4IACA

X-ray structure of camp dependent protein kinase a in complex with high mg2+ concentration, amp-pcp and pseudo-substrate peptide sp20
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 111
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iacA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iacA02
1M2QA 2IWIA 2VO3A 3TKHA 4L45A 5HO8A 2ZMDA 3ZSHA 1G8SA 2VX1A 3FHIA 1I09A 3GU7A 3GEQA 5BVEA 5CSWA 2J0IA 4QMSA 2GFCA 4K2RA 1GIIA 3FMLA 4TXCA 3DQWA 4EUTA 5FDXA 5HE2A 1VEBA 5DIAA 4CT1A 3QYZA 4L46A 5LVNA 3MBLA 4J98A 4CT2A 5BVNA 4MXOA 4NH1A 4QQCA 5D7VA 3NMUF 1U5QA 2FSMX 1UWHA 4M14A 4CYJA 2YA9A 1PMNA 2C3KA 4E5AX 5JRQA 2QCSA 4IX3A 5AM7A 3RP9A 4S2ZA 4M3QA 4I5PA 3HV7A 4QP8A 4J71A 3KK9A 3NUYA 2HZNA 2R4BA 4QT1A 2QO9A 3UO6A 3GQIA 3FZSA 5I5ZA 3OCSA 3KMWA 2CLXA 5HBHA 4Y83A 1H4LA 1M14A 3NAXA 4O0SA 3F3ZA 1GAGA 4OTPA 3CCNA 4X2FA 4ZOGA 5AV0A 2PE0A 3FLQA 4FSZA 5CU4A 3ZO3A 2F2UA 4WNOA 2J50A 4CLJA 5IUIA 3C4XA 3OROA 2J5EA 3LFSA 3S3IA 3LCDA 3SXRA 4X0MA 4N4SA 3LFNA 4ACMA 4A9RA 5IPJA 4EZ3A 4GG7A 3TCPA 5HGIA 4MXYA 3UDBA 2J5FA 1IG1A 2WNTA 4X6QC 3LMGA 5HNGA 3NLBA 3GC9A 4F7NA 4O7ZA 4YZDA 2ZB0A 5IA2A 3NNXA 1M2PA 5E8UA 3F2RA 5KZ0A 3MFRA 2X4FA 5KMMA 3ZOSA 4WT6A 4C38A 4QPSA 3AC5A 2X4ZA 3PPZA 5CWZA 3COIA 1MQBA 3VW6A 3FZOA 4ONAA 5LMKA 2C1AA 3Q4TA 2HY81 5EQEA 4A7CA 3I4BA 3VS0A 2PSQA 3TI1A 4GT5A 3UZTA 4Q2AA 1CMKE 4ZAUA 3ZUUA 4F7JA 4B8LA 3AQVA 1M2RA 3FKOA 3OUKA 4IWQA 1U54B 4NYEA 4KSQA 5LCKA 5FM3A 3U9CA 3CQUA 3NUSA 1B38A 4UZHA 5AV4A 2YCQA 2A0CX 3W8LA 4JRNA 4D1XA 3CJGA 3RPYA 3GQLA 2OU7A 2QI8A 2GNIA 2WU6A 3FSFA 1GY3A 3ORLA 1SVEA 5AP2A 5AX9A 3RAHA 4CG9A 3OF0A 3UZRA 1WBWA 2QOOA 4P2KA 3PIZA 4FUXA 3I5ZA 3ZHPC 2O2UA 4TN6A 4DLJA 2Y4IC 2WMUA 2R3OA 4BCOA 3EN7A 3NW5A 5K5XA 2FSLX 4J53A 2PZIA 2HENA 4FV2A 4FT9A 4RWIA 1SYKA 2ZYBA 2JKMA 4DEBA 1FBNA 5FBOA 2OBJA 3FYJX 4ZY4A 4O2PA 2YM8A 4UALA 4EQMA 3R8MA 2XNNA 3HUBA 4UYAA 4ACDA 3PPJA 5KX8A 1OL7A 3O71A 4F1TA 4V05A 4C61A 3BE9A 4Z16A 1Y6AA 4AZVA 5AAGA 4XNEA 3KEXA 4F0FA 2W96B 1Z9XA 4AF3A 5E8VA 1EH4A 2F7ZE 4I41A 4FE2A 3FAAA 3MTLA 3PJ8A 1H1WA 2CCHA 2OXXA 2WTVA 2WTIA 3SW7A 1M52A 2R3HA 1OBGA 3ZSIA 4B7TA 3O8PA 4L3PA 2BPMA 3NRMA 1YXTA 4G3DA 4QQTA 5BMSA 2PVMA 3L9MA 5AX3A 2QOBA 3RZBA 2VTOA 4GMYA 3EQPA 4YJOA 4YPSA 3TDVA 5LVOA 4B6LA 5FTOA 5CF5A 1XO2B 2ITTA 4FEXA 2VGPA 2XM8A 4QQ5A 3VBWA 3VRZA 2PZ5A 2WTKC 4R1VA 4ARKA 3UMXA 3UIBA 4A06A 2YWVA 3WILA 4IBMA 5K4IA 1S9JA 4RBLA 3P7AA 5EYDA 2YJRA 5IG1A 1WBTA 2ACXA 5ANEA 5M44A 3EFWA 4BDDA 4JBOA 3W2PA 4D4VA 5LARA 5AA9A 2ITPA 4KKGA 3A7JA 1LEWA 4APPA 1ZWSA 2WIPA 3F5UA 4FL1A 3R7YA 4FIEA 4IQ6A 4QP9A 4BDBA 3VF8A 3TWJA 4FV0A 4RJ6A 4JQEA 4KIKA 3S95A 4MTAA 4FKVA 4MYGA 3DS6A 3CC6A 3GGFA 4EHGA 3P0MA 4EQCA 3D4QA 4O82A 4CZTA 4ZMFA 2W1CA 1OIUA 3ROCA 3GC8A 5AAEA 4OBOA 4HVHA 4O7TA 1UV5A 5JMSA 3EFLA 4W9XA 3R1QA 3GC7A 2RSVA 4IB3A 4FEWA 1K9AA 4ZTRA 5CZHA 3QRIA 3QRKA 2A27A 4M69B 1TQPA 3ZZWA 4DTBA 2C68A 4K33A 3HUCA 4RIWA 1YQJA 4X7QA 3ROYA 4FMQA 4E6DA 4YO4A 3DQXA 3ZBXA 2J90A 3MH0A 3WF5A 3E3BX 4OTHA 4FIGA 4RIOA 2HCKA 2C6DA 2VN9A 4PMSA 4FK6A 4YU2A 5IH4A 3NNUA 3VUIA 2YM7A 1WBSA 4DBXA 1A06A 3R02A 3KVXA 4AA5A 3R00A 4ASZA 2ITVA 3C13A 3MGYA 3L9NA 4L3LA 4NWMA 3MVLA 3UOHA 4AN2A 4JX3A 4C0TA 3OG7A 5CNOA 4BCNA 3TN8A 1QCFA 5GJDA 2IZRA 2XK7A 1E1XA 2PUUA 4BHZA 4D28A 4CRLA 3EQRA 3GCVA 2ERZE 2G1TA 4MF1A 3W2RA 5FXRA 3RHXA 2I6LA 2PHKA 2PZPA 3KRXA 4X21A 4BCPA 3DLZA 5IUHA 4RX7A 3JR1A 3D15A 4XV1A 4DG3E 3BHHA 3POOA 4FK3A 3E5AA 3R01A 4ZSGA 1CKPA 1Q99A 3SRVB 2Z7LA 1XJDA 2IVTA 2Q0BA 2JIIA 1OKYA 3KRWA 3C4ZA 4TPTA 3U8WA 3WF8A 4F6SA 2GFSA 2CKQA 2ZDUA 4C2VA 5C1QB 1OPJA 1X8BA 3QTUA 5M53A 2YCRA 4F6WA 2HW7A 1RDQE 3ZEWA 5CU0A 2GU8A 3VRYA 3LCKA 4U0IA 3WE8A 3P4KA 2DQ7X 3OWLA 4ERWA 3QD3A 2C6MA 2W1EA 2WOUA 3MV5A 4DGGA 1URCA 1QPJA 4MBIA 3R1YA 4DEGA 4JAJA 4RPVA 3OT8A 5EDQA 5H9BA 2C3LA 4Z55A 3TDWA 4DEAA 4I5HA 4BIEA 4QP3A 4BICA 3BLQA 4U3ZA 4IAAA 1O9UA 4CMUA 2P0CA 3F6XA 5HZNA 4F65A 3GENA 2UZVA 3SOCA 3BYSA 3ORIA 4GK2A 3SAYA 4J52A 1O6LA 3PSCA 3DFAA 3FY2A 2GNLA 4AE6A 2A4LA 2ETKA 5IEYA 3NWWA 3UJGA 4YJPA 4C58A 1YRPA 5KHXA 4DGMA 2XNEA 2BAQA 5C27A 3PXZA 4QNAA 3FBVA 3FYKX 4KINA 2XEZA 1PXLA 4GJ3A 3LQ5A 5LXMA 2F2CB 4D2RA 1IR3A 2YACA 3MFUA 4RC2A 3VWAA 3HMIA 5C8MA 4ORKA 3WI6A 4F1MA 2NO3A 3EQDA 4BKZA 3HECA 4E3CA 5HTIA 2CNUA 5B2KA 1E9HA 2ITWA 4IFCA 4XV2A 4JBQA 2YZLA 3LFFA 4MAOA 5HNBA 4PL4A 3D83A 3TZ9A 4OAUC 4I3ZA 1Q8TA 3S00A 2QR8A 5LMKC 3CIKA 3FMHA 3MFSA 4HZSA 2ZAZA 2Y7JA 3DJ5A 4CV8A 4JX7A 3Q5IA 2NNWB 1IAJA 3UYTA 4DF3A 1PRYA 3MY5A 3TNPC 2DYLA 2NRYA 5GINE 3M42A 2B7AA 2UW7A 4FKOA 4G2FA 1OBDA 2Z02A 4I6FA 5FRIA 2RL5A 1JPAA 4FX3A 4CMOA 4X2GA 4O0WA 2VZ6A 2V7AA 3ZFXA 