEA 4EHEA 4FG9A 3KK8A 3GCUA 4O38A 4CKIA 5FG8A 4FZFB 4FV1A 4GRBA 3SAYA 3MH3A 1PXLA 2XK9A 3U8WA 3ORXA 2VTSA 3R9NA 3RMFA 4BRXA 3ENMA 2WHBA 3TNIA 3IKAA 3AC8A 4AW5A 3TIYA 3CXWA 3SLSA 5DIAA 3Q9WA 3GI3A 4NKSA 3VWAA 4DEGA 5IDNA 3S00A 3LJ1A 4JG6A 5B2KA 2C0IA 3F2RA 3DDPA 3H0YA 3LHJA 2QURA 2G15A 4IAKA 5EK7A 3RPYA 2ETMA 5BUJA 3DNEA 5KBRA 5A4TA 1LEWA 1IAHA 2UW4A 2OF2A 4FTOA 3WI6A 5F1ZA 4JBQA 5L2WA 4DCAA 5F9EA 3AMBA 2B9FA 3NS9A 2JBPA 4USFA 4USDA 4FV6A 2JAVA 3F82A 5CVFA 3NAYA 2XNMA 4O91A 2X4FA 3AD4A 4OR5A 4FEUA 4EC8A 4K18A 3BYMA 1XH7A 3EH9A 2QC6A 4HYSA 3KA0A 1URWA 4A9RA 3NUAA 4FL3A 2VU3A 2PVHA 2X6DA 2XNNA 4AN3A 4BBMA 5CZIA 3PVBA 4NJ3A 4ZTLA 4I1ZA 4KIOA 3SXFA 4BCPA 5HLNA 4FTRA 1BL6A 3PPKA 4FVQA 2OJIA 4NU1A 2RKUA 3QXPA 3QTXA 4EOJA 3C5UA 4O81A 2W0JA 1CDKA 4WRGA 4GSBA 3PG3A 3V5PA 5ANDA 5DRBA 4QMLA 5A4CA 2A27A 4PTCA 3QC4A 5AV4A 5HO6A 3VS1A 2OXDA 5FP5A 2IW6A 3BI6A 2PVJA 4AF3A 5DVRA 4FEWA 2Y9QA 2I0EA 3QQFA 4B7TA 4AGCA 5LWMA 1OIUA 4WG3A 4NM3A 3D4QA 3V5LA 3LCTA 4XH6A 3JYAA 4MXXA 3R8ZA 3DBQA 5IQDA 3FMKA 2YDIA 3P78A 3GCSA 1E1VA 3MFTA 4FKTA 5HHWA 2IW9A 3PSBA 2WTJA 4U3YA 3TACA 2VTHA 2XKFA 3FLWA 4PX6A 4HW7A 4AACA 1ZMWA 4R7IA 1MRVA 2E9UA 1YHSA 4E5BA 5EQPA 2FVDA 4HNFA 4FIIA 4BKYA 2W1GA 4AZTA 1YOMA 2EVAA 4YO6A 3IS5A 1SM2A 3ZO3A 4D4YA 3DK6A 4X2FA 3A61A 3RAHA 1JKLA 2WOTA 4YSMA 2QOBA 3PWDA 2W96B 4QMWA 3RGFA 3U9CA 4IWOA 4ACGA 4BHZA 4PUZA 2F9GA 4QPSA 2PVKA 4YPDA 1OM1A 4NM7A 3MVJA 5J9LA 2CNVA 4CNHA 1ZYJA 2ZYBA 3HA8A 5HQ0A 4QMNA 3ZC6A 4B0GA 4UZDA 4QMOA 2OWBA 3O50A 3D7ZA 4WKQA 1REKA 1B39A 3CEKA 3HV3A 4C59A 5I9VA 2HXLA 1XH9A 1Q41A 3BPRA 3DLZA 3GC8A 4X6RA 4AP7A 4ENYA 3AQVA 5CT0A 2JGZA 4EKKA 4BDHA 5CXHA 5DT3A 4YZBA 1KOBA 3DT1A 4MX9A 3RKBA 1YWNA 5EW9A 2Y7JA 4QP3A 2GU8A 3LKMA 3LVPA 4CFFA 3I0OA 3ORNA 3TT0A 4F0IA 3QXOA 3DJ5A 1OI9A 2HELA 4O82A 2BAJA 1CM8A 3GQLA 3A4PA 5GINE 1YHVA 1UVRA 2VWWA 4IFCA 3FXWA 4M66A 3ZFXA 4C2VA 5J9YA 2I1MA 3KRJA 4O0WA 2YM3A 5HTBA 4XV2A 3RZFA 2R3OA 5A4EA 2XF0A 5HICA 4FX3A 4AG8A 2B0QA 3OWKA 3DNDA 5LVNA 3MA3A 3BE2A 3ERKA 4MF0A 3TWJA 3WIGA 2H8HA 3EFKA 3HECA 4C34A 4YJSA 2YIXA 4BCGA 1Q8ZA 4FKUA 3TTIA 3BQRA 3OVVA 2O8YA 4YLJA 4QTAA 2A1AB 4ALWA 3QRUA 4AOJA 5HNGA 5AUTA 4F7SA 3UE4A 3KN6A 3WE4A 3QRKA 2Z8CA 5BVEA 2ONLC 2P33A 4RA4A 4FSWA 4YMJA 4AFJA 5A46A 5E4HA 3CD3A 3SXRA 3RK5A 1FVTA 4EKLA 4RWKA 3O8PA 3PXQA 2BR1A 3ALNA 3F9NA 3AMYA 4ZSLA 2WB8A 4C4GA 3FQSA 5M4IA 3VRZA 3NW5A 3WF6A 4QTBA 2QOOA 3PXFA 3NIZA 5IQFA 3W18A 4U3ZA 2PVNA 3PVUA 2RF9A 3Q4TA 4RRVA 5EHOA 2BKKA 5CENA 3ZSGA 4FSQA 4OLIA 5B7VA 4UV0A 2IPXA 3TUBA 5DR2A 5F95A 4YJVA 4ZP5A 1XR1A 3OTUA 2W1EA 4QPMA 2WEIA 3MESA 3GVUA 2C68A 5E8ZA 5A54A 3II5A 5D1JA 1BI8A 3AC1A 1JSUA 3Q60A 2OJGA 2QODA 4MH7A 4HYHA 4BYIA 4JQEA 4B6LA 2R3JA 5AAGA 1P5EA 3E3BX 3L8XA 4EHGA 3LFFA 4U6RA 3P5KA 4E3CA 2VWUA 3RPVA 2HW6A 3MH2A 2GHGA 2GMXA 2JKQA 4KRDA 2BAKA 2WO6A 3TV6A 3EN5A 5AP3A 3L8PA 4D5KA 3NUYA 4ERWA 1Q97A 1JQHA 2H34A 5AWMA 4PDPA 2VO6A 1QPCA 3LMGA 2PUIA 1J91A 4YZNA 3FSKA 3T9TA 2EXCX 4KBKA 5EYDA 3D83A 4B4LA 3ZMMA 3FSFA 3H0ZA 4B8LA 4UX9A 4TL0A 2YCQA 3WILA 2GDOA 3CPCA 2HIWA 2WMQA 4N57A 2ERKA 1P14A 4RJ3A 2OJJA 2BUJA 3LFDA 3G5DA 4FYNA 3RHXA 3GBZA 4A4OA 3QQUA 5AP5A 2EXMA 4UWBA 3UYSA 3HVCA 2WELA 3FLSA 4F6WA 2F4JA 4MBJA 3PY3A 4I6QA 4P90A 5CSHA 3OCTA 3HDNA 4LM5A 4PL3A 5HTCA 2QR8A 4FG8A 4YURA 4FV8A 3I60A 4E7WA 1RJBA 1YWVA 2IJMA 4IAZA 4DCEA 2CGWA 1IASA 4TPTA 4YU2A 3CLYA 4XUFA 2VWYA 5C8MA 4S30A 3QX4A 3E92A 3FC1X 4IWPA 1OL2A 3NIEA 2HZNA 5CEKA 3VF8A 2YM4A 4D58A 3P86A 4Y73A 4ZTNA 3FE3A 2F57A 4U7ZA 5AUWA 3NNXA 4EBVA 2QQ7A 5FLFA 2YZAA 4CZYB 2IVTA 4LGDA 1UNGA 3F2AA 4WIHA 2XNPA 2WMRA 2QHMA 3HMPA 2BHHA 2J7TA 3HA6A 2C6OA 4TN6A 1JBPE 2WU7A 3IECA 5T6KA 3SXSA 4FTUA 5M09A 2ZJWA 4TNBA 5AAFA 3VVHA 4I21A 2VTLA 3GU6A 4BTMA 2W1FA 5IH5A 2YM6A 3F2NA 4D2SA 5DYJA 4FKOA 4AW2A 5CF6A 5IUHA 4FV0A 4BI0A 5J7HA 4FOCA 5FEDA 3HRFA 3K54A 3GCQA 4FKGA 4LL5A 3SW4A 3VBYA 4A4XA 3AT2A 4F4PA 1H00A 4E93A 3PP0A 2VWXA 5L8LA 4H1JA 2OIBA 4KKGA 5LCKA 3A7GA 3REPA 3TN8A 2CNQA 3MB7A 4TKSA 3Q2MA 5ICPA 4UALA 3LXLA 1RW8A 2VWVA 3SD0A 2B9JA 4RWLA 1H28A 2C5NA 4FR4A 4O0VA 4YNOA 5C4LA 2JFMA 3EFJA 4LI5A 3I0QA 2UVYA 2WOUA 3C7QA 2VO0A 5LVOA 2UW3A 3UJGA 2BRBA 4LG4A 1L3RE 4ANOA 2EUFB 4QMMA 2XIKA 3TZ8A 1DM2A 3H10A 3VO3A 3AC3A 5K9IA 2VGOA 4I92A 4QOXA 5EKOA 2B53A 2O5KA 3H3CA 2JDTA 4MNFA 5E8UA 4C4EA 5CU0A 3ZEPA 3BE9A 4ZS4A 4N6YA 4KUJA 3RNYA 2BVAA 2BHEA 5BMMA 5HX6A 4IZ7A 3MVHA 4MXAA 3UMXA 1XO2B 3ZO2A 4QMQA 3BLRA 3FLQA 4G3FA 4ZOGA 3T9IA 3PIXA 4HGEA 4DBNA 1JVPP 2UW8A 3JY0A 1ERKA 1ATPE 3IO7A 1M7QA 4F63A 5JRSA 3Q6UA 1DAWA 4ZSEA 4YPSA 4RIXA 5A6NA 4QQCA 5JT2A 1MQ4A 2PMOX 3PVWA 4OAVB 5IPJA 5CASA 3QCSA 4F0GA 2E9PA 2VO7A 3V8TA 3MW1A 5JFSA 5JN2A 3ROYA 4RJ8A 2VAGA 3G2FA 4FSRA 3FI8A 3HP5A 1Z57A 4WOVA 4XOYA 1F0QA 1W7HA 5BVKA 4UBAA 4AOTA 4PDSA 4OBPA 3ZDUA 2CCHA 1M17A 1Q8TA 1IRKA 