2UW3A

Structure of pka-pkb chimera complexed with 5-methyl-4-phenyl-1h- pyrazole
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of Inhibitors of Protein Kinase B Using Fragment-Based Lead Discovery
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 106
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw3A02
1Y8YA 1WZYA 2O5KA 3P5KA 3ZO3A 4C0TA 1YHWA 3C0HA 4FV1A 3QTQA 5D7AA 5CU0A 4D9UA 2ITWA 3C0GA 5JRQA 4CLJA 3ELJA 3UZTA 3BU3A 3CS9A 3TJDA 3CKXA 4FTCA 3UZPA 4FVRA 4BDJA 2GU8A 4FKRA 4FEUA 4PMTA 3P23A 2OH4A 4I21A 5BVOA 3DLZA 2W9ZB 4JIAA 4C35A 4KSQA 5L6WL 3AMYA 2VX3A 3B8RA 4XJ0A 5K4IA 3BGPA 4WRSA 3VUIA 3LXLA 1OL5A 3T9IA 1X8BA 3WYYA 4W9WA 3BZ3A 2YLEA 2YISA 4OR5A 2OF2A 3CTJA 3PA3A 3G6HA 3M2WA 4IX4A 3FYKX 3E7OA 5EHOA 1U59A 1XH7A 2XZSA 2PVMA 4J53A 5HO7A 3QRKA 2H9VA 3WF8A 3I60A 4O2ZA 2YDIA 4DEHA 4USEA 4YNOA 5KO1A 4ZY5A 2VTIA 2WTCA 3NNXA 3TWJA 4J8MA 2R3JA 4BCKA 3IECA 3PXYA 1JVPP 5GZ9A 2B7AA 3VRYA 3AC1A 5IDNA 5E4HA 3QC9A 4AA4A 2UVZA 2YWPA 1OM1A 4KKEA 3PXFA 4H05A 5HU3A 4BDDA 1OGUA 2AC5A 2NRUA 2PE1A 3KGAA 4M8TA 4DH1A 4BCJA 2O3PA 4E6AA 1WCCA 3QQGA 2WELA 2R3MA 3TTIA 3HEGA 1XH5A 4R77A 3KMUA 5HE3A 2CDZA 3P86A 4FTOA 4EOMA 4UN0C 4F7LA 3MY1A 3N4VA 3G5DA 5CNNA 4J99A 4LG4A 5DBXA 3OCSA 3IONA 3R7UA 2IN6A 3JYAA 4IB1A 3ITZA 1W8CA 4EL9A 4KD1A 2C0OA 4R6VA 1HCKA 4PV0A 1P14A 4W4VA 3UE4A 4YBKA 5BPYA 2YCRA 4F1MA 4QMYA 5D1JA 3DQXA 3HGKA 4O91A 3FI3A 4UYAA 2AC3A 4RX7A 2BCJA 3Q96A 4EZ7A 4BI1A 4FKLA 4FKUA 4BZDA 4Z55A 5HX6A 5TE0A 3PRFA 4R1VA 3SQQA 4DGGA 4XS2A 4FV4A 4ZTQA 4D0XA 3VQHA 1JSUA 3ATSA 2XJ2A 2BFXA 3MB7A 1Y57A 2QOQA 1MP8A 4Z7HA 4AT4A 5CSWA 4HCUA 1PMUA 2QR8A 4EUTA 5IUGA 4YTHA 1M2PA 3FZRA 5FP5A 4FT3A 3AC8A 4ALWA 3IOPA 2WOUA 1XH9A 5G1XA 3PPJA 4R5SA 3RAIA 1IG1A 2X8IA 2YM6A 1JKLA 5IH5A 4S2ZA 5AUVA 1OVEA 4AT5A 5J8IA 1VJYA 3UVRA 4ZSAA 3VF9A 3FC1X 1P4OA 4RC3A 4RGJA 3TZ8A 4FK6A 1H1RA 5AAEA 1ZARA 3OEFX 3SLSA 1WBNA 3WF7A 5HG7A 1WVWA 2BROA 2JEDA 4EK6A 2YEXA 4D5KA 1OECA 3AG9A 2ZV9A 3EFLA 5BQ0A 2QKWB 3PFQA 4TXCA 5ACKA 5CTPA 2DQ7X 1OIRA 2X4FA 4WSQA 3UOLA 2B9IA 1H1PA 3NMUF 4QMNA 3KU2A 3RPVA 1H0WA 1WAKA 3D9VA 4O0UA 3MTFA 1Q4LA 3K3IA 3L1SA 1QL6A 3A7IA 3HA8A 3ORXA 1R78A 5CZHA 5CASA 1JLUE 3NIZA 2DYLA 3OC1A 4PMMA 4UMPA 4V01A 3CBLA 3BEAA 2XP2A 4FSRA 2C6EA 3CJGA 3QRUA 4II5A 3PWYA 3QD4A 3NVKI 4FR4A 2YIXA 3UO4A 4I5PA 3Q52A 2GNGA 2VTLA 2XB7A 4FT5A 1K9AA 3RWQA 3CPBA 1R39A 4HW7A 3VW8A 4O82A 3KREA 3R63A 3RALA 4AZSA 3QCYA 5EM5A 3FY2A 4FNXA 3TV6A 1H1QA 4BTKA 4OW8A 3F5UA 1YVJA 1WBPA 1XWSA 3DBEA 1DI9A 1YWVA 3F2AA 5CF4A 2JD5A 2VTQA 4BCIA 5A4TA 1FVTA 4G5PA 3DXPA 5HQ0A 3FMMA 3P08A 2OFUA 4GIHA 3R7YA 3QAME 2GS2A 4XYFA 5I3RA 4XNEA 3W1FA 4BTFA 5H2UA 4D2PA 4FE2A 2QOCA 5HVJA 2OXXA 5DOSA 4Y83A 4JDJA 3GGFA 4GFMA 3CC6A 4FSTA 4IVAA 2EXCX 2QOHA 2WTKB 3WOWA 4FA2A 5A14A 4CZYB 3E3BX 4D4RA 4F08A 1OPKA 4R3RA 3QQFA 2QVSE 4FZFB 3R7OA 4OAVB 4CKJA 2WNTA 3BU6A 1OL6A 2X2MA 4BHZA 2VD5A 3DFCB 4JBPA 5JFVA 3OXTA 4F9BA 4DG0E 3KXXA 1P4FA 2VX1A 4I41A 2HYYA 4YLJA 4EORA 3E7VA 2XCHA 3WILA 5I9VA 2G9XA 2XCKA 4HCVA 4O7RA 2WMSA 1UV5A 4X0MA 5JGBA 3FEGA 4NJDA 5DRBA 3VQUA 5EDQA 3PP1A 3GXLA 2RG6A 3VRZA 5CAQA 2PE2A 4FKGA 2VTPA 4H58A 1KE7A 5AFVA 3AGMA 4DEEA 5L2SA 4EBVA 2J0JA 4TYHA 3RAKA 1Q3DA 4PRJA 1W82A 1ZZLA 3G15A 4E4MA 3ID6C 3LLTA 4IB3A 4CFNA 3W8LA 4RLLA 5IUIA 3F82A 4FG7A 5HG9A 2WTDA 3C4FA 4YZMA 5K9IA 3QCQA 3OMVA 5ETFA 4D55A 2PVRA 2XS0A 3AD4A 2WGJA 4GUBA 3R9RA 2YACA 3P0MA 2HY81 2BRNA 2X9EA 2BILB 4MD7E 5L2IA 5LVPA 4O27B 2WIHA 4TNDA 3KXMA 5TR6A 3C0IA 5LMAA 5FEDA 3QHWA 3F5PA 2WMUA 2VAGA 3RPYA 2R7BA 4YJNA 3AMBA 3SXFA 4HVDA 3F3VA 5F95A 4C8BA 3LJ1A 2CKPA 3HRFA 2R2PA 3WZDA 1YXVA 2I0YA 3EHAA 4G3EA 5BMMA 4Y73A 3I0OA 3RPSA 2Q0BA 3PWDA 5IUHA 2X7GA 4UBAA 3ACKA 1S9IA 2XKEA 4L44A 4BDCA 5CAUA 5IQBA 1JSTA 1Q61A 3QRIA 4FSNA 4X7QA 5J9LA 3UZRA 1PMVA 3HNGA 2FGIA 4RJ8A 2R3LA 3I6UA 4I0SA 5DHJA 4PL5A 4U6RA 5HBEA 5HNBA 5J87A 2UW0A 4EH5A 4LRKA 4FIHA 4CYIA 4M15A 2XUUA 4EOPA 3EQRA 3DK3A 4MTAA 1VYZA 3OWKA 4BCGA 3QF9A 4F9WA 3GBZA 2PMNX 2WKMA 4KNBA 1CKPA 4DGMA 2GHMA 3QKKA 4F09A 4M12A 4BTMA 1BLXA 2YABA 4GMYA 2VWVA 4WOVA 4AFJA 2YFXA 2R3RA 3EFKA 3V5PA 2PZYA 3F61A 4DBNA 4IAAA 1XKKA 3TDWA 3FLNC 3EN5A 5HU9A 5EHYA 2XK6A 1ZYJA 3SGCA 4O7VA 3D2IA 2ITQA 5AUWA 5CENA 4H36A 1OL7A 3C9WA 3RAHA 5KHWA 3CTQA 3UODA 4DINA 3FJQE 4ZXTA 2QOFA 2YITA 4U40A 4I94A 4CVAA 3LKMA 3TTJA 3R01A 3KCKA 5HVKA 3C7QA 1MRVA 3VS4A 2C3LA 4A9SA 1NY3A 3DU8A 3NR9A 3HV5A 4IAIA 2VNYA 4AW1A 2WMQA 2W1CA 1GOLA 4FV8A 4FZDB 2PWLA 4GFOA 4FUXA 2C0IA 3DKGA 3AC3A 3K5VA 4FSUA 2YN8A 3S2PA 3W2OA 3UP7A 4GIIA 3RPOA 3EJ1A 3QU0A 2R64A 2HXQA 5CT0A 4E6CA 4RIXB 5BVKA 4JRNA 1JKKA 4LMUA 1P5EA 5M09A 1LPUA 4J98A 1QPCA 3AD6A 4ZSJA 3P7CA 1WBOA 2WMWA 3DJ7A 3S0OA 4CG8A 2JIVA 5J5TA 4CZTA 4NW5A 5HOAA 2GHGA 3KXHA 3QXPA 4Y8DA 5I9UA 3SRVA 1GIIA 4EOQA 3QKLA 4GS6A 4CFXA 2W9FB 1GIJA 1CKIA 5L2QA 3EN4A 3PPKA 2W1FA 3HDNA 2J2IB 1WMKA 4PL3A 3PVUA 2GTMA 3WI6A 3UQCA 4W8DA 3R73A 4JDIA 4CFMA 2CKOA 2WMVA 3NWWA 2UVYA 3QX4A 4LMNA 4CYJA 3IOKA 4QP2A 1A48A 4Q9SA 4CFVA 2F49A 3QWJA 4FEQA 3UO6A 1RJBA 1MRYA 2VWZA 4FUYA 