4JG6A 4R5YA 3AD4A 4PNKA 2ITXA 3AGLA 5EYCA 4OLIA 1UWJA 5D11A 4GT3A 2R0IA 3Q9XA 4F0IA 2CGWA 4JJRA 4FIJA 3PVGA 2RFDA 3BHVA 3R8LA 3EH9A 4ZLOA 4BR3A 3A61A 1BUHA 3EQCA 3IW5A 5JK3A 3V5JA 3GU5A 3A62A 4LI5A 5AP1A 1WBVA 2BCJA 4GCJA 5L8JA 5GZ8A 4O2ZA 5LWMA 3QCQA 4F9BA 3C0IA 4FTIA 5IQGA 3R2YA 4EL9A 2VV9A 4ALWA 1WBPA 3C5UA 3V3VA 3GCSA 5CXZA 3E92A 2PVKA 1ZARA 4QMOA 2WO6A 5ANGA 3RKBA 3QHRA 4G34A 4QTCA 3CXWA 4UV0A 3VS6A 3QFVA 4ANSA 2XIXA 3PE2A 3DT1A 4N6YA 4TT7A 4Y72A 3DTWA 4JG7A 3SXSA 2JFMA 1FVVA 4HCTA 3COHA 4HGTA 3Q4UA 3RPOA 1R0PA 3PXQA 4ANLA 5M08A 2PMLX 2C0IA 3FKNA 3VS2A 2C6TA 3ZLSA 1FINA 3VO3A 3ZMMA 3ORTA 1PW2A 4GU9A 3RJCA 3ZSGA 3SG8A 1JNKA 4XG4A 4FSUA 4MXCA 4ZZOA 4AT3A 4D58A 4FV3A 2QNJA 3IGGA 5CSXA 3Q96A 3QGYA 3MH2A 2HK5A 3NR9A 3JY0A 3PWYA 3V6RA 2B9HA 4IADA 2W1GA 4M13A 2NRUA 4QTDA 3RAKA 3VC4A 5CASA 3FC2A 3R9DA 1F0QA 5HEZA 3AXWA 2XNBA 1H24A 1GZNA 4RVTA 4AS0A 3NUUA 4DGNA 4RFMA 4YNEA 1ZZ2A 2C0OA 4GH2A 1AGWA 3TIYA 2BRNA 4EOQA 5I9UA 3TT0A 3WIKA 3DY7A 4BDAA 4G6LA 3EB0A 4IZ7A 5ETFA 3PY0A 4EK5A 1Q5KA 3PA3A 3DKGA 4MQ1A 3MIAA 3KXGA 1DS5A 4NM7A 4AT5A 4EK4A 4ZIMA 4BKYA 4I6BA 3M2WA 4D0XA 4MWHA 4EBWA 2WB8A 1LUFA 3VBXA 4XV3A 2P2HA 4EHZA 4UMRA 3RK7A 4C4GA 4NT4A 4BCQA 1SVHA 3NYOA 3DDPA 5FD2A 3ZFMA 4EBVA 2V0DA 1PXKA 3Q53A 3ZO1A 4PMPA 4ID7A 5ANDA 4CMTA 1MRUA 2W4OA 2W5BA 2VWIA 4FSMA 3IOPA 4DN5A 2PMOX 4DEDA 3ZONA 2WMAA 3SV0A 3WBLA 1E1VA 5DNRA 2JIVA 3SKCA 5IMEA 1OGUA 4PL3A 4GUEA 4AE9A 4DC2A 3FXXA 3MA3A 4Y46A 1WVXA 3CS9A 1WMKA 3K5VA 5K0KA 3QL8A 2OH0E 4M68A 1OM1A 4QRCA 4EH7A 2J0JA 4MKCA 1QMZA 2BZHB 3KN6A 1RQQA 2P4IA 2FVDA 4I0SA 1FPUA 3MWUA 4E4LA 4C4EA 4WRGA 5CQUA 5EYMA 1YDTE 2BAKA 3GT8A 3LJ0A 5AUVA 3ULIA 3V8WA 4D2SA 3HA6A 2BRHA 1BKXA 4LMUA 2GPHA 3RPSA 3ALOA 4AZSA 4LV5A 3PFQA 4AX8A 2QQ7A 4FV1A 4I4EA 5I9ZA 5HO7A 4BDGA 4C3PA 5IQFA 1NVRA 4OUCA 5CAQA 2VGOA 3R0TA 3NGAA 3DK7A 3BGPA 3CPCA 2R3PA 2UZBA 2UZEA 3R22A 3ZH8A 5L6OA 5CEIA 1GJOA 2YIQA 3SDJA 4IEBA 3MESA 4O86A 4XOZA 4S34A 5D1JA 2JD5A 4BCHA 4DGLC 4BTKA 4EKLA 1OIRA 2ESMA 4S31A 4D2WA 3DNEA 4ENYA 3QCSA 3UQGA 3HKOA 5IEVA 2B9IA 3H0ZA 4RIXA 4EH9A 1GNGA 3DXNA 5E92A 1TQIA 2WHBA 4MH7A 5AR3A 4MK0A 3DV3A 2PWLA 4O7RA 1U59A 3VJNA 5B2LA 2X6EA 1PXNA 4KS7A 4O84A 5AUWA 4BY9E 2OLCA 4XBRA 3FXWA 3QZGA 2CKPA 3OHTA 4BKJA 1PXJA 1YKRA 4IACA 4C3RA 5E8XA 3AMYA 2R3KA 3VAPA 4AT4A 4PPAA 2R0UA 3V5LA 3PRIA 3ORZA 1OPKA 3TV7A 5LQFA 2UZLA 1UA2A 3P5KA 3QX2A 1SMHA 2BIKB 1UU3A 5IQIA 2JLDA 1AQ1A 5AV1A 1XQZA 2J4ZA 3GU6A 1Y91A 4R6VA 4O81A 1NVSA 3ZXTA 2ITZA 5FGKA 4DH3A 4DG0E 4BBMA 4O0TA 3FI3A 4QD6A 1XH8A 3EL8A 4FKRA 4XX9A 5CEOA 3VN9A 3F2NA 4YC3A 5JZNA 1FGKA 2G15A 4WG4A 4CV9A 4E7WA 4D9TA 5IZFA 2UVZA 3B8QA 4RWKA 3G15A 2JITA 2GTMA 5BPYA 3PRFA 3S4QA 4MBJA 1YI3A 1JSUA 2XBJA 4NEUA 3BELA 5JGDA 2WGJA 4QMVA 1Z5MA 3CKXA 5J7HA 4D4RA 5J9LA 3LFEA 4L6QA 2QODA 4YGAA 3BBTB 5L3AA 4YHTA 2WEVA 1WBOA 3R1NA 5TR6A 2HOGA 3ZRKA 2BZKB 3TM0A 2CJMA 1VYZA 3IONA 3E8CA 4ENXA 4NSTA 4YNOA 5JEBA 5IQBA 2V55A 4G9CA 5TF9A 5CAVA 4NJ3A 4RSSA 2UW0A 2Z60A 3FDNA 5AM6A 4FT0A 4RMZA 3C4WA 4U41A 4AZFA 3P1AA 3ACKA 4TYGA 5AWMA 4O0RA 2YCSA 3UQCA 4ITJA 3LFQA 2YFXA 3VUTA 4BGQA 3TIZA 2QOCA 3DJ7A 3O23A 4ZLZA 2REIA 2XRWA 3HLLA 5KZIA 1SNUA 2Y0AA 4LGDA 3V04A 4QOXA 5HVJA 4G5JA 5AR5A 1JKKA 1FGIA 2ITYA 2RG6A 3IECA 2H6DA 1W82A 3QRUA 4OTIA 3BGQA 5KBRA 3PWDA 3TUBA 5BYLA 4GYIA 5C01A 3PJ1A 2Y4PA 2XCKA 2XKCA 3FPQA 3KA0A 4ALVA 1OZ1A 4RZVA 3DBCA 4D9UA 4AW0A 5GZAA 4EK3A 2Q83A 3EKNA 2UVXA 3K54A 4OTDA 5EM7A 3LKMA 4F09A 4Y5HA 3G33A 5DBXA 4J99A 3QXPA 2BDJA 4I22A 2BDWA 4W4WA 4BF2A 4KBKA 3LMIA 2FYSA 4O91A 3LXPA 1UKHA 5C03A 1BL6A 3BEGA 3G90X 4GT4A 3QYWA 4RIWB 4Q9SA 3IOKA 2ONLA 4QQJA 5H8EA 1KUTA 4DHFA 1G3NA 1ZYJA 3UOKA 3Q5ZA 3PYYA 4QMQA 5AP4A 4G6NA 3FSKA 5G6VA 4TYIA 3EQHA 2JFLA 2W0JA 5EI6A 5E8SA 5IEXA 2UW6A 3CY3A 3TNQB 4HGSA 5EKNA 4IAYA 5KMLA 2R2PA 4FG8A 1UNGA 2OKRA 4X3JA 3T3UA 4FTCA 3RZFA 2OIBA 5CNNA 2GNGA 3EFKA 5K4JA 4FNZA 4R3RA 4QMMA 4QMUA 2WTWA 1Y57A 4F6UA 4QMPA 3UOJA 1PXIA 4ZSAA 4MD7E 5D12A 3PJ2A 4F9AA 2IPXA 4LV8A 4HVDA 2QG5A 3RTPA 5CSPA 3MY0A 2JBPA 3SGCA 4GW8A 4QMYA 5E8ZA 5KO1A 2CNQA 3F3TA 4JIAA 4E93A 3G2FA 5L8KA 1ZXEA 2C1BA 2JDSA 4RJ3A 2ZM3A 2OF4A 3ORPA 1CSNA 2VTSA 2P33A 2XZSA 3A7IA 3PA5A 4QMTA 4R8QA 3EQBA 2YABA 3PDTA 2YCFA 4W8DA 2OJJA 1WCCA 4M7IA 4M8TA 4A07A 3A7FA 4XS2A 4BCIA 1OUYA 4C34A 1AD5A 4JBVA 4QPMA 1B39A 1J3HA 3A60A 5E1SA 1PHKA 2GHGA 4OBPA 1TQMA 3NDMA 3ZUTA 4F9YA 5DHJA 1JKTA 3E3PA 3U6JA 1W7HA 4L7SA 5I3RA 4EOJA 1OKZA 2PMNX 1XH4A 2VTAA 4O0YA 5J87A 1XR1A 3Q60A 2VTRA 1R39A 3OOMA 4NUSA 4PDPA 3W18A 4MHAA 3KMUA 4XYFA 2CNVA 1B6CB 1ZOHA 2A1AB 4I92A 5AAFA 3TL8A 4CFWA 5LWNA 1IA8A 5AEPA 2W7XA 3NW7A 5HIBA 