1YOLA 3CPBA 3W32A 5BQ0A 4MXZA 2PVFA 4ANSA 4JOAA 4M84A 2ZDTA 3DXQA 3TJCA 4ANMA 3QBNA 4R5YA 3BLHA 3BX5A 2RGPA 4Q2AA 1BUHA 2EB3A 2J90A 3IONA 3QZFA 2OXXA 5K0KA 2GFSA 3Q32A 4R1YA 5AP1A 3BELA 4O7YA 2FUMA 1R3CA 3AD5A 2X6EA 4RIOA 1XJDA 5HORA 5AP7A 3V04A 4I5PA 1H4LA 4IM3A 4ITIA 2OGVA 4QTEA 2WTIA 1OZ1A 2HOGA 5DT4A 5EHYA 3F88A 3KB7A 3ZCLA 4IVDA 2VGPA 2C47A 4RT7A 4UMQA 4R7BA 2XNEA 5IQGA 3MGYA 1ZZLA 3RM7A 1YXVA 3GB2A 4GFGA 3BLQA 4FTQA 4G3CA 2NRUA 1OKVA 3C0HA 3GC9A 4P5ZA 5DR6A 4CCBA 2VTPA 3R7YA 1CSNA 4PMPA 5KO1A 3NGAA 4EI4A 5L6WL 5CANA 1MRUA 3QL8A 4WG5A 3BGQA 1Q8UA 3P79A 1KV1A 1UWJA 3KFAA 3U4WA 3QLGA 2QLQA 4OGRA 5GJGA 4EC9A 1RDQE 3N51A 4R1VA 4RX7A 4GK4A 4F9BA 4JQ7A 4D9TA 5LXMA 3IG7A 3NDMA 4GT3A 3CSVA 5CY3A 5DWRA 1S9IA 5E90A 4QP1A 5H8BA 4EK3A 3DPKA 2G2IA 1PMNA 2BZHB 1WCCA 2R3IA 2OSCA 4DITA 4ZZMA 4FKQA 4FUXA 4CGAA 3NAXA 3AOXA 2HY0A 2ZVAA 3H9RA 3DK7A 4J53A 5L2QA 1A9UA 2YM7A 2HZIA 5D11A 4JDKA 3FPQA 4EHZA 2WMUA 3IOKA 2RIOA 4EWHA 3U6JA 1GZNA 3L1SA 4EBWA 1YKRA 3IDPA 4CKJA 3SW7A 4ONAA 5IU2A 4O7ZA 4DTAA 2DWBA 4C57A 2VTQA 4MKCA 4JI9A 1ZYSA 2UZUE 1WVWA 5C26A 4FKVA 3OEFX 4ACMA 3ZM9A 5AADA 1BLXA 3WARA 1Y8GA 4BWPA 1KE7A 5EDPA 2RFNA 2IVSA 4XRLA 5LVMA 2VNYA 4HVGA 4JNWA 2ITVA 4JX7A 2PVYA 5CI7A 2PZYA 2XVDA 1Q5KA 4BDAA 3TV7A 4TW9A 3KF4A 4I94A 1YXTA 2O64A 4FBXA 5K4JA 3SDJA 5E9EA 2CLXA 3MWUA 5IMXA 3HV4A 3V5QA 5E92A 3DOGA 1WBSA 2BPMA 4JR7A 4OTPA 2PYWA 3FL5A 3BWFA 4B9DA 3ELJA 1YOJA 4DG3E 3E7VA 5CAOA 2YFXA 3V8WA 1OPJA 3WF5A 3T3UA 5EI8A 3QA0A 4FTAA 2CKPA 4AZVA 2CKOA 2BAQA 4EOKA 3PLAE 3HZTA 2B54A 2PZ5A 4G9RA 4L3JA 2R64A 4LYNA 4PWNA 3WIKA 4APCA 4UYNA 2XK7A 3FMDA 3WZUA 3I6WA 5BUIA 5J79A 4CCUA 3JUHA 3SQQA 1Y91A 4RJ6A 5CVGA 3L8VA 5JQ5A 3TDVA 3R63A 2C0TA 2G2HA 3R9OA 2HY81 4FV7A 1ZYCA 4J8MA 4F7LA 4BDGA 1UNLA 3EYHA 4NFMA 4DGMA 3C4XA 4BDJA 4NTSA 4H3PA 1KSWA 3I6UA 2BFXA 3N4VA 2GNFA 4CFVA 4GV1A 5DHJA 1YI3A 5TF9A 3SX9A 5JGBA 3ID6C 3IW7A 3QGWA 4D9UA 4XOZA 1JKTA 2QI8A 3OBJA 2BZIB 3MBLA 4GJ3A 5DOSA 4A7CA 5K4IA 3E8CA 4WBBB 2O2UA 2QU5A 4I0SA 3KMUA 4DFXE 3FMJA 2BROA 2YIYA 2HWPA 3R8PA 3R9DA 2UZNA 1VYZA 3KL8A 1W84A 2CGXA 3OW3A 1VEBA 3LJ2A 4DEEA 4YO4A 4HVSA 3BGPA 2IW8A 3COMA 1U5RA 3MV5A 4ZS0A 3TV4A 4O7NA 3HL7A 5AFVA 4FF8A 3DZOA 2X9FA 3NNWA 3VW6A 3W1FA 4CQEA 2BFYA 3ZC5A 4FZDB 2XJ1A 1QMZA 2OLCA 1KE5A 1MP8A 2OJ9A 3DB6A 1SVEA 3KXHA 1SNUA 3LFSA 1J7LA 3UO6A 4YC3A 5DEWA 4L53A 3BHVA 1S9JA 4MK0A 4RJ7A 2WMVA 4USEA 2IZRA 3PUPA 4E6CA 5HVKA 3P9JA 4GMYA 5CI6A 5CALA 4XV3A 3R9HA 3ULIA 5IDPA 5D7VA 4FKRA 3D0EA 4IFGA 2GHMA 4F7JA 5EDQA 2AC5A 5HE1A 5JK3A 2FB8A 2XM8A 4ANBA 3E64A 3BWJA 5J9ZA 3TKIA 4L44A 3W2SA 2VTMA 1H1WA 2H96A 4BDDA 1YWRA 5BVWA 4NTTA 4PDYA 5L8JA 3ZZEA 2ITNA 4V0GB 5IQAA 2YIQA 1XBAA 3BBTB 4QMTA 1Z5MA 3LCDA 2G01A 2OH0E 4I20A 4BL1A 1PXOA 4BKJA 3DV3A 4QMYA 2YJSA 4OTRA 4LOQA 4FYOA 4X3JA 5GJFA 5C03A 3RZBA 3QTRA 2PMLX 3R7VA 3FZ1A 4O86A 3MPMA 2R0UA 2J9MA 4WG4A 3W8QA 1GIJA 2RSVA 5ANGA 1H08A 3BKBA 4CG9A 3W2QA 4EH9A 2JKOA 4C37A 4PDOA 3L8SA 1VJYA 3GCPA 3A7HA 4GUBA 5A4QA 3MDYA 3LAUA 4I0RA 5EFQA 4IX5A 4G9CA 3BYOA 3GP0A 2WU6A 3KVXA 4J96A 4IB1A 5EI2A 5AR5A 1PKDA 4AXAA 4AZEA 3WYYA 4RLKA 3C9WA 5EYKA 2BMCA 5DR9A 1H8FA 3R8UA 3SC1A 5CT7A 4BCKA 5CEQA 3WOWA 1REJA 3MB6A 2J50A 4EQCA 4HYIA 4M14A 3LCSA 3O7LB 4TZRA 2J0IA 5EDRA 5CAPA 1U59A 2PL0A 2VNWA 2XNOA 4KBCA 2QHNA 4GVAA 1I44A 2HCKA 4YP8A 5CEIA 4MQ2A 3UC4A 4AU8A 4EOPA 4BBEA 1OPKA 3DQXA 4YJQA 2VTTA 3CGFA 2WTCA 3MI9A 3OOMA 4HOKA 5TE0A 2GS2A 5BVDA 3ACJA 3MH0A 3D2IA 4RG0A 4WNMA 2XB7A 3G33A 1XKKA 2Y0AA 3QTSA 3FYKX 1NVSA 4J1RA 4NH1A 3MS9A 3QKKA 5DLSA 4NJDA 5IA2A 4KSPA 3D7TB 4PPBA 3ZUUA 3QQLA 3CKWA 4S31A 1JPAA 4L7FA 2ITQA 4P5QA 4FNZA 3JS2A 1DAYA 2C3KA 2JIVA 4W4YA 3WBLA 2Q0BA 3DBEA 2UZOA 4F09A 1NVQA 2LGCA 4DTBA 3EQFA 1OBDA 5BYYA 4D55A 4KRCA 2GQRA 3LLTA 4IZAA 4XG6A 1O6LA 2NP8A 4XG7A 1AQ1A 4FIJA 4O6EA 4BZOA 2RG5A 2QD9A 4ZTHA 5FP6A 4RX8A 3PSCA 2HW7A 4MEDA 4M7IA 4NM0A 2WMXA 1BL7A 4YHFA 2Y8OA 4KS8A 1ZYLA 3D2KA 3HLLA 3O8TA 2BRGA 3Q4UA 5AMNA 4DHFA 2XJ2A 3QYWA 3QQKA 4XMOA 1WBWA 4DC2A 2H9VA 4MF1A 4L7SA 4Z16A 5HKMA 4TWOA 5AR4A 2XUUA 3CQWA 4CEGA 2HENA 5IQBA 2W9FB 3F3VA 4AW1A 4L67A 4OTFA 2OK1A 2BDFA 4GS6A 5CU4A 2ZV9A 2F2UA 2XK3A 4J71A 3W33A 4FT9A 5TT7A 3G6GA 1Q8YA 3VJNA 3MSSA 2E2BA 4ZJJA 3B2TA 2EWAA 3Q5ZA 4FSZA 2W5BA 5FM2A 3VBTA 3ACKA 5GZ8A 2XBAA 4FTTA 4R7HA 5CYIA 4H3BA 3EQHA 4F9YA 4EL9A 2WMBA 3Q5IA 3UZRA 1PJKA 3CQUA 4EQUA 3S4QA 2Y4IB 2VO3A 4BCMA 1Q61A 1ZARA 4F1OA 4LOOA 2PTKA 1FGIA 1LUFA 2VTAA 3VUGA 2R2PA 5CEOA 3COIA 1JLUE 4PV0A 2P2IA 3FUPA 3NYVA 1JNKA 4YZCA 5ANEA 4FVRA 1CTPE 3L9PA 4TWPA 5IKWA 3RPRA 3W2PA 4DLIA 4ACDA 2Z2WA 3O23A 5M4CA 5IISA 3D15A 4AN9A 5EQEA 4YBJA 4JRNA 2VX3A 1AD5A 2C1BA 3ATTA 2ZMCA 3E87A 1FVRA 2WXVA 1QPJA 3VHKA 5GIPE 4YR8A 3NR9A 1P4OA 3TUCA 3F3WA 3QAME 4APPA 2YHVA 2JDSA 3PE1A 4E8AA 3SOAA 4PL4A 4JR3A 4N6ZA 4CXAA 1KE6A 