2ITNA 4EJNA 5M51A 2WEIA 2FVDA 2VO7A 4TWNA 4C4JA 4TT7A 4QYHA 5D11A 4W4XA 5DE2A 5LVOA 2XRUA 1YWNA 2H34A 4UY9A 3OVVA 5H8BA 2BKKA 2IWIA 2W1EA 4GK4A 5AA9A 3TM0A 4WNMA 4JT3A 3BIZA 3A8WA 1QMZA 4FTAA 4EEVA 5IQAA 4O0RA 5GNKA 5EI8A 5A4QA 3NCGA 2PUPA 4PX6A 4YHTA 3Q53A 5BMSA 4LRJA 1E1XA 2RGPA 5CT7A 1H4LA 1U54B 3GOPA 4EK3A 5CALA 5IH4A 3L8XA 4WNPA 3BI6A 4ZTLA 3PVWA 4V05A 3S00A 3MFTA 4YHFA 5AV3A 4QNYA 4EWQA 4QMWA 5F1ZA 3A7FA 3GU4A 4FTTA 4ZJVA 5LXMA 1UVRA 3PRIA 4JL9A 4EI4A 3MS9A 3Q4UA 4O1OA 3C5UA 4K33A 2FA2A 2ITTA 4UALA 3VHKA 2J4ZA 3G0FA 5CI7A 1ERKA 3GC7A 3SAYA 3V5JA 3FI8A 5LVLA 5H3QA 2WTKC 3C51A 4K0YA 4DAWA 4QPMA 2B0QA 2OBJA 3NUXA 3QA0A 4ANLA 3BYUA 4IADA 4PDYA 4L7SA 4DLIA 4DEBA 4HVGA 5HG8A 2QNJA 4AT3A 3D7TB 4UMQA 3FSFA 3DB8A 1V0BA 5AP2A 5FWKK 2BTSA 3PXQA 4TYIA 3A2CA 4PP9A 1NVRA 5IQGA 2W7XA 4G9CA 3RNIA 3R8ZA 4AZFA 4ZSGA 4DGOA 3JY0A 5A6OA 5IA4A 4Y5QA 1PW2A 2PK9A 4EC9A 2XKDA 1BUHA 2O0UA 3B8QA 4JIKA 4AA5A 1M2RA 4ZSLA 3HP2A 5E8SA 4G3GA 3BV2A 2HZNA 1OZ1A 4LQMA 4JX7A 5JT2A 4L8MA 3EN6A 2QG7A 3MH3A 3VF8A 2IG7A 1H24A 2OXYA 2BHHA 4P7EA 4QP1A 4EH7A 2Q83A 2QOOA 3OWPA 4A06A 5C8NA 4X3JA 3HDMA 4XOYA 4IMYA 4BC6A 3RNYA 3L9MA 4QQTA 4XG3A 4RT7A 3D5UA 4ID7A 4DH3A 4C4GA 5CEMA 2KULA 4GYIA 4I23A 3NYXA 3QFVA 1TKIA 2R3IA 3KXNA 4A4LA 3TEIA 4NT4A 5HORA 3ZO2A 3RK5A 1AD5A 3OF0A 4XBRA 3W2CA 3DTCA 2ITUA 2VU3A 2W1GA 3UNJA 3WBLA 3ZH8A 2FSMX 3GCSA 2WQOA 3BYVA 5AIRA 1YDTE 3RPRA 5DA3A 4I4FA 4KINA 3W2RA 3E63A 2YM5A 2CJMA 4YUQA 1VZOA 4DT8A 2J0IA 1PMNA 3FSKA 4WA9A 2W4OA 4BL1A 2UZDA 3G0EA 4B6LA 5M56A 4YO6A 4IB5A 4PDPA 4EOOA 2JDSA 4FNYA 2ZB0A 2NO3A 3QALE 4AZEA 2BZIB 3HRCA 3B2TA 5AAFA 3Q6WA 3ZDIA 4D1SA 4EYMA 5M4CA 4N6YA 4IH8A 3E92A 4QTBA 3TUCA 1YDSE 2SRCA 3ANQA 2XVDA 2GCDA 2YZAA 4YJPA 5D41A 5EM8A 5HHWA 3L9NA 4U0IA 3RINA 4CLIA 5BVFA 3ZLXA 4FL3A 3KXZA 4L53A 2R3OA 1SM2A 4YMJA 3CGOA 3QTWA 4C38A 5M4FA 3DJ5A 3EKNA 5FXRA 4YBJA 3KB7A 3OTVA 4YZCA 1E9HA 2Z2WA 3SXSA 3EYHA 3ALNA 1OITA 1PXNA 5FTOA 4N70A 3ZOSA 4FTLA 4U41A 1ZMWA 2EB2A 3R1YA 4JAIA 5I4NA 4AGUA 3ROCA 4KIPA 2VWBA 2DWBA 3VBYA 5IKWA 5A3XA 3FZPA 1UWHA 5IMXA 4YJUA 2YIRA 4K9YA 3NW7A 4MVFA 3VS0A 4D9TA 5DIAA 2PMLX 3D5XA 5J1VA 2ONLA 2BDJA 2C69A 2OIQA 2B55A 2JKQA 5CXHA 3THBA 3HMOA 2X39A 3ORTA 3ZU7A 5E92A 2XK3A 2XNMA 3PTGA 2E9VA 4JQ8A 4CMOA 1KUTA 5I9WA 4DH5A 3QQKA 3ZBFA 4U5JA 3NCZA 4QTDA 5IDPA 3Q6UA 2WMBA 5A6NA 1M52A 3I81A 4CTBA 4V04A 4DEDA 4DTAA 2G01A 3ZC5A 2QHNA 1KOBA 5J9YA 1WFCA 3QTUA 4UV0A 2EXEA 5L3AA 4FTIA 4PQNA 3OCGA 3LLAA 4HPTE 1Q99A 2I6LA 4DH7A 3MVJA 3PXKA 1IAHA 4ZMFA 4YGAA 4MHAA 3E8EA 3H4JA 4QMSA 1F5QA 4BZOA 2ZV7A 3CKWA 3L8PA 5L8LA 1W7HA 4PPBA 3RWPA 3DGKA 3BBWA 3DK7A 3O17A 2YIWA 4TYEA 1E1VA 5IQEA 4RWIA 1FVVA 3RP9A 1PMEA 4CFFA 4BI0A 2O63A 4NWMA 5AP3A 1XH6A 4CCUA 4I24A 4G1WA 1BX6A 1ZYSA 4C7TA 5BUEA 4N0SA 3A61A 2J9MA 1VYWA 1YXXA 5IQDA 2X1NA 4NM0A 2YM4A 3V5TA 3FAAA 1XQZA 1TVOA 4S30A 5DMZA 4MEDA 3SD0A 4C62A 3VS7A 4AOIA 2V62A 4PMSA 4CXAA 3E5AA 5D9HA 5ETCA 1DM2A 3FMHA 1H1WA 3IW4A 4BDHA 3BYMA 4FF8A 4LV5A 4OTHA 1UKHA 4DEIA 2WXVA 3NZ0A 4QPAA 4HYSA 3LCKA 4U44A 3RKBA 4JXFA 5E8YA 4XRJA 2C6LA 3F2NA 4XRLA 5JGDA 2PZRA 4WKQA 1YQJA 2W05A 2XMYA 4UWYA 1PKDA 3R7EA 4AWIA 1Q97A 2CGWA 2HIWA 4RIXA 3Q2JA 2HY0A 4LI5A 3C50A 3Q60A 2JITA 5M4IA 2GQSA 5FXSA 4KS7A 3C4WA 1Q8UA 2NPQA 2IW8A 3VBQA 3OD6X 3MVLA 4G3FA 4FC0A 4ASXA 1UU7A 3QZGA 3QCXA 3JVRA 5GZ8A 1ZRZA 3ZSGA 2IVVA 4QMTA 1JQHA 4HZRA 3FMDA 3HLLA 3PLAE 4FX3A 4OTWA 4PPCA 1H26A 2OZAB 2HOGA 3AT4A 3F7ZA 4FL2A 4FT0A 3COKA 2X8EA 3R1NA 5FDXA 2PUUA 5LVNA 4JVGA 4JI9A 5GINE 4RX5A 4YNEA 3JY9A 2ZMDA 5CSHA 1OKYA 2V7OA 4M66A 4RFYA 4UWBA 5ANKA 1YI6A 3QX2A 3ZLYA 5G6VA 4EQMA 3ETAA 2XK9A 1OKVA 2A0CX 3UTOA 4FG9A 4IZAA 1U5RA 5CXZA 3O96A 3V5QA 4GG7A 3FMNA 5CEOA 4KBKA 2W1DA 4YP8A 1Q8TA 4BIBA 4QP9A 4YPDA 4ZJIA 4TWCA 1U54A 4K2RA 1F3MC 4RJ3A 4QMXA 4A9YA 1O6YA 1B39A 1REKA 2JBPA 3PZEA 5CF5A 3CD8A 3ULIA 4GH2A 2OJGA 2R3NA 3O71A 1OBGA 3W10A 3MH1A 4RBLA 2ESMA 2G2IA 4O0VA 4LRMA 2I40A 5EK7A 4R7HA 1DAYA 2XA4A 2A19B 2CGXA 5E8UA 4D2SA 4E6QA 3T8OA 3U6IA 4DBXA 1YOJA 4JJRA 4O6EA 3TNWA 1O6KA 5DNRA 5HE0A 4XHKB 1H27A 4FKQA 4K8AA 5JZJA 4TN6A 2ZMCA 4XG2A 4G16A 5AM6A 1XBCA 5EI6A 3JS2A 3G51A 3S1HA 3MA6A 3ZFMA 2WB8A 3P9JA 3R8VA 2IZTA 3FQEA 4AW2A 3TNIA 4DC2A 4Z7GA 3MIYA 3SOCA 3U4WA 2UW5A 3A4PA 3PUPA 4O38A 3OTUA 2HENA 3BWFA 1H8FA 3RI1A 5FXQA 5FGKA 5CEIA 4E5WA 5KMLA 4U79A 1Y6AA 3QD2B 2CGVA 3I79A 2BZKB 3MFSA 3POZA 4GRBA 3VBWA 5EYCA 5HE1A 4BWPA 3EQIA 1W83A 5C26A 5GZAA 4E20A 2OI4X 2HWOA 2JAVA 4KIKA 5CAOA 5I9XA 3DJ6A 3C4EA 3KMWA 3LFNA 2F7EE 3A4OX 2CCHA 4ANMA 1UNGA 2C30A 4MX9A 4F7SA 3G9LX 4FTNA 4QMVA 4QP7A 4RFZA 1URWA 5L8JA 2B9JA 2QCSA 4I6HA 2HZIA 4O7WA 3EFJA 4HJOA 4DITA 4J7BA 4J52A 4Z16A 2ZM4A 1M14A 5IH6A 5A4LA 5HICA 1K2PA 3ANRA 4DHFA 3HAVA 4CV9A 4IANA 3R7IA 4YTCA 4I6FA 4HPUE 4QOXA 4WIHA 4BCHA 2ITOA 3O7LD 4NCTC 3HMNA 5CEKA 1Z5MA 5CAVA 4ASZA 4C37A 3NS9A 4XH6A 2R3KA 1ZYCA 2QHMA 4PTCA 1KSWA 2GNJA 3D0EA 2C5YA 3LQ8A 3NYNA 3V8WA 4AX8A 4BI2A 4F64A 4CD0A 2PUIA 4FZ7A 5A4EA 1OIYA 3EIDA 3LJ2A 3O2MA 2HWPA 4QP3A 3GU6A 2PVFA 4MAOA 4CT2A 1DS5A 3D7ZA 2BRBA 