4TZRA 4FEVA 3WF6A 4LUEA 4DAWA 3C0GA 3MJ2A 1OITA 2UUEA 5ICPA 3DK3A 5IA4A 3HP2A 5CEPA 4S33A 2OXDA 3V51A 3SG9A 3VBQA 4TNBA 4CNHA 3T3VA 2R7IA 2X9FA 4F08A 4H58A 5IUGA 3D7ZA 5HU9A 3PTGA 4H39A 2X2LA 2AYPA 3OTUA 4IXPA 4CGAA 4Q9ZA 2FUMA 4AZEA 4O7WA 4ASEA 4GKIA 3CTJA 3FQSA 4IH8A 4D1ZA 2X1NA 2XIKA 5IH6A 2QU5A 2OI4X 3OFMA 5FP6A 4USFA 4A4LA 4CFUA 4PDOA 3MS9A 2V7OA 5EG3A 3D0EA 1IEPA 1PMUA 3R30A 1PXMA 4JDIA 4JLCA 3TKUA 4CXAA 4WSYA 4DFUA 4E26A 3W2OA 2IW8A 3VS3A 1F5QA 1YOMA 5BYYA 4FTMA 3LAUA 3PUPA 4A9UA 4FIFA 1BI7A 4AN3A 2NPQA 5CU2A 4FKLA 4WG3A 5ANJA 2W05A 2WPAA 2B4SB 4H1MA 3W2SA 4USEA 5CYIA 3OXTA 4WRSA 2WD1A 3NS9A 4E4MA 3ZZEA 3N9XA 4U7ZA 4O7YA 3BYUA 4UWBA 4UXLA 3PY3A 3QQGA 2FA2A 4FIIA 3PXRA 5D9HA 2RKUA 3AD6A 2W1IA 3O17A 5DRBA 4TWNA 3ZS5A 3FC1X 3QTRA 4Q5EA 3F2AA 4NW5A 4QTBA 2H9VA 2C6OA 4IWDA 4WUNA 2WAJA 2QOQA 4LFIA 4XJ0A 3LM0A 4EOMA 4P7EA 4F4PA 3PJCA 5EYKA 5B0XA 3HZTA 5BUIA 3UYSA 4N6ZA 3TUDA 4L52A 4LL5A 2PULA 5EQPA 2PVFA 1K3AA 2W1HA 3IDPA 3KXZA 4KA3A 3THBA 1YVJA 1XH5A 2H96A 4D55A 2VTHA 4FV4A 1XWSA 5CLPA 3LJ1A 4RX8A 1Q4LA 2UV2A 3LM5A 3ANQA 5BUEA 4IM2A 2Y6MA 3JXWA 5DRDA 4PP7A 3CLYA 3UNJA 4NK9A 3SA0A 3EQGA 1SM2A 2XKFA 3OMVA 2B52A 4U6RA 3LFBA 5FXSA 5H2UA 2R3JA 2ZV9A 1I44A 5FTQA 3RGFA 2CN8A 4FEUA 5A4QA 3VQHA 4L42A 5EHYA 4Y73A 5AUZA 4GFOA 2XH5A 3P7CA 4KB8A 4EC8A 3L8PA 1OUKA 5EK7A 2R3QA 1MQ4A 5BVWA 1ZY4A 4K18A 4YTFA 2GS6A 2WXVA 5DA3A 3E7VA 4IVAA 3SD0A 4ANOA 4W4XA 4O7NA 4XRLA 4RVLA 3UTOA 4W9WA 2C6LA 3E8DA 3UO4A 2V22A 5AR7A 1W98A 2PVHA 4FTKA 5HBEA 4DG2E 4I93A 1XBCA 5DEWA 5JFSA 4BDEA 2GQGA 1SVGA 3MPAA 4AU8A 4D0WA 5CF6A 3Q4CA 4K8AA 5KUPA 3HV6A 4BGHA 2HWOA 4NKSA 5M56A 3QLFA 4EONA 3NUAA 2W9ZB 3A4OX 4FKSA 4P4CA 1REJA 1ZAOA 3EOCA 4O0XA 4L44A 2QOHA 5ACKA 4ZTSA 3R8VA 1Q8YA 2IZUA 3R7VA 4I23A 4O96A 1ZMUA 2BR1A 3GFWA 4CQGA 2BTSA 1J7LA 1FVRA 4QPAA 3TKIA 3OWKA 2I1MA 4NM0A 4EJNA 3VS1A 1VJYA 2ITUA 2VTIA 4JG8A 2IG7A 3OTVA 5CF8A 3HX4A 3EWHA 3NNVA 4YC8A 5C4LA 2PY3A 4QMXA 3NSZA 1KOBA 2XIZA 1OL5A 3K3JA 4CFFA 3DBQA 4RZWA 4KWPA 2XBAA 3BYOA 4IAIA 4CSVA 1ND4A 1REKA 2G9XA 2C4GA 2W1ZA 5HG9A 3UNZA 1TKIA 1LPUA 4L53A 2OJGA 3KMMA 3VUMA 1Q41A 5T68A 5A4TA 4PP9A 3V5WA 1A9UA 4PPCA 5HLPA 4ZTQA 1CKIA 5C4KA 4JT3A 3CJFA 3LE6A 4JVGA 2ONLC 3QQHA 4FOBA 2XA4A 4LRKA 4ITIA 4ZJJA 4GKHA 4YP8A 1IASA 3KULA 3MA6A 4J1RA 1H0VA 2HXLA 2WTCA 2ZOQA 5JFVA 4XBUA 3BRBA 4RC4A 1OKVA 2XB7A 2VTPA 1H00A 5EH0A 3W10A 2YAKA 1V0OA 3UPXA 4EWHA 4EH6A 5AMNA 4G6OA 3KREA 4Y95A 4EZ5A 3L1SA 2I0EA 2X8IA 4FOCA 4RLKA 4QYGA 3UIMA 1UNHA 2YEXA 2FGIA 3ZRLA 4BDIA 3MI9A 4ZSEA 4Z7HA 4WOVA 1DAYA 4IHPA 3W16A 2AC3A 2ITOA 3HP5A 5J9YA 2ETRA 1JVPP 2XUUA 5AP7A 4OTFA 4ZSJA 2VTNA 4GV1A 4QMZA 5A3XA 4C57A 4DTKA 3KGAA 2J0LA 3FQEA 3BU3A 4BTFA 3KKVA 2O63A 1KE9A 3C0HA 3FLSA 3O8UA 4FT3A 4GG5A 4FKWA 4RIXB 4RA5A 3V5PA 3AC3A 4PWNA 5K9IA 4GFMA 4C4IA 3NW6A 2ZMCA 4A4OA 3WZKA 4I20A 3PXFA 4KKHA 2LAVA 3A2CA 3F82A 2OZOA 4XG9A 5AUUA 5HORA 3HRFA 3PIYA 2ZM1A 5C26A 4FI1A 2IJMA 2IZSA 5GJGA 3JY9A 2QURA 3R9NA 4ACHA 2O3PA 1DAWA 4K11A 4DT8A 1KWPA 4L8MA 2WMTA 2R3MA 3GU8A 3MH1A 4F63A 5J8IA 2PTKA 4O7SA 4UWYA 3QKLA 2BVAA 2WMQA 1RE8A 4BL1A 5IISA 2GHLA 3PLSA 5BVFA 3DOGA 4UXQA 1PXOA 2B1PA 4NZWB 2PYWA 3PVUA 3POZA 4O0VA 2Y4IB 2OO8X 3NYNA 3AMAA 2XJ2A 2C30A 2PVRA 2OZAA 2WQNA 3HMNA 4IE9A 5EOBA 1DM2A 3A7HA 4FIHA 3RI1A 2RFEA 1JSVA 3ZLYA 3HV4A 4YJSA 2AC5A 5GHVA 2PVNA 2JKQA 4I21A 5JGAA 4MNEA 4IWOA 3S1HA 3ZFYA 3DAKA 3TNIA 4USDA 4F7LA 3TZ7A 4K1BA 4N70A 3FLWA 3HV5A 4OGRA 4XHKB 3LFCA 4YZBA 3FMNA 1Y6BA 2I0VA 3TG1A 3PZEA 2R3RA 2GHMA 2J7TA 5I3OA 3R8UA 4IM3A 3WZUA 4EC9A 3F69A 2XYUA 3ATSA 3TJCA 1JSTA 2BILB 5CTPA 1DI9A 4IWPA 3HVCA 5HCXA 1H28A 5IDNA 5TT7A 1KE6A 3CGOA 4E8AA 3WARA 1GZKA 3KQ7A 3OY3A 3QRJA 3R1SA 2FB8A 3FHRA 3Q2MA 4IAZA 3VW8A 3ZM4A 2IVSA 1U4DA 2BKZA 2R7BA 3HA8A 3C4CA 2PUPA 4WKQA 3ZEPA 2CHLA 3L8SA 1YWVA 2B53A 4EK8A 3GC0A 2ZVAA 3QTQA 4XG7A 5FDPA 3A99A 4DFLA 3V8SA 5AV2A 2GMXA 4AN9A 1OL6A 3QQUA 4HJOA 4BN1A 1JAMA 2YLFA 3RVGA 2WZJA 4HGEA 2FO0A 3DKCA 1PKGA 1BYGA 1H26A 2WTKB 3CPBA 4IX5A 3VBYA 3NZ0A 2VO7A 3QCXA 3R71A 5DG5A 4JDJA 5FEEA 2CN5A 4AGUA 3R9RA 5J5SA 2GNFA 4FTAA 4HZRA 3W55A 3BI6A 3NAYA 4FKQA 2JGZA 3RAIA 3HV3A 2XK8A 2EVAA 3E88A 4C3FA 2QG7A 4GJ2A 2X9EA 3EMGA 2UZWE 1Y8YA 4YTIA 2OWBA 2VTMA 4ZZNA 2CPKE 2VNWA 4S30A 3NEWA 4HNFA 1PF8A 2XKEA 4FSWA 5IMXA 2VTQA 3TV4A 5L6PA 4QYHA 4TWPA 5ANKA 5EOLA 5AR4A 4L7FA 4FNWA 4JDKA 1LR4A 4UYNA 3DZOA 5FBNC 3W2CA 4D4SA 1Q24A 2BIYA 3CE3A 4GIIA 5LVPA 2WMVA 5H8GA 4BZOA 5DE2A 5A6NA 4K9YA 1RJBA 2JDRA 3CKWA 4ANQA 5KBQA 4E6CA 3R7GA 5F20A 5CXHA 1FVTA 2BTRA 4C62A 1CDKA 1M17A 2GNHA 2VTJA 3LCOA 4W4YA 1UKIA 2ERKA 2G01A 2OJFE 3QUPA 4IC8A 3OXIA 3WF7A 