5LVOA

Human pdk1 kinase domain in complex with allosteric compound pse10 bound to the pif-pocket
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
286
structure length
285
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 285
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvoA01
1U5QA 3LMHA 4O7SA 4MHAA 4XG6A 4H1MA 4IZAA 1PW2A 4QMWA 5HE0A 3TV6A 1FMKA 4TWNA 1JWHA 4D4SA 5FUTA 1ZYLA 3BHVA 3FKLA 4WNKA 4BI0A 3RK5A 3OOMA 3EQCA 3O8UA 3O8TA 4DEGA 1G8SA 3KMWA 1CKIA 5JQ8A 4GRBA 2OG8A 2XYUA 1B38A 3IW4A 4TRLA 3P23A 1KE7A 3RNYA 3FQSA 4AQCA 1OECA 2V7OA 2WQBA 3ROYA 4FVRA 4BCKA 2JIIA 3D0EA 3ZRMA 3WYYA 3QAME 5CS6A 3ITZA 4WRSA 3WYXA 4F7JA 4FGBA 4WIHA 3UZPA 2CN5A 3UPXA 3W1FA 2X9EA 3WF5A 5CT0A 5AV2A 4ZOGA 3NYXA 4ZXTA 1ZYJA 2JAMA 3BQCA 1YDSE 3EQBA 3EQFA 2NPQA 1FBNA 4BCGA 4IX4A 4YURA 1YOLA 5LVNA 1M2RA 3A62A 5HICA 1AD5A 2GFSA 2XIXA 4KSPA 3ZRKA 3HL7A 3R7IA 2E9UA 3EL7A 1KV2A 5C26A 4J52A 1FPUA 2X4ZA 3AT3A 3H9FA 4RA5A 4YZMA 3RBWA 3I79A 4KIKA 4RPVA 3FLQA 2W99B 3R9RA 3AC4A 4A9TA 4ZP5A 4D9UA 3V6SA 4AW2A 4ZJIA 2PZ5A 3UYSA 2O5KA 4YJRA 2O3PA 4KRCA 3UIUA 3R9DA 3VW8A 2C5OA 2B7AA 2ZVAA 4YC3A 1PMVA 4LM5A 3DXNA 3QD3A 4V01A 4QMTA 4DFXE 5ETIA 4DFYA 3T3UA 5ICPA 4S32A 3TCPA 4XS2A 1YI4A 4I21A 3HV7A 4E8AA 4RIYA 3B8RA 4UALA 3BRBA 3U4UA 3L8VA 2JEDA 3SRVA 3KMMA 2RG5A 3NNUA 4H3BA 4YJOA 2YCSA 1LUFA 2J9MA 4BGHA 3MGYA 4I6QA 4IVDA 2GTMA 3QTIA 4IB1A 4RC3A 2XK9A 3QRUA 3G6HA 4CFXA 4OBOA 4WA9A 4R1VA 4ZTLA 4DG3E 1X8BA 4YGAA 5TR6A 3W18A 1CSNA 3VW6A 3RCJA 2WQEA 3PP0A 3UOLA 3NUYA 2OJJA 1WZYA 2XZSA 3OW4A 4HYSA 4EC9A 4N6ZA 3N4UA 3L8SA 1UWHA 1REKA 1BL7A 2YCRA 4B4LA 3DNEA 4CNHA 3KVXA 3BE9A 3C51A 3CD3A 2BAKA 4DE4A 2XJ1A 4QP2A 5LJJA 3HV3A 2WU7A 2ITZA 3BGQA 4I4FA 5HQ0A 2OICA 4A7CA 2VX0A 4NIFB 3L9NA 3TIYA 3ZBXA 4YMJA 3UQCA 4L52A 3NNXA 1Z5MA 2IVTA 3PWYA 2GHMA 5JKGA 3KQ7A 2C3KA 3O23A 4QMPA 3MTLA 5JK3A 4USEA 4F6WA 2PMOX 2PUPA 2XNNA 5IUGA 3D2IA 3IKAA 4IM0A 4HJOA 4AF3A 5HD7A 4TNBA 5HE1A 4DFZE 3BYMA 1PKDA 4QT1A 4HVHA 4F9CA 3BYUA 4C2VA 3NYVA 1ZZ2A 5J8IA 5AR5A 1FVRA 4PTGA 4MBJA 1GIHA 2XNMA 3Q96A 4WG4A 2WMSA 3F9NA 3EHAA 4QMSA 2QKWB 4GK4A 4FNZA 2G2IA 5CVHA 3R83A 4BIBA 3F88A 3C5IA 4FEWA 2OIDA 4AOJA 3WARA 4IZ5A 3CTQA 4HGTA 3N51A 4PY1A 3KXZA 4F7SA 4DFNA 4EEVA 4MXYA 4DA5A 4XJ0A 3QZIA 1W84A 4TL0A 2XKCA 3MYGA 2RG6A 3WZJA 4GH2A 4F08A 5BX0A 5J7HA 3FAAA 3PVUA 4NCTC 4NTTA 4E6QA 3OC1A 4Q9SA 5AAEA 3R8LA 3M11A 4AGDA 4BDJA 1YDTE 5E8XA 1A48A 4NTSA 5IQHA 3QHRA 4FSTA 3HP5A 3V04A 4O1PA 3LJ0A 1RE8A 3GQIA 2C6OA 5DFPA 3CS9A 1YWNA 2QCSA 3KK9A 2IW8A 3ZUUA 2XIYA 4RLLA 4ZSGA 2XMYA 4F9YA 2VX3A 4RVKA 3KF7A 5J1VA 2O2UA 4AGCA 4N4SA 5AR8A 4DFUA 5ACBC 5FXQA 3EQGA 3NAXA 2JAVA 3PXZA 1PXPA 2BRGA 2CSNA 4TW9A 3QALE 4FV1A 3LFNA 5IF1A 1CKPA 3RPYA 1TKIA 3OBJA 5DWRA 2R4BA 1IAHA 3WZKA 3VUTA 4MNFA 4YU2A 1OI9A 3Q6UA 4IZ7A 5CU0A 4NM7A 1ZMUA 4RWLA 4BDHA 4C0TA 4D1ZA 4AW5A 3Q5IA 2IG7A 2JD5A 1WMKA 3CPBA 2Q0NA 3R22A 4L01A 4MWHA 3TV7A 4J99A 3WF9A 2ITUA 4YBKA 3HVCA 4BL1A 3CGOA 4LV8A 3G0FA 3UYTA 5A6OA 3ZFMA 5AA8A 4TT7A 4RIXB 3IONA 4HZRA 4LMNA 1JKKA 2ONLC 2IZSA 3NUAA 4GUEA 4ZSLA 4ZTSA 4G6LA 3DB6A 3PRIA 4M12A 1Q8ZA 2GTNA 5HVJA 4KD1A 3VUHA 4ZTHA 4DLJA 2C0TA 3SG8A 4PPAA 4I6FA 4NH1A 4UYNA 3PUPA 2VUWA 5TF9A 2P3GX 4FKSA 4FSMA 5JMSA 2WKMA 5F1ZA 4FTTA 2IW9A 3ZDIA 4D2PA 1ZOEA 5IQGA 3ORPA 4QMXA 1PKGA 5EKOA 3V8TA 2PTKA 3UG1A 4DH5A 4QYGA 3QTQA 2C3JA 3CR0A 4X3JA 3RHKA 2CKOA 4JDJA 4U42A 3QQUA 1TVOA 4L3JA 4RJ4A 3UP7A 1NA7A 4JR3A 2YABA 4HPTE 3F5PA 5DH3A 5HG8A 2PUNA 3BZ3A 5CEMA 2NRYA 5DEWA 3Q9YA 3BQRA 3K2LA 4EOPA 1KE5A 2VWUA 4D4YA 3BHUA 3O96A 5EM8A 5C01A 5LWMA 2GQSA 3Q2JA 3U4WA 1U4DA 1B6CB 4RX7A 5KZ0A 3SDJA 4E3CA 4FKRA 2EU9A 3VRZA 1H0VA 5JT2A 3UC3A 3NNVA 5M4IA 3RWPA 1LEZA 4APPA 4YSMA 4FKIA 3VS1A 4ANNA 4JX7A 2RL5A 4I0TA 3FY2A 4G1WA 5M07A 4CMTA 4FNWA 4A06A 2OI4X 1YXTA 3ZM4A 3D14A 4O0TA 5LVPA 1IRKA 2CJMA 2EVAA 4O7LA 2QO2A 5AP5A 2B55A 2R3RA 2W4KA 2HENA 4FEXA 4OTHA 5IH5A 2JDOA 3F7ZA 2F2UA 3C4XA 3KRJA 4FUXA 3PJCA 5FBOA 3POOA 4DEHA 3HLLA 1QPDA 4EYMA 1OITA 4EOQA 3QGYA 4KIKB 4Y73A 3QTWA 4KWPA 1K2PA 3F5GA 5J9ZA 2AC5A 2PSQA 5LCJA 3RWQA 4DITA 3FXWA 3MY0A 5HIBA 2Z7SA 3MN3A 4X6RA 4FIJA 3WILA 4PWNA 2V55A 3R8VA 4O7YA 2F7EE 3DK6A 4M66A 2CGWA 4L9IA 2VTTA 4EOKA 3T9IA 4F9BA 3PZHA 4FF8A 4RIYB 3PTGA 2WELA 4FIFA 3TJCA 4ALUA 3SRVB 1Q97A 2J5FA 5A46A 1PYXA 2BZHB 2ERKA 2FSLX 4I5HA 1XBCA 2R3QA 2IJMA 2VGPA 4G34A 4CCBA 4AE9A 4QMOA 5J95A 2XNEA 4BBEA 4TY1A 3R9HA 5KMKA 2UZLA 4Y5QA 3DXQA 2VRXA 3PXKA 4EZ5A 4E93A 3TNIA 2GFCA 2R9SA 3FYJX 4LL5A 4GKHA 4XOZA 4PQNA 4YZCA 5J1WA 5BVOA 2Z7QA 5DA3A 4J96A 2C1AA 2JIVA 4DBXA 4UY9A 2A27A 3E7OA 4O2ZA 4ACCA 4AUAA 4OTQA 2GCDA 4YC6A 4JX3A 3EQDA 4IADA 3NLBA 4C57A 3F69A 2HWOA 3LCSA 5AV3A 3T8OA 2I7QA 2UZNA 3G90X 4D2VA 2UW3A 3BE2A 3C9WA 1ZMWA 5E8VA 5H2UA 3Q6WA 2ZV8A 4HGLA 5FTQA 2F9GA 3TZ9A 3N4VA 2H9VA 4FSYA 3DKFA 4ITJA 5HGIA 5EHOA 4K11A 5EFQA 1HCLA 3LXKA 5I0BA 5EYKA 3QZHA 3GU8A 1UVRA 3MVLA 4X2JA 4E4LA 2XKDA 5JRQA 5KKRB 1YDRE 3C1XA 3CD8A 3NPCA 3QCSA 5EOBA 5CASA 2YM4A 3CQUA 5BQ0A 3MB7A 3BKBA 3O71A 3PA4A 2VTQA 1DI9A 4EC8A 5FEDA 4IX6A 