4JBPA 5BYLA 3ZM4A 4HPUE 3R7GA 3TEIA 2UW7A 4DTKA 2W4KA 4XHKB 3HMOA 3VS5A 2W17A 5LVPA 5TKDA 2IO6A 3C5IA 3UO4A 4HCTA 3C4ZA 2C1AA 4FV2A 3RAIA 5HO7A 1ZOEA 4JRVA 5J87A 3AC2A 5CAUA 1OKWA 1M2RA 3R8MA 3I81A 3PWYA 2YLFA 3HMMA 4WUAA 4O7RA 1Y57A 2RFEA 4HYUA 1M52A 2V7OA 2IN6A 3ALOA 4O6LA 4D4RA 3C0IA 4A4LA 3C4CA 3VN9A 4JIAA 4B8MA 4FUYA 2JITA 5J8IA 3VUDA 4K77A 1OIRA 3R83A 4J98A 2WIPA 2QNJA 3JVSA 2G1TA 2OZAB 3N4UA 4TY1A 3UOKA 2J51A 3HV7A 3ZXTA 2B7AA 3U6IA 4IVCA 4CRSA 3MFSA 3NCZA 3VRYA 4TYHA 4TRLA 3LFAA 2W05A 3EQPA 5A4LA 3BHYA 1M2PA 1RQQA 3F3TA 4IZYA 4N0SA 3UGCA 4EK6A 5LMKA 4MCVA 3O2MA 4NIFA 3WZKA 5EOLA 3QFVA 4L45A 4AFEA 2JFLA 4ASEA 4YTFA 4XG3A 4UXLA 3V8SA 3VS3A 5L2IA 1R1WA 1URCA 3GGFA 3KN5A 1V0PA 4R3CA 3BCEA 5F20A 4R78A 4C36A 4D0WA 4XRJA 4FV9A 4LGHA 3PA3A 4AN2A 1GNGA 2WTVA 1IAJA 5KMIA 3QTQA 3K3JA 4G3DA 3QWJA 4E6QA 3HEGA 3OUNB 3MH1A 1KV2A 4QYGA 1E9HA 3QQJA 4Y95A 5AP4A 4AA4A 1SVHA 4QMVA 3NEWA 2ITZA 4MXYA 2PUNA 4OTIA 2PULA 3NYOA 4C61A 4OTGA 1Q3DA 2JDVA 4X2KA 3HV5A 3DU8A 5BNJA 5IMEA 4FTMA 5JFVA 3QX2A 4YJRA 2BDJA 3BV3A 4MWHA 5HOAA 5H2UA 2XKCA 1GZOA 2ETRA 3IQ7A 4XG4A 3VBWA 5EKNA 2GQSA 3DJ7A 3VW8A 3PJCA 2X2MA 1WZYA 2R9SA 4GEOA 4IB5A 2AC3A 5HE0A 1F3MC 4IMYA 3A8XA 5M55A 4Q9ZA 2ITOA 3SGCA 1XHAA 4S33A 4CV8A 1VZOA 3QWKA 4FICA 2C3LA 2X2KA 2J5FA 3MFUA 4BICA 1YQJA 3CE3A 4LV8A 3NUXA 2QG5A 3OXTA 1MRYA 3SRVB 4QMSA 2OJFE 4M8TA 3E7OA 4IC7A 4RGJA 3R28A 4TNDA 4CRLA 1YXUA 4GIHA 1H25A 4RVTA 2ZB0A 3DQWA 2CGUA 3TM0A 3UNJA 5ACKA 4H36A 4I5MA 4I93A 3AXWA 5CU3A 2B1PA 2RG6A 5JMSA 2VD5A 4ZTSA 4EOOA 3VS7A 3C13A 4L9IA 4EH4A 1OGUA 4EUTA 4CT1A 4JL9A 4PNKA 3KULB 2XK8A 2C0OA 4UB7A 4NUSA 2F49A 4CQGA 3R8LA 2ITTA 3KEXA 4G3GA 3DAJA 2OH4A 4O2PA 4XNEA 3R7UA 3ZONA 4CFMA 2Y6OA 2BRNA 5CQWA 4F0FA 5HE2A 4AUAA 2O65A 5A9UA 5JGDA 5JH6A 2BTRA 4IIRA 4D1XA 5JKGA 4M68A 1YDTE 1FPUA 1TKIA 3COKA 3FKLA 4W4XA 2XJ0A 4M12A 1ZOHA 1BI7A 5DBXA 2VTJA 3OW4A 4E1ZA 3QD0A 3N9XA 4GKIA 3ZZWA 3EL7A 2YDKA 1UKHA 3PP1A 4FZ7A 3UZPA 4E73A 4EEVA 4I41A 4F9WA 1PRYA 4ZXTA 3RWPA 5HX8A 4G2FA 4O22A 4DG2E 4JAIA 1PXMA 4AWIA 5HG8A 3EQIA 2PE2A 4EOIA 1JAMA 5KMOA 4QNAA 2C6LA 4BWXA 4IXPA 2X7FA 4YNEA 3R2BA 3K3IA 1YVJA 4IE9A 2XRWA 3CR0A 4JT3A 5LVLA 4CFWA 3R9RA 3RK7A 3OS3A 3IOPA 3P1AA 4IWDA 4BDBA 5KHXA 2YN8A 5CEMA 3OOGA 1WVXA 1BYGA 1OBGA 3K5UA 2ZDUA 4JLCA 4TYGA 2VTRA 4GK3A 3CP9A 3QU0A 2B9IA 3PIZA 3RHKA 1HOWA 2GNHA 2W7XA 4QP9A 3OCSA 3DKCA 5EYCA 2R3LA 3EKKA 4ERKA 1FBNA 4PMSA 2YLEA 5FQDC 3U9NA 2EXEA 4QD6A 5LMAA 3ZRLA 3GUBA 3Q96A 2IZSA 5HCYA 4NK9A 4ZEGA 4H1MA 4W4WA 4WSYA 4OUCA 2NPQA 3OROA 4C4IA 5H3QA 5AJQA 4FOBA 3RCJA 4TWCA 2SRCA 1Y6AA 3OXZA 4PMTA 4FT3A 4P7EA 2PPQA 5M08A 2X39A 2YAKA 2CN5A 3TNWA 3SG9A 4FTLA 2JKKA 5A14A 2WQMA 4J99A 3ZDIA 3ORKA 2XCHA 2JLDA 2QU6A 4Z3VA 5JFWA 3ULZA 3R21A 4IDTA 4EK8A 4MBLA 1OECA 5BVFA 2ZV2A 3COHA 4V0GA 2GFCA 1Q4LA 5EHLA 4RIYB 3PPZA 5AV0A 1G3NA 4NW6A 4LL0A 4C4HA 5T3QA 4NYEA 3ZRKA 3QRTA 4G17A 2R3HA 4IJPA 2WTKC 3ZUTA 2B9HA 5FTGA 2PVMA 4S32A 5CF4A 4XCUA 3DS6A 4RWJA 3KMMA 4ITJA 2V5QA 2BTSA 5ANIA 2QOQA 4YC6A 5C27A 4F70A 2ESMA 2V0DA 3PPJA 2PE0A 4O0YA 3UTOA 3QC9A 2GTMA 3BGZA 3E93A 2OIQA 2VTNA 3DXNA 4XG8A 5AX3A 3EKNA 3R30A 4H3QA 1U54B 3LJ0A 4LUDA 4WT6A 4RA5A 4PPCA 3UC3A 3VNTA 4HGTA 4X0MA 3GNIB 2R3KA 4E6DA 4YZ9A 3QGYA 3VS2A 4C38A 4EONA 4PP7A 4JJRA 3E3PA 3QTWA 2Q0NA 3E8NA 3OT3A 1TVOA 2XK6A 3LIJA 1MQBA 1K9AA 5FEEA 3LFBA 4QQ5A 2Q83A 5LJJA 1SNXA 5FXQA 5EM6A 5G1XA 4HCUA 4L42A 3UMWA 3T3VA 5M44A 2QO2A 3DY7A 3IW5A 5I4NA 4DFNA 3M11A 4WNKA 4FKPA 4L52A 3UPZA 3ZTXA 2VTIA 3NSZA 3HAMA 3VQHA 3C1XA 1PXNA 2JIUA 4G16A 3GC0A 3BHTA 4GUEA 3ENHA 4RVKA 3IW4A 1H01A 1UU7A 3FI3A 4I24A 1NVRA 3EN4A 5CNNA 5HVYA 4X3FC 1OKZA 3HKOA 2NRYA 3PY0A 3LCKA 4BCNA 5J5SA 5KHWA 4M13A 5IF1A 3ZRMA 2B55A 2BKZA 2JBOA 1Q62A 4ZLZA 3UQFA 5CEPA 2OICA 2R7BA 3QD4A 4E4MA 3CTJA 5BVNA 4DH7A 3ZU7A 5IH6A 5C1QB 3NUPA 4RX5A 3DFCB 3O17A 3ETAA 3PE2A 1PKGA 4FK6A 2X81A 3FBVA 3MJ1A 3P23A 1GZKA 1H0VA 1UNHA 1LPUA 3DDQA 4YJUA 3NUNA 3FZSA 3PVGA 5BYZA 2JAMA 3PTGA 2YCRA 4BCQA 2YM8A 1I09A 1FMOE 3QQHA 1ZMVA 2O3PA 4W9WA 4FSMA 3EQRA 4GK2A 4IJ9A 2VUWA 3PDTA 1PXPA 2QLUA 2R3RA 3OY1A 4BIEA 1FGKA 4DT8A 3ORIA 3EQGA 3H4JA 5FBOA 4GU9A 2WFYA 3V51A 4N4SA 4WUNA 4YJNA 4I6FA 5EW8A 5C01A 3V6SA 1KE8A 5HLWA 1JSVA 3POZA 4D5HA 3NVMB 1YRPA 5H9BA 4FKJA 2JIIA 4F08A 4YJTA 5F94A 2WQNA 3L9LA 3R7EA 4MWIA 4OTDA 2ZOQA 4IAIA 2BRMA 3BEAA 3QRIA 5IA4A 2UVZA 2JEDA 3D5XA 5HG5A 4U40A 4PTGA 4BDFA 4IBMA 3QUEA 4U8ZA 2KTYA 2JD5A 4EH5A 4IM0A 1H26A 3I7CA 4ZJVA 5AA9A 1R39A 1ZXEA 2A4LA 5CS6A 1OPLA 2CPKE 2R7IA 3NYNA 4XG2A 5M4FA 4UMTA 4WRSA 3TXOA 5BX0A 3BZ3A 4Z9LA 2GSFA 1XH4A 4AW0A 4FIEA 4J8NA 3U6HA 1J7UA 4IZ5A 4CD0A 3F7WA 5CVHA 4F6SA 5C8KA 4DA5A 1APME 4II5A 4OBQA 2WGJA 4KB8A 4RFZA 5CSWA 3T8OA 3KQ7A 3VJOA 2PVLA 3WZJA 4EH7A 3FLZA 2X4ZA 3EFLA 3L9MA 3QCXA 4X3FB 2EB2A 3DGKA 2FH9A 3PRFA 4ANQA 