4NFMA 4AXAA 3BPRA 4ZJVA 5HU3A 3PA4A 2QHMA 3O2MA 2X2MA 1YXSA 3MB6A 3QZFA 5A6OA 1PMEA 3OCBA 5CSHA 4EQUA 2F7XE 4LOQA 4YZNA 3QUDA 3R9OA 2YDKA 4E5WA 3F88A 3PVWA 4E6QA 3IW6A 3BYMA 5H3QA 4ZXTA 3LQ8A 3OY1A 5J5TA 2JC6A 5GZ9A 5B7VA 3AC8A 5AP3A 3OCGA 4WUAA 5CANA 1CM8A 4RX5A 3G9LX 3GCQA 4Y5QA 2GQSA 4FSYA 3HEGA 3QTXA 2YHVA 4FGRA 1JLUE 5CY3A 4JS8A 3JS2A 2C5XA 4AUAA 4OR5A 4AA0A 2QKRA 2XJ0A 3ACJA 2WTDA 3OW4A 3QTIA 1PJKA 2QHNA 3PXKA 4HPUE 5DT3A 3C7QA 5F9EA 1XKKA 4RWLA 3MVJA 3A7GA 4YR8A 4ZY5A 4IZ5A 4PQNA 4YBKA 4RJ4A 4C4HA 4CFNA 4YJQA 3ZXZA 4YZ9A 3KVWA 3MH3A 5FEQA 5HX6A 3UC4A 4G3CA 2E9PA 3E87A 3PG3A 3FJQE 4ACGA 4DITA 4DFZE 2YISA 2Z8CA 4YJVA 1UU9A 4XV9A 4DBNA 4EZ7A 4RJ7A 2BUJA 2YM6A 3AC1A 4WIHA 2O0UA 2OK1A 2OGVA 1KV1A 1RW8A 4AAAA 4EH3A 1ZYDA 2RFNA 2X6DA 2R3LA 1P4OA 3VF9A 3AC4A 3I0OA 4ZLYA 5M06A 3QZIA 4KUJA 2GTNA 1CTPE 1ZY5A 3IGOA 1YW2A 4JR7A 3H4JA 4AW2A 3PSBA 3R63A 4PDYA 3ORKA 4M15A 1ZMWA 4GSBA 5F94A 2P3GX 2G2FA 2WQEA 4YHFA 5F95A 3TZ8A 2PE2A 3SX9A 4E4XA 3FI4A 5CALA 3W8QA 2X39A 3L9PA 3LHJA 4RG0A 4V01A 3BQRA 3MB7A 3KCKA 5DR9A 4I24A 3QWJA 4IFGA 5LMAA 3U6IA 4MXZA 5IKWA 4YLJA 3EN6A 3EIDA 4E6AA 1OI9A 1Q97A 3EKKA 3PY1A 1XHAA 4YZCA 3TTJA 5DT0A 5E8WA 1YDRE 2C3IB 5BVDA 3A8WA 3ET7A 4LUDA 4WO5A 4BZDA 2LGCA 3KL8A 2OIQA 4U81A 3DGKA 2CSNA 5DWRA 4NCTC 3RMFA 3ZLWA 2BDFA 4DFNA 4OAVB 2OW3A 3AMBA 2V62A 4CKJA 2PL0A 1YWNA 4HVGA 4BI2A 5A14A 3AGMA 3CQEA 4TYHA 2J2IB 3VULA 3CP9A 4N0SA 3AC2A 4PL5A 4BYJA 3W33A 3ZDIA 4D2VA 4FTJA 3D5XA 3UOLA 4U44A 4BVUA 2Y9QA 3G9NA 4XLIA 2VWZA 4ZSLA 3BV3A 2H8HA 2UVYA 5EDRA 2PE1A 4ALUA 2E2BA 5CAPA 3RPRA 4YUQA 3VQUA 3QZHA 1M7QA 5HLNA 4H36A 4PV0A 1BMKA 4FC0A 3OCTA 5CX9A 5L2WA 5IQHA 5TE0A 5AR2A 3MFTA 4BDJA 4F99A 3UC3A 5HHWA 4ZEGA 1F3MC 3LIJA 4A9SA 4EI4A 2X8EA 2UW9A 5EW9A 4EYMA 3I1AA 4MD9E 4O6LA 5DFPA 4HW7A 3UODA 4X6RA 1FQ1B 3H0YA 2C6EA 2QKWB 3QGWA 4BCKA 4QO9A 2BZIB 4E5BA 5M4CA 1H25A 2JAMA 4GS6A 3RBWA 3GXLA 2JDOA 3CQWA 3LVPA 4DT9A 5AUYA 3BV2A 3GU4A 3F7WA 4I5MA 2HY0A 4MEDA 3E8NA 4FZAB 3VUKA 2R3FA 3K5UA 3IG7A 4YJTA 3Q9WA 3UO5A 5DGZA 2W06A 4UX9A 3PLAE 4OTWA 4HYHA 1VR2A 2UZDA 3NCGA 3QUEA 2EXCX 2J51A 4TKSA 5HE1A 1YXXA 3PSDA 4Z3VA 5FTGA 5LCJA 4RT7A 3WF9A 3QD4A 2VWYA 4H3QA 4FSRA 4FVRA 4IAKA 4YJNA 2W4KA 5CS6A 3FE3A 1WBNA 1QPDA 4U45A 3R8ZA 3F3UA 2HZIA 4XEYA 4CTBA 3FZRA 3UZPA 4FSQA 3OOGA 1Q8UA 3W32A 2O8YA 2EWAA 4DEEA 3AT2A 2JEDA 2ZDTA 4G5PA 3SC1A 4JI9A 3ERKA 5EW8A 5IU2A 3E62A 5IQDA 2YERA 3UIUA 4NIFA 3O8TA 2XK4A 5BQ0A 2CGVA 3KY2A 3BWJA 4BYIA 2BZJA 2XIYA 3ZO2A 5KMOA 1JKSA 1ZRZA 1JBPE 3E93A 2XK3A 3FMJA 4GFGA 5EM6A 3U9NA 5LJJA 4KIKB 3FY0A 3BCEA 4FV6A 3C50A 4FR4A 3C4FA 4QP6A 1MP8A 4R7BA 4S32A 2IVUA 4TYEA 2J9MA 2RG5A 4JQ8A 4JQ7A 5ACBC 4FYOA 1U5RA 1J7IA 4PPBA 3OD6X 4FYNA 2JAVA 3DLSA 3H30A 4I5CA 3F7ZA 1XH7A 4IW0A 5EI8A 4HVSA 5CVGA 2E9NA 5J1WA 5M07A 5J79A 2XNPA 3FL5A 3PVBA 3PXYA 4IJPA 3RWQA 2XMYA 4DH5A 1Q3WA 5JZJA 2JDTA 3EQIA 1PXPA 2B9FA 3UMWA 3MYGA 4ZTNA 2J0MB 2PK9A 3MPMA 1PYXA 3OVVA 3RK9A 3OBJA 1UU8A 3KULB 3FZTA 3BLHA 3HDMA 3ODZX 2G2HA 3N4UA 2IW9A 3U51A 3F5XA 5HESA 3U4WA 4BBEA 5JQ8A 4NJDA 3NVKI 4YSJA 2BROA 3F3VA 2Y8OA 3DBEA 4IB1A 2YIYA 4NTSA 2ZJWA 5LMBA 2GNJA 2WEIA 4U43A 3KF7A 2YIXA 4Z9LA 3L8XA 3SQQA 5CAUA 5M4IA 4BWPA 4AGWA 4IIRA 4M84A 2B0QA 1H08A 2WIHA 1TVOA 1YHVA 4C59A 5J9ZA 1OKWA 4R3PA 2CGUA 3GCPA 4PDSA 4P90A 5T3QA 3MPTA 1W83A 2XVDA 5E7RA 3F61A 3P7BA 3HAMA 3GOKA 3QX4A 5FXQA 5IQEA 3VHKA 2BHHA 2C5OA 1KE7A 3EJ1A 4QP2A 3P08A 3PPKA 5A4EA 2I7QA 3Q52A 2R3IA 4U42A 2XNMA 3DCVA 3QXOA 4OTGA 4OBQA 4CCBA 5A4CA 1YXUA 2RGPA 3AD5A 3A8XA 4DH1A 3ZC5A 1Y8GA 4RJ5A 4RQVA 4HVIA 4MX9A 5HICA 2V5QA 4QP4A 1KE5A 4X2KA 4BGGA 5CEMA 5K0XA 1GZOA 4BWKA 4LGHA 5M51A 3KC3A 4BFMA 3ENHA 5EQYA 2YIWA 4J95A 2XJ1A 4FVPA 2R9SA 4DH8A 5KMIA 3WYXA 4PNIA 5HD7A 3D14A 2J6MA 3FMEA 4I0RA 3R28A 4PF4A 2YITA 4DINA 5HNIX 2EXMA 2Z2WA 2BRMA 3VUGA 2WTJA 2X0GA 4WA9A 5HG8A 4TY1A 3ANRA 5FWKK 3TJDA 4DTAA 3KXXA 5JSMA 2VWXA 3F9NA 4CFXA 4YC6A 5FLFA 3ORNA 4K6ZA 2VX0A 2JKOA 3HYHA 4L00A 2OZAB 3FLNC 3QF9A 4G1WA 4X2JA 3JPVA 5E8TA 2B55A 5J95A 1ZOEA 3F66A 3MVHA 4X3FA 3EN4A 5AR8A 4NFNA 4B4LA 3GB2A 4TWCA 3FLYA 3M1SA 4MNEB 4DFBA 2Q0NA 2QOFA 1H1PA 3NUXA 5DT4A 5M4UA 4QTEA 2BALA 3T9TA 4V04A 4AOJA 1VZOA 3MIYA 3QU0A 4XOYA 5JH6A 4F7SA 2OJIA 3OS3A 3FWQA 5ETCA 2IW6A 2UZOA 4AGCA 4D5HA 3VVHA 4DFXE 3BWFA 5M09A 4XCUA 5F4NA 3KN5A 2J0KA 5IA3A 4FGBA 4YTCA 4ZZMA 4GEOA 2IN6A 2WELA 3ENMA 3QA0A 5KE0A 2G2IA 3UP7A 3G6HA 3MDYA 4TL0A 4LRMA 3UG1A 5T6KA 3GUBA 5HBJA 2PMIA 2YN8A 3ITZA 4CD0A 3KU2A 4DCAA 1GOLA 4QYYA 2C69A 5EHLA 3VS5A 2VO0A 3TXOA 3LOKA 1PKDA 2ZB1A 1R0EA 3GI3A 4PRJA 3UVRA 4BIBA 4DEIA 3QQJA 4HOKA 3QQKA 3TZMA 3I7CA 4HYUA 2WQOA 5DOSA 