2HAKA 3ZCLA 5JFXA 3ZM9A 1WBTA 3EQDA 5CSPA 4X6QC 3EZRA 3PY3A 2R5TA 3BCEA 5T68A 4FG8A 4E1ZA 4ZZNA 3MPTA 2EWAA 1V0PA 3HMPA 2XF0A 3LPBA 4RJ7A 4IAKA 4C2WA 4F63A 4YJSA 4K11A 2V22A 3QQJA 2BKZA 3FKLA 3FLSA 3HUCA 4C61A 2ZB1A 3SDJA 3WE8A 3AXWA 4I0TA 3HA6A 2CKEA 5HD7A 3GFEA 4C58A 2VTRA 4UEUA 5IA2A 3DQWA 3QZIA 5HBHA 2C1BA 3FLZA 1ZOEA 3VBXA 5C01A 2H6DA 4C59A 3FV8A 5AUTA 3SG8A 5AP5A 4ZLOA 1S9JA 4QMZA 2BHEA 2JFLA 3GCVA 3QD3A 4YC8A 5BNJA 3SVVA 3DA6A 3EOCA 5CVHA 2W5HA 4RWLA 5FM3A 4C3RA 3WZUA 4M69B 3R21A 1H1SA 4GG5A 4NCTA 4WO5A 3ZTXA 4UMTA 4B9DA 3GB2A 4RPVA 5IQFA 2AUHA 4DEGA 4MCVA 2W1HA 4RLKA 2OGVA 3IG7A 4I3ZA 4XG8A 3NX8A 5EDRA 4IDTA 2XKCA 4X2GA 3OXZA 4Y72A 4E4XA 4BY9E 3FE3A 3MIAA 1U4DA 5EYMA 5HCZA 1NXKA 1KV1A 2ZM1A 4IIRA 4E4NA 1W98A 4IAYA 4BKJA 2VUWA 4IEBA 2IVUA 3BWJA 3NSZA 3MY5A 3IW8A 2XYNA 3A7HA 4LGDA 2ETRA 4NFNA 2CMWA 2CSNA 3G90X 1JPAA 1V0OA 5EH0A 4OTIA 1L8TA 3F6XA 3IKAA 4BIEA 3OOGA 5FEEA 1H25A 2WPAA 3ZLWA 4E8AA 3E64A 4I6BA 4ALUA 4A4XA 5EDPA 1RW8A 2C6MA 3Q2MA 2GQGA 4DGNA 4OBPA 5E8WA 1CM8A 3R9OA 4RFMA 4FIGA 3CQEA 4X2KA 4KRCA 4PWNA 4B0GA 4BBMA 4CTCA 3GQLA 5EHLA 4D4VA 4U97A 5EI2A 3OXIA 5IA5A 3CTHA 4MH7A 5ETAA 4AU8A 3R9NA 4ZZOA 3UNKA 3Q5IA 3F3UA 4U3YA 5E1SA 4BDBA 3CLYA 4BHNA 4D28A 2E9UA 4L9IA 3KN5A 3IDBA 5HX8A 1O9UA 2ZAZA 2PPQA 1FMOE 3EQHA 4W9XA 3IS5A 3OT8A 3GFWA 3NRMA 2GS7A 1DAWA 3L8VA 2E9OA 4O6LA 1K3AA 5AAGA 4ZJJA 3LMGA 5J79A 4A7CA 2X2LA 3KCFA 3QTIA 5I5ZA 3TKHA 3FKNA 4NM5A 4CFWA 4ZY4A 4CRLA 4RIWB 5HTIA 3LFSA 2OSCA 3MW1A 5E8XA 4AGCA 2UUEA 5HESA 3NGAA 5H8GA 2V55A 3GU7A 1NT2A 4IM3A 4A9TA 4XV9A 2V7AA 5AJQA 4NUSA 4G9RA 3UQGA 4B4LA 2PL0A 4WNKA 4GU6A 5KHXA 3R6XA 3FXWA 3WE4A 4BICA 4RX8A 4NK9A 2BIYA 2Y6MA 2VX0A 3ZS5A 2JIIA 4GK3A 2XM8A 2UZUE 4D4YA 4MNFA 2OH0E 2RFEA 4TZRA 3DNEA 4KABA 4FKOA 4JOAA 5FD2A 3IDPA 2RFSA 4NIFB 3R9DA 5KNJA 4IXPA 5HNIX 3FMEA 3ET7A 4NKSA 4QMOA 4D2VA 4EH9A 5J95A 3PIXA 3HVCA 5AM7A 3WIKA 3A99A 3BELA 3DZOA 4WBBB 1J7LA 2FH9A 3Q9YA 3NW6A 4ACHA 2BRGA 1FVRA 4EZ5A 1MQBA 3KA0A 4DF3A 3PA5A 3EQGA 3LCSA 4D1ZA 3MN3A 4FSWA 4QQJA 4GJ2A 1BL7A 3UC4A 1XO2B 1ZZ2A 4DG3E 3KRXA 3ZXZA 4NU1A 4ZTSA 3ORPA 4C2VA 5E9EA 2IW6A 4Q5HA 4FICA 3R9HA 5DR9A 4D2WA 4AXAA 4R8QA 5C1QB 2YM7A 2ZYBA 3GP0A 4MXXA 4IVDA 4ITHA 4JRVA 4E7WA 4FT9A 4M97A 4IHPA 3G2FA 1PXPA 3DT1A 5DH3A 4GL9A 5HO8A 1R1WA 3DBQA 2OZAA 5LWMA 4CFUA 4BTJA 3Q9ZA 3P7AA 1OBDA 2C6KA 2A4LA 1SVEA 1PJKA 2ZVAA 3KF4A 3O51A 4M14A 3W18A 1YW2A 2C5VA 2BR1A 3O8TA 3LFCA 1SMHA 1Y91A 5AUZA 3VNTA 3P4KA 1HCLA 4XP2A 1NA7A 2QO7A 3R2YA 1F0QA 3LE6A 3LXPA 2J50A 4L43A 4YSMA 3VHEA 4C4FA 1ZYDA 5AR5A 1H08A 4MBLA 1UNHA 4GFGA 3AMAA 4CG9A 3EL7A 3MB6A 5FBOA 1WBVA 2ZM3A 1RE8A 3TXOA 2J0MB 2PVKA 4QYGA 5I0BA 3CGFA 3P78A 4YJRA 2HW7A 2C6IA 4OTQA 4RJ6A 3FQHA 3ZO4A 3GC8A 2W1IA 5KMMA 3BHHA 3E93A 3QUEA 4AN9A 2BIKB 2YLFA 4K18A 2IO6A 2BFYA 4AE6A 1JNKA 4OT5A 3CY2A 3DFAA 2I0HA 2QOBA 1P2AA 5DRDA 2UW4A 4G6LA 3HMIA 3IDCA 5HNGA 3ZUTA 2X8DA 3V6RA 4OBQA 3FHIA 2OIBA 4KSPA 3WZEA 2YZLA 2ITVA 3MTLA 5IA3A 4C34A 4H39A 2UW9A 3OHTA 5FTGA 4C36A 2UZLA 3WF6A 4QP6A 2R3GA 3ENHA 1SVHA 3OROA 4IZYA 4G6OA 4IWQA 4AGDA 4WG5A 1IA8A 4ERKA 2OJFE 3NVMB 2UZOA 3EN9A 1Q24A 5BYLA 3NAYA 4O7TA 2C5NA 4P4CA 3UMWA 5AR7A 5ANEA 2EVAA 5HVYA 5KKRB 2PZIA 4B7TA 1YXSA 5F94A 2XEZA 3OT3A 2GTNA 4IFGA 4KBCA 5HO6A 2Z7SA 3S4QA 4R7BA 4TYGA 3R1SA 4ZS0A 3OUKA 3COIA 3TT0A 3NUSA 5I9YA 2IZRA 3GOKA 1L3RE 5HZNA 5HTBA 5B7VA 2JGZA 3VN9A 5AA8A 1XBBA 4G2FA 3MESA 4NFMA 5AV0A 5AP0A 4LOPA 3AT3A 4Q2AA 4A9RA 3OBGA 2ERZE 4PMPA 4IZ7A 2QU5A 2V5QA 3DKCA 5T3QA 2ZV2A 4UMRA 3NAXA 2Y4PA 3Q3BA 2VTNA 4DH8A 3U51A 5CEQA 3KK8A 2KTYA 3LOKA 5HGIA 1CSNA 4RVKA 3ZHPC 5JKGA 2EXMA 3DBFA 2X9FA 3V3VA 4AZVA 2ETMA 3EMGA 3BKBA 3LCOA 4MKCA 4IJPA 4P90A 2UW7A 3DPKA 3L9LA 4EC8A 4EOLA 5JQ8A 3RZFA 4E3CA 4OTRA 4EH8A 3KKVA 3F88A 5JH6A 1T46A 2C3IB 3CJFA 1FGKA 3TZMA 5JQ5A 4GVJA 3MFUA 3COHA 2YIQA 4FYOA 4HNFA 3W2SA 1AGWA 2GFCA 2PZ5A 4ENXA 3LHJA 5FBNC 4F99A 3O8PA 4M7IA 2CKQA 1U46A 3QRTA 4ANBA 3BQCA 2C3JA 1ZOHA 2FSOX 4OT6A 2B52A 3QGYA 3R02A 2ZV8A 3H9OA 4MWHA 3UG2A 5KBQA 5M55A 2PVJA 1ATPE 1KE5A 4X3FB 5CAPA 4ZS4A 3VAPA 3NYVA 2R3FA 3U6JA 1GZNA 3PSCA 3CPCA 3DZQA 1J1BA 4IZ5A 3ZLSA 2VGOA 5KCVA 3MBLA 4H1JA 5F9EA 3HAMA 3WYXA 4MD9E 4APCA 1I44A 3HP5A 4E5BA 2CLXA 2UZTA 4X2FA 3JUHA 2C6OA 4IVCA 1KE9A 4LL5A 3TIZA 4E26A 5A46A 4ASEA 3P79A 2C68A 5HIDA 5BVEA 5M57A 3FQSA 2PVYA 4Z9LA 5HTCA 4GT3A 3VUMA 2QOLA 3I1AA 1ZOGA 5M44A 4EOIA 4MNEB 5HCXA 4RMZA 3DTWA 3Q32A 1PXKA 2JBOA 1ZAOA 2W5AA 3DB6A 3QZFA 5ANDA 4PF4A 3E62A 4IQ6A 4UZDA 3W8QA 4OAUC 3MGYA 5C8KA 4I22A 1OPLA 1PHKA 4APPA 1TQPA 1SZMA 3W32A 4C33A 5EQYA 3GUBA 1QCFA 1G8SA 1JWHA 4IBMA 5TF9A 3BU5A 1QPDA 2XK7A 4DFNA 2YM3A 4E6DA 5J7HA 2JKMA 1XHAA 2P2HA 3PJ8A 3ZO1A 3UQFA 4DGLC 3VBVA 2BAQA 5FUTA 4FV2A 2AYPA 3LMHA 4E73A 4U8ZA 4EONA 5DYJA 4XLIA 4J8NA 1XBAA 1ZY5A 3CIKA 3Q9XA 3OY1A 3BHVA 1Z57A 3O7LB 4D2RA 5ANIA 4IJ9A 2C5XA 4QTEA 5IQHA 3L8SA 2PYWA 4W4WA 2B4SB 3IGGA 2RSVA 5FP6A 5GIOE 2ERKA 2GNHA 1BKXA 3FI4A 4Y95A 5DWRA 4OTDA 5DVRA 2WQBA 4QRCA 1R0PA 2E9PA 5LCJA 2OO8X 2P33A 2W4JA 4J97A 3F3ZA 4BDAA 3CE3A 3LVPA 2Y7JA 