4C2WA 4D0XA 5GNKA 3KRXA 3I5ZA 1R78A 2X9EA 1UA2A 5HESA 3UQGA 2E9NA 2HAKA 3VULA 5EQYA 4I4EA 1WBVA 1J1BA 2C6KA 2GQGA 4D28A 2UW6A 3ATSA 3OWPA 3W16A 2C3JA 3LE6A 5GJDA 4V04A 2WMTA 2YAAA 5ACBC 4EJNA 5B2LA 5J1VA 5L2TA 4IW0A 4A9TA 5HI2A 4MNEB 2P3GX 4BTFA 5HIEA 3A4OX 1OL6A 1QPDA 3KREA 4D2RA 3UIXA 3JXWA 1DI9A 3FMLA 1OUYA 3KXXA 3LLAA 4FC0A 3EMGA 4BKZA 2ITUA 4BFMA 3ANQA 3LM0A 1YDRE 4JS8A 4ZSGA 1XH6A 4GU6A 4PNIA 4LRMA 3EJ1A 3TZMA 2J0JA 2JC6A 2UZBA 4RJ5A 5IQCA 5M07A 1PMUA 4GYIA 4ZLOA 3EZRA 3CY2A 2R3QA 2BZKB 2QOIA 4Y72A 3GC7A 5KUPA 3LFNA 4YLKA 2HZ0A 4DEBA 2XIXA 3ANRA 3IDBA 3KRRA 4ZMFA 2NNWB 4EYJA 1OKYA 4DGOA 2VWBA 4K0YA 3OUKA 4FT5A 4JAJA 4WHZA 3W2RA 1P4FA 4BZDA 4EOSA 4FA2A 3DK3A 5EM8A 3RP9A 4QYEA 3R0TA 4O7WA 3NWWA 2BALA 4FI1A 4R3PA 4BDKA 4UMUA 2XA4A 3UIUA 1LEZA 4MHAA 4E5WA 1JSTA 3FMHA 3KY2A 4BTJA 4E6AA 5AR3A 3C4EA 4D4VA 2FSOX 4IH8A 3RALA 3S2PA 3ZLSA 4CFUA 5HTIA 1IG1A 3FZPA 3F5GA 5AEPA 3FLYA 1PF8A 5CSXA 4L8MA 3ZLXA 4DH1A 4F7NA 5FDPA 3U4UA 2ZMDA 2UV2A 4Z7GA 3TTJA 3FZRA 5DPVA 4G1WA 5CU6A 4DYMA 2QVSE 4RBLA 4YC8A 1YHWA 4PRJA 2OF4A 5HZNA 4BR3A 2YJRA 4PMMA 5FDXA 3MFRA 3H9OA 4NT4A 3ZYAA 3DKOA 3OWLA 3TG1A 4QP6A 3Q04A 3CJFA 3Q4CA 3CKXA 3PJ2A 4EZ3A 4BCIA 2WD1A 4NSTA 4EZ7A 5K5NA 2PZPA 2W1ZA 2WQBA 3HX4A 2ITYA 5AIRA 1XQZA 5T68A 5CXZA 3H9FA 4FKSA 2WTWA 5D9HA 3IK3A 2UZVA 2ITWA 2V22A 3DBCA 4KBAA 5JFXA 2R0IA 4RPVA 1GZ8A 2FSLX 3ZFMA 5E8XA 3P0MA 3VC4A 1PMEA 5IA0A 4TYIA 2DS1A 1IEPA 4U81A 3MY5A 2QO9A 4PPAA 3R73A 1YXSA 4RC2A 4ZY6A 2UZEA 3KULA 5HO8A 3UZTA 4JVGA 2WIHA 4YHTA 3O8UA 4WSQA 3POOA 3V3VA 2UW0A 2X8EA 2BIKB 2UW5A 2UW9A 2H6DA 3EWHA 3GEQA 4O7SA 2W06A 5I5ZA 2GNJA 1UV5A 2XZSA 5AUXA 3PRIA 3A60A 3RCDA 5AM7A 2XH5A 4UWCA 5LQFA 1XH5A 3ROCA 5IG1A 2VRXA 4H39A 4HZSA 4CTCA 3MIYA 3KU2A 4YTIA 4NL0A 3V5TA 1P2AA 5KNJA 3EQDA 4OTQA 3F61A 4L00A 1GIHA 2IZTA 4JQ8A 4M67A 4WBOA 4WD5A 5AP2A 3FV8A 4K11A 3HGKA 3HP2A 5HEZA 4BN1A 5I9YA 4CMTA 3TKHA 3TZ9A 2Z02A 4IX6A 4RZWA 3P7AA 2C6EA 1KWPA 1OL1A 4U80A 2UVXA 5ETFA 3BYSA 5B2MA 1PXIA 3PIYA 4BC6A 4Q5EA 5FUTA 2C5YA 5HU3A 4BF2A 4TXCA 5JQ8A 4NCTC 3B2WA 5HNBA 3UP2A 4EK4A 2YABA 2JDRA 3FKOA 3NX8A 4RVLA 4UY9A 3VBVA 3S3IA 2Z60A 4F6UA 2CGVA 4GG7A 3KXZA 3VAPA 3CJGA 4ZY4A 4DLJA 2I0HA 3G90X 3OBGA 3ZO1A 3EN6A 3EN9A 3F3ZA 3HDMA 4U79A 3TNHA 4KSQA 1MUOA 5FD2A 3B8QA 1GJOA 2C6TA 3KCFA 3QD2B 3PG1A 1UU8A 3TUDA 4FGBA 2YEXA 2ONLA 2FA2A 2UUEA 2X7OA 2AUHA 3LXPA 4XP2A 4D1SA 5C4KA 4Y8DA 4KINA 2CJMA 2W1DA 5J1WA 3HUCA 3R02A 4GIIA 5E8TA 5HBJA 2R3PA 5KKRC 4U42A 4QTCA 3RAWA 2BZJA 4XG9A 4GKHA 3AMAA 1KOAA 4EHVA 5AUUA 4XEYA 4FKIA 4UMRA 1XBBA 1ZLTA 4G5PA 1FINA 2UZWE 5HCZA 2EU9A 3QZGA 4W4VA 3UG1A 4ZMEA 3LOKA 4FG7A 3WYXA 4I4FA 5D41A 1G8SA 3FC2A 1GAGA 4IX4A 4EH3A 3TI1A 3ORLA 4EJ7A 3DZQA 4RIYA 5CF5A 4HVDA 3GXLA 4MD8E 2O0UA 4A9UA 4ZAUA 1OIQA 3UNZA 3MN3A 4YJPA 1CKPA 2R3NA 4EWQA 4MXOA 5I9XA 3E62A 3GU8A 4F9CA 5AX9A 1J1CA 4OT6A 2GTNA 4DGNA 4YJOA 4FSTA 3CBLA 1Q24A 2I0YA 2QOHA 3DFAA 4AZFA 3UVQA 4E5AX 3Q9XA 4IACA 2YISA 4QMXA 4CMOA 4XP0A 4W8DA 3TNPC 4U44A 1Q99A 2A19B 4W9XA 5ANJA 3THBA 3V6RA 2CLQA 5HVJA 3LXKA 4AAAA 4FV4A 5KMMA 3E5AA 1LP4A 1U54A 4U0IA 3FAAA 3R7OA 4RX9A 4F99A 3FMEA 5J5TA 1Q8WA 2P2HA 3K5VA 3LM5A 3QTIA 3ZFYA 5CTPA 4HPTE 5GZAA 4O0SA 3KF7A 3CQEA 1NW1A 5DRDA 2V62A 2YERA 3F7ZA 3RK9A 4KIKB 4C02A 4C8BA 4O84A 4EOMA 5HCXA 4RZVA 3F5UA 2X2LA 2W1IA 4FEQA 3KXNA 3HUBA 4IQ6A 4BGGA 1DI8A 1CKIA 4BI2A 5DMZA 4YUQA 4O21A 3E88A 2B52A 2G2FA 4Y46A 5IA5A 3JR1A 1QCFA 4S2ZA 3VUMA 4DFYA 5TO8A 1G5SA 3GOKA 3G0EA 5A3XA 1GIIA 4EYMA 2P4IA 2PZRA 1ZY4A 2YCSA 5G6VA 2ERZE 3MVMA 5CSVA 4V01A 2OKRA 4FODA 4GH2A 3VUKA 5KKRB 2C4GA 1LR4A 4R5SA 4LQMA 4YGAA 4F65A 1YI6A 3O7LD 4ID7A 4X7QA 2QG7A 4CLIA 3U55A 4KD1A 1OMWA 3WF8A 3IGOA 4F1MA 2OG8A 3VBQA 2FYSA 3VHEA 3W2CA 3DJ6A 1YXXA 5FXRA 3P08A 1NY3A 3FY2A 4G34A 4Y85A 4H58A 4OTWA 3F69A 2ZAZA 2P55A 3ORTA 2XNGA 3QHWA 4HGSA 4PL5A 3IDCA 2X7GA 5HG9A 4CZTA 1RE8A 3VIDA 4FE2A 2OFVA 3PA4A 1EH4A 5AV1A 3FJQE 3W55A 1UU9A 3LW0A 3F66A 2X0GA 3G9NA 4MTAA 4RIWB 3QHRA 5AR8A 2W1HA 3KMWA 5HLPA 4EH6A 3QTUA 3BBWA 3FWQA 5L2SA 4FZ6A 3NUUA 5IEXA 5LOHA 2W5HA 3NUSA 3I5NA 3AGLA 1O6YA 4CFXA 4EZ5A 1H1RA 3UOLA 4M0ZA 3LQ3A 4C4JA 5HBEA 4DEHA 2PMNX 2OBJA 5ITAA 2QKWB 3QKLA 5EH0A 4IHPA 3MJ2A 3R22A 2G9XA 4RFMA 2J4ZA 2JKMA 2YZLA 5E7RA 2Z7SA 4CG8A 4ZZNA 4AGWA 4OAUC 2QOKA 4HNIA 1GOLA 1V1KA 2W1CA 4O1PA 3CS9A 4XYFA 4M0YA 2HZ4A 3QQGA 4BZNA 4QRCA 5IEYA 2GS6A 4C58A 4F1TA 4BHNA 2XCKA 5CX9A 1WFCA 3EL8A 2PHKA 4ACHA 4AQCA 4L3PA 5I0BA 4OT5A 1XBCA 3CTHA 4GT4A 4QMZA 1CMKE 3FXZA 4C3FA 4K8AA 3QALE 4WNOA 1W83A 3PFQA 2I40A 2ZM1A 3ZHPC 5F4NA 2XM9A 4O2ZA 4FTIA 4YTHA 2BRHA 4UEUA 3RNIA 4YTCA 3SVVA 2BCJA 4U43A 1H1PA 4FEXA 4ALUA 5E1SA 4CMUA 3LQ8A 4X3FA 1ZYDA 4CSVA 4FT7A 2XKEA 3OP5A 2F2CB 4I22A 3EFWA 4ITHA 1U46A 3QA8A 4AZWA 3NNUA 4L68A 3RWQA 2ZM4A 4U5JA 3OXIA 5M06A 4BDEA 2ETKA 2R3GA 1H1QA 