3I81A 4XG2A 3FPMA 1YHWA 4R5SA 4OW8A 4ZTLA 3E64A 4L01A 4V0GA 3NX8A 4ZK5A 3R83A 3NVMB 3SHEA 4FG7A 3O50A 2RF9A 3QTZA 3ID6C 3WZEA 5AADA 4RLLA 3V01A 3Q9YA 3CR0A 2NP8A 1QPEA 4J8MA 5G1XA 2QO2A 4BTJA 4FF8A 4I4FA 4MD8E 3S0OA 2GS2A 3UIXA 3HRBA 4C2WA 4FV9A 4AZTA 4FTTA 1W84A 4YJUA 3I6UA 3IPHA 4WBOA 5I9XA 4YPDA 2UW5A 3WE4A 5DMZA 3BHTA 4J96A 3Q4ZA 2OFVA 4KAOA 4IB0A 4QYEA 3CD8A 2OSCA 2WMXA 5H8BA 3WOWA 2EB3A 1NVQA 3OC1A 2BHEA 4XG8A 1STCE 1V0PA 3UVQA 5AA8A 1P14A 4YLKA 3FMDA 3MN3A 2WQMA 4BBFA 3NPCA 1IAHA 3U4UA 2WU7A 3E7OA 4HYSA 4UN0C 4NW6A 2O5KA 3H3CA 5HTBA 5JN2A 2WMRA 4TTHB 5K3YA 1YOJA 3ATTA 2VO6A 3PIXA 4RFZA 4I0TA 1BLXA 2ZM4A 3I60A 1P4FA 4XP0A 5M55A 3SOAA 3VJOA 4G9RA 2EU9A 3ZCLA 1G8AA 1H1QA 2GQRA 2YDIA 3OXZA 4ACCA 3MVMA 3UG2A 4MCVA 4F0GA 5AFVA 2ITQA 1MRYA 3BEAA 5CENA 4BZNA 3UNKA 3DBDA 3ZM9A 3SW4A 2JBOA 4UY9A 3D94A 2W1DA 4B9DA 4QMWA 1UNLA 2HELA 4WNKA 1ZLTA 4L3JA 4U40A 4IM0A 2GSFA 5J1VA 3VHEA 3CTQA 5LVLA 4G3EA 4EH4A 3JYAA 5LOHA 1CKJA 3BHUA 3FMMA 2XNGA 2B54A 3DDQA 4GL9A 4DH7A 4E73A 4QYFA 5EM5A 5I9YA 3PE1A 2EXEA 2IVVA 5DN3A 3RK5A 1OVEA 4H3PA 4CFVA 4O7LA 4M66A 1UVRA 3W2QA 5GNKA 4EH5A 4RC3A 1H1RA 1ZZLA 4YTHA 3V5TA 3QA8A 3DA6A 4PTCA 1LEZA 2HW6A 2PZRA 2DUVA 3FL4A 4XH6A 5DH3A 3IW4A 3GP0A 2W99B 2ITNA 4FUYA 5L2TA 3Q9ZA 3RPVA 4U3YA 2I0YA 3MTFA 4IC7A 4RIYA 2O65A 5CQWA 2BMCA 3O51A 3K2LA 2XRUA 2VWVA 4EYJA 1R1WA 3JUHA 3R8PA 5HX8A 5J7BA 3DPKA 4OT5A 1S9IA 3PJ3A 4QP7A 1J1BA 3D5UA 5DEYA 3R6XA 2X81A 4FBXA 4AW5A 5FUTA 4L68A 2VNYA 3I5NA 3OBGA 2QR7A 3I6WA 3RM7A 2GS7A 4LL0A 4Z7GA 4ASDA 3HGKA 4C8BA 5AP0A 4M97A 3O0GA 4FZ7A 2B9JA 5HOAA 3EZRA 5A9UA 4CRSA 1T45A 4IDTA 3ZRMA 3KK8A 4KNBA 2VWUA 1P5EA 4FNYA 2OXYA 3KRRA 4EHVA 3NUNA 4XRJA 4D1SA 3QTWA 1NT2A 1PYEA 3M11A 3NIZA 1MRVA 1APME 2F57A 4TWOA 3SVVA 1O6YA 1XH6A 3REPA 4M67A 2W5AA 5C9CA 3UE4A 2UZTA 3FEGA 1UU7A 3FXZA 4AA4A 3VUDA 5KMKA 3LZBA 5CT0A 4OT6A 3F5GA 4M0ZA 2VTTA 4IVCA 4RWJA 5CF4A 2W4JA 1V1KA 2VD5A 3DU8A 4HYIA 2QU6A 5IA0A 4BB4A 3KCFA 4XP2A 4EH8A 4WD5A 2BFYA 4WSQA 4CEGA 4ASXA 1ZYCA 1ZOGA 5HG7A 1QPCA 5FQDC 2HWPA 5AP6A 1WVWA 3G0FA 3O7LB 3KXHA 4IB5A 5HE0A 5D7AA 3BGZA 4UEUA 2CDZA 2RIOA 3EN5A 4JR3A 4ZTHA 2W9FB 5BVOA 3ETAA 4KIPA 3IO7A 4MXAA 4ANNA 4R3CA 5E1EA 4FKJA 1YI6A 2HZ0A 3ZDUA 4C4JA 5ANIA 4AOTA 1OPLA 3P23A 3QCYA 2EB2A 4CCUA 1PY5A 1BI8A 2HZ4A 3AT3A 4NM3A 5HLWA 2C47A 5KHWA 4ZS4A 4NCTA 4LMNA 4AGDA 4TYHB 4FNXA 4MF0A 4NKAA 4O38A 3IQ7A 3Q32A 1H07A 4AFJA 2CKOA 1XBAA 4AACA 4IANA 2F9GA 4IMYA 5I4NA 3FLZA 3DXQA 3GNIB 4YSMA 4E4NA 5I0BA 3Q04A 2WOTA 1FMKA 2CLQA 3CY2A 4DGOA 5JT2A 3OZ6A 4J8NA 5L2QA 3OEZA 5IH5A 3LFAA 4NTTA 4QMNA 4E1ZA 2UZNA 3S2PA 2BRBA 3D7TA 4RVKA 4LOOA 2Z7SA 5HVYA 1KSWA 4H3BA 3C51A 4X3FC 3TV6A 4U79A 1Q62A 4D2PA 2W5HA 4GK4A 4I1ZA 5ETIA 3WIGA 2YWPA 2F7EE 4FTQA 3H10A 3ODYX 3B8RA 1YOLA 3PZHA 4YBJA 2VTLA 2VRXA 4EOPA 3NYXA 3RCJA 3LCSA 3N51A 3DXPA 3LXLA 1NA7A 3ORXA 4AFEA 1NW1A 4CYIA 3G5DA 3IKAA 2XNOA 4KKEA 3DKOA 5GIOE 5F1ZA 4JL9A 4R78A 4L67A 3QC9A 1JKLA 3PP0A 5KMNA 3BLRA 3G0EA 2JDVA 1HCKA 2IO6A 1Q8ZA 3EFJA 5HCYA 2WQBA 3ZC6A 1OMWA 1YXVA 3QTSA 1FMOE 4L43A 5JKGA 4G17A 3Q3BA 5E9EA 2VU3A 1J91A 1WVYA 5C8NA 4O22A 4HNIA 5A4LA 2QOKA 5FP5A 2PUIA 4JDHA 4O7VA 2VWWA 2Z7RA 3V5QA 2Z7QA 4FVQA 3EN9A 4QMLA 4AZWA 2A19B 3D9VA 4C35A 2PVYA 4MQ2A 2C0TA 4FTNA 1WAKA 3ZU7A 3G6GA 2QLUA 3QQLA 3VBVA 4BCMA 4BI0A 5I9VA 3C1XA 4RJ8A 4CQEA 4HPTE 3ELJA 3H9OA 3H9RA 3BHYA 5IQAA 4EHEA 4FZ6A 2E9UA 2QD9A 5EW3A 5BX0A 4FT7A 4HGLA 5GJFA 5DYJA 1GIJA 3DNDA 4UB7A 4ZY6A 4BC6A 5BNJA 3QBNA 4IJ9A 2BAJA 4NIFB 3UGCA 4C36A 2FSOX 3U55A 5M57A 4JXFA 4UZDA 3UBDA 4BCFA 5L2IA 3QHWA 2DWBA 3QRTA 5FG8A 4FKIA 3BU6A 3D5WA 3ZUVA 3NIEA 4I6QA 1QL6A 4ZJIA 3HNGA 1OL2A 5KMJA 5LVMA 3GBZA 3MW1A 3R9HA 1U46A 2FH9A 2ZV2A 3B2WA 5AUXA 3V6SA 4C33A 1ZYLA 4AP7A 2XIRA 2CCIA 3T9IA 4BCJA 3FI8A 1J7UA 4F9WA 4WBBB 4PUZA 2JKKA 5EDPA 2WKMA 1U54A 4EEVA 1VYWA 2X7FA 3MJ1A 5L2SA 3LXKA 5ETAA 2OICA 4QNYA 4YURA 5HO6A 5HIDA 2R3NA 4YJRA 3KFAA 4FEQA 2BFXA 3AG9A 4FL3A 2PZYA 4TNDA 3RWPA 4YMJA 2OFUA 3HMOA 4I6HA 3F3WA 4Y85A 3ZO4A 5D41A 3U54A 3LLAA 3R04A 1XH9A 3O7LD 4KBCA 4MVFA 2C5VA 3IW8A 3KRJA 4MNFA 4MBLA 3I79A 4JRVA 4KABA 4PMTA 4TW9A 3VUHA 1KV2A 5CAOA 4J7BA 4WNPA 2XM9A 5IDPA 2I40A 3COKA 1YWRA 2P55A 3FUPA 3EQFA 5AIKA 4KBAA 3DTCA 3BE2A 5TKDA 1YI4A 3DKFA 4GVAA 4XLVA 5ANOA 4G31A 4N57A 5TO8A 4GUBA 3RHKA 3IS5A 1HOWA 4G3FA 3R7EA 3UQFA 5A54A 4J97A 4UMQA 4W8EA 4GYGA 4JBPA 3UPZA 3PG1A 4R7IA 2W17A 2OG8A 4LYNA 4PY1A 4EOLA 5HKMA 4U8ZA 4D2TA 4DLIA 1YDSE 5HIEA 2VAGA 4FV7A 5CVHA 3C9WA 3LXNA 5DI1A 4NM5A 5IA1A 3DBFA 4G16A 1FOTA 4DCEA 2X7GA 2UW4A 5BYZA 3RALA 2HXQA 2OIDA 2VWBA 3FMKA 3R7IA 2I0HA 4AWIA 3N4VA 5L6WL 4K0YA 4Q5HA 