4CFNA 4U45A 3ODYX 3D15A 4FKJA 5IDPA 2GS6A 2W0JA 3V6RA 2ZV9A 3VS3A 2F4JA 4GJ2A 2FSTX 3VJOA 3V5QA 4O0RA 3MY5A 1IAJA 1BUHA 3V01A 3Q52A 3HX4A 4CCUA 3LQ8A 4QP9A 4RFMA 4FSUA 4LRKA 2FH9A 3ORLA 4EH6A 3BYVA 3UJGA 3HAMA 4OBQA 5BUJA 4W9WA 4XH6A 2HK5A 4FG8A 3HP2A 4FV7A 3RPVA 4JDKA 1I09A 2JFMA 2QNJA 3F2NA 4MD7E 2ITYA 5IPJA 4FVQA 2X6DA 3M1SA 4LOQA 5DRDA 5JSMA 3DDQA 4PMSA 5HE3A 3HV6A 3PDTA 4M68A 4JNWA 4EWHA 2OJGA 1SNXA 2QODA 3O7LB 3O8PA 4F7NA 1H1PA 3OXIA 2ZM4A 4AA0A 1WBVA 4IIRA 1YI3A 2ZM1A 2UW0A 1ERKA 4TYGA 3ULIA 1CMKE 1LPUA 4AZSA 3KXMA 4RX9A 5EKNA 2VTOA 2J51A 1NY3A 2VTJA 3C0HA 3DFCB 4NM0A 4EKKA 3F7WA 4CKJA 2PUIA 2XRUA 4F9WA 3B8QA 5T6KA 3RM6A 3AC8A 4KNBA 4AOIA 3NUUA 4X3FA 4RT7A 4DEEA 2ERZE 3NX8A 4I93A 2C6TA 4KINA 2OXYA 3SC1A 1BMKA 2JBPA 4J7BA 3ZH8A 2ZDUA 4EK3A 5HX8A 3R21A 5CEQA 2O63A 2WAJA 4M0ZA 4FSNA 4FTJA 4LRJA 4YPDA 5E90A 3KN5A 3ZLYA 3NAYA 5JQ5A 2C47A 5ANDA 4GFMA 3E92A 4USDA 5JZNA 5HNGA 1GZNA 5AR2A 1M2PA 3H3CA 3PA3A 4FL3A 4P2KA 4FEUA 3CKXA 5HO7A 3VQUA 4C7TA 4EONA 3RAHA 3MJ2A 2QHMA 1PMUA 4A9UA 5KX8A 4CLIA 3ATSA 3SW4A 3IS5A 3Q3BA 3OY3A 1OL7A 2YAKA 3FZOA 4O7NA 3WIKA 4RJ3A 3ACKA 3ZMMA 1H0WA 1Q41A 4ZSAA 3FYKX 5CF6A 4GS6A 1UU8A 4FE2A 4MQ1A 2B9HA 3ZZEA 3ORTA 1GAGA 3DTCA 3R71A 4QP6A 3UVPA 2YAAA 3MPMA 4XNEA 4HYHA 1MRYA 1GIJA 1JBPE 3DLSA 4AT5A 3P0MA 5EM5A 4NFMA 4IACA 4ZZOA 3MFTA 1PY5A 5EDPA 2PPQA 1H1SA 1Y8GA 5GZ9A 1OIUA 3UE4A 4PL4A 3FMKA 5FD2A 2E9OA 5AV1A 5I9WA 5K0XA 3BCEA 2XKFA 4D9TA 4RZWA 3TEIA 4C62A 3OF0A 5JFWA 2H6DA 3WOWA 2YZLA 3KB7A 3ALOA 4IZYA 2XIRA 1UKIA 2RGPA 3CIKA 2UW6A 1Q3WA 5EW8A 4U7ZA 1UU3A 3RCDA 1OPJA 2VWBA 2ZMCA 4P90A 3RNIA 3R63A 4L68A 1JKSA 4ZZMA 2X6EA 1O6KA 1NVQA 1PJKA 4ALWA 5LMAA 1DAWA 2B52A 3HECA 4DG2E 1CTPE 1B39A 5L6PA 4TTHB 3SV0A 2Y4IC 1SVEA 2I6LA 3PJ1A 5FQDC 3JUHA 2I0HA 5EQEA 4C02A 5M4CA 3OZ6A 1KOBA 2J6MA 1JPAA 3ANQA 4QNAA 5KHWA 4G31A 1KE9A 4YZ9A 1E1XA 3AC3A 4JOAA 5HLPA 3U6HA 4RQVA 2PVMA 3R0TA 5CVFA 5AUYA 5GINE 2CKQA 3CGFA 3GCPA 4JIAA 1H28A 4GIIA 4BKJA 2XJ2A 3IQ7A 1F0QA 3MVMA 3KXHA 5KBRA 3TZMA 2R0IA 2YLEA 3WF8A 2IZUA 2HYYA 1H1RA 1S9JA 4BN1A 4XOYA 2WEVA 3AOXA 3ZSIA 4FUYA 1Q8WA 2YEXA 4CLJA 3DGKA 2B9IA 2WMUA 3AC2A 3OOGA 4AW1A 1O9UA 1ZOGA 4TKSA 5CENA 5JZJA 4U81A 5E92A 4RVTA 3JY9A 2EXEA 3ZRLA 1GJOA 3KA0A 3QGWA 4II5A 3RM7A 2PMNX 3HNGA 1M7QA 4EK5A 4KSQA 4AGUA 1APME 4XLIA 4AXAA 5A4QA 5CQWA 2VZ6A 3OMVA 4GEOA 4HCUA 1YKRA 3QWKA 4XMOA 3RAWA 3FXZA 2O8YA 4XCUA 3E5AA 4L3LA 3R1SA 2F49A 4QTDA 1OIRA 2W06A 4ASZA 4O0UA 3DJ5A 4F0GA 4YUQA 1R3CA 2IZRA 1F5QA 4BIEA 2OZAA 2H34A 3FBVA 3GCSA 1OKZA 3LQ5A 4R5SA 1YXUA 5E1EA 5F20A 2VWWA 5CSHA 3REPA 3ZLXA 5CAVA 5CSXA 2EB2A 4C61A 5DPVA 5EDRA 4H39A 4Q5EA 3PJ3A 2W5HA 4YTIA 5T3QA 4BDDA 5JEBA 4L45A 3RAKA 4AT4A 1UU9A 5HCYA 3PY0A 4EK4A 2J0JA 3KFAA 4QP8A 4XX9A 1H25A 2CNVA 5BNJA 1KV1A 2AUHA 1H4LA 5C9CA 2R3LA 4XEYA 3PXQA 3DLZA 2FSMX 5KMOA 4LFIA 3VS6A 4K2RA 2PZRA 4P5QA 4C3PA 4Z55A 2YDJA 3MA3A 1KE6A 3WBLA 4E4MA 3HMNA 3TNHA 2ITOA 4ZY6A 4RIOA 4CV8A 2JIUA 5H9BA 1A9UA 2YCFA 3TKUA 2GHGA 2IVVA 5KMNA 4NT4A 3MH3A 3UDBA 2ETMA 4KRDA 4GV1A 4FIHA 5HIDA 3MH2A 3SW7A 5EI8A 1J7IA 4IVCA 4FKQA 5E8TA 2VWYA 4G9CA 4WUAA 5DE2A 4IAFA 5TE0A 4MKCA 1WAKA 4QQTA 1V0BA 1H1WA 1W7HA 2EWAA 4WKQA 3T9TA 2BRHA 2R3KA 2UZVA 3FI3A 3LFCA 4FZ6A 4LL0A 3ROCA 2IPXA 2Z02A 4Q9ZA 2CCHA 5FXRA 3R7UA 3TUCA 4FBXA 2ACXA 4FGRA 4ALVA 2JGZA 4GL9A 4DH7A 2PWLA 4FTOA 2FVDA 3HA6A 1IASA 2ZDTA 2XK4A 1JKLA 4QMYA 4CTCA 5L6OA 5KNJA 4GVAA 2WO6A 2C6IA 4GJ3A 4TYEA 4WUNA 2YWPA 3GC9A 2HIWA 3QXPA 3EL8A 3OUKA 3FPMA 2NP8A 3QA0A 1RJBA 5AP4A 2CNUA 3BWJA 4X2FA 4FR4A 4X3FB 1OB3A 3K5UA 4LGGA 4ERWA 1OL2A 2YIWA 3CY2A 2B53A 4FOCA 4FKUA 4JG8A 3SXFA 2QOIA 1STCE 2QG5A 4EUTA 1Y91A 3MTFA 3OFMA 4QMMA 5CI6A 3QC9A 3QL8A 4MD8E 4ZZNA 3LVPA 4UYAA 4L3PA 3WF7A 5AUXA 4BCHA 4ZMEA 3R02A 4X21A 3Q4TA 3QYZA 1WVXA 3FY0A 4G16A 4S33A 5TOZA 2Y8OA 3UIMA 3W2SA 4FEVA 5E8YA 2NRUA 3U54A 1OL6A 3D7TB 4YTCA 4BCPA 1Q5KA 3GXLA 4L67A 3QBNA 4EWQA 4C4JA 4G17A 4YBJA 5DMZA 3QX4A 3DB8A 5BVWA 4YPSA 3GB2A 4BBMA 4C4FA 3TM0A 5B0XA 3IOPA 1YWVA 3JS2A 4U6RA 4USFA 3AXWA 2W1ZA 4BTJA 5LVOA 3OT8A 3QLGA 4G3GA 2OK1A 2UW8A 4CFMA 4DINA 2RFEA 3FMDA 4FIGA 2OF2A 4NEUA 5ANEA 4HW7A 2VTLA 4FZAB 4HGSA 3RVGA 4EOLA 4W4XA 3DJ7A 1FVVA 2YLFA 3G33A 3VRYA 3EB0A 2UZTA 1H27A 4EHZA 5M09A 5HTIA 1K9AA 3C5UA 3KXXA 3NMUF 5J7BA 5KMJA 3OCSA 4MQ2A 4C3RA 4BHZA 3MV5A 3BU5A 1OPLA 1FGKA 3L1SA 1JLUE 1RDQE 2OF4A 3MVHA 4ZTNA 3TI1A 4J71A 2XEYA 3U51A 2BCJA 4CFFA 1ZZLA 3BHYA 4TYHA 2YHVA 5DNRA 4FNYA 4YJUA 1YWRA 2P2IA 4DHFA 3VC4A 5CEOA 5LMKC 4HVSA 1JVPP 4QRCA 3C4FA 5HBJA 3W8QA 1BL6A 2BFYA 3KEXA 3ZC5A 3THBA 2GNGA 3FLYA 4GW8A 4G5JA 2YDKA 3NIZA 4BZOA 1OZ1A 3OCGA 3ELJA 4I6BA 3ZM9A 3N4TA 4CKRA 2W1IA 2JLDA 3MJ1A 2IW6A 2VTSA 1YRPA 1UNHA 3ET7A 3BYSA 3P86A 5CU3A 5HG9A 3ALNA 3M42A 5FTOA 4O7TA 3PIZA 3BYOA 2OLCA 2P55A 5GZ8A 4D55A 1R0EA 2UVYA 3UO4A 1ZY4A 4WBBB 4AWIA 3ZYAA 4ENYA 1L8TA 1XBAA 1WBWA 5CT7A 4RJ7A 1XH6A 5H8EA 2YM6A 3EH9A 4GUBA 2KULA 4KIOA 2Q0BA 1PYEA 1G3NA 5AM6A 2ZM3A 1QMZA 4QQJA 3TV4A 3UOKA 4EHEA 4TNDA 3ATTA 5HE2A 3A2CA 4M3QA 4JIKA 3KMUA 5ETFA 4E73A 3ZO1A 4AZWA 