3E8EA 3GENA 4G3EA 4GYGA 2OI4X 4IB3A 4D2TA 3NPCA 1G8AA 5CLPA 4ANLA 4FNXA 1H27A 4FNYA 4MNEA 1BKXA 4AGUA 2V55A 3LQ5A 4AT4A 3SA0A 3MTFA 2UZLA 3R8VA 3FZOA 3F3UA 2YWPA 5FEQA 4CFNA 5I3RA 1NXKA 4IM2A 4JDJA 1DS5A 3LPBA 4G6LA 4BY9E 5DG5A 4ANNA 1H07A 2Y6MA 4KAOA 4D1ZA 4DH3A 3C4WA 3PXZA 3R71A 3IW6A 3HV6A 3S1HA 1KE9A 4CYIA 3DKGA 1H0WA 4KKHA 4I23A 2YCFA 3UOHA 4JXFA 4MYGA 4IADA 5EM7A 5FTOA 5FTQA 3V5JA 3F6XA 3JY9A 2A2AA 2XEYA 4RWIA 3UPXA 5I9UA 2F7ZE 3GOPA 3A99A 2UZDA 2OU7A 4MD9E 5JEBA 2R3MA 4FZAB 4GFMA 2C30A 5KMLA 5L6PA 2XEZA 2XS0A 5ETAA 2WPAA 4AT5A 4DBXA 3PJ1A 4EOQA 5A6OA 3QZIA 4FMQA 2CN8A 3MY1A 4KNBA 5DN3A 4FTNA 3DA6A 3TNQB 3IW8A 4FVPA 4KIPA 5HE3A 2QOFA 1W82A 3EZVA 3O96A 4BWKA 5B0XA 3FMNA 3PZEA 4XLVA 4CTBA 1O9UA 1OIYA 3EB0A 3G0FA 3PJ8A 5DH3A 3SKCA 3VS6A 3HRBA 4XP3A 1W0XC 2YITA 4G6NA 4XV9A 4ACCA 1V0OA 3DTWA 3F5PA 1H24A 4IVBA 2P0CA 4QP4A 5M53A 1ZY5A 4JG8A 2C6IA 4QYYA 4AE6A 4YSJA 2Z7RA 2Y4PA 3P4KA 4UN0C 5CAQA 2R3FA 4GCJA 4K9YA 4LMUA 4HVHA 5LMBA 1FVVA 4Y5QA 4ZSJA 3RVGA 2GHLA 2R5TA 4IAAA 4HJOA 4R6VA 4HVIA 3UOJA 3G9LX 1XH8A 1H1SA 3TL8A 2E9VA 5EI6A 4ZJIA 3Q9ZA 3R1SA 2VWZA 4DE4A 5FBNC 1A06A 5EM5A 4YZDA 4I3ZA 3VS4A 5IQEA 4ZIMA 3KRWA 5E8YA 2XYNA 5CQUA 3IPHA 5AUVA 5BVOA 3KGAA 4BCHA 4HCVA 4X2GA 3E63A 2ACXA 1HCLA 3CCNA 4DINA 3ODYX 3ORPA 3WF9A 3KKVA 3NCGA 3MPTA 5IH4A 4Q9SA 3BIZA 4D4SA 1A48A 4U97A 3TCPA 5GZ9A 2Z7LA 3GU4A 1OUKA 1FOTA 1PYEA 4RFYA 2CCIA 3NRMA 4YZMA 3LFEA 3LCOA 5AR2A 4AT3A 2XIZA 4CT2A 3PLSA 3Q6WA 2GNIA 3DCVA 2CKQA 3DB8A 4IAFA 1SMHA 1M2QA 3FL4A 3KVWA 4G6OA 2A0CX 2CHLA 4MAOA 2HWOA 4CV9A 4ZY5A 3MY0A 4ZZOA 3FDNA 5I9WA 5E91A 4EQMA 4BIDA 2ZV8A 2CNUA 4C4FA 5AP0A 4BI1A 4A9YA 5K5XA 4DF3A 3GQIA 4RQKA 4TTHB 5DE2A 3KC3A 4RLLA 4ZK5A 4M69B 3RINA 3ZSHA 2PU8A 5L4QA 3AT4A 2X8IA 4FL2A 3UIMA 1ZRZA 4DGGA 4EH8A 4DH8A 3O71A 4RQVA 3Q9YA 3F5XA 3OWJA 4O27B 1W8CA 4IDVA 5ANKA 3OTVA 4IANA 3H30A 3AGMA 5EW3A 2IG7A 3ZBXA 2J0MB 3FI4A 3SG8A 4E20A 5D7AA 3ZSIA 4DEDA 4RJ4A 5GIOE 3DKFA 4LUEA 4UZHA 3CD8A 2J0LA 2PMIA 2ZB1A 4M15A 3ZXZA 1BMKA 2QOLA 2WZJA 1R0PA 2XKDA 4WNPA 3UDBA 5BUEA 4XX9A 4NFNA 4YLLA 3QTZA 5AP6A 2VV9A 5CAVA 5C8NA 4I6BA 3MTLA 4Y83A 4EUUA 4R77A 5EYMA 3UP7A 5E8SA 1WBOA 3SV0A 3BQCA 1L8TA 5HIBA 4AX8A 4C35A 2C6DA 2C69A 4C0TA 5M51A 3ORZA 2HK5A 2YACA 4FIGA 3V5WA 4D2PA 1YW2A 1TQIA 2F7EE 5E8VA 3OG7A 4FKWA 2RFSA 3TKUA 3U51A 1U4DA 3R6XA 4XJ0A 3UG2A 3BYUA 4BTKA 1WAKA 1B38A 4PP9A 3R1QA 4FTCA 3JVRA 4QQJA 5JGAA 3QRJA 4V05A 5AM6A 4CLJA 3QF9A 5K0XA 5C9CA 2J5EA 3G6HA 4Y5HA 4D2VA 3OF0A 5EOBA 2QONA 5DT0A 5CSPA 3U87A 3D7TA 3QYZA 4WO5A 3BEGA 3NZ0A 2HYYA 4L01A 2V7AA 3QKMA 4MXCA 4BYJA 3NW7A 3QZHA 1R0EA 4M97A 4RC4A 4QMUA 5LMKC 4FKLA 4O7VA 1ZOGA 3PZHA 5TR6A 3PYYA 1WBNA 4GT5A 1PXKA 2RL5A 4MVFA 3GT8A 4GG5A 2WQEA 4HGLA 3DAKA 2GS7A 3EQBA 3LMIA 2PSQA 2J0KA 3OFMA 3OD6X 3NLBA 3MIAA 2YIRA 3UYTA 3UIBA 4KABA 3ZS5A 4QNYA 2ZM3A 1NT2A 4NWMA 4ZTRA 4BCJA 3A7JA 5M4UA 4MBIA 2WTKB 1T45A 4JDHA 3EIDA 4FTKA 3LFQA 4LMNA 4DFUA 1NA7A 4N70A 4C3PA 3SOCA 5FWKK 3OMVA 4LV5A 5IUIA 4FIHA 4IX3A 5D12A 3LZBA 4PY1A 5JZNA 4E4LA 4NEUA 4KIKA 4NCTA 1AGWA 3ODZX 5I9ZA 3C0GA 1TQMA 1JKKA 3KRLA 3MVLA 3Q4ZA 5H8EA 2ZV7A 5J95A 3VQUA 4BB4A 4DFLA 3FHIA 5KBQA 3NVKI 4NW5A 5HD4A 2IVVA 3RTPA 3HMIA 4QTDA 1GY3A 4G31A 3ZLWA 2PZIA 5H8GA 4AA5A 4G5JA 3G51A 3GCVA 4J97A 1V0BA 2X8DA 3LXNA 4X6QC 3FPMA 4NM5A 1XWSA 4UWYA 3ZUVA 4AA0A 4CZUA 3ZOSA 4U9AA 1QPEA 2W99B 5BMSA 4UXQA 4DG0E 1PHKA 3FYJX 2WMSA 4BGHA 2O63A 4XV1A 4R8QA 5AUZA 3AC5A 1T46A 1ZZ2A 2PUPA 1FQ1B 1ND4A 4XLIA 4PF4A 2QKRA 4OTHA 4DFZE 2XMYA 5DEYA 2IWIA 1M7NA 2JDOA 2GCDA 2AYPA 4IVAA 4M3QA 5AV2A 3R7IA 3R1YA 4ZSAA 4CVAA 5HU9A 4X2JA 2WNTA 3FQEA 1IR3A 5HIDA 2C3IB 3A7FA 4RC3A 1PYXA 3WF7A 4DAWA 3R01A 1BX6A 5CF8A 3BV2A 3CIKA 4DGLC 3KXMA 1STCE 4FL1A 4K2RA 4IB0A 4A9SA 1PY5A 4OBOA 5D10A 3HNGA 5DGZA 3D5VA 4DN5A 1OVEA 3B8RA 2RFDA 4BCOA 3PXYA 2HXQA 5AAEA 5J7BA 1Y8YA 5E8WA 4O1OA 3CY3A 4TYHB 3I79A 1PW2A 1ZAOA 2VX1A 3BU5A 5HGIA 3VUIA 1Z9XA 5JZJA 3MYGA 5L8KA 5LCJA 4GFOA 4NIFB 4I0TA 4LOPA 2ITXA 3I1AA 4ASXA 3PJ3A 5JRQA 4GL9A 1B6CB 4KIQA 2WMAA 4P4CA 4RIWA 3W10A 4D2WA 4DT9A 4TYEA 4EK5A 5DFPA 3PXRA 3AT3A 3W8LA 3OY3A 3O51A 2I7QA 2BIYA 5LWNA 1OL5A 4WA9A 4J7BA 4CKRA 4K6ZA 3GFEA 2C6MA 3I4BA 5AR7A 3UQCA 2VN9A 1F5QA 5CNOA 4AE9A 3RAKA 3G15A 1K3AA 3OHTA 5KMKA 1VR2A 2J6MA 2YIWA 3TDWA 3RBWA 5GHVA 4KWPA 3U54A 1UU3A 2CSNA 3KXGA 2OZAA 3EYGA 3R2YA 3EHAA 2R4BA 3Q53A 1UKIA 1Q3WA 2C5OA 3FLNC 3AG9A 3OCBA 4DEAA 5ETIA 2I6LA 2UZTA 4MD7E 2XRUA 3W2OA 5AUYA 1ZWSA 1OITA 4TT7A 2WQOA 4GVJA 4C33A 1FMKA 4GJ2A 4E4NA 4QMPA 4YHJA 3ET7A 3L9NA 4ZTMA 1JKSA 3A7IA 2XK4A 1TQPA 3GFWA 3QCYA 3AC4A 2OIDA 3ZH8A 4IAYA 3E8DA 5AA8A 1WMKA 2W4JA 4JIKA 3FQHA 2X1NA 2XP2A 1YI4A 3NNVA 4FNWA 4XBUA 2DQ7X 3HAVA 1HCKA 1IA9A 3BHUA 2YM5A 2LAVA 2ITPA 2CDZA 3DLSA 4U45A 4FK3A 5EG3A 3LMHA 4JG7A 3IGGA 2OZOA 3O0GA 3Q52A 4MQ1A 4P2KA 2VWIA 3M42A 1SZMA 2XIRA 4QO9A 3OCGA 3PXKA 2FO0A 3D5UA 5DNRA 4ORKA 3RI1A 3S0OA 2XNBA 1U5QA 5LARA 1W98A 3C51A 4EH2A 4FV3A 4QP8A 4E4XA 2OO8X 2QOCA 3MA6A 4X2NA 5CZHA 4R3RA 4OW8A 3PY1A 4Z55A 4F9AA 3FZTA 5IEVA 4FEVA 2PVRA 4I6HA 2XIYA 5KZ0A 3EN7A 3BYVA 3HMNA 2KULA 2VZ6A 2J2IB 2CKEA 4O0XA 3ZBFA 4AGDA 2YDJA 4NZWB 2WMWA 4J52A 2CMWA 4KKEA 3UODA 4AZSA 4X21A 4ENXA 5M56A 4BGQA 5E1EA 2NO3A 3EOCA 2PUUA 3BHHA 3OEZA 4AOIA 2C5XA 3ITZA 4QP2A 3TZ7A 3WZDA 3DTCA 1X8BA 3SRVA 4LFIA 3AD6A 4RVMA 4C7TA 3C4FA 3A2CA 3DBFA 3TJDA 4ALVA 2GNGA 5L3AA 4KA3A 4QYHA 4O7LA 2XYUA 3M1SA 2E9OA 3D14A 2WEVA 5ETCA 5DI1A 2W5AA 2W9ZB 3DBDA 4AS0A 4ASZA 5HD7A 3P7CA 3PA5A 3UVPA 4FSUA 5JSMA 2DUVA 5HNIX 4BBFA 4ARKA