4B8MA 4O0UA 3U6HA 4ERKA 5ITAA 5FM2A 4UMPA 3DZQA 5BMMA 3BIZA 2CGXA 3WZDA 3BQCA 3EYGA 5CI6A 3R7UA 3HAVA 3OW3A 4O1OA 5AIRA 5KKRC 3EL7A 4R1YA 2KULA 2UW8A 4EUUA 3KB7A 4U97A 3R73A 3C4EA 1GIHA 2FSTX 4FTRA 4BCGA 4DEHA 4EOKA 4EOSA 2CKEA 4O6EA 1WFCA 5B2MA 4LGGA 5HE3A 2C6KA 3KRLA 5FEDA 1J1CA 4BWXA 3DJ6A 4EK6A 4X3FB 2X7OA 3NUPA 3TTIA 3DFCB 2QO7A 4CZUA 4C4FA 2A2AA 5EKOA 2UZUE 2OH4A 1H1SA 2YM4A 3FV8A 4CZYB 3TUCA 4XMOA 4KSPA 1DI8A 3PP1A 4FV8A 3CGFA 4K77A 4RQKA 1ZYSA 4D4YA 4KIQA 1URWA 2VUWA 2E9OA 4FODA 2IZTA 3ZBFA 4H1JA 5EM8A 4DA5A 3ORMA 4C37A 1NXKA 3Q6WA 5DR2A 4ZS0A 4FKPA 4PTGA 3NCZA 2RFSA 1ATPE 3QC4A 3QKKA 4M69A 5AJQA 3ULZA 2YM3A 4FV5A 4CKIA 4WG5A 4EH2A 4M0YA 1WZYA 4WHZA 3VIDA 4EKKA 4FSNA 3AOXA 2XS0A 4F9CA 4RX9A 2C3JA 4IVDA 4IDVA 4IVBA 3B2TA 4IX4A 5EHOA 5BVKA 1H0WA 2H34A 2YJSA 1P2AA 4UBAA 4FZDB 2QC6A 3R2BA 3RNYA 4BTMA 5DLSA 4DFYA 4V0GB 1A48A 3VS7A 2YIRA 2PUNA 4MWIA 2YZAA 1LP4A 4XG6A 3P9JA 3FZ1A 4EJ7A 2WMSA 3QD2B 5JFWA 4E20A 1OB3A 3Q2JA 2XEYA 1Q61A 4LQMA 2R3GA 3ZTXA 3LCTA 3QAME 3GVUA 2BKKA 4BDKA 2VX3A 3OWPA 1OL1A 2X2KA 3VBTA 5E4HA 4CLIA 3DAJA 5CEKA 2PVJA 3RAWA 3BYVA 3DB8A 4L9IA 2XCHA 3RM6A 4NU1A 4A9TA 5HTCA 3KXMA 4BDHA 5L4QA 1H8FA 1KE8A 3CSVA 3SRVA 3P86A 1IRKA 5CU3A 3ZLXA 3HRCA 4LRJA 3JVRA 4U9AA 4APCA 4NL0A 4U5JA 3TEIA 3G51A 3OEFX 4FL2A 1IA9A 5HCZA 5IQCA 5M4FA 2C6IA 3F5PA 1K2PA 4GVJA 3FQHA 3W1FA 3BKBA 5E91A 4GU6A 4BIDA 4IAFA 4ITHA 4RRVA 5DPVA 3C5IA 2XK6A 3BX5A 2F49A 5CEQA 3LMHA 5HD4A 5CT7A 4JOAA 3IW7A 3GFEA 4YLLA 3OUNB 4HCVA 3D2IA 2R5TA 4IX6A 2W1FA 4MXXA 3CEKA 3SXFA 3HMPA 4G3GA 4CVAA 5A46A 3CTHA 3IK3A 4X2NA 1Q3DA 3AT4A 4BHNA 1H01A 4AQCA 4FTOA 4EOOA 1R3CA 2PU8A 1PMVA 3UP2A 3V8TA 5AUTA 1MUOA 3JVSA 4UWCA 4B0GA 2GDOA 4H05A 4CG8A 4DE4A 4FZFB 2EUFB 5L8LA 4KRDA 4O21A 2O64A 3QKMA 1JOWB 3TNHA 1Z57A 1W8CA 2F4JA 3NYVA 3I7BA 2ZV7A 2C5YA 5DR6A 5TOZA 5HI2A 4CFMA 3ALNA 2JIUA 3D2KA 3L8VA 3BBWA 1YHSA 4QP1A 1L3RE 1HCLA 3MSSA 3WZJA 5K5NA 1ZMVA 2WMBA 4CTCA 5GIPE 2ZV8A 4TRLA 2QOLA 4F64A 3KF4A 4O27B 2YAAA 4EOIA 3DB6A 3FZPA 4KS8A 3IDCA 3A4PA 2P2IA 4FKTA 3OWJA 2QOIA 4PX6A 4AG8A 2YM5A 3R7OA 3LJ2A 4BDCA 2XKDA 1O6KA 5D10A 3WYYA 4RIYB 4XUFA 5EFQA 3EYHA 4XP3A 1R78A 1XBBA 4BDFA 4GRBA 4GK3A 3MY1A 4DYMA 4O83A 4II5A 2SRCA 1T46A 3O96A 3P79A 4R77A 3LFDA 1H27A 5DVRA 2QONA 1BX6A 3QD0A 3TACA 5KCVA 4JAIA 3H9FA 4FSTA 5JQ5A 4RVMA 4FKGA 2CMWA 3DAEA 1BL7A 3NNWA 4FKUA 4F70A 4FT5A 1W0XC 5CSVA 3GOPA 3HDNA 3RCDA 3R21A 3RNIA 3FI2A 4OTRA 5KKRB 2HAKA 4W4VA 4FTLA 4A4XA 2PVLA 2UW3A 3E63A 5AP5A 3SLSA 5JGBA 3I0QA 3QWKA 3CD3A 4JNWA 4O1PA 4CKRA 3TNWA 4C02A 4XG3A 4ZMEA 4IZAA 1GZ8A 4U80A 5CZIA 4ZTMA 1JWHA 3DK6A 4PMMA 5JRSA 4FICA 1M7NA 4IZYA 3N4TA 4ANBA 2DS1A 2X8DA 2PPQA 2QVSE 4FG9A 5CVFA 4JIKA 4KRCA 4ANMA 4B99A 4GIHA 1SZMA 1ERKA 5E90A 1KOAA 3UVPA 1SNXA 2Y6OA 2YLEA 1JQHA 3Q6UA 1L8TA 2AUHA 3P78A 1OECA 2YDJA 4RFYA 3OP5A 1OIQA 4YZMA 5HQ0A 5BUJA 4AOIA 3BZ3A 4EORA 3OT3A 5EI2A 4AW1A 1G5SA 4HCUA 1V0BA 2HYYA 4LOPA 5KNJA 4LG4A 4M12A 2E9VA 4BRXA 2XF0A 4KD1A 4WNMA 3QQFA 4ZP5A 3T8OA 2HIWA 2WMWA 3LW0A 4FTUA 5CI7A 2C5NA 4YO6A 3FKLA 3LLTA 2OF2A 4QTAA 3IDBA 5AV3A 4RGJA 3U87A 4LM5A 3HL7A 2XP2A 4P5ZA 5IA5A 3QALE 4TYJA 4UMUA 5HVKA 3RINA 4I94A 1OIYA 5JFXA 1Q8WA 3BU5A 4F1OA 5E8YA 3L9LA 4FA2A 3D5VA 4OTQA 2XK9A 4R7HA 5HG5A 2XYNA 1NY3A 3ZYAA 5C8KA 3EHAA 5I9WA 4BI1A 3VNTA 4EWQA 4PTEA 2KTYA 3QLGA 2BRGA 3EZVA 3E8EA 3KXNA 4C7TA 5IF1A 2GCDA 3GCUA 3LQ3A 3CBLA 4Y8DA 4KIOA 2WFYA 4P5QA 5CU6A 4A9YA 3D7TB 3K3IA 2OJ9A 3LPBA 3II5A 2R64A 4RA4A 2QLQA 4UMTA 4YHJA 3VS4A 3HMMA 4D5KA 3COMA 2ETMA
chains in the Genus database with same CATH superfamily
1M2QA 2IWIA 2VO3A 3TKHA 4L45A 5HO8A 2ZMDA 3ZSHA 1G8SA 2VX1A 3FHIA 1I09A 3GU7A 3GEQA 5BVEA 5CSWA 2J0IA 4QMSA 2GFCA 4K2RA 1GIIA 3FMLA 4TXCA 3DQWA 4EUTA 5FDXA 5HE2A 1VEBA 5DIAA 4CT1A 3QYZA 4L46A 5LVNA 3MBLA 4J98A 4CT2A 5BVNA 4MXOA 4NH1A 4QQCA 5D7VA 3NMUF 1U5QA 2FSMX 1UWHA 4M14A 4CYJA 2YA9A 1PMNA 2C3KA 4E5AX 5JRQA 2QCSA 4IX3A 5AM7A 3RP9A 4S2ZA 4M3QA 4I5PA 3HV7A 4QP8A 4J71A 3KK9A 3NUYA 2HZNA 2R4BA 4QT1A 2QO9A 3UO6A 3GQIA 3FZSA 5I5ZA 3OCSA 3KMWA 2CLXA 5HBHA 4Y83A 1H4LA 1M14A 3NAXA 4O0SA 3F3ZA 1GAGA 4OTPA 3CCNA 4X2FA 4ZOGA 5AV0A 2PE0A 3FLQA 4FSZA 5CU4A 3ZO3A 2F2UA 4WNOA 2J50A 4CLJA 5IUIA 3C4XA 3OROA 2J5EA 3LFSA 3S3IA 3LCDA 3SXRA 4X0MA 4N4SA 3LFNA 4ACMA 4A9RA 5IPJA 4EZ3A 4GG7A 3TCPA 5HGIA 4MXYA 3UDBA 2J5FA 1IG1A 2WNTA 4X6QC 3LMGA 5HNGA 3NLBA 3GC9A 4F7NA 4O7ZA 4YZDA 2ZB0A 5IA2A 3NNXA 1M2PA 5E8UA 3F2RA 5KZ0A 3MFRA 2X4FA 5KMMA 3ZOSA 4WT6A 4C38A 4QPSA 3AC5A 2X4ZA 3PPZA 5CWZA 3COIA 1MQBA 3VW6A 3FZOA 4ONAA 5LMKA 2C1AA 3Q4TA 2HY81 1XMMA 5EQEA 4A7CA 3I4BA 3VS0A 2PSQA 3TI1A 4GT5A 3UZTA 4Q2AA 