4JAJA 5HCYA 2X0GA 4DE4A 4IAFA 4PNIA 3PPZA 2BRMA 4JBVA 3LW0A 2B1PA 3BRBA 4WUAA 5HI2A 4WG3A 4MF0A 2QONA 3UGCA 4YJTA 3D4QA 4Y5HA 4FSZA 4ACCA 4RIWA 1OPJA 2C6TA 2QODA 4XG7A 3TG1A 4IE9A 3EQPA 4JLCA 3D14A 3G9NA 2XNEA 4FI1A 4XV1A 2XIRA 4M0YA 3MH0A 4O0WA 2YERA 2HZ0A 2XEYA 2Y4IB 2JDTA 4IACA 4R7IA 4FZAB 3PVGA 3UJGA 3RTPA 2RFDA 3BPRA 5HE2A 2A2AA 2P4IA 3ODZX 2XNPA 4HCTA 3DKFA 4F6WA 4F7NA 4CQEA 1JKTA 4D2TA 3II5A 3VUHA 3ORKA 1FPUA 3FZSA 4RIOA 4TRLA 2I0EA 2J0LA 3P7BA 2J51A 1Q62A 1FOTA 3UPZA 3RCJA 3NDMA 5K4JA 5IF1A 4NIFA 4WD5A 5L8KA 3F7WA 3FI2A 2ITPA 5M07A 2XIYA 4ZP5A 4CQGA 2F4JA 1UWJA 3I5ZA 3OCBA 4IVBA 5GJGA 5B2KA 2BPMA 3NUPA 3QLGA 5CVFA 4F0IA 2X4ZA 3OW3A 4RJ4A 3TZ9A 5FRIA 3QZHA 3EL8A 5AR4A 4FV7A 4HYUA 2XJ1A 5DT4A 3R22A 3E8NA 3LIJA 3SV0A 4AZWA 3NNWA 3TCPA 3FLYA 3DXNA 4XBUA 2F9GA 2H96A 3R2BA 3GQIA 3H9RA 2E9NA 5JRSA 2O8YA 2R3PA 4S34A 4S31A 4BDEA 4H1MA 4D0WA 3BHTA 3MWUA 4FNWA 4CKRA 3BEGA 2LAVA 3E8CA 2A1AB 5HG5A 2XM9A 3PXRA 3O50A 4NYEA 4CKIA 4BN1A 4AN3A 3PXZA 4HGSA 1LR4A 4G6NA 4XG9A 3VS6A 3TDVA 3AD5A 3HECA 1R0EA 2VWYA 2QQ7A 3MH2A 4EJ7A 3R8MA 4U3ZA 5H9BA 5KKRC 2Y9QA 3EYGA 5BUIA 3OBJA 3GEQA 1PXOA 1GJOA 2CPKE 3R04A 4X6RA 3U55A 3IW5A 3TNQB 3MVMA 4FTKA 3FLQA 2Y8OA 2WMXA 3LFBA 4FSMA 3RCDA 2WQEA 4AOTA 4CRSA 3BLQA 2PVLA 3DS6A 5AX9A 2I7QA 3NUAA 2VO3A 3ORMA 2OICA 3G6GA 4RSSA 4BWXA 2P0CA 4CCBA 3R83A 1ND4A 3KRJA 2XYUA 4GUEA 3RGFA 2O64A 2EU9A 2YCQA 4AUAA 3SC1A 3LQ5A 5LVMA 4QTAA 2BAKA 3DKOA 3QYWA 3VUKA 2YM8A 3HV6A 3U9NA 5EG3A 2C1AA 3C13A 4UX9A 4MXYA 3FL5A 3U9CA 4EBWA 2PMOX 1JBPE 2Z7QA 2ETKA 4K77A 3ULZA 2ZDTA 3H30A 4RVLA 4OLIA 4LYNA 2BZJA 3ZUUA 3LXKA 4P2KA 1W84A 1GAGA 4BIDA 1SYKA 4UYNA 5CLPA 2A27A 5AMNA 3R8UA 5CSVA 4U42A 3WZJA 1YI3A 4LGHA 1PF8A 4XV2A 4FTUA 4R1YA 4AA0A 4OBOA 4L01A 4M68A 2XBAA 5H8EA 3MVHA 5K3YA 2VRXA 2OU7A 3R71A 4NTSA 4C3FA 2WFYA 3I4BA 4RVTA 4B99A 3UG1A 3IO7A 2I1MA 4HVHA 5GHVA 4GCJA 3E8DA 4HYIA 2UW8A 4X3FC 3SHEA 4BCPA 4RRVA 4EZ3A 4IAZA 3QWKA 4F9YA 3CQUA 3A7JA 1Q3WA 1KV2A 3PJ2A 4DCAA 3UP2A 5CU3A 4FKSA 2YDJA 3BYSA 5KMKA 2P3GX 4N6ZA 4TTHB 4C02A 4CEGA 3WZKA 2I0VA 2J7TA 2IZUA 2J0KA 3DDQA 3FZOA 5HBJA 4GJ3A 2F57A 3LCDA 4QO9A 1UU3A 4EQUA 2OLCA 3ORZA 4FVQA 2WTIA 4X2NA 4UWCA 4CSVA 2VTTA 2Z7RA 5FTQA 4XEYA 3O8UA 4TWPA 2QO9A 5B2MA 3GCQA 3O23A 1Q8YA 2ITYA 4IWOA 3U4UA 1YHSA 2OF4A 4MQ2A 3VS1A 4HGTA 3FLWA 4G34A 3TKUA 1FBNA 2RF9A 4O1PA 3LXNA 4YJOA 1A06A 4PDOA 3F3TA 4WNOA 3R28A 4G3DA 2QG5A 4Z3VA 2OG8A 4GKIA 2ITXA 1M7NA 3EWHA 3VS3A 3HUBA 4ALVA 3BYOA 3EKKA 1H0VA 5KZ0A 2XIKA 3UBDA 5K0KA 3UYTA 3DDPA 4BDIA 3Q4TA 4PL4A 4KKGA 3RBWA 3IQ7A 3PSBA 3TIYA 4C57A 5KMJA 2NP8A 4LUDA 4RZWA 4RA5A 4ANQA 4DFLA 3VS5A 3W2QA 2QKRA 4FMQA 1YKRA 4JDHA 2EUFB 3KMMA 3OW4A 2XIZA 3R00A 4FL1A 3AC2A 2C0TA 1PXJA 4FSQA 5EW9A 1SVGA 2Z8CA 4EK8A 3U6HA 4UZHA 1GZOA 4PY1A 4ZTHA 2PULA 2G2FA 3MDYA 3BQRA 4ORKA 1J91A 4AS0A 3VVHA 5IEXA 2WD1A 2WTVA 4I92A 1J1CA 4FNZA 3H3CA 2HZ4A 5HIBA 2YCFA 4GW8A 1TQIA 4NEUA 5EFQA 4ZTMA 3LJ0A 2XK4A 5IEYA 2PUNA 4BYJA 3TI1A 1MQ4A 2QC6A 4NTTA 3PYYA 3ZRLA 2VZ6A 4MNEA 5EKNA 4FSYA 1QPJA 5CVGA 3R7VA 3B2WA 3ZMMA 4EH3A 3KVXA 4QMMA 4G3CA 5AR8A 3EQCA 1XH4A 4LFIA 4YR8A 1Z9XA 4IC8A 2RG5A 3KN6A 3D7TA 4QPSA 4FEXA 2P55A 3UVPA 4ZK5A 3LFEA 3QBNA 3NLBA 4BFMA 4O21A 3LZBA 3IGOA 3JR1A 3VUGA 2Y4IC 4I0RA 4KB8A 4YPSA 3OY3A 4AGWA 4ONAA 3RM7A 2BZHB 4NM7A 1JSVA 1G3NA 2F7XE 2PZPA 2Y0AA 2JFMA 3QUDA 4HZSA 4OTGA 5T6KA 4BRXA 3EN7A 3PSDA 5AP4A 3DBDA 2J90A 4JDKA 4F9CA 2OXDA 4D1XA 5BX0A 4DA5A 5HIEA 1YRPA 1UKIA 4FKTA 5CY3A 5AV1A 2GQRA 4MK0A 4DFZE 2FSTX 3FYJX 4UXLA 3RK7A 5BVWA 4MF1A 2VWUA 3T3UA 4V0GB 3ZONA 5B2LA 4XOZA 4S32A 3ZEPA 4FGBA 1OIQA 4J95A 1GNGA 3JXWA 4GK2A 2IPXA 1JAMA 2OWBA 3BLRA 3TZ7A 4FKVA 2PU8A 2X2KA 3EFWA 4O7YA 4E93A 2C5OA 2FSLX 4JR7A 4DFXE 3A60A 3VW6A 2HW6A 3ORIA 3C5IA 4GU9A 3CEKA 4QYEA 3ACJA 4XX9A 1XR1A 4F4PA 3C4ZA 4EK4A 3N4UA 1GZKA 2REIA 4UB7A 3VC4A 3FXXA 1ZMUA 3HV7A 5C9CA 3OS3A 3SRVB 5L6PA 2QI8A 4AP7A 3WF9A 4LM5A 1AQ1A 3VIDA 1UNLA 2WIPA 5LARA 4ZSEA 3GC0A 3D5WA 4QMUA 1JOWB 3BHYA 5CI6A 4JS8A 5IQCA 3ZC6A 3AC5A 4XG6A 2R0UA 4D4SA 5IA1A 1IAJA 4J96A 1H28A 4W4YA 4XG4A 3QTZA 4QMPA 2LGCA 5E1EA 1VEBA 3S3IA 4DFBA 3TV7A 3PVBA 4M3QA 5LMBA 4GV1A 3W33A 4EKKA 3E3PA 1GIHA 3GT8A 4KA3A 4YURA 4HNIA 4UXQA 5DR2A 4YZBA 1EH4A 2CCIA 1PXLA 4FGRA 3H9FA 3W55A 4PDSA 3H0ZA 3RK9A 2OIDA 4YLLA 4MXCA 4M0ZA 5J5SA 3PY0A 2FB8A 2BUJA 1PRYA 4K1BA 2YCSA 5DFPA 2UZEA 5CF6A 4O86A 1APME 2ZDUA 4L7FA 3RMFA 2WAJA 1ZXEA 4BGHA 5L2TA 5C4KA 3MV5A 2HK5A 3MJ2A 3U87A 3V8TA 2XNGA 4FBXA 1NVQA 3EZVA 4F65A 4O81A 2RFNA 5L4QA 2BDFA 4O0XA 4RWKA 2W17A 2VWXA 1YXTA 2H8HA 4ACDA 2PHKA 3BLHA 1M7QA 4K6ZA 2GDOA 5AP7A 5KUPA 1BMKA 4ENYA 5FLFA 3CQWA 4RVMA 3UOHA 3QQHA 3ATTA 4H3BA 4NM3A 1XH8A 4QP4A 5AP6A 4TWOA 5IPJA 1KOAA 3TACA 3LFFA 2O65A 3OWLA 4F1TA 2XRWA 3QTSA 3R30A 4F9AA 2QO2A 5JZNA 3UIUA 2CNUA 4YC6A 3KRLA 5J7BA 3KF7A 2NRYA 3N9XA 4JG6A 1IASA 5AP1A 4ITJA 2R3QA 4FIIA 4JR3A 4KWPA 3LCTA 3FY0A 3ZZWA 4ANOA 3F69A 3S95A 5A9UA 2UZVA 1SNUA 1W0XC 4ZTNA 3AT2A 4JQEA 3LM0A 1ZYLA 3NUUA 5KZIA 2VTSA 3KULB 4P5QA 1IR3A 4MBIA 4FKWA 4Q5EA 3ZFYA 4O7NA 2OW3A 2Q0NA 