chains in the Genus database with same CATH superfamily
4ASDA 4FSYA 3JPVA 3GU7A 5I3OA 4LRJA 2DYLA 4BVUA 3ZO4A 3VF9A 2PWLA 1PMVA 4TYJA 5CWZA 5AV3A 4E26A 2FSTX 3RPOA 5IUGA 3RM6A 4YBKA 1SVGA 3OZ6A 4IC8A 2YA9A 4NKAA 1J7IA 4RSSA 1WBPA 4XBRA 2GPHA 3BU6A 4PQNA 5FM3A 3SHEA 4A06A 3I7BA 5IZFA 3R04A 3QLFA 3ZEWA 4UMPA 4A07A 2VTOA 2FSMX 4DH5A 4FT0A 4QYFA 3R00A 2OFUA 3RPSA 3UVRA 4K33A 4O83A 1WBTA 2IZUA 3M2WA 1J3HA 2WAJA 4QPAA 5KZIA 4L46A 2YWVA 4S34A 4CYJA 4HZRA 4TWNA 5IQIA 4FV5A 3UO5A 3NYXA 4EOLA 3R1NA 5IA3A 4AXDA 3D9VA 4O0RA 3Q2JA 4IWQA 3S95A 4FSNA 3WE8A 4ZLYA 3VONA 2F7XE 5KE0A 4JBVA 4FGRA 1E1XA 3CGOA 5M57A 1KUTA 4JBOA 3EQCA 1OB3A 2FGIA 1JWHA 2PE1A 3NW6A 4L3LA 3UBDA 5TOZA 4BCFA 2VX0A 1OL7A 3VUHA 4LGGA 3PSDA 5HG7A 3GU5A 3ZLYA 1K2PA 2WTDA 5KX8A 3FMMA 3A62A 2Z7QA 3FKNA 3P7BA 4EORA 1Y6BA 3WZEA 5K3YA 1O6KA 2OXYA 2I0VA 4O4FA 1IA8A 4K1BA 4Q5HA 4JX3A 3NMUF 1CKJA 4B99A 3CC6A 3FXXA 4L43A 3D5WA 3HRCA 5L6OA 3UNKA 4DFBA 5FGKA 5KMNA 3QUPA 3FHRA 3TIZA 3N4TA 1JOWB 5IA1A 4H05A 2PY3A 4Z7HA 3CTQA 2B4SB 4FTJA 4RMZA 4BIBA 1SYKA 4I5HA 3QD3A 5KCVA 1UWHA 1M14A 2Y4IC 2PK9A 4U41A 2QCSA 3MPAA 1PXJA 3LFCA 3QCQA 4DEIA 4C3RA 4M69A 4BDIA 4BDCA 3W0SA 3BRBA 3K2LA 4O0TA 4ZTQA 2IVUA 4W8EA 5AIKA 2OW3A 3DXPA 4GW8A 3FI2A 2BDWA 4KS7A 5BPYA 1ZMUA 4QP7A 3DAEA 4O7TA 4I5CA 4XS2A 5FRIA 1VYWA 4QQTA 4LRKA 5IQHA 1WVYA 3VS0A 5HBHA 3FY0A 2QR7A 3KK9A 4DHJA 4O0UA 4C62A 4F64A 2QO7A 3D94A 3C50A 3BU3A 3RJCA 3FEGA 3OC1A 4JDIA 4J95A 5FXSA 2BILB 2WKMA 5KMJA 2W4OA 4UYAA 5CU2A 3A8WA 3VBXA 3KCKA 4L6QA 1QL6A 4O96A 2GNLA 4RIXB 3VUTA 3HYHA 2REIA 4IEBA 4QT1A 3Q3BA 3QUDA 2C5VA 4FIFA 2XBJA 3ORMA 5DA3A 5ANOA 3OT8A 3V01A 1YDSE 4PTEA 4EHEA 4FG9A 3KK8A 3GCUA 4O38A 4CKIA 3W0QA 5FG8A 4FZFB 4FV1A 4GRBA 3SAYA 3MH3A 1PXLA 2XK9A 3U8WA 3ORXA 2VTSA 3R9NA 3RMFA 4BRXA 3ENMA 1OGYA 2WHBA 3TNIA 3IKAA 3AC8A 4AW5A 3TIYA 3CXWA 3SLSA 5DIAA 1G8KA 3Q9WA 3GI3A 4NKSA 3VWAA 4DEGA 5IDNA 3S00A 3LJ1A 4JG6A 5B2KA 2C0IA 4LDTA 3F2RA 3DDPA 3H0YA 3LHJA 2QURA 2G15A 4IAKA 5EK7A 3RPYA 2ETMA 5BUJA 3DNEA 5KBRA 5A4TA 1LEWA 1IAHA 2UW4A 2OF2A 4FTOA 3WI6A 5F1ZA 4JBQA 5L2WA 4DCAA 5F9EA 3AMBA 2B9FA 3NS9A 2JBPA 4USFA 4USDA 4FV6A 2JAVA 3F82A 5CVFA 3NAYA 2XNMA 4O91A 2X4FA 3AD4A 4OR5A 4FEUA 4EC8A 4K18A 3BYMA 1XH7A 3EH9A 2QC6A 4HYSA 3KA0A 1URWA 4A9RA 3NUAA 4FL3A 2VU3A 2PVHA 2X6DA 2XNNA 4AN3A 4BBMA 5CZIA 3PVBA 4NJ3A 4ZTLA 4I1ZA 4KIOA 3SXFA 4BCPA 5HLNA 4FTRA 1BL6A 3PPKA 4FVQA 2OJIA 4NU1A 2RKUA 3QXPA 3QTXA 4EOJA 3C5UA 4O81A 2W0JA 1CDKA 2XAOA 4WRGA 4GSBA 3PG3A 3V5PA 5ANDA 5DRBA 4QMLA 5A4CA 3AKJA 2A27A 4PTCA 3QC4A 3AKKA 5AV4A 5HO6A 3VS1A 2OXDA 5FP5A 2IW6A 3BI6A 2PVJA 4AF3A 5DVRA 4FEWA 2Y9QA 2I0EA 3QQFA 4B7TA 4AGCA 5LWMA 1OIUA 4WG3A 4NM3A 3D4QA 3V5LA 3LCTA 4XH6A 3JYAA 4MXXA 3R8ZA 3DBQA 5IQDA 3FMKA 2YDIA 3P78A 3GCSA 1E1VA 3MFTA 4FKTA 5HHWA 2IW9A 3PSBA 2WTJA 4U3YA 3TACA 2VTHA 2XKFA 3FLWA 4PX6A 4HW7A 4AACA 1ZMWA 4R7IA 1MRVA 2E9UA 1YHSA 4E5BA 5EQPA 2FVDA 4HNFA 4FIIA 4BKYA 2W1GA 4AZTA 1YOMA 2EVAA 4YO6A 3IS5A 1SM2A 3ZO3A 4D4YA 3DK6A 4X2FA 3A61A 3RAHA 1JKLA 2WOTA 4YSMA 2QOBA 3TMOA 3PWDA 2W96B 4QMWA 3RGFA 3U9CA 4IWOA 4ACGA 4BHZA 4PUZA 2F9GA 4QPSA 2PVKA 4YPDA 1OM1A 4NM7A 3MVJA 5J9LA 2CNVA 4CNHA 1ZYJA 2ZYBA 3HA8A 5HQ0A 4QMNA 3ZC6A 4B0GA 4UZDA 4QMOA 2OWBA 3O50A 3D7ZA 4WKQA 1REKA 1B39A 3CEKA 3HV3A 4C59A 5I9VA 2HXLA 1XH9A 1Q41A 3BPRA 3DLZA 3GC8A 4X6RA 4AP7A 4ENYA 3AQVA 5CT0A 2JGZA 4EKKA 4BDHA 5CXHA 5DT3A 4YZBA 1KOBA 3DT1A 4MX9A 3RKBA 1YWNA 5EW9A 2Y7JA 4QP3A 2GU8A 3LKMA 3LVPA 4CFFA 3I0OA 3ORNA 2AEGA 3TT0A 4F0IA 3QXOA 3DJ5A 1OI9A 2HELA 4O82A 2BAJA 1CM8A 3GQLA 3A4PA 5GINE 1YHVA 1UVRA 2VWWA 4IFCA 3FXWA 4M66A 3ZFXA 4C2VA 5J9YA 2I1MA 3KRJA 4O0WA 2YM3A 5HTBA 4XV2A 3RZFA 2R3OA 5A4EA 4AXEA 2XF0A 5HICA 4FX3A 4AG8A 2B0QA 3OWKA 3DNDA 5LVNA 3MA3A 3BE2A 3ERKA 4MF0A 3TWJA 3WIGA 2H8HA 3EFKA 3HECA 4C34A 4YJSA 2YIXA 4BCGA 1Q8ZA 4FKUA 3TTIA 3BQRA 3OVVA 2O8YA 4YLJA 4QTAA 2A1AB 4ALWA 3QRUA 4AOJA 5HNGA 5AUTA 4F7SA 3UE4A 3KN6A 3WE4A 3QRKA 2Z8CA 5BVEA 2ONLC 2P33A 4RA4A 4FSWA 4YMJA 4AFJA 5A46A 5E4HA 3CD3A 3SXRA 3RK5A 1FVTA 4EKLA 4RWKA 3O8PA 3PXQA 2BR1A 3ALNA 3F9NA 3AMYA 4ZSLA 2WB8A 4C4GA 