1CMKE 4ZAUA 3ZUUA 4F7JA 4B8LA 3AQVA 1M2RA 3FKOA 3OUKA 4IWQA 1U54B 4NYEA 4KSQA 5LCKA 5FM3A 3U9CA 3CQUA 3NUSA 1B38A 4UZHA 5AV4A 2YCQA 2A0CX 3W8LA 4JRNA 4D1XA 3CJGA 3RPYA 3GQLA 2OU7A 2QI8A 2GNIA 2WU6A 3FSFA 1GY3A 3ORLA 1SVEA 5AP2A 5AX9A 3RAHA 4CG9A 3OF0A 3UZRA 1WBWA 2QOOA 4P2KA 3PIZA 4FUXA 3I5ZA 3ZHPC 2O2UA 4TN6A 4DLJA 2AQXA 2Y4IC 2WMUA 2R3OA 4BCOA 3EN7A 3NW5A 5K5XA 2FSLX 4J53A 2PZIA 2HENA 4FV2A 4FT9A 4RWIA 1SYKA 2ZYBA 2JKMA 4DEBA 1FBNA 5FBOA 2OBJA 3FYJX 4ZY4A 4O2PA 2YM8A 4UALA 4EQMA 3R8MA 2XNNA 3HUBA 4UYAA 4ACDA 3PPJA 5KX8A 1OL7A 3O71A 4F1TA 4V05A 4C61A 3BE9A 4Z16A 1Y6AA 4AZVA 5AAGA 4XNEA 3KEXA 4F0FA 2W96B 1Z9XA 3UDSA 4AF3A 5E8VA 1EH4A 2F7ZE 4I41A 4FE2A 3FAAA 3MTLA 3PJ8A 1H1WA 2CCHA 2OXXA 2WTVA 2WTIA 3SW7A 1M52A 2R3HA 1OBGA 3ZSIA 4B7TA 3O8PA 4L3PA 2BPMA 3NRMA 1YXTA 4G3DA 4QQTA 5BMSA 2PVMA 3L9MA 5AX3A 2QOBA 3RZBA 2VTOA 4GMYA 3EQPA 4YJOA 4YPSA 3BL7A 5LVOA 4B6LA 3TDVA 5FTOA 5CF5A 1XO2B 2ITTA 4FEXA 2VGPA 2XM8A 4QQ5A 3VBWA 3VRZA 3VONA 2PZ5A 2WTKC 4R1VA 4ARKA 3UMXA 3UIBA 4A06A 2YWVA 3WILA 4IBMA 5K4IA 1S9JA 4RBLA 3P7AA 5EYDA 2YJRA 5IG1A 1WBTA 2ACXA 5ANEA 5M44A 3EFWA 4BDDA 4JBOA 3W2PA 4D4VA 5LARA 5AA9A 2ITPA 4KKGA 3A7JA 1LEWA 4APPA 1ZWSA 2WIPA 3F5UA 4FL1A 3R7YA 4FIEA 4IQ6A 4QP9A 4BDBA 3VF8A 3TWJA 4FV0A 4RJ6A 4JQEA 4KIKA 3S95A 4MTAA 4FKVA 4MYGA 3DS6A 3CC6A 3GGFA 4EHGA 3P0MA 4EQCA 3D4QA 4O82A 4CZTA 4ZMFA 2W1CA 1OIUA 3ROCA 3GC8A 5AAEA 4OBOA 4HVHA 4O7TA 1UV5A 5JMSA 3EFLA 4W9XA 3R1QA 3GC7A 2RSVA 4IB3A 4FEWA 1K9AA 4ZTRA 5CZHA 3QRIA 3QRKA 2A27A 3PUFC 4M69B 1TQPA 3ZZWA 4DTBA 2C68A 4K33A 3HUCA 4RIWA 1YQJA 4X7QA 3ROYA 4FMQA 4E6DA 4YO4A 3DQXA 3ZBXA 2J90A 3MH0A 3WF5A 3E3BX 4OTHA 4FIGA 4RIOA 2HCKA 2C6DA 2VN9A 4PMSA 4FK6A 4YU2A 5IH4A 3NNUA 3VUIA 2YM7A 1WBSA 4DBXA 1A06A 3R02A 3KVXA 4AA5A 3R00A 4ASZA 2ITVA 3C13A 3MGYA 3L9NA 4L3LA 4NWMA 3MVLA 3UOHA 4AN2A 4JX3A 4C0TA 3OG7A 5CNOA 4BCNA 3TN8A 1QCFA 5GJDA 2IZRA 2XK7A 1E1XA 2PUUA 2XARA 4BHZA 4D28A 4CRLA 3EQRA 3GCVA 2ERZE 2G1TA 4MF1A 3W2RA 5FXRA 3RHXA 2I6LA 2PHKA 2PZPA 3KRXA 4X21A 4BCPA 3DLZA 5IUHA 4RX7A 3JR1A 3D15A 4XV1A 4DG3E 3BHHA 3POOA 4FK3A 3E5AA 3R01A 4ZSGA 1CKPA 1Q99A 3SRVB 2Z7LA 1XJDA 2IVTA 2Q0BA 2JIIA 1OKYA 3KRWA 3C4ZA 4TPTA 3U8WA 3WF8A 4F6SA 2GFSA 2CKQA 2ZDUA 4C2VA 5C1QB 1OPJA 1X8BA 3QTUA 5M53A 2YCRA 4F6WA 2HW7A 1RDQE 3ZEWA 5CU0A 2GU8A 3VRYA 3LCKA 4U0IA 3WE8A 3P4KA 2DQ7X 3OWLA 4ERWA 3QD3A 2C6MA 2W1EA 2WOUA 3MV5A 4DGGA 1URCA 1QPJA 4MBIA 3TYKA 3R1YA 4DEGA 4JAJA 4RPVA 3OT8A 5EDQA 5H9BA 2C3LA 4Z55A 3TDWA 4DEAA 4I5HA 4BIEA 4QP3A 4BICA 3BLQA 4U3ZA 4IAAA 1O9UA 4CMUA 2P0CA 3F6XA 5HZNA 4F65A 3GENA 2UZVA 3SOCA 3BYSA 3ORIA 4GK2A 3SAYA 4J52A 1O6LA 3PSCA 3DFAA 3FY2A 2GNLA 4AE6A 2A4LA 2ETKA 5IEYA 3NWWA 3UJGA 4YJPA 4C58A 1YRPA 5KHXA 4DGMA 2XNEA 2BAQA 5C27A 3PXZA 4QNAA 3FBVA 3FYKX 4KINA 2XEZA 1PXLA 4GJ3A 3LQ5A 5LXMA 2F2CB 4D2RA 1IR3A 2YACA 3MFUA 4RC2A 3VWAA 3HMIA 5C8MA 4ORKA 3WI6A 4F1MA 2NO3A 3EQDA 4BKZA 3HECA 4E3CA 5HTIA 2CNUA 5B2KA 2IF8A 1E9HA 2ITWA 4IFCA 4XV2A 4JBQA 2YZLA 3LFFA 4MAOA 5HNBA 4PL4A 3D83A 3TZ9A 4OAUC 4I3ZA 1Q8TA 3S00A 2QR8A 3AKKA 5LMKC 3CIKA 3FMHA 3MFSA 4HZSA 2ZAZA 2Y7JA 3DJ5A 4CV8A 4JX7A 3Q5IA 2NNWB 1IAJA 3UYTA 4DF3A 1PRYA 3MY5A 3TNPC 2DYLA 2NRYA 5GINE 3M42A 2B7AA 2UW7A 4FKOA 4G2FA 1OBDA 2Z02A 4I6FA 5FRIA 2RL5A 1JPAA 4FX3A 4CMOA 4X2GA 4O0WA 2VZ6A 2V7AA 3ZFXA 4JG6A 4R5YA 3AD4A 4PNKA 4BJJB 2ITXA 3AGLA 5EYCA 4OLIA 1UWJA 5D11A 4AXEA 4GT3A 2R0IA 3Q9XA 4F0IA 2CGWA 4JJRA 4FIJA 3PVGA 2RFDA 3BHVA 3R8LA 3EH9A 4ZLOA 4BR3A 3A61A 1BUHA 3EQCA 3IW5A 5JK3A 3V5JA 3GU5A 3A62A 4LI5A 5AP1A 1WBVA 2BCJA 4GCJA 5L8JA 5GZ8A 4O2ZA 5LWMA 3QCQA 4F9BA 3C0IA 4FTIA 5IQGA 3R2YA 4EL9A 2VV9A 4ALWA 1WBPA 3C5UA 3V3VA 3GCSA 5CXZA 3E92A 2PVKA 1ZARA 4QMOA 2WO6A 5ANGA 3RKBA 3QHRA 4G34A 4QTCA 3CXWA 4UV0A 3VS6A 3QFVA 4ANSA 2XIXA 3PE2A 3DT1A 4N6YA 4TT7A 4Y72A 3DTWA 4JG7A 3SXSA 2JFMA 1FVVA 4HCTA 3COHA 4HGTA 3Q4UA 3RPOA 1R0PA 3PXQA 4ANLA 5M08A 2PMLX 2C0IA 3FKNA 3VS2A 2C6TA 3ZLSA 1FINA 3VO3A 3ZMMA 3ORTA 1PW2A 4GU9A 3RJCA 3ZSGA 3SG8A 1JNKA 4XG4A 3W0MA 4FSUA 4MXCA 4ZZOA 4AT3A 4D58A 4FV3A 2QNJA 3IGGA 5CSXA 3Q96A 3QGYA 3MH2A 2HK5A 3NR9A 3JY0A 3PWYA 3V6RA 2B9HA 4IADA 2W1GA 4M13A 2NRUA 4QTDA 3RAKA 3VC4A 5CASA 3FC2A 3R9DA 1F0QA 5HEZA 3AXWA 2XNBA 1H24A 1GZNA 4RVTA 4AS0A 3NUUA 3ML1A 4DGNA 4RFMA 4YNEA 1ZZ2A 2C0OA 4GH2A 1AGWA 3TIYA 2BRNA 4EOQA 5I9UA 3TT0A 3WIKA 3DY7A 4BDAA 4G6LA 3EB0A 4IZ7A 5ETFA 3PY0A 4EK5A 1Q5KA 3PA3A 3DKGA 4MQ1A 3MIAA 3KXGA 1DS5A 4NM7A 4AT5A 4EK4A 4ZIMA 1W2DA 4BKYA 4I6BA 3M2WA 4D0XA 4MWHA 4EBWA 2WB8A 1LUFA 3VBXA 4XV3A 2P2HA 4EHZA 4UMRA 3RK7A 4C4GA 4NT4A 4BCQA 1SVHA 3NYOA 3DDPA 5FD2A 3ZFMA 4EBVA 2V0DA 1PXKA 3Q53A 