2X6DA 2PMIA 4WT6A 5DEYA 3HX4A 3FMLA 5DI1A 2ITZA 5AWMA 3OCTA 3BE9A 2JDRA 5ANJA 4H3PA 5CANA 5M53A 3QA8A 2ZJWA 1O6LA 4EH6A 1Q8ZA 4O83A 2UZBA 2Z60A 4Y46A 4JBQA 2PVNA 3ZFXA 4ZEGA 3JVSA 4PP7A 3Q5ZA 4AQCA 5TT7A 1YXUA 5F20A 4FVPA 4KUJA 3GU8A 3R1QA 4GSBA 5AX3A 3COMA 2YAAA 3D5VA 2VO0A 3U54A 5DGZA 3FL4A 4MWIA 3TUDA 1WBWA 1IA9A 3EQFA 5AUXA 5K5NA 5JSMA 5CS6A 1BI8A 4QQ5A 5AUYA 4EUUA 4XP0A 5AIKA 5BVNA 4EK5A 1CDKA 1BYGA 4IDVA 3MPAA 4QYYA 4RIYB 4IM2A 3QLFA 2CGUA 5DN3A 5I9ZA 3TN8A 3V8SA 5CQUA 5B0XA 2C4GA 5IA0A 4OGRA 1CMKE 4CZUA 4EHVA 3UIMA 4TY1A 2GPHA 3DAEA 3P1AA 4L00A 4BYIA 1Y6BA 5JK3A 4ZOGA 3R7GA 4A4OA 1LP4A 4R3CA 3R8LA 1FMKA 2XIXA 4ZZMA 3VJOA 4DLJA 1OI9A 4NL0A 2CN8A 2G15A 2JIUA 1KE6A 4S33A 3WARA 4AN2A 5DPVA 4BCQA 4GKHA 3UIXA 3VO3A 4ASDA 4BGQA 5ANGA 3CCNA 4Q9ZA 2IVTA 1FGIA 1YHVA 5EM7A 1LEWA 4IWPA 3A7GA 4YJQA 5C27A 2PVHA 4QD6A 4I5CA 5AADA 2QU6A 3DOGA 3FPQA 5EM6A 5M06A 2OJIA 3C4CA 2CHLA 5HEZA 2WHBA 2XKFA 3M1SA 3UVQA 3I5NA 2BRHA 4B8MA 4ZLYA 4USDA 3U8WA 3ZZEA 1R3CA 3NEWA 3K5UA 3PY1A 3TJCA 3IW6A 5KMNA 3FMJA 4I5MA 1FQ1B 3GCPA 2VV9A 2W96B 2HELA 3NUYA 4EHEA 3OZ6A 4RWJA 3UO5A 3DBCA 4FKJA 3HMMA 4QYFA 3D83A 1G8AA 2FO0A 4KBAA 2XBJA 4H3QA 4WG4A 2B53A 5FG8A 5KMOA 4O0SA 3I0QA 3QD0A 4NZWB 3CP9A 3K2LA 4L3LA 5JEBA 5K5XA 4O7SA 4L3PA 2B9FA 4FODA 3UOKA 3VULA 3WF5A 4BB4A 4I6QA 4AW5A 5EKOA 2W99B 2WMAA 3D94A 4AG8A 3MJ1A 4AACA 4EHZA 4JQ7A 4EWHA 4L67A 2Z02A 2QLUA 5EW8A 4RC4A 1WVXA 5AR3A 3ALOA 4HVSA 4NKAA 1M17A 4NJ3A 4DEAA 1H00A 1MRUA 1GY3A 3TL8A 4IB0A 4XLVA 5K0XA 3A62A 4I93A 3MSSA 5KBRA 5JFWA 3UNZA 4FV6A 4QMQA 3D15A 3PG1A 1NW1A 3ZSHA 2GHLA 1I09A 5IMEA 3PG3A 5M4UA 3UYSA 2J5EA 3KXGA 4DFYA 2WU7A 4KS8A 4E5AX 4ANNA 4EOJA 5D7VA 1IEPA 3EH9A 3BV3A 5E7RA 2J6MA 4WBOA 2B9HA 5C4LA 2PSQA 2VNWA 3DV3A 4ITIA 3FZ1A 3KL8A 3PJCA 2Z7LA 4JNWA 5DEWA 4FKIA 4L68A 3Q04A 5HKMA 5FDPA 4GEOA 3SG9A 2OKRA 1BL6A 1OUYA 1UU8A 2C3KA 4CT1A 2IJMA 4GYGA 3SOAA 2C47A 3RVGA 3L9PA 4YU2A 5A4CA 2YIYA 2W06A 2WU6A 4V0GA 3QCSA 3BE2A 5HD4A 3DLSA 4O84A 5E90A 1VR2A 3KK9A 2IZSA 4ACGA 4BCNA 1Y8GA 1PYXA 3AQVA 3BBTB 4FV9A 4RQKA 2G2HA 4RJ5A 4FEWA 2YAKA 4FEVA 2JC6A 1UU9A 5D12A 4N57A 3EQBA 5JGAA 5IQIA 4QT1A 3PDTA 4HYHA 3ENMA 1YI4A 3V04A 4PTGA 2DUVA 4FTRA 1MUOA 4F0FA 2CNVA 4BWKA 4L45A 1HOWA 4A07A 4I1ZA 2BALA 4FOCA 3VJNA 3ORLA 4U45A 3T3VA 4F0GA 5KX8A 1J7IA 4JG8A 3GVUA 3I7BA 3K54A 4BKYA 4HGLA 2CN5A 4AF3A 4BKZA 2W0JA 3TKIA 3I7CA 4JBOA 5KMIA 3OP5A 1YOMA 4ZMEA 5TO8A 3V5LA 4CV8A 3ERKA 4PNKA 3NYOA 3FXZA 4J1RA 5ITAA 3ZXTA 2PE0A 4AE9A 1PKGA 3KRWA 2F2UA 2VTOA 5DT3A 2CLQA 5F4NA 4FIFA 4TW9A 3PIZA 4LL0A 4U7ZA 2CNQA 5EQEA 3Q4ZA 3LFQA 3W16A 3PP0A 2P2IA 4M69A 2BTRA 5E8TA 5IG1A 4TL0A 2JKOA 3N4TA 4HGEA 3IW7A 4MXAA 3H0YA 2IW9A 1XJDA 3ZBXA 4CGAA 1FINA 3NNVA 4JX3A 4O22A 3CSVA 3MFRA 4IX3A 2VTJA 2WQNA 3RHXA 3NIEA 4F7JA 5M08A 4O7LA 4M13A 4YSJA 2OJJA 1NVSA 5EYKA 2V0DA 3CD3A 3QUPA 4EQCA 3FHRA 3AC4A 4L3JA 4LOOA 5CX9A 3MYGA 4TPTA 4YTIA 5LOHA 5TOZA 4FK3A 3NPCA 4QMLA 3SA0A 4C4HA 5LWNA 5AUUA 4LGGA 3TNPC 4PUZA 3DAKA 5FM2A 4FYNA 5CU2A 5CNOA 4BGGA 4XP3A 2JAMA 4EKLA 2JLDA 4G17A 5CZIA 4L46A 1CTPE 2UV2A 3FDNA 4R5YA 2GS6A 3FPMA 3E88A 2W5BA 4AFEA 4C4EA 3C1XA 5AV2A 2WMRA 5DT0A 5CEPA 2X7FA 4O0YA 2UW3A 1T45A 3RHKA 4DTKA 3KRRA 3ZDUA 5ETIA 4RZVA 1OIUA 3REPA 2XJ0A 3QL8A 4MXZA 4HVIA 2RL5A 5DG5A 4RG0A 3ROYA 4DN5A 5GIPE 5BUJA 3R0TA 4BDGA 4F70A 1REJA 5A54A 4KIKB 5L6OA 2WTJA 4OTFA 3GI3A 3F2RA 2XNOA 3KULA 4QQCA 4FV0A 2VTHA 3BGQA 4EHGA 3OOMA 5J9ZA 1Q41A 5C03A 3M42A 5C8MA 3C4XA 4DCEA 4NH1A 5CF8A 2GNLA 2JKKA 3GCUA 2IVSA 3QYZA 2BMCA 4A9UA 4CMTA 4F6UA 4I20A 5HLWA 4BR3A 2BVAA 5ACBC 1YDRE 5BYYA 4D58A 2YJRA 5DLSA 3M11A 4IM0A 4WRGA 3VWAA 2JDOA 3FZTA 3QQUA 3ZYAA 4NSTA 3GNIB 4GT4A 4YTFA 3V51A 2GNFA 3RAWA 3ZUVA 3PE2A 4MQ1A 3F5XA 3QTXA 4MXOA 3PIYA 3SKCA 1UA2A 4KIOA 3UC3A 2XH5A 5AEPA 4O96A 1ZY4A 4L52A 1LEZA 2YA9A 4YZDA 3RZBA 4BDFA 4O7ZA 4DFUA 2F7ZE 3EB0A 4PTEA 3H10A 5AV4A 3SXRA 3MPMA 3PZHA 5GJFA 3QQLA 2E2BA 2ONLC 2VTAA 3F3WA 3F66A 3JPVA 4MD8E 4F6SA 2O2UA 3GENA 3FC2A 5GJDA 3SX9A 4RIYA 4KRDA 4MYGA 3V01A 3HV4A 4CNHA 1OUKA 4ACMA 2G1TA 2JDVA 3HRBA 5LQFA 4FTMA 4WUNA 2XK8A 4YC3A 4ZLZA 3LM5A 4FV3A 1KWPA 3BGZA 3QRJA 1ZLTA 2QOKA 3KVWA 4MBJA 1A9UA 2R7IA 2UZNA 3QC4A 3LFAA 5IZFA 4FIEA 3CXWA 4TNBA 1PY5A 4C4IA 3HKOA 5HLNA 1G5SA 4XCUA 1B6CB 1OKWA 4WSYA 4BZNA 4DT9A 2VGPA 4R3PA 2EB3A 4U43A 2VWWA 5EYDA 5E8ZA 2J5FA 3LFDA 4U80A 4UMUA 3DAJA 4IX5A 3ZRMA 5LJJA 4D5HA 5ICPA 4YZ9A 3ZEWA 1H07A 1STCE 4P5ZA 4ZTRA 5E91A 1LUFA 1ZWSA 2VWIA 2OJ9A 3HV3A 3Q4CA 4WHZA 2R3HA 3KY2A 3HZTA 3VS2A 2VO6A 4R78A 3E87A 3HL7A 2YDKA 2GSFA 3UMXA 2QR7A 4X2JA 5CU6A 2FYSA 4IFCA 4N4SA 4EH4A 3PJ1A 3QXOA 4FOBA 4GVAA 5LCKA 3FMKA 1H01A 2WEVA 4O2PA 4BDKA 1OL2A 2YHVA 3DK6A 3V6SA 5IEVA 4FV5A 3QGWA 4Y85A 3PA4A 3PLSA 2BAJA 3LAUA 2UW6A 4F1OA 2WZJA 4EOKA 3TUBA 2QOIA 2XNNA 4RX9A 1OMWA 4LV8A 3K3JA 4HOKA 2W4KA 4IWDA 1B38A 2GMXA 5LMKC 2QURA 2R4BA 4DG2E 4EYJA 5L2WA 3T9TA 4G5JA 3GU5A 3A8XA 4RQVA 1WVYA 2OK1A 4FIJA 5CU4A 2RIOA 4CMUA 2WMTA 3MA3A 4X21A 5D10A 4IX6A 1CKJA 3AOXA 2X7OA 2RKUA 5ANOA 5EOBA 4ZAUA 4J71A 3MY0A 4KKHA 4QTCA 1RQQA 