3V5JA 4YJSA 4ASXA 1P14A 2OXXA 1T46A 3HMOA 3TN8A 3V51A 2VTIA 5AUUA 1Y8YA 3KRWA 4BDBA 3C4EA 3IGOA 4IC7A 3DZQA 3Q5ZA 2BAQA 5IQAA 4GYGA 3A4OX 3GU6A 5DT3A 2PVYA 4UB7A 5FEQA 5IA0A 4IAZA 4U41A 1O6LA 3QF9A 1L3RE 2G2FA 3MESA 3BBTB 4BDGA 5E8UA 4UMPA 3UZRA 2WMAA 2GS2A 5IZFA 2HWPA 5HTCA 3NUNA 4GK2A 4GYIA 4O7WA 4QTEA 2WOTA 4L7SA 2HW7A 5IH6A 3L9LA 2R3NA 3FI2A 4FT3A 4RIWB 1XH9A 3V5LA 3O51A 4FVPA 1W98A 5ANGA 3DTWA 3R6XA 3MFSA 4QOXA 5AR3A 4YLKA 4FNXA 3FLWA 5FDXA 1R0PA 5LVLA 4S30A 2OZAB 5TT7A 4CEGA 3K54A 1EH4A 2RFNA 3C4CA 4BB4A 3MH0A 5DBXA 4BCMA 1IR3A 4K33A 5I9YA 3A7HA 3FZTA 2XK3A 4M84A 5AR4A 4D28A 2HXLA 4LGHA 4ZAUA 1XWSA 3LFBA 4ZTRA 5KUPA 2YN8A 3R30A 4OTGA 2I0VA 3TDWA 4CG8A 2OJIA 3VS5A 3TG1A 5HCXA 4C38A 4M15A 2WTJA 2RF9A 4LUDA 3ZO4A 4FKPA 2HELA 3KK8A 2AC3A 4TWPA 3VNTA 2GSFA 3A7IA 3RZBA 3T3VA 3F66A 4O81A 2VTNA 2PHKA 4OTPA 4H58A 3D5WA 4DGNA 2XK7A 3ZC6A 4IH8A 4ASDA 4CD0A 2XUUA 2QR8A 3CQWA 5DT0A 2C5VA 1MRUA 2XA4A 4DG0E 4PDSA 2CNQA 5CXZA 1FQ1B 2REIA 5I9ZA 4W4VA 5EHLA 3GC8A 4ZJVA 3QKLA 3W2RA 3S1HA 3ORIA 1QL6A 2HZ0A 1REJA 2Y6OA 3I6UA 4XV1A 2PVRA 2WQOA 3TTIA 1G8AA 1U54A 5CU4A 2VGOA 4R77A 4G3DA 4AZEA 1J7UA 4OLIA 4BGGA 3UQGA 4EUUA 3UVQA 2WMWA 3CKWA 4MH7A 4FKGA 2ZB0A 4ANMA 3S00A 4JAIA 4PRJA 3CLYA 1SYKA 2IN6A 4ANQA 4GT5A 1AGWA 3NDMA 4RWKA 4ACDA 4MK0A 4Z9LA 1U5RA 1J3HA 2O64A 4HGEA 3ZTXA 2WIHA 4EK6A 4KB8A 5L2IA 1S9IA 3MIYA 2VD5A 1J1BA 2Y0AA 3PPZA 4LMUA 4EZ7A 5B2MA 3H30A 2X81A 3QRTA 4I5CA 4QMLA 5I3RA 3ZONA 4YO6A 2G9XA 4BRXA 4KA3A 4JVGA 4E5AX 3CTHA 2J90A 1YXXA 3R7EA 3VULA 4YO4A 2OZOA 3OT3A 1R78A 3DJ6A 1XH4A 1KWPA 2PUUA 5CEKA 4FYNA 2XS0A 3MPAA 4RLKA 2OBJA 2B0QA 4D1XA 3FHIA 4J53A 5ACKA 3Q9XA 4ZSEA 4MVFA 4O21A 3GVUA 4YJQA 2FUMA 4AP7A 4UXLA 4ZMFA 1U59A 4MXZA 3TIZA 4WSQA 3MS9A 3IGGA 3PY1A 5I9UA 3DQWA 3IG7A 3ZXTA 4IW0A 2GNIA 4YJPA 1VZOA 3OVVA 2CGUA 1J1CA 1VYZA 1JAMA 5J9LA 2PY3A 2WQMA 4FTAA 4LOOA 2QLQA 4B99A 2R7BA 4EOJA 4H05A 2W5AA 2XBJA 4QMVA 3C4WA 4ZS0A 4UWBA 4OAVB 3LCOA 2ETRA 3MVJA 3N9XA 4JAJA 4YJTA 1OVEA 3AG9A 2XNPA 2UZWE 3GQLA 5CLPA 3BPRA 3DAKA 5TKDA 3UIBA 5BVNA 4GT4A 5M55A 3SG9A 1DAYA 1Q8YA 3QRIA 3BWFA 2I40A 4L7FA 2QLUA 3I6WA 4AFJA 3FHRA 3HYHA 4PP9A 2XM9A 4TYHB 3BHTA 4IHPA 4KBCA 5HO8A 5JH6A 4I1ZA 4EK8A 5IA2A 1VYWA 5EI2A 4AGWA 5FBNC 4O91A 3AMAA 3E87A 1W8CA 3BEAA 5A6NA 1W82A 5E4HA 5LOHA 5AFVA 1KUTA 2IVUA 3BV2A 3NZ0A 2BDWA 5AUVA 4IANA 4B7TA 3NCGA 5IISA 5L8KA 4U44A 5C1QB 3O50A 3KXGA 3F2AA 3LM0A 2VU3A 4J98A 4J8MA 3MPTA 1XQZA 4XV3A 4ZTQA 3RHXA 4XV9A 3C0GA 3OHTA 5ITAA 1SM2A 3E93A 4D2RA 5CF4A 3EKKA 4QTBA 4E6AA 1RQQA 5JFSA 2VWIA 3R7GA 5IEXA 3VF9A 4DF3A 2P33A 4YHJA 2YM5A 2FB8A 5LCKA 2ZYBA 3A7GA 4NJ3A 3TT0A 3UBDA 3AD6A 1ZXEA 2HZ4A 4YNOA 3AT2A 2R3IA 1LP4A 1OKVA 1Q24A 1U46A 1OUYA 2F7XE 3LOKA 3NS9A 4RJ6A 5DRBA 4L44A 3ZXZA 4EBWA 4N6YA 1V1KA 3CCNA 4FG7A 4PL3A 2PULA 1UNGA 4JT3A 3FC2A 3KCKA 3V3VA 4AN3A 3OWPA 4NFNA 4D0XA 2WXVA 3EQHA 3ORMA 4UZHA 4FK6A 3GU5A 3R1YA 4FOBA 4FZFB 4ZY4A 2NNWB 5HG7A 2IZTA 3DDPA 4NSTA 1FGIA 1QPEA 4PNIA 1VEBA 2OJFE 3FZRA 1YW2A 2W9ZB 2HZIA 5ANIA 3KGAA 3HA8A 4FSQA 4ITIA 5ETAA 5L4QA 1DM2A 2FSOX 3DCVA 4Y85A 2WOUA 3WZUA 3TUDA 4GKIA 2YFXA 3CBLA 3IDCA 3HAVA 3EYHA 3VF8A 5AADA 5F9EA 3H9OA 4EBVA 3CJFA 3HRBA 3SQQA 3WI6A 3F3TA 3GC0A 3E8DA 3GU7A 3NW5A 2I1MA 4JL9A 4Q5HA 3NVKI 2YWVA 1P4OA 1ZMVA 2ETKA 2X39A 4CZUA 2G01A 5A14A 5M4FA 5FGKA 1DI8A 5DG5A 2R3OA 3EN4A 1QPJA 2XYNA 5E7RA 3PG1A 4TYIA 4FKWA 1OBDA 4WG3A 4NM5A 3QQGA 3V5PA 3SA0A 3CSVA 3FLNC 1E9HA 1WCCA 4FX3A 4XRLA 4EKLA 4L53A 3U55A 4R5YA 4FT7A 4ZIMA 3DY7A 5KHXA 3KRLA 1LR4A 1PF8A 5HX6A 3D83A 4Z7GA 2WU6A 1PMNA 4FV0A 5LMKA 3PVWA 5EYDA 1OL1A 5DI1A 4UMRA 2PE0A 4DEDA 4FT5A 5IEYA 5K5XA 2OJ9A 4IQ6A 4RC2A 3FMHA 5BUIA 4RA4A 2CGXA 4C59A 5L3AA 1Q3DA 3QQJA 3PSBA 2BFXA 2J0MB 2JDTA 4NZWB 3ZO3A 5FXSA 2BROA 4DGLC 1PXLA 3S95A 3R73A 3UTOA 1WBOA 4DEAA 3IW7A 3TNPC 2GMXA 5EK7A 1PMEA 5DGZA 1XR1A 1P4FA 2VNWA 1VJYA 3R7OA 5CSVA 5D41A 4ACGA 1M7NA 2OIQA 5JFXA 4FV9A 4BCOA 4Y72A 1U54B 4ANLA 2BRNA 4C58A 2XH5A 5EM7A 4D5KA 1YHWA 3VS4A 4MXCA 2BKZA 1V0PA 4OT6A 2VTMA 5D9HA 4W4WA 4WT6A 1UA2A 3BEGA 1MRVA 5I9VA 4GU9A 3VS0A 3PPKA 4FEQA 4PX6A 2PZPA 2ITNA 2UZOA 3QQKA 3UNJA 4O0WA 3H10A 3I5NA 4C35A 4F0FA 3LCDA 2WNTA 1NVRA 1GNGA 3FJQE 4GSBA 3L9PA 2X4FA 3W2CA 3HMPA 2HY81 2HY0A 3OCTA 5FWKK 5IA4A 4HYUA 1ZWSA 4FIIA 3W32A 2WTCA 3JYAA 1MQ4A 2IVSA 3QTRA 4GK3A 3COKA 5A3XA 3LCKA 3ZEWA 4AN2A 2J4ZA 4B9DA 3EQRA 2YCQA 4CRSA 4NW5A 5DT4A 3VBYA 3DBQA 4QMNA 2Z60A 3E64A 4Z7HA 3QD0A 5CEPA 3QD2B 3TZ7A 4BCQA 3FZSA 2WMRA 2ITVA 2RKUA 3P9JA 4I4EA 2V7AA 3IDPA 4UV0A 4BYIA 4C36A 3WE8A 3F2RA 5J79A 3EFWA 2WTVA 5EW3A 2JKQA 5C8MA 2BALA 4FKTA 2CDZA 4LG4A 4A4OA 4AZVA 5AMNA 4N0SA 4E1ZA 4BDAA 2C6KA 2WTKB 4A4LA 4C4GA 1UU7A 2VO0A 3U9CA 3I7BA 4MXOA 4W9XA 4QMQA 3CP9A 3G9LX 5F4NA 4XHKB 3D5XA 3ODZX 4KKEA 3P78A 3OWLA 2OFUA 4LGDA 2JKKA 5I5ZA 2LGCA 4E20A 5A54A 4N70A 2Z8CA 4CZYB 3G9NA 3TNWA 2B1PA 4YZNA 4BF2A 4CT1A 4CQEA 5GZAA 4RG0A 1TQIA 4NCTA 5KKRC 4HPUE 2OH0E 1GZKA 2BR1A 3PYYA 1URWA 4QO9A 4NL0A 2QQ7A 2PYWA 4MNEA 1ND4A 3PLAE 2W1HA 4ACHA 3BU6A 1MUOA 4IAYA 5FP5A 5HLWA 5HCZA 