3FQSA 5M4IA 3VRZA 3NW5A 3WF6A 4QTBA 2QOOA 3PXFA 3NIZA 5IQFA 3W18A 4U3ZA 2PVNA 3PVUA 2RF9A 3Q4TA 4RRVA 5EHOA 2BKKA 5CENA 3ZSGA 4FSQA 4OLIA 5B7VA 4UV0A 2IPXA 3TUBA 5DR2A 5F95A 4YJVA 4ZP5A 1XR1A 3OTUA 2W1EA 4QPMA 2WEIA 3MESA 3GVUA 2C68A 5E8ZA 5A54A 3II5A 5D1JA 1BI8A 3AC1A 1JSUA 3Q60A 2OJGA 2QODA 4MH7A 4HYHA 3UDTA 4BYIA 4JQEA 4B6LA 2R3JA 5AAGA 1P5EA 3E3BX 3L8XA 4EHGA 3LFFA 4U6RA 3P5KA 4E3CA 2VWUA 3RPVA 2HW6A 3MH2A 2GHGA 2GMXA 2JKQA 4KRDA 2BAKA 2WO6A 3TV6A 3EN5A 5AP3A 3L8PA 4D5KA 3NUYA 4ERWA 1Q97A 1JQHA 2H34A 5AWMA 4PDPA 2VO6A 1QPCA 3LMGA 2PUIA 1J91A 4YZNA 3FSKA 3T9TA 2EXCX 4KBKA 5EYDA 3D83A 4B4LA 3ZMMA 3FSFA 3H0ZA 4B8LA 4UX9A 4TL0A 2YCQA 3WILA 2GDOA 3CPCA 2HIWA 2WMQA 4N57A 2ERKA 1P14A 4RJ3A 2OJJA 2BUJA 3LFDA 3G5DA 4FYNA 3RHXA 3GBZA 4A4OA 3QQUA 5AP5A 2EXMA 4UWBA 3UYSA 3HVCA 2WELA 3FLSA 4F6WA 2F4JA 4MBJA 3PY3A 4I6QA 4P90A 5CSHA 3OCTA 3HDNA 4LM5A 4PL3A 5HTCA 2QR8A 4FG8A 4YURA 4FV8A 3I60A 4E7WA 1RJBA 1YWVA 2IJMA 4IAZA 4DCEA 2CGWA 1IASA 4TPTA 4YU2A 3CLYA 4XUFA 2VWYA 5C8MA 4S30A 3QX4A 3E92A 3FC1X 4IWPA 1OL2A 3NIEA 2HZNA 5CEKA 3VF8A 2YM4A 4D58A 3P86A 4Y73A 4ZTNA 3FE3A 2F57A 4U7ZA 5AUWA 3NNXA 4EBVA 2QQ7A 5FLFA 2YZAA 4CZYB 2IVTA 4LGDA 1UNGA 3F2AA 4WIHA 2XNPA 2WMRA 2QHMA 3HMPA 2BHHA 2J7TA 3HA6A 2C6OA 4TN6A 1JBPE 2WU7A 3IECA 5T6KA 3SXSA 4FTUA 5M09A 2ZJWA 4TNBA 5AAFA 3VVHA 4I21A 2VTLA 3GU6A 4BTMA 2W1FA 5IH5A 2YM6A 3F2NA 4D2SA 5DYJA 4FKOA 4AW2A 5CF6A 5IUHA 4FV0A 4BI0A 5J7HA 4FOCA 5FEDA 3HRFA 3K54A 3GCQA 4FKGA 4LL5A 3SW4A 3VBYA 4A4XA 3AT2A 4F4PA 1H00A 4E93A 3PP0A 2VWXA 5L8LA 4H1JA 2OIBA 4KKGA 5LCKA 3A7GA 3REPA 3TN8A 2CNQA 3MB7A 4TKSA 3Q2MA 5ICPA 4UALA 3LXLA 1RW8A 2VWVA 3SD0A 2B9JA 4RWLA 1H28A 3ML1A 2C5NA 4FR4A 4O0VA 4YNOA 5C4LA 2JFMA 3EFJA 4LI5A 3I0QA 2UVYA 2WOUA 3C7QA 2VO0A 5LVOA 2UW3A 3UJGA 2BRBA 4LG4A 1L3RE 4ANOA 2EUFB 4QMMA 2XIKA 3TZ8A 1DM2A 3H10A 3VO3A 3AC3A 5K9IA 2VGOA 4I92A 4QOXA 5EKOA 2B53A 2O5KA 3H3CA 2JDTA 4MNFA 5E8UA 4C4EA 5CU0A 3ZEPA 3BE9A 4ZS4A 1W2CA 4N6YA 4KUJA 3RNYA 2BVAA 2BHEA 5BMMA 5HX6A 4IZ7A 3MVHA 4MXAA 3UMXA 1XO2B 3ZO2A 4QMQA 3BLRA 3FLQA 4G3FA 4ZOGA 3T9IA 3PIXA 4HGEA 4DBNA 1JVPP 2UW8A 3JY0A 3AKLA 1ERKA 1ATPE 3IO7A 1M7QA 4F63A 5JRSA 3Q6UA 1DAWA 4ZSEA 4YPSA 4RIXA 5A6NA 4QQCA 5JT2A 1MQ4A 2PMOX 3PVWA 4OAVB 5IPJA 5CASA 3QCSA 4F0GA 2E9PA 2VO7A 3V8TA 3MW1A 5JFSA 5JN2A 3ROYA 4RJ8A 2VAGA 3G2FA 4FSRA 3FI8A 3HP5A 1Z57A 4WOVA 4XOYA 1F0QA 1W7HA 5BVKA 4UBAA 4AOTA 4PDSA 4OBPA 3ZDUA 2CCHA 1M17A 1Q8TA 1IRKA 1YOLA 3CPBA 3W32A 5BQ0A 4MXZA 2PVFA 4ANSA 4JOAA 4M84A 2ZDTA 3DXQA 3TJCA 4ANMA 3QBNA 4R5YA 3BLHA 3BX5A 2RGPA 4Q2AA 1BUHA 2EB3A 2J90A 3IONA 3QZFA 2OXXA 5K0KA 2GFSA 3Q32A 4R1YA 5AP1A 3BELA 4O7YA 2FUMA 1R3CA 3AD5A 2X6EA 4RIOA 1XJDA 5HORA 5AP7A 3V04A 4I5PA 1H4LA 4IM3A 4ITIA 2OGVA 4QTEA 2WTIA 1OZ1A 2HOGA 5DT4A 5EHYA 3F88A 3KB7A 3ZCLA 4IVDA 2VGPA 2C47A 4RT7A 4UMQA 4R7BA 2XNEA 5IQGA 3MGYA 1ZZLA 3RM7A 1YXVA 3GB2A 4GFGA 3BLQA 4FTQA 4G3CA 2NRUA 1OKVA 3C0HA 3GC9A 4P5ZA 5DR6A 4CCBA 2VTPA 3R7YA 1CSNA 4PMPA 5KO1A 3NGAA 4EI4A 5L6WL 5CANA 1MRUA 3QL8A 4WG5A 3BGQA 1Q8UA 3P79A 1KV1A 1UWJA 3KFAA 3U4WA 3QLGA 2QLQA 4OGRA 5GJGA 4EC9A 1RDQE 3N51A 4R1VA 4RX7A 4GK4A 4F9BA 4JQ7A 4D9TA 5LXMA 3IG7A 3NDMA 4GT3A 3CSVA 1XMMA 5CY3A 5DWRA 1S9IA 5E90A 4QP1A 5H8BA 4EK3A 3DPKA 2G2IA 1PMNA 2BZHB 1WCCA 2R3IA 2OSCA 4DITA 4ZZMA 4FKQA 4FUXA 4CGAA 3NAXA 3AOXA 2HY0A 2ZVAA 3H9RA 3DK7A 4J53A 5L2QA 1A9UA 2YM7A 2HZIA 5D11A 4JDKA 3FPQA 4EHZA 2WMUA 3IOKA 2RIOA 4EWHA 3U6JA 1GZNA 3L1SA 4EBWA 1YKRA 3IDPA 4CKJA 3SW7A 4ONAA 5IU2A 4O7ZA 4QEBA 2DWBA 4DTAA 4C57A 2VTQA 4MKCA 4JI9A 4FRFA 1ZYSA 2UZUE 1W2FA 1WVWA 5C26A 4FKVA 3OEFX 4ACMA 3ZM9A 5AADA 1BLXA 3WARA 1Y8GA 4BWPA 1KE7A 5EDPA 2RFNA 2IVSA 4XRLA 5LVMA 2VNYA 4HVGA 4JNWA 2ITVA 4JX7A 2PVYA 5CI7A 2PZYA 2XVDA 1Q5KA 4BDAA 3TV7A 4TW9A 3KF4A 4I94A 1YXTA 2O64A 4FBXA 5K4JA 3SDJA 5E9EA 2CLXA 3MWUA 5IMXA 3HV4A 3V5QA 5E92A 3DOGA 1WBSA 2BPMA 4JR7A 4OTPA 2PYWA 3FL5A 3BWFA 4B9DA 3ELJA 1YOJA 4DG3E 3E7VA 5CAOA 2YFXA 3V8WA 1OPJA 3WF5A 3T3UA 5EI8A 3QA0A 4FTAA 2CKPA 4AZVA 2CKOA 2BAQA 4EOKA 3PLAE 3HZTA 2B54A 2PZ5A 4G9RA 4L3JA 2R64A 4LYNA 4PWNA 3WIKA 4APCA 4UYNA 2XK7A 3FMDA 3WZUA 3I6WA 5BUIA 5J79A 4CCUA 3JUHA 3SQQA 1Y91A 4RJ6A 5CVGA 3L8VA 5JQ5A 3TDVA 3R63A 2C0TA 2G2HA 3R9OA 2HY81 4FV7A 1ZYCA 4J8MA 4F7LA 4BDGA 1UNLA 3EYHA 4NFMA 4DGMA 3C4XA 4BDJA 4NTSA 4H3PA 1KSWA 3I6UA 2BFXA 3N4VA 2GNFA 4CFVA 4GV1A 5DHJA 1YI3A 5TF9A 3SX9A 5JGBA 3ID6C 3IW7A 3QGWA 4D9UA 4XOZA 1JKTA 2QI8A 3OBJA 2BZIB 3MBLA 4GJ3A 5DOSA 4A7CA 5K4IA 3E8CA 4WBBB 2O2UA 2QU5A 4I0SA 3KMUA 4DFXE 3FMJA 2BROA 2YIYA 2HWPA 3R8PA 3R9DA 2UZNA 1VYZA 3KL8A 1W84A 2CGXA 3OW3A 1VEBA 3LJ2A 4DEEA 4YO4A 4HVSA 3BGPA 2IW8A 3COMA 1U5RA 3MV5A 4ZS0A 3TV4A 4O7NA 3HL7A 5AFVA 4FF8A 3DZOA 2X9FA 3NNWA 3VW6A 3W1FA 4CQEA 2BFYA 3ZC5A 4FZDB 3W0PA 2XJ1A 1QMZA 2OLCA 1KE5A 1MP8A 2OJ9A 3DB6A 