4EH2A 3ORNA 2NNWB 4YHJA 4OTPA 2HCKA 4JG7A 5AR2A 3QHRA 4L6QA 3VUDA 3F9NA 3NW5A 3TNHA 3F5GA 2R9SA 3W2PA 5E8VA 3KQ7A 2C6DA 4LOQA 4BCMA 3FKOA 1QPEA 2WOTA 2X81A 4LUEA 3I6WA 4YZNA 4QP8A 4O0TA 5FQDC 3IK3A 2DS1A 2GFSA 3BX5A 3DNDA 4NW6A 5I3OA 4G31A 3UPXA 4ANSA 4E4LA 3UOJA 4I4EA 2OZOA 1GZ8A 3ZSIA 1PXMA 2QD9A 3GC9A 3NUNA 3TV4A 3V5WA 5FEQA 3ZRKA 5BVDA 1Q8WA 4XMOA 1DI8A 4W8EA 4ZIMA 4XUFA 3WIGA 2YWVA 4U81A 5LMKA 4KAOA 3KFAA 4ERWA 3SW7A 3Q9WA 3POOA 2WQMA 1PYEA 1V1KA 3OUNB 4FTQA 5HLPA 3UIBA 2UZWE 4AOJA 1KE8A 1OB3A 5KE0A 4BF2A 4U9AA 4DYMA 2F2CB 3PE1A 4RA4A 3LQ3A 3PJ3A 4TYHB 2XNBA 4USFA 4QNAA 2BDWA 3FBVA 3BHUA 3CR0A 4YLKA 5EOLA 5BYZA 3R8PA 2PY3A 4AW0A 1RDQE 2R0IA 3IPHA 4FTJA 5JFSA 4RC2A 1YOLA 4L42A 3DY7A 3DCVA 4FZ6A 4M84A 5CSXA 3ZM4A 1TQMA 5CQWA 2X6EA 1OKZA 4AAAA 5J1WA 3HYHA 3KEXA 4IC7A 3FWQA 5EW3A 3FUPA 4C3PA 5IISA 3O0GA 4ARKA 1JKSA 5DR6A 1URCA 3N51A 1YWRA 2VN9A 4TKSA 2WTWA 3MI9A 4DTBA 4YO4A 5EQPA 4BCFA 5JMSA 3OEZA 4BBFA 1Q5KA 5JN2A 4ZY6A 4M67A 3QKMA 4OUCA 2ZOQA 4B8LA 3OWJA 4XV3A 2WO6A 4AZTA 4FKPA 4X3FA 4GT5A 5IU2A 3VUTA 3NNUA 3QTRA 4TYJA 4FT7A 5CWZA 3VBTA 1BI7A 4PPAA 2FUMA 1WBSA 1PXIA 2VTMA 4IW0A 3D2KA 3UDBA 4BVUA 4EOSA 2W1ZA 4YJVA 3CY3A 2PTKA 1J3HA 2GNIA 3RM6A 3LMIA 3DXQA 2YJSA 2UVXA 4KIQA 1IRKA 3RJCA 3OFMA 4I5HA 2HXLA 3OG7A 1J7UA 4BBEA 4BCOA 3ODYX 2Y6OA 2ACXA 5TKDA 3G33A 2OFVA 3SW4A 1SNXA 2QLQA 1OL1A 1M2QA 1ZMVA 5CYIA 3KC3A 1U5QA 3AGLA 2B54A
chains in the Genus database with same CATH superfamily
1Y8YA 1WZYA 2O5KA 3P5KA 3ZO3A 4C0TA 1YHWA 3C0HA 4FV1A 3QTQA 5D7AA 5CU0A 4D9UA 2ITWA 3C0GA 5JRQA 4CLJA 3ELJA 3UZTA 3BU3A 3CS9A 3TJDA 3CKXA 4FTCA 3UZPA 4FVRA 4BDJA 2GU8A 4FKRA 4FEUA 4PMTA 3P23A 2OH4A 4I21A 5BVOA 3DLZA 2W9ZB 4JIAA 4C35A 4KSQA 5L6WL 3AMYA 2VX3A 3B8RA 4XJ0A 5K4IA 3BGPA 4WRSA 3VUIA 3LXLA 1OL5A 3T9IA 1X8BA 3WYYA 4W9WA 3BZ3A 2YLEA 2YISA 4OR5A 2OF2A 3CTJA 3PA3A 3G6HA 3M2WA 4IX4A 3FYKX 3E7OA 5EHOA 1U59A 1XH7A 2XZSA 2PVMA 4J53A 5HO7A 3QRKA 2AQXA 2H9VA 3WF8A 3I60A 4O2ZA 2YDIA 4DEHA 4USEA 4YNOA 5KO1A 4ZY5A 2VTIA 2WTCA 3NNXA 3TWJA 4J8MA 2R3JA 4BCKA 3IECA 3PXYA 1JVPP 5GZ9A 2B7AA 3VRYA 3AC1A 5IDNA 5E4HA 3QC9A 4AA4A 2UVZA 2YWPA 1OM1A 4KKEA 3PXFA 4H05A 2X0PA 5HU3A 4BDDA 1OGUA 2AC5A 2NRUA 2PE1A 3KGAA 4M8TA 4DH1A 4BCJA 2O3PA 4E6AA 1WCCA 3QQGA 2WELA 2R3MA 3TTIA 3HEGA 1XH5A 4R77A 3KMUA 5HE3A 2CDZA 3P86A 4FTOA 4EOMA 4UN0C 4F7LA 3MY1A 3N4VA 3G5DA 5CNNA 4J99A 4LG4A 5DBXA 3OCSA 3IONA 3R7UA 2IN6A 3JYAA 4IB1A 3ITZA 1W8CA 4EL9A 3UDZA 4KD1A 2C0OA 4R6VA 1HCKA 4PV0A 1P14A 4W4VA 3UE4A 4YBKA 5BPYA 2YCRA 4F1MA 4QMYA 5D1JA 3DQXA 3HGKA 4O91A 3FI3A 4UYAA 2AC3A 4RX7A 2BCJA 3Q96A 4EZ7A 4BI1A 4FKLA 4FKUA 4BZDA 4Z55A 5HX6A 5TE0A 3PRFA 4R1VA 3SQQA 4DGGA 4XS2A 4FV4A 4ZTQA 4D0XA 3VQHA 1JSUA 3ATSA 2XJ2A 2BFXA 3MB7A 1Y57A 2QOQA 1MP8A 4Z7HA 4AT4A 5CSWA 4HCUA 1PMUA 2QR8A 4EUTA 5IUGA 4DDGA 4YTHA 1M2PA 3FZRA 5FP5A 4FT3A 3AC8A 4ALWA 3IOPA 2WOUA 1XH9A 5G1XA 3PPJA 4R5SA 3RAIA 1IG1A 2X8IA 2YM6A 1JKLA 5IH5A 4S2ZA 4AXEA 5AUVA 1OVEA 4AT5A 5J8IA 1VJYA 3UVRA 4ZSAA 3VF9A 3FC1X 1P4OA 4RC3A 4RGJA 3TZ8A 4FK6A 1H1RA 5AAEA 1ZARA 3OEFX 3SLSA 1WBNA 3WF7A 5HG7A 1WVWA 2BROA 2JEDA 4EK6A 2YEXA 4D5KA 1OECA 3AG9A 2ZV9A 3EFLA 5BQ0A 2QKWB 3PFQA 4TXCA 5ACKA 5CTPA 2DQ7X 1OIRA 2X4FA 4WSQA 3UOLA 4QDVA 2B9IA 1H1PA 3NMUF 4QMNA 3KU2A 3RPVA 1H0WA 1WAKA 2X0OA 3D9VA 4O0UA 3MTFA 1Q4LA 3K3IA 3L1SA 1QL6A 3A7IA 3HA8A 3ORXA 1R78A 5CZHA 5CASA 1JLUE 3NIZA 2DYLA 3OC1A 4PMMA 4UMPA 4V01A 3CBLA 3BEAA 2XP2A 4FSRA 2C6EA 3CJGA 3QRUA 4II5A 4AQKA 3PWYA 3QD4A 3NVKI 4FR4A 2YIXA 3UO4A 4I5PA 3Q52A 2GNGA 2VTLA 2XB7A 4FT5A 1K9AA 3RWQA 3CPBA 1R39A 4HW7A 3VW8A 4O82A 3KREA 3R63A 3RALA 4AZSA 3QCYA 5EM5A 3FY2A 4FNXA 3TV6A 1H1QA 4BTKA 4OW8A 3F5UA 1YVJA 1WBPA 1XWSA 3DBEA 1DI9A 1YWVA 3F2AA 5CF4A 2JD5A 2VTQA 4BCIA 5A4TA 1FVTA 4G5PA 3DXPA 5HQ0A 3FMMA 3P08A 2OFUA 4GIHA 3R7YA 3QAME 2GS2A 4XYFA 5I3RA 4XNEA 3W1FA 4BTFA 5H2UA 4D2PA 4FE2A 3NFFB 2QOCA 5HVJA 2OXXA 5DOSA 4Y83A 4JDJA 3GGFA 4GFMA 1VLRA 3CC6A 4FSTA 4IVAA 3AKJA 2EXCX 2QOHA 2WTKB 3WOWA 4FA2A 5A14A 4CZYB 3E3BX 4D4RA 4F08A 1OPKA 4R3RA 3QQFA 2QVSE 4FZFB 3R7OA 4OAVB 4AXCA 4CKJA 2WNTA 3BU6A 1OL6A 2X2MA 4BHZA 2VD5A 3DFCB 4JBPA 5JFVA 3OXTA 4F9BA 4DG0E 3KXXA 1P4FA 2VX1A 4I41A 2HYYA 4YLJA 4EORA 3E7VA 2XCHA 3WILA 5I9VA 2G9XA 2XCKA 4HCVA 4O7RA 2WMSA 1UV5A 4X0MA 5JGBA 3FEGA 4NJDA 5DRBA 3VQUA 5EDQA 3PP1A 3GXLA 3W0OA 2RG6A 3VRZA 5CAQA 2PE2A 4FKGA 2VTPA 4H58A 1KE7A 5AFVA 3AGMA 4DEEA 5L2SA 4EBVA 2J0JA 4TYHA 3RAKA 1Q3DA 4PRJA 1W82A 1ZZLA 3G15A 4E4MA 3ID6C 3LLTA 4IB3A 4CFNA 3W8LA 4RLLA 5IUIA 3F82A 4FG7A 5HG9A 2WTDA 3C4FA 4YZMA 5K9IA 3QCQA 3OMVA 5ETFA 4D55A 2PVRA 2XS0A 3AD4A 2WGJA 4GUBA 3R9RA 2YACA 3P0MA 2HY81 2BRNA 2X9EA 2BILB 4MD7E 5L2IA 5LVPA 4O27B 2WIHA 1G8JA 4TNDA 3KXMA 5TR6A 3C0IA 5LMAA 5FEDA 3QHWA 3F5PA 2WMUA 2VAGA 3RPYA 2R7BA 4YJNA 3AMBA 3SXFA 4HVDA 3F3VA 5F95A 4C8BA 3LJ1A 2CKPA 3HRFA 1XMMA 2R2PA 3WZDA 1ST4A 1YXVA 2I0YA 3EHAA 4G3EA 5BMMA 4Y73A 3I0OA 3RPSA 2Q0BA 3PWDA 4JMQA 5IUHA 2X7GA 4UBAA 3ACKA 1S9IA 2XKEA 4L44A 4BDCA 5CAUA 5IQBA 1JSTA 1Q61A 3QRIA 4FSNA 4X7QA 5J9LA 3UZRA 