2DWBA 1KE8A 3LM5A 4FODA 4M13A 4H3QA 4Y46A 1V0OA 3M2WA 4B6LA 2UW7A 1GIIA 3K3IA 4O0SA 5A9UA 4GFGA 4E6CA 5CF8A 1HOWA 4X2GA 3LLAA 5M08A 2WHBA 2ZV7A 4O6EA 4MYGA 4DGMA 4BZNA 4BCFA 1ATPE 3D5UA 4HCTA 4YP8A 2R3FA 4BTFA 1UKHA 4ZK5A 4AS0A 4CFVA 1Q8UA 3DKOA 5IUIA 3R9OA 4PMPA 2X9FA 4AOTA 5AA9A 5BYLA 3NUPA 1JSVA 3NYNA 4JXFA 2PZYA 3EIDA 1Q61A 4PF4A 5HNBA 3SXSA 4BY9E 3PG3A 2BMCA 4G6OA 2J0KA 2V0DA 3CJGA 1F3MC 2OWBA 1WBTA 2BTRA 3LFDA 3NIEA 4S34A 4QTAA 4JS8A 5KE0A 3UO5A 3CPCA 4X7QA 3IOKA 2Q83A 3LZBA 3LMGA 4ZLZA 5A4TA 1YOJA 3Q4UA 3QUEA 4UMUA 4KKGA 2JFLA 3OCBA 3QZFA 3NEWA 5IMEA 2R3GA 4XP3A 3DPKA 2H96A 3F3ZA 3VUDA 2ONLA 5IA3A 5HG5A 3UC4A 4RVLA 3VWAA 4FL2A 5GJFA 4DEBA 4BICA 2E2BA 2QOQA 5CANA 2RFDA 5HIEA 3QFVA 3FXXA 3GI3A 3GUBA 2QD9A 3A99A 3OTVA 4IXPA 4AA5A 3C0IA 4QYYA 4EH5A 2J5EA 5LARA 4CQGA 2R64A 4G3CA 4I22A 3LXPA 2UZBA 2XK6A 2BRBA 5AUWA 3TZ8A 4EH3A 3QTUA 3AD4A 2QO7A 3HEGA 3DT1A 2QKRA 4W8DA 3RTPA 3E88A 3VVHA 5CF5A 1UV5A 4DH1A 4JR7A 1ZLTA 3NCZA 4WSYA 1WBSA 4UEUA 3OROA 5JN2A 4JJRA 2B9FA 5I9XA 3NYOA 5M56A 1OGUA 3KN6A 4FKOA 3LLTA 3BLQA 2VV9A 4MBIA 3SX9A 3OXTA 4J95A 1H08A 3W2QA 4U97A 4JG6A 5M57A 2R3HA 4ANSA 1Y6AA 3EFKA 5CQUA 2BZJA 5EYMA 5CSWA 4DCEA 3HZTA 1OL5A 2VN9A 4YNEA 1JKTA 3P1AA 4UX9A 5IQBA 5D1JA 5AJQA 1FOTA 2PVKA 2QONA 3L8XA 2IWIA 5E8WA 1I44A 4XLVA 3VUKA 4C4EA 3A7JA 4I92A 3EZVA 1XKKA 4WNPA 3PXRA 4M97A 4JG7A 2J7TA 1KOAA 4DYMA 3P7CA 4U40A 4WO5A 4BI1A 3TKHA 4RFZA 2GHLA 4D2SA 2W1EA 3HDNA 1TQMA 4FI1A 1H24A 4ITHA 3KVWA 5J9YA 2ZV2A 4Y8DA 2C68A 3LKMA 3DS6A 4O0YA 5DLSA 5DOSA 3A61A 5M44A 3E63A 2WMQA 4GT3A 2WTDA 4RWIA 4XG4A 4KUJA 5CSPA 4ANOA 5L2WA 3RINA 4FTIA 4F1TA 5E8ZA 4E7WA 4BWPA 4EH4A 1XHAA 3DKGA 3FQHA 3OEFX 2E9VA 1R39A 3AD5A 3ZLSA 2ITQA 2JKMA 3AT4A 1MQBA 3VN9A 1PRYA 5K3YA 4C34A 3FL5A 3KCFA 3KXNA 1M52A 5EH0A 3EN6A 3R8PA 3RKBA 5CAQA 4ACMA 4EH2A 3BELA 4Y95A 3VUMA 3ZFYA 3GEQA 3KU2A 4I41A 4WD5A 4F99A 4PL5A 3VUGA 2VTPA 4BKZA 4CKIA 2GU8A 5HEZA 3LE6A 5AWMA 3IPHA 5KMLA 4XBUA 4AZTA 5HOAA 3VHEA 1AQ1A 2X1NA 3AMYA 4CTBA 2F7ZE 4EQMA 2GS7A 4QYHA 1IG1A 3CXWA 5HU3A 4JDIA 2W1FA 2WQNA 5FRIA 5EG3A 4FC0A 4OT5A 4GG5A 4RBLA 2R0UA 5KZIA 3C13A 3FEGA 1ZRZA 1J91A 3VHKA 4PNKA 4MBLA 4MEDA 4Y5HA 3QKKA 2XP2A 2HOGA 5HORA 4D2WA 2X7OA 3DK3A 2HXQA 4TWOA 4O7ZA 2YDIA 5LWNA 3MW1A 4HZSA 4O7VA 3TNQB 2VAGA 4O82A 2OXDA 3F3VA 2FA2A 5HBEA 4YSJA 3RPOA 4APCA 2WMTA 3I81A 4PPBA 4QD6A 2OIBA 3ZCLA 1SVGA 1OM1A 4C4HA 4D1SA 3DFAA 2WMVA 3II5A 4FV5A 4OW8A 4GVJA 4ZEGA 4YJVA 3QTSA 4C3FA 3VBXA 4CYJA 4RX5A 1XH8A 4DTKA 3JR1A 2YIRA 2O0UA 4KABA 1H1QA 3U8WA 2BIKB 3S4QA 1HCKA 4FTRA 5EM6A 2CN8A 4FTQA 3FMJA 4V0GA 2CCIA 4F9AA 3FZPA 3RK7A 4F4PA 4FZ7A 5CALA 4O83A 3QCXA 1T45A 3Q4CA 4DC2A 4C4IA 2XRWA 4UBAA 1ZYCA 2QOOA 1P5EA 2WMBA 4FV3A 5AAGA 4NWMA 4P7EA 3LFFA 3QZGA 1ZYDA 1YXVA 5AP1A 5AM7A 1NT2A 2FO0A 3OD6X 4UMQA 5DEYA 3FMEA 4BDEA 2OFVA 4FICA 4EQCA 2C3IB 1SMHA 4OBPA 2JKOA 3IK3A 1KSWA 3ORZA 3MIAA 4FZDB 3ZLWA 3PSCA 5CZIA 2WTWA 5GIOE 2EUFB 5ANJA 3O2MA 4R3PA 4I94A 5CTPA 3ZHPC 2YM3A 4ZY5A 1NW1A 5CAUA 2NO3A 4EL9A 4IMYA 4EOIA 4K0YA 4LOPA 3IW6A 4O96A 2C0IA 3LPBA 3OG7A 2XJ0A 3PFQA 5BPYA 5LXMA 2JDVA 2PVFA 3DBDA 4X6QC 4F6UA 3BI6A 1OUKA 1W83A 2V62A 3F6XA 3R28A 3A4PA 4IWPA 4MNEB 3DXPA 4PDPA 3GP0A 2Y6MA 2YACA 3PSDA 4L8MA 2O65A 3QD4A 4U9AA 2DQ7X 2X2KA 3NUSA 3LXLA 1QCFA 2RFSA 2W5BA 3ZSHA 5C8NA 5JGDA 4RMZA 5CNOA 4CFWA 4D58A 2YM7A 5CVGA 3ZBFA 2J2IB 5DHJA 4H1JA 4GG7A 2WD1A 5C03A 1JQHA 5EDQA 4S2ZA 2UVZA 1LEWA 4TZRA 3KRRA 4BI2A 3QQFA 4D5HA 4IWOA 3FL4A 4A9SA 5BUEA 3JXWA 5EOLA 3GBZA 5L8LA 3TJDA 4OTWA 4IWDA 4QNYA 5L8JA 3EN7A 3GCQA 3B2WA 3FLZA 3PP1A 4M8TA 3NR9A 3EZRA 5KCVA 3LHJA 4RWJA 2X0GA 2WEIA 3COHA 3H4JA 4FTNA 4HYIA 5EHYA 1CDKA 4EOMA 5C8KA 2Z7RA 3TL8A 3LFQA 2VO6A 3GNIB 3TTJA 5EQPA 5A4LA 3V8SA 4PDYA 1IA8A 4DT9A 4IAIA 3RPSA 2Z7LA 2GQGA 4J97A 3R7YA 3VUIA 4U3ZA 3NNWA 3RGFA 3QA8A 4YHFA 5HVYA 3VQHA 3R04A 4BWKA 4QP3A 2QOLA 4FG9A 1H01A 1OPKA 4W4YA 5BYYA 3A8WA 3FDNA 3SVVA 4CV9A 3F3UA 1BI8A 1P2AA 2ZOQA 3RI1A 4DH3A 3S0OA 4NYEA 2GDOA 4X3FC 1H8FA 3P08A 4IJ9A 2BVAA 5CU2A 3GOPA 3BU3A 3SKCA 1YOMA 2W4JA 2V22A 3D4QA 4G9RA 4JRVA 4NM3A 4TXCA 1Z9XA 5DIAA 4MCVA 1G5SA 2CKEA 3FWQA 2R3PA 4R7HA 5HI2A 5E9EA 4GU6A 4K9YA 5CY3A 3H0YA 2B4SB 3ZSGA 4NUSA 4EZ3A 3G15A 4BBFA 2WGJA 2A19B 4HOKA 5HHWA 2C4GA 5C27A 3GCVA 4GIHA 5IQDA 4I5MA 2QOCA 2CHLA 5L2SA 4IDTA 3VS2A 4E4XA 3UP2A 2BZIB 2XVDA 3QHWA 5AX9A 4IX5A 4QQCA 3DBEA 5K5NA 3FSFA 3BGPA 4G5PA 4OAUC 4ORKA 1URCA 4LQMA 3H0ZA 2PU8A 3OUNB 4FT0A 3OW3A 5EI6A 4C33A 4RC4A 4EH9A 4U43A 2C3LA 4AACA 2W05A 3AQVA 3PLSA 5H8BA 3SOCA 4HVDA 4O86A 3ANRA 4ZSJA 5IQEA 3FI8A 1NXKA 4FK3A 2C6DA 2WIPA 2XNBA 3I4BA 2E9PA 5M53A 4KBKA 5FM3A 3HV5A 3EKNA 5EW9A 3Q04A 3AGMA 4FTLA 2CMWA 4CXAA 2XKEA 2XNGA 5HZNA 3UIXA 2I0YA 3D9VA 3G6GA 4R8QA 3MFRA 1CKJA 3ORNA 1MP8A 4I0SA 4QPSA 3HMMA 2X8DA 3MWUA 4BC6A 4K6ZA 4CMUA 3A7FA 4Q2AA 1RW8A 3K5VA 4LRMA 3HMIA 3EQPA 3F82A 4U5JA 4DT8A 4FSZA 4R3RA 3NUXA 3ZOSA 5IEVA 4OTRA 2QU6A 3RK9A 2W96B 5DYJA 3IECA 4IM2A 4AG8A 4ZLYA 3FMMA 5A4EA 3ZDUA 4WBOA 4BYJA 3R1NA 4BDIA 4JLCA 4PTCA 3PIYA 4BTMA 2X8IA 3SOAA 4M7IA 