1SVEA 3KXHA 1SNUA 3LFSA 1J7LA 3UO6A 4YC3A 5DEWA 4L53A 3BHVA 1S9JA 4MK0A 4RJ7A 2WMVA 4USEA 2IZRA 3PUPA 4E6CA 5HVKA 3P9JA 4GMYA 5CI6A 5CALA 4XV3A 3R9HA 3ULIA 5IDPA 5D7VA 4FKRA 3D0EA 4IFGA 2GHMA 4F7JA 5EDQA 2AC5A 5HE1A 5JK3A 2FB8A 2XM8A 4ANBA 3E64A 3BWJA 5J9ZA 3TKIA 4L44A 3W2SA 2VTMA 1H1WA 2H96A 4BDDA 1YWRA 5BVWA 4NTTA 4PDYA 5L8JA 3ZZEA 2ITNA 4V0GB 5IQAA 2YIQA 1XBAA 3BBTB 4QMTA 1Z5MA 3LCDA 2G01A 2OH0E 4I20A 4BL1A 1PXOA 4BKJA 3DV3A 4QMYA 2YJSA 4OTRA 4LOQA 4FYOA 4X3JA 5GJFA 5C03A 3RZBA 3QTRA 2PMLX 3R7VA 3FZ1A 4O86A 3MPMA 2R0UA 2J9MA 4WG4A 3W8QA 1GIJA 2RSVA 5ANGA 1H08A 3BKBA 4CG9A 3W2QA 4EH9A 2JKOA 4C37A 4PDOA 3L8SA 1VJYA 3GCPA 3A7HA 4GUBA 5A4QA 3MDYA 3LAUA 3W0RA 4I0RA 5EFQA 4IX5A 4G9CA 3BYOA 3GP0A 2WU6A 3KVXA 4J96A 4IB1A 2A98A 5EI2A 1PKDA 5AR5A 4AXAA 4AZEA 3WYYA 4RLKA 3C9WA 5EYKA 2BMCA 5DR9A 1H8FA 3R8UA 3SC1A 5CT7A 4BCKA 5CEQA 3WOWA 1REJA 3MB6A 2J50A 4EQCA 4HYIA 4M14A 3LCSA 3O7LB 4TZRA 2J0IA 5EDRA 5CAPA 1U59A 2PL0A 2VNWA 2XNOA 4KBCA 4O4CA 2QHNA 4GVAA 1I44A 2HCKA 4YP8A 5CEIA 4MQ2A 3UC4A 4AU8A 4EOPA 4BBEA 1OPKA 3DQXA 4YJQA 2VTTA 3CGFA 2WTCA 3MI9A 3OOMA 4HOKA 5TE0A 2GS2A 5BVDA 3ACJA 3MH0A 3D2IA 4RG0A 4WNMA 2XB7A 3G33A 1XKKA 2Y0AA 3QTSA 3FYKX 1NVSA 4J1RA 4NH1A 3MS9A 3QKKA 5DLSA 4NJDA 5IA2A 4KSPA 3D7TB 4PPBA 3ZUUA 3QQLA 3CKWA 4S31A 1JPAA 4L7FA 2ITQA 4P5QA 2X0QA 4FNZA 3JS2A 1DAYA 2C3KA 2JIVA 4W4YA 3WBLA 2Q0BA 3DBEA 2UZOA 4F09A 1NVQA 2LGCA 4DTBA 3EQFA 1OBDA 5BYYA 4D55A 4KRCA 2GQRA 3LLTA 4IZAA 4XG6A 1O6LA 2NP8A 4XG7A 1AQ1A 4FIJA 4O6EA 4BZOA 2RG5A 2QD9A 4ZTHA 5FP6A 4RX8A 3PSCA 2HW7A 4MEDA 4M7IA 4NM0A 2WMXA 1BL7A 4YHFA 2Y8OA 4KS8A 1ZYLA 3D2KA 3HLLA 3O8TA 2BRGA 3Q4UA 5AMNA 4DHFA 2XJ2A 3QYWA 3QQKA 4XMOA 1WBWA 4DC2A 2H9VA 4MF1A 4L7SA 4Z16A 5HKMA 4TWOA 5AR4A 2XUUA 3CQWA 4CEGA 2HENA 5IQBA 2W9FB 3F3VA 4AW1A 4L67A 4OTFA 2OK1A 2BDFA 4GS6A 5CU4A 2ZV9A 2F2UA 2XK3A 4J71A 3W33A 4FT9A 5TT7A 3G6GA 4MUQA 1Q8YA 3VJNA 3MSSA 2E2BA 4ZJJA 3B2TA 2EWAA 3Q5ZA 4FSZA 2W5BA 4O4EA 5FM2A 3VBTA 3ACKA 5GZ8A 2XBAA 4FTTA 4R7HA 5CYIA 4H3BA 3EQHA 4F9YA 4EL9A 2WMBA 3Q5IA 3UZRA 1PJKA 3CQUA 4EQUA 3S4QA 2Y4IB 2VO3A 4BCMA 1Q61A 1ZARA 4F1OA 4LOOA 2PTKA 1FGIA 1LUFA 2VTAA 3VUGA 2R2PA 5CEOA 3COIA 1JLUE 4PV0A 2P2IA 3FUPA 3NYVA 1JNKA 4YZCA 5ANEA 4FVRA 1CTPE 3L9PA 4TWPA 5IKWA 3RPRA 3W2PA 4DLIA 4ACDA 2Z2WA 3O23A 5M4CA 5IISA 3D15A 4AN9A 5EQEA 4YBJA 4JRNA 2VX3A 1AD5A 2C1BA 3ATTA 2ZMCA 3E87A 2WXVA 1FVRA 1QPJA 3VHKA 5GIPE 4YR8A 3NR9A 1P4OA 3TUCA 3F3WA 3QAME 4APPA 2YHVA 2JDSA 3PE1A 4E8AA 3SOAA 4PL4A 4JR3A 4N6ZA 4CXAA 1KE6A 4JBPA 5BYLA 3ZM4A 4HPUE 3R7GA 3TEIA 2UW7A 4DTKA 2W4KA 4XHKB 3HMOA 3VS5A 2W17A 5LVPA 5TKDA 2IO6A 3C5IA 3UO4A 4HCTA 3C4ZA 2C1AA 4FV2A 3RAIA 5HO7A 1ZOEA 5BV3A 4JRVA 5J87A 3AC2A 5CAUA 1OKWA 1M2RA 3R8MA 3I81A 3PWYA 2YLFA 3HMMA 4WUAA 4O7RA 1Y57A 2RFEA 4HYUA 1M52A 2V7OA 2IN6A 3ALOA 4O6LA 4D4RA 3C0IA 4A4LA 2XANA 3C4CA 3VN9A 4JIAA 4B8MA 4FUYA 2JITA 5J8IA 3VUDA 4K77A 1OIRA 3R83A 4J98A 2WIPA 2QNJA 3JVSA 2G1TA 2OZAB 3N4UA 4TY1A 3UOKA 2J51A 3HV7A 3ZXTA 2B7AA 3U6IA 4IVCA 3UDZA 4CRSA 3MFSA 3NCZA 3VRYA 4TYHA 4TRLA 3LFAA 2W05A 3EQPA 5A4LA 3BHYA 1M2PA 1RQQA 3F3TA 4IZYA 4N0SA 3UGCA 4EK6A 5LMKA 4MCVA 3O2MA 4NIFA 3WZKA 5EOLA 3QFVA 4L45A 4AFEA 2JFLA 4ASEA 4YTFA 4XG3A 4UXLA 3V8SA 3VS3A 5L2IA 1R1WA 1URCA 3GGFA 3KN5A 1V0PA 4R3CA 3BCEA 5F20A 4R78A 4C36A 4D0WA 4XRJA 4FV9A 4LGHA 3TYKA 3PA3A 4AN2A 1GNGA 2WTVA 1IAJA 5KMIA 3QTQA 3K3JA 4G3DA 3QWJA 4E6QA 3HEGA 3OUNB 3MH1A 1KV2A 4QYGA 1E9HA 3QQJA 4Y95A 5AP4A 4AA4A 1SVHA 4QMVA 3NEWA 2ITZA 4MXYA 2PUNA 4OTIA 2PULA 3NYOA 4C61A 4OTGA 1Q3DA 2JDVA 4X2KA 3HV5A 3DU8A 5BNJA 5IMEA 4FTMA 5JFVA 3QX2A 4YJRA 2BDJA 3BV3A 4MWHA 5HOAA 5H2UA 2XKCA 1GZOA 2ETRA 3IQ7A 4XG4A 3VBWA 5EKNA 2GQSA 3DJ7A 4QDEA 3VW8A 3PJCA 2X2MA 1WZYA 2R9SA 4GEOA 4IB5A 2AC3A 5HE0A 1F3MC 4IMYA 3A8XA 5M55A 4Q9ZA 2ITOA 3SGCA 1XHAA 4S33A 4CV8A 1VZOA 3QWKA 4FICA 2C3LA 2X2KA 2J5FA 3MFUA 4BICA 1YQJA 3CE3A 4LV8A 3NUXA 2QG5A 3OXTA 1MRYA 3SRVB 4QMSA 2OJFE 4M8TA 3E7OA 4IC7A 4RGJA 3R28A 4TNDA 4CRLA 1YXUA 4GIHA 1H25A 4RVTA 2ZB0A 3DQWA 2CGUA 3TM0A 3UNJA 5ACKA 4H36A 4I5MA 4BJJB 4I93A 3AXWA 5CU3A 2B1PA 2RG6A 5JMSA 2VD5A 4ZTSA 4EOOA 3VS7A 3C13A 4L9IA 4EH4A 1OGUA 4EUTA 4CT1A 4JL9A 4PNKA 3KULB 2XK8A 2C0OA 4UB7A 4NUSA 2F49A 4CQGA 3R8LA 2ITTA 3KEXA 4G3GA 3DAJA 2OH4A 4O2PA 4XNEA 3R7UA 3ZONA 4CFMA 2Y6OA 2BRNA 5CQWA 4F0FA 5HE2A 4AUAA 2O65A 5A9UA 5JGDA 5JH6A 2BTRA 4IIRA 4D1XA 5JKGA 4M68A 3NFFB 1YDTE 1FPUA 1TKIA 3COKA 3FKLA 4W4XA 2XJ0A 4M12A 1ZOHA 1BI7A 5DBXA 2VTJA 3OW4A 4E1ZA 3QD0A 3N9XA 4GKIA 3ZZWA 3EL7A 2YDKA 1UKHA 3PP1A 4FZ7A 3UZPA 4E73A 4EEVA 4I41A 4F9WA 1PRYA 4ZXTA 3RWPA 5HX8A 4G2FA 4O22A 4DG2E 4JAIA 1PXMA 4AWIA 5HG8A 3EQIA 2PE2A 4EOIA 1JAMA 5KMOA 4QNAA 2C6LA 4BWXA 4IXPA 2X7FA 4YNEA 3R2BA 3K3IA 1YVJA 4IE9A 2XRWA 3CR0A 4JT3A 5LVLA 4CFWA 3R9RA 3RK7A 3OS3A 3IOPA 3P1AA 4IWDA