1PMVA 3HNGA 2FGIA 4RJ8A 2R3LA 3I6UA 4I0SA 5DHJA 4PL5A 4U6RA 5HBEA 5HNBA 5J87A 2UW0A 4EH5A 4LRKA 4FIHA 4CYIA 4M15A 2XUUA 4EOPA 3EQRA 3DK3A 4MTAA 1VYZA 3OWKA 4BCGA 3QF9A 4F9WA 3GBZA 2PMNX 2WKMA 4KNBA 1CKPA 4DGMA 2GHMA 3QKKA 4F09A 4M12A 4BTMA 1BLXA 2YABA 4GMYA 2VWVA 4WOVA 4AFJA 2YFXA 2R3RA 3EFKA 3V5PA 2PZYA 3F61A 4DBNA 4IAAA 1XKKA 3TDWA 3FLNC 3EN5A 5HU9A 5EHYA 2XK6A 1ZYJA 3SGCA 4O7VA 3D2IA 2ITQA 5AUWA 5CENA 4H36A 1OL7A 3C9WA 3RAHA 5KHWA 3CTQA 3UODA 4DINA 3FJQE 4ZXTA 2QOFA 2YITA 4U40A 4I94A 4CVAA 3LKMA 3TTJA 3R01A 3KCKA 5HVKA 3C7QA 1MRVA 3VS4A 2C3LA 4A9SA 1NY3A 3DU8A 3NR9A 3HV5A 4IAIA 2VNYA 4AW1A 2WMQA 2W1CA 1GOLA 4FRFA 4FV8A 4FZDB 2PWLA 4GFOA 4FUXA 2C0IA 3DKGA 3AC3A 3K5VA 4FSUA 2YN8A 3S2PA 3W2OA 3KIOC 3UP7A 4GIIA 3RPOA 3EJ1A 3QU0A 2R64A 2HXQA 5CT0A 4E6CA 4RIXB 5BVKA 4JRNA 1JKKA 4LMUA 1P5EA 5M09A 1LPUA 4J98A 1QPCA 3AD6A 4ZSJA 3P7CA 1WBOA 2WMWA 3DJ7A 3S0OA 4CG8A 2JIVA 5J5TA 4CZTA 4NW5A 5HOAA 2GHGA 3KXHA 3QXPA 4Y8DA 5I9UA 3SRVA 1GIIA 4EOQA 4I6LA 3QKLA 4GS6A 4CFXA 2W9FB 1GIJA 1CKIA 5L2QA 3EN4A 3PPKA 2W1FA 3HDNA 2J2IB 1WMKA 4PL3A 3PVUA 2GTMA 3WI6A 3UQCA 4W8DA 3R73A 4JDIA 4CFMA 2CKOA 2WMVA 3NWWA 2UVYA 3QX4A 4LMNA 4CYJA 3IOKA 4QP2A 1TZDA 4Q9SA 1A48A 4CFVA 2F49A 3QWJA 4FEQA 3UO6A 1RJBA 1MRYA 2VWZA 4FUYA 2ITNA 4EJNA 5M51A 2WEIA 2FVDA 5BV3A 2VO7A 4TWNA 4C4JA 4TT7A 4QYHA 5D11A 4W4XA 5DE2A 5LVOA 2XRUA 1YWNA 2H34A 4UY9A 3OVVA 5H8BA 2BKKA 2IWIA 2W1EA 4GK4A 5AA9A 3TM0A 4WNMA 4JT3A 3BIZA 3A8WA 1QMZA 4FTAA 4EEVA 5IQAA 4O0RA 5GNKA 5EI8A 5A4QA 3NCGA 2PUPA 4PX6A 4YHTA 3Q53A 5BMSA 4LRJA 1E1XA 2RGPA 5CT7A 1H4LA 1U54B 3GOPA 4EK3A 5CALA 5IH4A 3L8XA 4WNPA 3BI6A 4ZTLA 3PVWA 4V05A 3S00A 3MFTA 2X0QA 4YHFA 5AV3A 1TFFA 4QNYA 4EWQA 4QMWA 5F1ZA 3A7FA 3GU4A 4FTTA 4ZJVA 5LXMA 1UVRA 3PRIA 4JL9A 4EI4A 3MS9A 3Q4UA 4O1OA 3C5UA 4K33A 2FA2A 2ITTA 4UALA 3VHKA 2J4ZA 3G0FA 5CI7A 1ERKA 3GC7A 3SAYA 3V5JA 3FI8A 5LVLA 5H3QA 2WTKC 3C51A 4K0YA 4DAWA 4QPMA 2B0QA 2OBJA 3NUXA 3QA0A 4ANLA 3BYUA 4IADA 4PDYA 4L7SA 4DLIA 4DEBA 4HVGA 5HG8A 2QNJA 4AT3A 3D7TB 4UMQA 3FSFA 3DB8A 1V0BA 5AP2A 5FWKK 2BTSA 3PXQA 4TYIA 3A2CA 4PP9A 1NVRA 5IQGA 2W7XA 4G9CA 3RNIA 3R8ZA 4AZFA 4ZSGA 4DGOA 3JY0A 5A6OA 5IA4A 4Y5QA 1PW2A 2PK9A 4EC9A 2XKDA 1BUHA 2O0UA 3B8QA 4JIKA 4AA5A 1M2RA 4ZSLA 3HP2A 5E8SA 4G3GA 3BV2A 2HZNA 1OZ1A 4LQMA 4JX7A 5JT2A 4L8MA 3EN6A 2QG7A 3MH3A 3VF8A 2IG7A 1H24A 2OXYA 2BHHA 4P7EA 4QP1A 4EH7A 2Q83A 2QOOA 3OWPA 4A06A 5C8NA 4X3JA 3HDMA 4XOYA 4IMYA 4BC6A 3RNYA 3L9MA 4QQTA 4XG3A 4RT7A 3D5UA 4ID7A 4DH3A 4C4GA 5CEMA 2KULA 4GYIA 4I23A 3NYXA 3QFVA 1TKIA 2R3IA 3KXNA 4A4LA 3TEIA 4NT4A 5HORA 4AXFA 3ZO2A 3RK5A 1AD5A 3OF0A 4XBRA 3W2CA 3DTCA 2ITUA 2VU3A 2W1GA 3UNJA 3WBLA 3ZH8A 2FSMX 3GCSA 2WQOA 3BYVA 5AIRA 1YDTE 3RPRA 5DA3A 4I4FA 4KINA 3W2RA 3E63A 2YM5A 2CJMA 4YUQA 1VZOA 4DT8A 2J0IA 1PMNA 3FSKA 4WA9A 2XARA 2W4OA 4BL1A 2UZDA 3NFGB 3G0EA 4B6LA 5M56A 4YO6A 4IB5A 4PDPA 4EOOA 2JDSA 4FNYA 2ZB0A 2NO3A 3QALE 4AZEA 2BZIB 3HRCA 3B2TA 5AAFA 3Q6WA 3ZDIA 4D1SA 4EYMA 5M4CA 4N6YA 4IH8A 3E92A 2IEWA 4QTBA 3TUCA 1YDSE 2SRCA 3ANQA 2XVDA 2GCDA 2YZAA 4YJPA 5D41A 5EM8A 5HHWA 3L9NA 4U0IA 3RINA 4CLIA 5BVFA 3ZLXA 4FL3A 3KXZA 4L53A 2R3OA 1SM2A 4YMJA 3CGOA 3QTWA 4C38A 5M4FA 3DJ5A 3EKNA 5FXRA 4YBJA 3KB7A 3OTVA 4YZCA 1E9HA 2Z2WA 3SXSA 3EYHA 3ALNA 1OITA 1PXNA 5FTOA 4N70A 3ZOSA 4FTLA 4U41A 1ZMWA 2EB2A 3R1YA 4JAIA 5I4NA 4AGUA 3ROCA 4KIPA 2VWBA 2DWBA 3VBYA 5IKWA 5A3XA 3FZPA 1UWHA 5IMXA 4YJUA 2YIRA 4K9YA 3NW7A 1G8KA 4MVFA 3VS0A 4D9TA 5DIAA 2PMLX 3D5XA 5J1VA 2ONLA 2BDJA 2C69A 2OIQA 2B55A 2JKQA 5CXHA 3THBA 3HMOA 2X39A 3ORTA 3ZU7A 5E92A 2XK3A 2XNMA 3PTGA 2E9VA 4JQ8A 4CMOA 1KUTA 5I9WA 4DH5A 3QQKA 3ZBFA 4U5JA 3NCZA 4QTDA 5IDPA 3Q6UA 2WMBA 5A6NA 1M52A 3I81A 4CTBA 4V04A 4DEDA 4DTAA 2G01A 3ZC5A 2QHNA 1KOBA 5J9YA 1WFCA 3QTUA 4UV0A 2EXEA 5L3AA 4FTIA 4PQNA 3OCGA 3LLAA 4HPTE 1Q99A 2I6LA 4DH7A 3MVJA 3PXKA 1IAHA 4ZMFA 4YGAA 4MHAA 3E8EA 3H4JA 4QMSA 3TMOA 1F5QA 4BZOA 2ZV7A 3CKWA 3L8PA 5L8LA 1W7HA 4PPBA 3RWPA 3DGKA 3BBWA 3DK7A 3O17A 2YIWA 4TYEA 1E1VA 5IQEA 4RWIA 1FVVA 3RP9A 1PMEA 4CFFA 4BI0A 2O63A 4NWMA 5AP3A 1XH6A 4CCUA 4I24A 4G1WA 1BX6A 1ZYSA 4C7TA 5BUEA 4N0SA 3A61A 2J9MA 1VYWA 1YXXA 5IQDA 2X1NA 4NM0A 2YM4A 3V5TA 3FAAA 1XQZA 1TVOA 4S30A 5DMZA 4MEDA 3SD0A 4C62A 3PFYA 3VS7A 4AOIA 2V62A 4PMSA 4CXAA 3E5AA 5D9HA 5ETCA 1DM2A 3FMHA 1H1WA 3IW4A 4BDHA 3BYMA 4FF8A 4LV5A 4OTHA 1UKHA 4DEIA 2WXVA 3NZ0A 4QPAA 4HYSA 3LCKA 4U44A 3RKBA 4JXFA 5E8YA 4XRJA 2C6LA 3F2NA 4XRLA 5JGDA 2PZRA 4WKQA 1YQJA 2W05A 2XMYA 4UWYA 1PKDA 3R7EA 4AWIA 1Q97A 2CGWA 2HIWA 4RIXA 3Q2JA 2HY0A 4LI5A 3C50A 3Q60A 2JITA 5M4IA 2GQSA 5FXSA 4KS7A 3C4WA 3PUFC 1Q8UA 2NPQA 2IW8A 3VBQA 3OD6X 3MVLA 4G3FA 4FC0A 4ASXA 1UU7A 3QZGA 3QCXA 3JVRA 5GZ8A 1ZRZA 3ZSGA 2IVVA 4QMTA 1JQHA 4HZRA 3FMDA 3HLLA 3PLAE 4FX3A 4OTWA 4PPCA 1H26A 2OZAB 2HOGA 3AT4A 3F7ZA 4FL2A 4FT0A 3COKA 2X8EA 3R1NA 5FDXA 2PUUA 5LVNA 4JVGA 4JI9A 5GINE 4RX5A 4YNEA 3JY9A 2ZMDA 5CSHA 1OKYA 2V7OA 4M66A 4RFYA 4UWBA 5ANKA 1YI6A 3QX2A 3ZLYA 5G6VA 4EQMA 3ETAA 2XK9A 1OKVA 2A0CX 3UTOA 4FG9A 4IZAA 1U5RA 5CXZA 3O96A 3V5QA 4GG7A 3FMNA 