4WNOA 3KRXA 5D7AA 4FV6A 4G3EA 4ONAA 4F70A 2V5QA 2UZUE 5HESA 2W17A 3POZA 4OR5A 4MXAA 4K77A 4UWCA 4F7LA 3O17A 1PXJA 4IDVA 2UZDA 2W4OA 4BDFA 3GFWA 3C7QA 3KY2A 4K8AA 4C2WA 5FP6A 3FMNA 1Q8TA 5DR9A 5B2KA 4ASEA 4E6DA 4F09A 5K4JA 2SRCA 4E5WA 1GOLA 3QKMA 4KAOA 2OO8X 4OTIA 2ITPA 4QQ5A 3U87A 4XBRA 4B0GA 3S3IA 4EH8A 3R8UA 3C50A 2PE2A 4EYJA 1R1WA 4O0XA 5F95A 3E3PA 4DBNA 3JY0A 2CLQA 3MBLA 4IE9A 5HD4A 4ENXA 2OW3A 2BUJA 5F94A 2QVSE 4JBQA 4IVBA 2CLXA 2EB3A 4RFYA 1H26A 5FM2A 2BKKA 1ZARA 3PE2A 4WOVA 4TPTA 2VNYA 3UNZA 3VAPA 3D5VA 4YLLA 3NW7A 2HZNA 1DS5A 4M67A 4L46A 2A2AA 4XYFA 5AV0A 1WVYA 3UPZA 4EI4A 3QWJA 4O6LA 5K0KA 3H9RA 3UG2A 3LFAA 4AW0A 3P7AA 5IQFA 4CVAA 1GZOA 1OIYA 3QQHA 4FSWA 3GOKA 3NRMA 4I6HA 4FSRA 4MWIA 4LI5A 1W0XC 3ZUTA 2QC6A 1Q4LA 3JVSA 3MSSA 4OUCA 4QYFA 3VJNA 5C4LA 4WRGA 4YZDA 4V0GB 4E4NA 2YJSA 2OSCA 3GT8A 4EQUA 3RZFA 1XH5A 5BVDA 3FQEA 2HCKA 5CXHA 4AE6A 4O27B 2C6EA 4I3ZA 3AMBA 2P0CA 4XP0A 3HRFA 5TO8A 3UZTA 3GGFA 4R3CA 4L00A 2R3MA 4RX8A 3MDYA 4QP4A 3OS3A 3VBQA 4AZFA 4O84A 3OP5A 4FTUA 4JBPA 3E8NA 2KTYA 3IW8A 4V04A 3FPQA 2C6LA 5GJGA 3RPRA 4I5PA 4FV8A 4O38A 5EYCA 3WE4A 5T68A 5M51A 2QURA 3HGKA 2XNOA 1WBPA 2YA9A 4I20A 1FMOE 2C5XA 3R2BA 1BX6A 2UUEA 4LV5A 4I0RA 5D7VA 3EN5A 3MFUA 2R2PA 3SXRA 3ORKA 3FKNA 4RZVA 4JBOA 3OEZA 2BPMA 3GCUA 3PJ2A 4XG9A 5IQIA 3QTXA 3DZOA 4JDHA 4FKVA 3QX2A 3FUPA 5J87A 3AC1A 1SNUA 4H36A 3FE3A 4IAKA 3D94A 3FI4A 5GIPE 4BHNA 4RQKA 5HBHA 1XH7A 4ZLOA 3OY1A 4MXXA 4WG5A 3UNKA 2ZB1A 2G2HA 5IMXA 5DVRA 3HKOA 2ITTA 4CT2A 4R7BA 2YM8A 1WBNA 4Z16A 4BCNA 2X7GA 3PXFA 2WFYA 3LAUA 1H00A 3U6IA 2PVJA 2W1CA 3EJ1A 3OWKA 4F63A 5HKMA 4DTAA 4XG2A 1O6YA 3SAYA 5ETCA 4LYNA 2C0OA 5AUZA 3TUBA 3KF4A 4JRNA 5JFVA 2PZIA 5E8SA 1A06A 2QHNA 5H3QA 2GQRA 2J0LA 4FYOA 5ANOA 4AFEA 3ZUVA 5HO6A 3BBWA 3EFJA 3EOCA 3RAIA 5JRSA 3R1QA 3W8LA 4BIDA 5IG1A 4NK9A 4O1OA 4ZJJA 4AT3A 3UOJA 4IWQA 3JPVA 3RP9A 4DGOA 5AIKA 5KO1A 3O0GA 4F65A 2PVNA 3QCQA 4BGQA 5JGBA 2H8HA 1SZMA 4E5BA 1BYGA 3W33A 3R8ZA 3C4ZA 3UQFA 3FSKA 2OH4A 3ULZA 2XBAA 3DAEA 4LUEA 4HCVA 4V05A 3PVGA 4L43A 2PMIA 3MA6A 3CEKA 5ANKA 4FT9A 3DBCA 3PPJA 1JSTA 3K3JA 3QCYA 3MH1A 4IM3A 5L6WL 4DFBA 4J1RA 2A1AB 4M69A 3BLRA 4XUFA 3RALA 2IO6A 4QTCA 5CAOA 3ETAA 4YZBA 3KULA 3DBFA 4O7RA 2Y9QA 4B8MA 1PXOA 2J50A 4EHGA 4IVAA 4PMTA 2QOKA 3F5XA 3MI9A 4FTMA 5BVKA 3VBTA 4JQ8A 2HW6A 3AGLA 4DEIA 4UN0C 5CAPA 2QU5A 3ACJA 4RVMA 5AP2A 4ARKA 1VR2A 1Q99A 3G2FA 4OGRA 3WZDA 4BKYA 3NSZA 4CYIA 1BI7A 3UVRA 2XEZA 4GFOA 3L8PA 2JC6A 2F57A 1M17A 5JGAA 1OKYA 3I5ZA 2QI8A 3W16A 3IW5A 1XJDA 4PMMA 5L2TA 3UMXA 4RSSA 1NVSA 3EWHA 3NWWA 5CYIA 2QO9A 1IEPA 3ZFXA 4YTFA 1YHSA 4ID7A 2BIYA 2XCHA 2PL0A 3DNDA 2UZEA 2YIQA 3ENHA 4PDOA 1Y6BA 3OWJA 1Y57A 3DK7A 3QRKA 3LFSA 1WFCA 5IH4A 5M4UA 4U0IA 2Y4PA 1OKWA 4F64A 4FIEA 4HVGA 2C5YA 4NKAA 4U8ZA 3HRCA 5HVKA 4KIQA 1YI6A 4NW6A 5AP0A 2W7XA 5FDPA 2UW4A 3FZ1A 2WZJA 3P5KA 2C5NA 4CFUA 4G3FA 5GNKA 3R00A 2X7FA 3Q4ZA 5DR6A 4XG8A 4O2PA 2BRMA 2Y4IB 4F0IA 3LIJA 4YC8A 2JDSA 3TXOA 2G15A 5LMBA 2Y7JA 3NGAA 5KMIA 4QYEA 4Z3VA 1TQPA 2C30A 2VTRA 2XIZA 2YISA 2Z2WA 3BLHA 5H8GA 4FV2A 4CSVA 4WNMA 2BDJA 2YERA 1ZAOA 4O22A 4DLIA 4AN9A 3EMGA 3E7VA 3GC7A 4UMTA 4MTAA 5BMSA 4GMYA 4JQEA 4PV0A 1PXIA 4IEBA 4NU1A 3Q53A 2C69A 3ERKA 2W1DA 4E26A 2W1GA 3A8XA 2R7IA 3HV4A 2G1TA 4EHVA 3UGCA 1J7LA 2XCKA 4AX8A 2XK8A 4R1YA 4DGGA 3WZEA 3W2OA 5J5SA 3NVMB 3DAJA 1UWJA 1YQJA 4BCIA 4O0VA 1K3AA 4QPAA 3I0QA 4TWCA 4KS8A 2UVXA 3VBVA 5E91A 4WHZA 2QOHA 2DS1A 3FKOA 1WVWA 3OTUA 3PXYA 2WMXA 3LFEA 4S31A 4TN6A 3ZS5A 5CEIA 2VWZA 5BMMA 3EQIA 2YJRA 3W55A 4U80A 4CRLA 2BTSA 3G0EA 4D0WA 2FYSA 4IBMA 3D7TA 2XF0A 5AUTA 4ZTMA 3TDVA 3W10A 4CGAA 3EFLA 3TKIA 5AP7A 3VBWA 1YXSA 1PXNA 2UW9A 5AP6A 5L2QA 3UODA 3QQLA 4GCJA 3FV8A 3EN9A 4IB3A 5IDNA 4RJ5A 2QG7A 1IA9A 3I60A 3DOGA 3U6JA 2I0EA 5I3OA 3KC3A 3VO3A 3ZO2A 4KIPA 5K9IA 2ESMA 2CPKE 5DN3A 4C37A 4HVIA 1ZOHA 2BHHA 3QC4A 4KKHA 4ANBA 3FC1X 1CM8A 4FL1A 2PK9A 3D7ZA 5CI7A 2A4LA 2PE1A 5I4NA 1GZ8A 3R8MA 4NKSA 3PWDA 5CU6A 3S2PA 2W9FB 4BDKA 4EH7A 4P5ZA 4YHTA 1FVTA 3CTJA 5GHVA 4F6SA 2A0CX 2DUVA 4BWXA 3KREA 3V5WA 2BHEA 5K4IA 3LXNA 4R6VA 2OKRA 4FTCA 2X8EA 3VS7A 5J5TA 3OXZA 3OBGA 5IU2A 4UXQA 2OGVA 4AU8A 2GNLA 1QPCA 2F2CB 3DA6A 2WB8A 4G6NA 3PE1A 5AIRA 4AA4A 4EORA 2R3JA 3I7CA 5B2LA 4KBAA 2QOBA 4EOSA 4EJNA 2VX1A 4PTEA 3SHEA 3Q9ZA 5D10A 4IX3A 2VWXA 3GFEA 4FV4A 1OIQA 3VIDA 4A4XA 3ENMA 3LJ1A 1Q62A 4L42A 4DFLA 5C4KA 1OMWA 2WPAA 5GJDA 3V8WA 3LMIA 3W2PA 3E8EA 2R5TA 4A07A 4AAAA 4DTBA 4QMUA 3F61A 3R2YA 4FMQA 3WF6A 3E3BX 3MY1A 1SVHA 3HDMA 4OTFA 4XRJA 3O7LD 4QPMA 3Q60A 3R7VA 3DU8A 4RJ8A 4IB5A 5FLFA 5CWZA 3SLSA 2C6MA 3L9MA 4MF0A 4DH8A 2XIKA 3A60A 1XO2B 2BDFA 4QP7A 1M2QA 2WTIA 4RRVA 3ZU7A 2XB7A 3QLFA 3CY3A 4HNIA 4KS7A 4YLJA 3R9NA 4DAWA 4BCJA 2X2LA 4X0MA 1M14A 4F1MA 5HTBA 1GY3A 3ORXA 4R7IA 5BVEA 4YR8A 4M0YA 3R01A 3ID6C 3UO6A 5AR7A 1OBGA 3DV3A 5M06A 3QUDA 2BILB 4XP2A 4A9YA 4DCAA 5CX9A 4UWYA 2VTHA 2ZJWA 2B9JA 4I23A 4FKLA 4X2KA 2EXMA 4J8NA 4NIFA 2B54A 1BLXA 4UZDA 4BVUA 3IDBA 4A9RA 4FA2A 5AV4A 1BKXA 3IO7A 4IAAA 3D2KA 3EYGA 5D12A 4R78A 4U3YA 2P4IA 1PXMA 4MX9A 2YITA 4QMZA 1PHKA 4XV2A 5CZHA 2GNFA 3BV3A 4ZS4A 5KMMA 3DQXA 4X2NA 5A4CA 5E1SA 3I1AA 3FMLA 3COIA 3P4KA 3QRJA 4HNFA 3PIXA 4M69B 5FTGA 3QU0A 4CG9A 2ZMDA 4RIWA 3RJCA 1ZY5A 2QR7A 4NJDA 3KULB 4PPCA 4BZDA 2J0IA 3F5UA 3PA5A 4D4VA 2VO7A 3SGCA 2JBOA 2BZKB 1JNKA 3KKVA 2X2MA 4MAOA 4YTHA 4EJ7A 4CMOA 3G51A 3E8CA 4TYJA 2WTKC 3V5TA 4BFMA 3LJ2A 3RMFA 2FGIA 1PXKA 2YIYA 3E62A 5AX3A 3ZEPA 2CGVA 3P79A 1FINA 4MD9E 3MB6A 4MF1A 3PY3A 1YVJA 2ITWA 3BX5A 4I24A 4K1BA 2ITXA 4L6QA 4N57A 2PVLA 1H07A 2QOFA 5IA5A 2EXCX 5BVFA 5IA1A 2VTAA 4M14A 5G6VA 3Q2MA 4D2TA 3BIZA 3PJ8A 2C1BA 2BAJA 5FEEA 1E1VA 2RIOA 3QUPA 2YZAA 4H3PA 2VO3A 5G1XA 4IJPA 3BGZA 2LAVA 3HUCA 5D11A 3NW6A 3CE3A 4RGJA 2PMLX 3SD0A 2UV2A 3LQ3A 3QTZA 2PVHA 4QP1A 1UNLA 2HAKA 2XM8A 5IKWA 5B7VA 5IUHA 4EOOA 3PZEA 1YHVA 2P2HA 5AP3A 1ZYSA 4CZTA 3BHHA 5AAFA 5KBQA 5LQFA 3UMWA 5IQCA 2OU7A 3JVRA 4YJNA 4OTDA 2AYPA 4ERKA 4F1OA 1Z57A 4JBVA 5EQYA 3GENA 3DKCA 3KL8A 3TWJA 4DN5A 4PP7A 3LCTA 3P7BA 4IB0A 4BDCA 2E9NA 3FLSA 3PRFA 3Q9WA 2GNHA 2YIXA 3QXOA 3AC5A 4XG7A 4BTKA 4U79A 3COMA 3B2TA 4G2FA 4B8LA 4D4RA 5HNIX 3CQEA 3GU4A 3WIGA 2GPHA 2JITA 3Q32A 3ZZWA 2ZAZA 4K18A 1JSUA 4PUZA 4Y83A 3TACA 3U9NA 2CKPA 3HUBA 2GNJA 4RIXA 1XBBA 3QYWA 2UW5A 2RSVA 5HU9A 4XG3A 3I0OA 5DR2A 2JDRA 3UOHA 4W8EA 4IC8A 3F3WA 4IFCA 5CNNA 4FTKA 3G5DA 3LW0A 4P4CA 4JI9A 4C8BA 2DYLA 3CC6A 5BYZA 3PVBA 5HLNA 4JQ7A 5LVMA 1JOWB 2VWVA 5FG8A 5AEPA 4IFGA 4BR3A
chains in the Genus database with same CATH superfamily
1U5QA 3LMHA 4O7SA 4MHAA 4XG6A 4H1MA 4IZAA 1PW2A 4QMWA 5HE0A 3TV6A 1FMKA 4TWNA 1JWHA 4D4SA 5FUTA 1ZYLA 3BHVA 3FKLA 4WNKA 4BI0A 3RK5A 3OOMA 3EQCA 3O8UA 3O8TA 4DEGA 1G8SA 3KMWA 1CKIA 5JQ8A 4GRBA 2OG8A 2XYUA 1B38A 3IW4A 4TRLA 3P23A 1KE7A 3RNYA 3FQSA 4AQCA 1OECA 2V7OA 2WQBA 3ROYA 4FVRA 4BCKA 2JIIA 3D0EA 3ZRMA 3WYYA 3QAME 5CS6A 3ITZA 4WRSA 3WYXA 4F7JA 4FGBA 4WIHA 3UZPA 2CN5A 3UPXA 3W1FA 2X9EA 3WF5A 5CT0A 5AV2A 4ZOGA 3NYXA 4ZXTA 1ZYJA 2JAMA 3BQCA 1YDSE 3EQBA 3EQFA 2NPQA 1FBNA 4BCGA 4IX4A 4YURA 1YOLA 5LVNA 1M2RA 3A62A 5HICA 1AD5A 2GFSA 2XIXA 4KSPA 3ZRKA 3HL7A 3R7IA 2E9UA 3EL7A 1KV2A 5C26A 4J52A 1FPUA 2X4ZA 3AT3A 3H9FA 4RA5A 4YZMA 3RBWA 4AQKA 3I79A 4KIKA 4RPVA 3FLQA 2W99B 3R9RA 3AC4A 4A9TA 4ZP5A 4D9UA 3V6SA 4AW2A 4ZJIA 2PZ5A 3UYSA 2O5KA 4YJRA 2O3PA 4KRCA 3UIUA 3R9DA 3VW8A 2C5OA 2B7AA 2ZVAA 4YC3A 1PMVA 4LM5A 3DXNA 3QD3A 4V01A 4O4FA 4QMTA 4DFXE 5ETIA 4DFYA 3T3UA 5ICPA 4S32A 3TCPA 4XS2A 1YI4A 4I21A 3HV7A 4E8AA 4RIYA 3B8RA 4UALA 3BRBA 3U4UA 3L8VA 2JEDA 3SRVA 3KMMA 2RG5A 3NNUA 4H3BA 4YJOA 2YCSA 1LUFA 2J9MA 4BGHA 3MGYA 4I6QA 4IVDA 2GTMA 3QTIA 4IB1A 4RC3A 2XK9A 3QRUA 3G6HA 4CFXA 4OBOA 4WA9A 4R1VA 4ZTLA 4DG3E 1X8BA 4YGAA 5TR6A 3W18A 1CSNA 3VW6A 3RCJA 2WQEA 3PP0A 3UOLA 3NUYA 2OJJA 1WZYA 2XZSA 3OW4A 4HYSA 4EC9A 4N6ZA 3N4UA 3L8SA 1UWHA 1REKA 1BL7A 2YCRA 4B4LA 3DNEA 4CNHA 3KVXA 3BE9A 3C51A 3CD3A 2BAKA 4DE4A 2XJ1A 4QP2A 5LJJA 3HV3A 2WU7A 2ITZA 3BGQA 4I4FA 5HQ0A 2OICA 4A7CA 2VX0A 4NIFB 3L9NA 3TIYA 3ZBXA 4YMJA 3UQCA 4L52A 3NNXA 1Z5MA 2IVTA 3PWYA 2GHMA 5JKGA 4DHZA 3KQ7A 2C3KA 3O23A 4QMPA 3MTLA 2AEGA 5JK3A 4USEA 4F6WA 2PMOX 2PUPA 2XNNA 5IUGA 3D2IA 3IKAA 4IM0A 4HJOA 4AF3A 5HD7A 2XANA 4F78A 4TNBA 5HE1A 4DFZE 3BYMA 1PKDA 4QT1A 4HVHA 4F9CA 3BYUA 4C2VA 3NYVA 1ZZ2A 2XAMA 5J8IA 5AR5A 1FVRA 4PTGA 4MBJA 1GIHA 2XNMA 3Q96A 4WG4A 2WMSA 3F9NA 3EHAA 4QMSA 2QKWB 4GK4A 4FNZA 2G2IA 5CVHA 3R83A 4BIBA 3F88A 3C5IA 4FEWA 2OIDA 4AOJA 3WARA 4IZ5A 3CTQA 4HGTA 3N51A 4PY1A 3KXZA 4F7SA 4DFNA 4EEVA 4MXYA 4DA5A 4XJ0A 3QZIA 1W84A 4TL0A 2XKCA 3MYGA 2RG6A 3WZJA 4GH2A 4F08A 5BX0A 5J7HA 3FAAA 3PVUA 4NCTC 4NTTA 4E6QA 3OC1A 4Q9SA 5AAEA 3R8LA 3UDZA 3M11A 4AGDA 4BDJA 1YDTE 5E8XA 1A48A 4NTSA 5IQHA 3QHRA 4FSTA 3HP5A 3V04A 4O1PA 3LJ0A 3W0MA 1RE8A 3GQIA 2C6OA 5DFPA 3CS9A 1YWNA 2QCSA 3KK9A 2IW8A 3ZUUA 2XIYA 4RLLA 4ZSGA 2XMYA 4F9YA 2VX3A 4RVKA 3KF7A 5J1VA 2O2UA 4AGCA 4N4SA 5AR8A 4DFUA 5ACBC 5FXQA 3EQGA 3NAXA 2JAVA 3PXZA 1PXPA 2BRGA 2CSNA 4TW9A 3QALE 4FV1A 3LFNA 5IF1A 1CKPA 3RPYA 1TKIA 3OBJA 5DWRA 2R4BA 1IAHA 1VLRA 3WZKA 3VUTA 4MNFA 4YU2A 1OI9A 3Q6UA 4IZ7A 5CU0A 4NM7A 1ZMUA 4RWLA 4BDHA 4C0TA 3W0NA 4D1ZA 4AW5A 3Q5IA 2IG7A 2JD5A 1WMKA 3CPBA 2Q0NA 3R22A 4L01A 4MWHA 3TV7A 4J99A 3WF9A 2ITUA 4YBKA 3HVCA 4BL1A 3CGOA 4LV8A 3G0FA 3UYTA 5A6OA 3ZFMA 5AA8A 4TT7A 4RIXB 3IONA 4HZRA 1W2CA 4LMNA 1JKKA 2ONLC 2IZSA 2X0QA 2X0PA 3NUAA 4GUEA 4ZSLA 3W0SA 4ZTSA 4G6LA 3DB6A 3PRIA 4M12A 1Q8ZA 2GTNA 5HVJA 4KD1A 3VUHA 4ZTHA 4DLJA 2C0TA 3SG8A 4PPAA 4I6FA 4NH1A 4UYNA 3PUPA 2VUWA 5TF9A 2P3GX 4FKSA 4FSMA 5JMSA 2WKMA 5F1ZA 4FTTA 2IW9A 3ZDIA 4D2PA 1ZOEA 5IQGA 3ORPA 4QMXA 1PKGA 5EKOA 3V8TA 2PTKA 3UG1A 4DH5A 4QYGA 3QTQA 2C3JA 3CR0A 4X3JA 3RHKA 2CKOA 4JDJA 4U42A 3QQUA 1TVOA 4L3JA 4RJ4A 3UP7A 1NA7A 4JR3A 2YABA 4HPTE 3F5PA 5DH3A 5HG8A 2PUNA 3BZ3A 5CEMA 2NRYA 5DEWA 3Q9YA 3BQRA 3K2LA 4EOPA 1KE5A 2VWUA 4D4YA 3BHUA 3O96A 5EM8A 5C01A 5LWMA 2GQSA 3Q2JA 3U4WA 1U4DA 1B6CB 4RX7A 5KZ0A 3SDJA 4E3CA 4FKRA 2EU9A 3VRZA 1H0VA 5JT2A 3UC3A 3NNVA 5M4IA 3RWPA 1LEZA 4APPA 4YSMA 4FKIA 3VS1A 4ANNA 4JX7A 2RL5A 4I0TA 3FY2A 4G1WA 5M07A 4CMTA 4FNWA 4A06A 