5CEOA 4KBKA 2W1DA 4YP8A 1Q8TA 4BIBA 4QP9A 4YPDA 4ZJIA 4QDEA 4TWCA 1U54A 4K2RA 1F3MC 1XMLA 4RJ3A 4QMXA 4A9YA 1O6YA 1B39A 1REKA 2JBPA 3PZEA 5CF5A 3CD8A 3ULIA 4GH2A 2OJGA 2R3NA 3O71A 1OBGA 3W10A 3MH1A 4RBLA 2ESMA 2G2IA 4O0VA 4LRMA 2I40A 5EK7A 4R7HA 1DAYA 2XA4A 2A19B 2CGXA 5E8UA 4D2SA 4E6QA 3T8OA 3U6IA 4DBXA 1YOJA 4JJRA 4O6EA 3TNWA 3AKKA 1O6KA 5DNRA 5HE0A 4XHKB 1H27A 4FKQA 4K8AA 5JZJA 4TN6A 2ZMCA 4XG2A 4G16A 5AM6A 1XBCA 5EI6A 4QEBA 3JS2A 3G51A 3S1HA 3MA6A 3ZFMA 2WB8A 3P9JA 3R8VA 2IZTA 3FQEA 4AW2A 3TNIA 4DC2A 4Z7GA 3MIYA 3SOCA 3U4WA 2UW5A 3A4PA 3PUPA 4O38A 3OTUA 2HENA 3BWFA 1H8FA 3RI1A 5FXQA 5FGKA 5CEIA 4E5WA 5KMLA 4AXDA 4U79A 1Y6AA 3QD2B 2CGVA 3I79A 2BZKB 3MFSA 3POZA 4GRBA 3VBWA 5EYCA 5HE1A 4BWPA 3EQIA 1W83A 5C26A 5GZAA 4E20A 2OI4X 2HWOA 2JAVA 4KIKA 5CAOA 5I9XA 3DJ6A 3C4EA 3KMWA 3LFNA 2F7EE 3A4OX 2CCHA 4ANMA 1UNGA 2C30A 4MX9A 3W0NA 4F7SA 3G9LX 4FTNA 4QMVA 4QP7A 4RFZA 4MUQA 1URWA 5L8JA 2B9JA 2QCSA 4I6HA 2HZIA 4O7WA 3EFJA 4HJOA 4DITA 4J7BA 4J52A 4Z16A 2ZM4A 1M14A 5IH6A 5A4LA 5HICA 1K2PA 3ANRA 4DHFA 3HAVA 4CV9A 4IANA 3R7IA 4YTCA 4I6FA 4HPUE 4QOXA 4WIHA 4BCHA 2ITOA 3O7LD 4NCTC 3HMNA 5CEKA 1Z5MA 5CAVA 4ASZA 4C37A 3NS9A 4XH6A 2R3KA 1ZYCA 2QHMA 4PTCA 1KSWA 2GNJA 3D0EA 2C5YA 3LQ8A 3NYNA 3V8WA 4AX8A 4BI2A 4F64A 4CD0A 2PUIA 4FZ7A 5A4EA 1OIYA 3EIDA 3LJ2A 3O2MA 2HWPA 4QP3A 3GU6A 2PVFA 4MAOA 4CT2A 1DS5A 3D7ZA 2BRBA 2HAKA 3ZCLA 5JFXA 3ZM9A 1WBTA 3EQDA 5CSPA 4X6QC 3EZRA 3PY3A 2R5TA 3BCEA 5T68A 4FG8A 4E1ZA 4ZZNA 4DDIA 4BJJB 3MPTA 2EWAA 1V0PA 3HMPA 2XF0A 3LPBA 4RJ7A 4IAKA 4C2WA 4F63A 4YJSA 4K11A 2V22A 1OGYA 3QQJA 2BKZA 3FKLA 3FLSA 3HUCA 4C61A 2ZB1A 3SDJA 3WE8A 3AXWA 4I0TA 3HA6A 2CKEA 5HD7A 3GFEA 4C58A 2VTRA 4UEUA 5IA2A 3DQWA 3QZIA 5HBHA 2C1BA 3FLZA 1ZOEA 3VBXA 5C01A 2H6DA 4C59A 3FV8A 5AUTA 3SG8A 5AP5A 4ZLOA 1S9JA 4QMZA 2BHEA 2JFLA 3GCVA 3QD3A 4YC8A 5BNJA 3SVVA 3DA6A 4DHZA 3EOCA 5CVHA 2W5HA 4RWLA 5FM3A 4C3RA 3WZUA 4M69B 3R21A 1H1SA 4GG5A 4NCTA 4WO5A 3ZTXA 4UMTA 4B9DA 3GB2A 4RPVA 5IQFA 2AUHA 4DEGA 4MCVA 2W1HA 4RLKA 2OGVA 3IG7A 4I3ZA 4XG8A 3NX8A 5EDRA 4IDTA 2XKCA 4X2GA 3OXZA 4Y72A 4E4XA 4BY9E 3FE3A 3MIAA 1U4DA 5EYMA 5HCZA 1NXKA 1KV1A 2ZM1A 4IIRA 4E4NA 1W98A 4IAYA 4BKJA 2VUWA 4IEBA 2IVUA 3BWJA 3NSZA 3MY5A 3IW8A 2XYNA 3A7HA 4LGDA 2ETRA 4NFNA 2CMWA 2CSNA 3G90X 1JPAA 1V0OA 5EH0A 4OTIA 1L8TA 3F6XA 3IKAA 4BIEA 3OOGA 5FEEA 1H25A 2WPAA 3ZLWA 4E8AA 3E64A 4I6BA 4ALUA 4A4XA 5EDPA 1RW8A 2C6MA 3Q2MA 2GQGA 4DGNA 4OBPA 5E8WA 1CM8A 3R9OA 4RFMA 4FIGA 3CQEA 4X2KA 4KRCA 4PWNA 4B0GA 4BBMA 4CTCA 3GQLA 5EHLA 4D4VA 4U97A 5EI2A 3OXIA 5IA5A 3CTHA 4MH7A 5ETAA 4AU8A 3R9NA 4ZZOA 3UNKA 3Q5IA 3F3UA 4U3YA 5E1SA 4BDBA 3CLYA 4BHNA 4D28A 2E9UA 4L9IA 3KN5A 3IDBA 5HX8A 1O9UA 2ZAZA 2PPQA 1FMOE 3EQHA 4W9XA 3IS5A 3OT8A 3GFWA 3NRMA 2GS7A 1DAWA 3L8VA 2E9OA 4O6LA 1K3AA 5AAGA 4ZJJA 3LMGA 5J79A 4A7CA 2X2LA 3KCFA 3QTIA 5I5ZA 3TKHA 3FKNA 4NM5A 4CFWA 4ZY4A 4CRLA 4RIWB 5HTIA 3LFSA 2OSCA 3MW1A 5E8XA 4AGCA 2UUEA 5HESA 3NGAA 5H8GA 2V55A 3GU7A 1NT2A 4IM3A 4A9TA 4XV9A 2V7AA 5AJQA 4NUSA 4G9RA 3UQGA 4B4LA 2PL0A 4WNKA 4GU6A 5KHXA 3R6XA 3FXWA 3WE4A 4BICA 4RX8A 4NK9A 2BIYA 2Y6MA 2VX0A 3ZS5A 2JIIA 4GK3A 2XM8A 2UZUE 4D4YA 4MNFA 2OH0E 2RFEA 4TZRA 3DNEA 4KABA 4FKOA 4JOAA 5FD2A 3IDPA 2RFSA 4NIFB 3R9DA 5KNJA 4IXPA 5HNIX 3FMEA 3ET7A 4NKSA 4QMOA 4D2VA 4EH9A 5J95A 3PIXA 3HVCA 5AM7A 3WIKA 3A99A 3BELA 3DZOA 4WBBB 1J7LA 2FH9A 3Q9YA 3NW6A 4ACHA 2BRGA 1FVRA 4EZ5A 1MQBA 3KA0A 4DF3A 3PA5A 3EQGA 3LCSA 4D1ZA 3MN3A 4FSWA 4QQJA 3UDTA 4GJ2A 1BL7A 3UC4A 1XO2B 1ZZ2A 4DG3E 3KRXA 3ZXZA 4NU1A 4ZTSA 3ORPA 4C2VA 5E9EA 2IW6A 4Q5HA 4FICA 3R9HA 5DR9A 4D2WA 4AXAA 4R8QA 5C1QB 2YM7A 2ZYBA 3GP0A 4MXXA 4IVDA 4ITHA 4JRVA 4E7WA 4FT9A 3W0PA 4M97A 4IHPA 3G2FA 1PXPA 3DT1A 5DH3A 4GL9A 5HO8A 1R1WA 3DBQA 2OZAA 5LWMA 4CFUA 4BTJA 3Q9ZA 3P7AA 1OBDA 2C6KA 2A4LA 1SVEA 1PJKA 2ZVAA 3KF4A 3O51A 4M14A 3W18A 1YW2A 2C5VA 2BR1A 3O8TA 3LFCA 1SMHA 1Y91A 5AUZA 3VNTA 3P4KA 1HCLA 4XP2A 1NA7A 2QO7A 3R2YA 1F0QA 3LE6A 3LXPA 2J50A 4L43A 4YSMA 3VHEA 4C4FA 1ZYDA 5AR5A 1H08A 4MBLA 1UNHA 4GFGA 3AMAA 4CG9A 3EL7A 3MB6A 5FBOA 1WBVA 2ZM3A 1RE8A 3TXOA 2J0MB 2PVKA 4QYGA 5I0BA 3CGFA 3P78A 4YJRA 2HW7A 2C6IA 4OTQA 4RJ6A 3FQHA 3ZO4A 3GC8A 2W1IA 5KMMA 3BHHA 3E93A 3QUEA 4AN9A 2BIKB 2YLFA 4K18A 2IO6A 2BFYA 4AE6A 1JNKA 4OT5A 3CY2A 3DFAA 2I0HA 2QOBA 1P2AA 5DRDA 2UW4A 4G6LA 3HMIA 3IDCA 5HNGA 3ZUTA 2X8DA 3V6RA 4OBQA 3FHIA 2OIBA 4KSPA 3WZEA 2YZLA 2ITVA 3MTLA 5IA3A 4C34A 4H39A 2UW9A 3OHTA 5FTGA 4C36A 2UZLA 3WF6A 4QP6A 2R3GA 3ENHA 1SVHA 3OROA 4IZYA 4G6OA 4IWQA 4AGDA 4WG5A 1IA8A 4ERKA 2OJFE 3NVMB 2UZOA 3EN9A 1Q24A 5BYLA 3NAYA 4O7TA 2C5NA 4P4CA 3UMWA 5AR7A 5ANEA 2EVAA 5HVYA 5KKRB 2PZIA 4B7TA 1YXSA 5F94A 2XEZA 3OT3A 2GTNA 4IFGA 4KBCA 5HO6A 2Z7SA 3S4QA 4R7BA 4TYGA 3R1SA 4ZS0A 3OUKA 3COIA 3TT0A 3NUSA 5I9YA 2IZRA 3GOKA 1L3RE 5HZNA 5HTBA 5B7VA 2JGZA 3VN9A 5AA8A 1XBBA 4G2FA 3MESA 4NFMA 5AV0A 5AP0A 4LOPA 3P5JC 3AT3A 4Q2AA 4A9RA 3OBGA 2ERZE 4PMPA 4IZ7A 2QU5A 2V5QA 3DKCA 5T3QA 2ZV2A 4UMRA 3NAXA 2Y4PA 3Q3BA 2VTNA 4DH8A 3U51A 5CEQA 3KK8A 2KTYA 3LOKA 5HGIA 1CSNA 4RVKA 3ZHPC 5JKGA