2OI4X 1YXTA 3ZM4A 3D14A 4O0TA 5LVPA 1IRKA 2CJMA 2EVAA 4O7LA 2QO2A 5AP5A 2B55A 2R3RA 2W4KA 2HENA 4FEXA 4OTHA 5IH5A 2JDOA 3F7ZA 2F2UA 3C4XA 3KRJA 4FUXA 3PJCA 5FBOA 3POOA 4DEHA 3HLLA 1QPDA 4EYMA 1OITA 4EOQA 3QGYA 4KIKB 4Y73A 3QTWA 4KWPA 1K2PA 3F5GA 5J9ZA 2AC5A 2PSQA 5LCJA 3RWQA 4DITA 3FXWA 3MY0A 5HIBA 2Z7SA 3MN3A 4X6RA 4FIJA 3WILA 4PWNA 2V55A 3R8VA 4O7YA 2F7EE 3DK6A 4M66A 2CGWA 4L9IA 2VTTA 4EOKA 3T9IA 4F9BA 3PZHA 4FF8A 4RIYB 3PTGA 2WELA 4FIFA 3TJCA 4ALUA 3SRVB 1Q97A 2J5FA 5A46A 1PYXA 2BZHB 2ERKA 2FSLX 4I5HA 1XBCA 2R3QA 2IJMA 3UDTA 2VGPA 4G34A 4CCBA 4JMQA 5BV3A 4AE9A 4QMOA 5J95A 2XNEA 4BBEA 4TY1A 3R9HA 5KMKA 2UZLA 4Y5QA 3DXQA 2VRXA 3PXKA 4EZ5A 4E93A 3TNIA 2GFCA 2R9SA 3FYJX 4LL5A 4GKHA 4XOZA 4PQNA 4YZCA 5J1WA 5BVOA 2Z7QA 5DA3A 4J96A 2C1AA 2JIVA 4DBXA 4UY9A 2A27A 3E7OA 4O2ZA 4ACCA 4AUAA 4OTQA 2GCDA 4AXFA 3NFGB 4YC6A 4JX3A 3EQDA 4IADA 3NLBA 4C57A 3F69A 2HWOA 3LCSA 5AV3A 3T8OA 2I7QA 2UZNA 3G90X 4D2VA 2UW3A 3BE2A 3C9WA 1ZMWA 5E8VA 5H2UA 3Q6WA 2ZV8A 4HGLA 5FTQA 2F9GA 3TZ9A 3N4VA 2H9VA 4FSYA 4QDVA 3DKFA 4ITJA 5HGIA 5EHOA 4K11A 5EFQA 1HCLA 3LXKA 5I0BA 5EYKA 3QZHA 3GU8A 1UVRA 3MVLA 4X2JA 4E4LA 2XKDA 5JRQA 5KKRB 1YDRE 3C1XA 3CD8A 3NPCA 3QCSA 5EOBA 5CASA 2YM4A 3CQUA 5BQ0A 3MB7A 3BKBA 3O71A 3PA4A 2VTQA 1DI9A 4EC8A 5FEDA 4IX6A 4CFNA 4U45A 3ODYX 3D15A 4FKJA 5IDPA 3W0PA 2GS6A 2W0JA 3V6RA 2ZV9A 3VS3A 2F4JA 4GJ2A 2FSTX 3VJOA 3V5QA 4O0RA 3MY5A 1IAJA 1BUHA 3V01A 3Q52A 3HX4A 4CCUA 3LQ8A 4QP9A 4RFMA 4FSUA 4LRKA 2FH9A 3ORLA 4EH6A 3BYVA 3UJGA 3HAMA 4OBQA 5BUJA 4W9WA 4XH6A 2HK5A 4FG8A 3HP2A 4FV7A 3RPVA 4JDKA 1I09A 2JFMA 2QNJA 3F2NA 4MD7E 2ITYA 5IPJA 4FVQA 2X6DA 3M1SA 4LOQA 5DRDA 5JSMA 3DDQA 4PMSA 5HE3A 3HV6A 3PDTA 4M68A 4JNWA 4EWHA 2OJGA 1SNXA 2QODA 3O7LB 3O8PA 4F7NA 1H1PA 3OXIA 2ZM4A 4AA0A 1WBVA 4IIRA 1YI3A 2ZM1A 2UW0A 1ERKA 4TYGA 3ULIA 1CMKE 1LPUA 4AZSA 3KXMA 4RX9A 5EKNA 2VTOA 2J51A 1NY3A 2VTJA 3C0HA 3DFCB 4NM0A 4EKKA 3F7WA 4CKJA 2PUIA 2XRUA 4F9WA 3B8QA 5T6KA 3RM6A 3AC8A 4KNBA 4AOIA 3NUUA 4X3FA 4RT7A 4DEEA 2ERZE 3NX8A 2XAOA 4I93A 2C6TA 4KINA 2OXYA 3SC1A 1BMKA 2JBPA 4J7BA 3ZH8A 2ZDUA 4EK3A 5HX8A 3R21A 5CEQA 2O63A 2WAJA 4M0ZA 4FSNA 4FTJA 4LRJA 4YPDA 5E90A 3KN5A 3ZLYA 2ZFYA 3NAYA 5JQ5A 2C47A 5ANDA 4GFMA 3E92A 4USDA 5JZNA 5HNGA 1GZNA 5AR2A 1M2PA 3H3CA 3PA3A 4FL3A 4P2KA 4FEUA 3CKXA 5HO7A 3VQUA 4C7TA 4EONA 3RAHA 3MJ2A 2QHMA 1PMUA 4A9UA 5KX8A 4CLIA 3ATSA 3SW4A 3IS5A 3Q3BA 3VONA 3OY3A 1OL7A 2YAKA 3FZOA 4O7NA 3WIKA 4RJ3A 3ACKA 3ZMMA 1H0WA 1Q41A 4ZSAA 3FYKX 5CF6A 4GS6A 1UU8A 4FE2A 4MQ1A 2B9HA 3ZZEA 3ORTA 1GAGA 3DTCA 3R71A 4QP6A 3UVPA 2YAAA 3MPMA 4XNEA 4HYHA 4AXEA 1MRYA 1GIJA 1JBPE 3DLSA 4LDTA 4AT5A 3P0MA 5EM5A 4NFMA 4IACA 4ZZOA 3MFTA 1PY5A 5EDPA 2PPQA 1H1SA 1Y8GA 5GZ9A 1OIUA 3UE4A 4PL4A 3FMKA 5FD2A 2E9OA 5AV1A 5I9WA 5K0XA 3BCEA 2XKFA 4D9TA 4RZWA 3TEIA 4C62A 3OF0A 5JFWA 2H6DA 3WOWA 2YZLA 3KB7A 3ALOA 4IZYA 2XIRA 3W0QA 1UKIA 2RGPA 3CIKA 2UW6A 1Q3WA 5EW8A 4U7ZA 1UU3A 3RCDA 1OPJA 2VWBA 2ZMCA 4P90A 3RNIA 3R63A 4L68A 1JKSA 4ZZMA 2X6EA 1O6KA 1NVQA 1PJKA 4ALWA 5LMAA 1DAWA 2B52A 3HECA 4DG2E 1CTPE 1B39A 5L6PA 4TTHB 3SV0A 2Y4IC 1SVEA 2I6LA 3PJ1A 5FQDC 3JUHA 2I0HA 5EQEA 4C02A 5M4CA 3OZ6A 1KOBA 2J6MA 1JPAA 3ANQA 4QNAA 5KHWA 4G31A 1KE9A 4YZ9A 1E1XA 3AC3A 4JOAA 4O4EA 5HLPA 3U6HA 4RQVA 2PVMA 3R0TA 5CVFA 5AUYA 5GINE 2CKQA 3CGFA 3GCPA 4JIAA 1H28A 4GIIA 4BKJA 2XJ2A 3IQ7A 1F0QA 3MVMA 3KXHA 5KBRA 3TZMA 2R0IA 2YLEA 3WF8A 2IZUA 2HYYA 3W0RA 1H1RA 1S9JA 4BN1A 4XOYA 2WEVA 3AOXA 3ZSIA 4FUYA 1Q8WA 2YEXA 4CLJA 3DGKA 2B9IA 2WMUA 3AC2A 3OOGA 4AW1A 1O9UA 1ZOGA 4TKSA 5CENA 5JZJA 4U81A 5E92A 4RVTA 3JY9A 2EXEA 3ZRLA 1GJOA 3KA0A 3QGWA 4II5A 3RM7A 2PMNX 3HNGA 1M7QA 4EK5A 4KSQA 4AGUA 1APME 4XLIA 4AXAA 5A4QA 5CQWA 2VZ6A 3OMVA 4GEOA 4HCUA 1YKRA 3QWKA 4XMOA 3RAWA 3FXZA 2O8YA 4XCUA 3E5AA 4L3LA 3R1SA 2F49A 4QTDA 1OIRA 2W06A 4ASZA 4O0UA 3DJ5A 4F0GA 4YUQA 1R3CA 2IZRA 1F5QA 4BIEA 2OZAA 2H34A 3FBVA 3GCSA 1OKZA 3LQ5A 4R5SA 1YXUA 5E1EA 5F20A 2VWWA 5CSHA 3REPA 3ZLXA 5CAVA 5CSXA 2EB2A 4C61A 5DPVA 5EDRA 4H39A 4Q5EA 3PJ3A 2W5HA 4YTIA 5T3QA 4BDDA 5JEBA 4L45A 3RAKA 4AT4A 1UU9A 5HCYA 3PY0A 4EK4A 4AAYA 2J0JA 3KFAA 4QP8A 4XX9A 1H25A 2CNVA 5BNJA 1KV1A 2AUHA 1H4LA 5C9CA 2R3LA 4XEYA 3PXQA 3DLZA 2FSMX 5KMOA 4LFIA 3VS6A 4K2RA 2PZRA 4P5QA 4C3PA 4Z55A 2YDJA 3MA3A 1KE6A 3WBLA 4E4MA 3HMNA 3TNHA 2ITOA 4ZY6A 4RIOA 4CV8A 2JIUA 5H9BA 1A9UA 2YCFA 3TKUA 2GHGA 2IVVA 5KMNA 4NT4A 3MH3A 3UDBA 2ETMA 4KRDA 4GV1A 4FIHA 5HIDA 3MH2A 3SW7A 5EI8A 1J7IA 4IVCA 4FKQA 5E8TA 2VWYA 4G9CA 4WUAA 5DE2A 4IAFA 5TE0A 4MKCA 1WAKA 4QQTA 1V0BA 1H1WA 1W7HA 2EWAA 4WKQA 3T9TA 2BRHA 2R3KA 2UZVA 3FI3A 3LFCA 4FZ6A 4LL0A 3ROCA 2IPXA 2Z02A 4Q9ZA 2CCHA 5FXRA 3R7UA 3TUCA 4FBXA 2ACXA 4FGRA 4ALVA 2JGZA 4GL9A 4DH7A 2PWLA 4FTOA 2FVDA 3HA6A 1IASA 2ZDTA 2XK4A 1JKLA 4QMYA 4CTCA 5L6OA 5KNJA 4GVAA 2WO6A 2C6IA 4GJ3A 4TYEA 4WUNA 2YWPA 3GC9A 2HIWA 3QXPA 3EL8A 3OUKA 3FPMA 2NP8A 3QA0A 1RJBA 5AP4A 2CNUA 3BWJA 4X2FA 4FR4A 4X3FB 1OB3A 3K5UA 4LGGA 4ERWA 1OL2A 2YIWA 3CY2A 2B53A 4AXDA 4FOCA 4FKUA 4JG8A 3SXFA 2QOIA 1STCE 2QG5A 4EUTA 1Y91A 3MTFA 3OFMA 4QMMA 5CI6A 3QC9A 3QL8A 4MD8E 4ZZNA 3LVPA 4UYAA 4L3PA 3WF7A 5AUXA 4BCHA 4ZMEA 3R02A 4X21A 3Q4TA 3QYZA 1WVXA 3FY0A 4G16A 4S33A 5TOZA 2Y8OA 3UIMA 3W2SA 4FEVA 5E8YA 2NRUA 3U54A 1OL6A 3D7TB 4YTCA 4BCPA 1Q5KA 3GXLA 4L67A 3QBNA 4EWQA 4C4JA 4G17A 4YBJA 5DMZA 3QX4A 3DB8A 5BVWA 4YPSA 3GB2A 4BBMA 4C4FA 3TM0A 5B0XA 3IOPA 1YWVA 3JS2A 4U6RA 4USFA 3AXWA 2W1ZA 4BTJA 5LVOA 3OT8A 3QLGA 4G3GA 2OK1A 2UW8A 4CFMA 4DINA 4BJJA 2RFEA 3FMDA 4FIGA 2OF2A 4NEUA 5ANEA 4HW7A 2VTLA 4FZAB 4HGSA 3RVGA 4EOLA 4W4XA 3DJ7A 1FVVA 2YLFA 3G33A 3VRYA 3EB0A 2UZTA 1H27A 4EHZA 5M09A 5HTIA 1K9AA 3C5UA 3KXXA 3NMUF 5J7BA 5KMJA 3OCSA 4MQ2A 4C3RA 4BHZA 3MV5A 3BU5A 1OPLA 1FGKA 3L1SA 1JLUE 1RDQE 2OF4A 3MVHA 4ZTNA 3TI1A 4J71A 2XEYA 3U51A 2BCJA 4CFFA 1ZZLA 3BHYA 4TYHA 2YHVA 5DNRA 4FNYA 4YJUA 1YWRA 2P2IA 4DHFA 3VC4A 5CEOA 5LMKC 4HVSA 1JVPP 4QRCA 3C4FA 5HBJA 3W8QA 1BL6A 2BFYA 3KEXA 3ZC5A 3THBA 2GNGA 3FLYA 4GW8A 4G5JA 2YDKA 3NIZA 4BZOA 1ST4A 1OZ1A 3OCGA 3ELJA 4I6BA 3ZM9A 3N4TA 4CKRA 2W1IA 2JLDA 3MJ1A 2IW6A 2VTSA 1YRPA 1UNHA 3ET7A 3BYSA 3P86A 5CU3A 5HG9A 3ALNA 3M42A 5FTOA 4O7TA 3PIZA 3BYOA 2OLCA 2P55A 5GZ8A 4D55A 1R0EA 2UVYA 4O4BB 3UO4A 1ZY4A 4WBBB 4AWIA 3ZYAA 4ENYA 1L8TA 1XBAA 1WBWA 5CT7A 4RJ7A 1XH6A 5H8EA 2YM6A 3EH9A 4GUBA 2KULA 4KIOA 2Q0BA 1PYEA 1G3NA 5AM6A 2ZM3A 1QMZA 4QQJA 3TV4A 3UOKA 4EHEA 4TNDA 3ATTA 5HE2A 3A2CA 4M3QA 4JIKA 3KMUA 5ETFA 4E73A 3ZO1A 4AZWA 3V5JA 4YJSA 4ASXA 1P14A 2OXXA 1T46A 3HMOA 3TN8A 3V51A 2VTIA 5AUUA 1Y8YA 3KRWA 4BDBA 3C4EA 3IGOA 4IC7A 3DZQA 3Q5ZA 2BAQA 5IQAA 4GYGA 3A4OX 3GU6A 5DT3A 2PVYA 4UB7A 5FEQA 5IA0A 4IAZA 4U41A 1O6LA 3QF9A 1L3RE 2G2FA 3MESA 3BBTB 4BDGA 5E8UA 4UMPA 3UZRA 2WMAA 2GS2A 5IZFA 2HWPA 5HTCA 3NUNA 4GK2A 4GYIA 4O7WA 4QTEA 2WOTA 4L7SA 2HW7A 5IH6A 3L9LA 2R3NA 3FI2A 4FT3A 4RIWB 1XH9A 3V5LA 3O51A 4FVPA 1W98A 5ANGA 3DTWA 3R6XA 3MFSA 4QOXA 5AR3A 4YLKA 4FNXA 3FLWA 5FDXA 1R0PA 5LVLA 4S30A 2OZAB 5TT7A 4CEGA 3K54A 1EH4A 2RFNA 3C4CA 4BB4A 3MH0A 5DBXA 4BCMA 1IR3A 4K33A 5I9YA 3A7HA 3FZTA 2XK3A 4M84A 5AR4A 4D28A 2HXLA 4LGHA 3BLAA 4ZAUA 1XWSA 3LFBA 4ZTRA 5KUPA 2YN8A 3R30A 4OTGA 2I0VA 2XALA 3TDWA 2OJIA 3VS5A 4CG8A 3TG1A 5HCXA 4C38A 4M15A 2WTJA 2RF9A 4LUDA 3ZO4A 4FKPA 2HELA 3KK8A 2AC3A 4TWPA 3VNTA 2GSFA 3A7IA 3RZBA 3T3VA 3F66A 4O81A 2VTNA 2PHKA 4OTPA 4H58A 4DDGA 3D5WA 4DGNA 2XK7A 3ZC6A 4IH8A 4ASDA 4CD0A 2XUUA 2QR8A 3CQWA 5DT0A 2C5VA 1MRUA 2XA4A 4DG0E 4PDSA 2CNQA 5CXZA 1FQ1B 2REIA 5I9ZA 4W4VA 5EHLA 3GC8A 4ZJVA 3QKLA 3W2RA 3S1HA 3ORIA 1QL6A 2HZ0A 1REJA 2Y6OA 3I6UA 4XV1A 2PVRA 2WQOA 3TTIA 1G8AA 1U54A 5CU4A 2VGOA 4I6LA 4R77A 4G3DA 4AZEA 1J7UA 4OLIA 4BGGA 2AQXA 3UQGA 4EUUA 3UVQA 2WMWA 3CKWA 4MH7A 4FKGA 2IF8A 2ZB0A 4ANMA 3S00A 4JAIA 4PRJA 3CLYA 1SYKA 2IN6A 4ANQA 4GT5A 1AGWA 3NDMA 4RWKA 4ACDA 4MK0A 4Z9LA 1U5RA 1J3HA 2O64A 4HGEA 3ZTXA 2WIHA 4EK6A 4KB8A 5L2IA 1S9IA 3MIYA 2VD5A 1J1BA 2Y0AA 3PPZA 4LMUA 4EZ7A 5B2MA 3H30A 2X81A 3QRTA 4I5CA 4QMLA 5I3RA 3ZONA 4YO6A 2G9XA 4BRXA 4KA3A 4JVGA 4E5AX 3CTHA 2J90A 1YXXA 3R7EA 3VULA 4YO4A 2OZOA 3OT3A 1R78A 3DJ6A 1XH4A 1KWPA 2PUUA 5CEKA 4FYNA 2XS0A 3MPAA 4RLKA 2OBJA 2B0QA 4D1XA 3FHIA 4J53A 5ACKA 3Q9XA 4ZSEA 4MVFA 4O21A 3GVUA 4YJQA 2FUMA 4AP7A 4UXLA 4ZMFA 1U59A 4MXZA 3TIZA 4WSQA 3MS9A 3IGGA 3PY1A 5I9UA 3DQWA 3IG7A 3ZXTA 4IW0A 2GNIA 4YJPA 4BJJB 1VZOA 3OVVA 2CGUA 1J1CA 1VYZA 1JAMA 5J9LA 2PY3A 2WQMA 4FTAA 4LOOA 2QLQA 4B99A 2R7BA 4EOJA 4H05A 2W5AA 2XBJA 4QMVA 3C4WA 4ZS0A 4UWBA 4OAVB 3LCOA 2ETRA 3MVJA 3N9XA 4JAJA 4YJTA 1OVEA 3AG9A 2XNPA 2UZWE 3GQLA 5CLPA 3BPRA 3DAKA 5TKDA 3UIBA 5BVNA 4GT4A 5M55A 4QEBA 3SG9A 1DAYA 1Q8YA 3QRIA 3BWFA 2I40A 4L7FA 2QLUA 3I6WA 4AFJA 3FHRA 3HYHA 4PP9A 2XM9A 4TYHB 3BHTA 4IHPA 4KBCA 5HO8A 5JH6A 4I1ZA 4EK8A 5IA2A 1VYWA 5EI2A 4AGWA 5FBNC 4O91A 3AMAA 4O4DA 3E87A 1W8CA 3BEAA 5A6NA 1W82A 5E4HA 5LOHA 5AFVA 1KUTA 2IVUA 3BV2A 3NZ0A 2BDWA 5AUVA 4IANA 4B7TA 3NCGA 5IISA 5L8KA 4U44A 5C1QB 3O50A 3KXGA 3F2AA 3LM0A 2VU3A 4J98A 4J8MA 3MPTA 1XQZA 4XV3A 4ZTQA 3RHXA 4XV9A 3C0GA 3OHTA 5ITAA 1SM2A 3E93A 4D2RA 5CF4A 3EKKA 4QTBA 4E6AA 1RQQA 5JFSA 4AXCA 2VWIA 3R7GA 5IEXA 3VF9A 4DF3A 2P33A 4YHJA 2YM5A 2FB8A 5LCKA 2ZYBA 3A7GA 4NJ3A 3TT0A 3UBDA 3AD6A 1ZXEA 2HZ4A 4YNOA 3AT2A 2R3IA 1LP4A 1OKVA 1Q24A 1U46A 1OUYA 2F7XE 3LOKA 3NS9A 4RJ6A 5DRBA 4L44A 3ZXZA 4EBWA 4N6YA 1V1KA 3CCNA 4FG7A 4PL3A 2PULA 1UNGA 4JT3A 3FC2A 3KCKA 3V3VA 4AN3A 3OWPA 4NFNA 4D0XA 2WXVA 3EQHA 3ORMA 4UZHA 4FK6A 3GU5A 3R1YA 4FOBA 4FZFB 4ZY4A 2NNWB 5HG7A 2IZTA 3DDPA 4NSTA 1FGIA 2XARA 1QPEA 4PNIA 1VEBA 2OJFE 3FZRA 1YW2A 2W9ZB 2HZIA 5ANIA 3KGAA 4LV7A 3HA8A 4FSQA 4ITIA 5ETAA 5L4QA 1DM2A 2FSOX 3DCVA 4Y85A 2WOUA 3WZUA 3TUDA 4GKIA 2YFXA 3CBLA 3IDCA 3HAVA 3EYHA 3VF8A 5AADA 5F9EA 1OGYA 3H9OA 4EBVA 3CJFA 3HRBA 3SQQA 3WI6A 3F3TA 3GC0A 3E8DA 3GU7A 3NW5A 2I1MA 4JL9A 4Q5HA 3NVKI 2YWVA 1P4OA 1ZMVA 2ETKA 2X39A 4CZUA 2G01A 5A14A 5M4FA 5FGKA 1DI8A 5DG5A 2R3OA 3EN4A 1QPJA 2XYNA 5E7RA 3PG1A 4TYIA 4FKWA 1OBDA 4WG3A 4NM5A 3QQGA 3V5PA 3SA0A 3CSVA 3FLNC 1E9HA 1WCCA 4FX3A 4XRLA 4EKLA 4L53A 3U55A 4R5YA 4FT7A 4ZIMA 3DY7A 5KHXA 3KRLA 1LR4A 1PF8A 5HX6A 3D83A 4Z7GA 2WU6A 1PMNA 4FV0A 5LMKA