3ZO1A 4PMPA 4ID7A 5ANDA 4CMTA 1MRUA 2W4OA 2W5BA 2VWIA 4FSMA 3IOPA 4DN5A 2PMOX 4DEDA 3ZONA 2WMAA 3SV0A 3WBLA 1E1VA 5DNRA 2JIVA 3SKCA 5IMEA 1OGUA 4PL3A 4GUEA 4AE9A 4DC2A 3FXXA 3MA3A 4Y46A 1WVXA 3CS9A 1WMKA 3K5VA 5K0KA 3QL8A 2OH0E 4M68A 1OM1A 4QRCA 4EH7A 2J0JA 4MKCA 1QMZA 2BZHB 3KN6A 1RQQA 2P4IA 2FVDA 4I0SA 1FPUA 3MWUA 4E4LA 4C4EA 4WRGA 5CQUA 5EYMA 1YDTE 2BAKA 3GT8A 3LJ0A 5AUVA 3ULIA 3V8WA 4D2SA 3HA6A 2BRHA 1BKXA 4LMUA 2GPHA 3RPSA 3ALOA 4AZSA 4LV5A 3PFQA 4AX8A 2QQ7A 4FV1A 4I4EA 5I9ZA 5HO7A 4BDGA 4C3PA 5IQFA 1NVRA 2IEWA 4OUCA 5CAQA 2VGOA 3R0TA 3NGAA 3DK7A 3BGPA 3CPCA 4O4CA 2R3PA 2UZBA 2UZEA 3R22A 3ZH8A 5L6OA 5CEIA 1GJOA 2YIQA 3SDJA 4IEBA 3MESA 4O86A 4XOZA 4S34A 5D1JA 2JD5A 4BCHA 4DGLC 4BTKA 4EKLA 1OIRA 2ESMA 4S31A 4D2WA 3DNEA 4ENYA 3QCSA 3UQGA 3HKOA 5IEVA 1ST0A 2B9IA 3H0ZA 4RIXA 4EH9A 1GNGA 1XMLA 3DXNA 2NYAA 5E92A 1TQIA 2WHBA 4MH7A 5AR3A 4MK0A 3DV3A 2PWLA 4O7RA 1U59A 3VJNA 5B2LA 2X6EA 1PXNA 4KS7A 4O84A 5AUWA 4BY9E 2OLCA 4XBRA 3FXWA 3UDTA 3QZGA 2CKPA 3OHTA 4BKJA 1PXJA 1YKRA 4IACA 4C3RA 5E8XA 3AMYA 2R3KA 3VAPA 4AT4A 4PPAA 2R0UA 3V5LA 3PRIA 3ORZA 1OPKA 3TV7A 5LQFA 2UZLA 1UA2A 3P5KA 3QX2A 1SMHA 2BIKB 1UU3A 5IQIA 2JLDA 1AQ1A 5AV1A 1XQZA 2J4ZA 3GU6A 1Y91A 4R6VA 4O81A 1NVSA 3ZXTA 2ITZA 5FGKA 4DH3A 4DG0E 4BBMA 4O0TA 3FI3A 4QD6A 4DDGA 1XH8A 3EL8A 4FKRA 4XX9A 5CEOA 3VN9A 3F2NA 4YC3A 5JZNA 1FGKA 2G15A 4WG4A 4CV9A 4E7WA 4D9TA 5IZFA 2UVZA 3B8QA 4RWKA 3G15A 2JITA 2GTMA 5BPYA 3PRFA 3S4QA 4MBJA 1YI3A 2ZFYA 1JSUA 2XBJA 4NEUA 3BELA 5JGDA 2WGJA 4QMVA 1Z5MA 3CKXA 5J7HA 4D4RA 5J9LA 3LFEA 4L6QA 2QODA 4YGAA 3BBTB 5L3AA 4YHTA 2WEVA 1WBOA 3R1NA 5TR6A 2HOGA 3ZRKA 2BZKB 3TM0A 2CJMA 1VYZA 3IONA 3E8CA 4ENXA 4NSTA 4YNOA 5JEBA 5IQBA 2V55A 4G9CA 5TF9A 5CAVA 4NJ3A 4RSSA 2UW0A 2Z60A 3FDNA 5AM6A 4FT0A 4RMZA 3C4WA 4U41A 4AZFA 3P1AA 3ACKA 4TYGA 5AWMA 4O0RA 2YCSA 3UQCA 4ITJA 3LFQA 2YFXA 3VUTA 4BGQA 3TIZA 2QOCA 3DJ7A 3O23A 4ZLZA 2REIA 2XRWA 3HLLA 5KZIA 1SNUA 2Y0AA 4LGDA 3V04A 4QOXA 5HVJA 4G5JA 5AR5A 3BL9A 1JKKA 1FGIA 2ITYA 2RG6A 3IECA 4AXCA 2H6DA 1W82A 3QRUA 4OTIA 3BGQA 5KBRA 3PWDA 3TUBA 5BYLA 4GYIA 5C01A 3PJ1A 2Y4PA 2XCKA 2XKCA 3FPQA 3KA0A 4ALVA 1OZ1A 4RZVA 3DBCA 4D9UA 4AW0A 5GZAA 4EK3A 2Q83A 3EKNA 2UVXA 3K54A 4OTDA 5EM7A 3LKMA 4F09A 4Y5HA 3G33A 5DBXA 4J99A 3QXPA 2BDJA 4I22A 2BDWA 4W4WA 4BF2A 4KBKA 3LMIA 2FYSA 4O91A 3LXPA 1UKHA 5C03A 1BL6A 3BEGA 3G90X 4GT4A 3QYWA 4RIWB 4Q9SA 3IOKA 2ONLA 4QQJA 5H8EA 1KUTA 4DHFA 1G3NA 1ZYJA 3UOKA 3Q5ZA 3PYYA 4QMQA 5AP4A 4G6NA 3FSKA 5G6VA 4TYIA 3EQHA 2JFLA 2W0JA 5EI6A 5E8SA 5IEXA 2UW6A 3CY3A 3TNQB 4HGSA 5EKNA 4IAYA 5KMLA 2R2PA 4FG8A 1UNGA 2OKRA 4X3JA 3T3UA 4FTCA 3RZFA 2OIBA 5CNNA 2GNGA 3EFKA 5K4JA 4FNZA 4R3RA 4QMMA 4QMUA 2WTWA 1Y57A 4F6UA 4QMPA 3UOJA 1PXIA 4ZSAA 4MD7E 5D12A 3PJ2A 4F9AA 2IPXA 4LV8A 4HVDA 2QG5A 3RTPA 5CSPA 3MY0A 2JBPA 3SGCA 4GW8A 4QMYA 5E8ZA 5KO1A 2CNQA 3F3TA 4JIAA 4E93A 3G2FA 5L8KA 1ZXEA 2C1BA 2JDSA 4RJ3A 2ZM3A 2OF4A 3ORPA 1CSNA 2VTSA 2P33A 2XZSA 3A7IA 3PA5A 4QMTA 4R8QA 3EQBA 2YABA 3PDTA 2YCFA 4W8DA 2OJJA 1WCCA 4M7IA 4M8TA 4A07A 3A7FA 4XS2A 3NFGB 4BCIA 1OUYA 4C34A 3O5AA 1AD5A 4JBVA 4QPMA 1B39A 1J3HA 3A60A 5E1SA 1PHKA 2GHGA 3BLAA 4OBPA 1TQMA 3NDMA 3ZUTA 4F9YA 5DHJA 1JKTA 3E3PA 3U6JA 1W7HA 4L7SA 5I3RA 4EOJA 1OKZA 2PMNX 1XH4A 2VTAA 4O0YA 5J87A 1XR1A 3Q60A 2VTRA 4DHJA 1R39A 3OOMA 4NUSA 4PDPA 3W18A 4MHAA 3KMUA 4XYFA 2CNVA 1B6CB 1ZOHA 2A1AB 4I92A 5AAFA 3TL8A 4CFWA 5LWNA 1IA8A 5AEPA 2W7XA 3NW7A 5HIBA 4TZRA 4FEVA 3WF6A 4LUEA 4DAWA 3C0GA 3MJ2A 1OITA 2UUEA 5ICPA 3DK3A 5IA4A 3HP2A 5CEPA 4S33A 2OXDA 3V51A 3SG9A 3VBQA 4TNBA 4CNHA 3T3VA 2R7IA 2X9FA 4F08A 4H58A 5IUGA 3D7ZA 5HU9A 3PTGA 4H39A 2X2LA 2AYPA 3OTUA 4IXPA 4CGAA 4Q9ZA 2FUMA 4AZEA 4O7WA 4ASEA 4GKIA 3CTJA 3FQSA 4IH8A 4D1ZA 2X1NA 2XIKA 5IH6A 2QU5A 2OI4X 3OFMA 5FP6A 4USFA 4A4LA 4CFUA 4PDOA 3MS9A 2V7OA 5EG3A 3D0EA 1IEPA 1PMUA 3R30A 1PXMA 4JDIA 4JLCA 3TKUA 4CXAA 4WSYA 4DFUA 4E26A 3W2OA 2IW8A 3VS3A 1F5QA 1YOMA 5BYYA 4FTMA 3LAUA 3PUPA 4A9UA 4FIFA 1BI7A 4AN3A 2NPQA 5CU2A 4FKLA 4WG3A 5ANJA 2W05A 2WPAA 2B4SB 4H1MA 3W2SA 4USEA 5CYIA 3OXTA 4WRSA 2X0OA 2WD1A 3NS9A 4E4MA 3ZZEA 3N9XA 4U7ZA 4O7YA 3BYUA 4UWBA 4UXLA 3PY3A 3QQGA 2FA2A 4FIIA 3PXRA 5D9HA 2RKUA 3AD6A 2W1IA 3O17A 5DRBA 4TWNA 3ZS5A 3FC1X 3QTRA 4Q5EA 3F2AA 4NW5A 4QTBA 2H9VA 2C6OA 4IWDA 4WUNA 2WAJA 2QOQA 4LFIA 4XJ0A 3LM0A 4EOMA 4P7EA 4F4PA 3PJCA 5EYKA 5B0XA 3HZTA 2A98A 5BUIA 3UYSA 4N6ZA 3TUDA 4L52A 4LL5A 2PULA 5EQPA 2PVFA 1K3AA 2W1HA 3IDPA 3KXZA 4KA3A 3THBA 1YVJA 1XH5A 2H96A 4D55A 4QDVA 2VTHA 4FV4A 1XWSA 5CLPA 3LJ1A 4RX8A 1Q4LA 2UV2A 3LM5A 3ANQA 5BUEA 4IM2A 2Y6MA 3JXWA 5DRDA 4PP7A 3W0PA 3CLYA 3UNJA 4NK9A 3SA0A 3EQGA 1SM2A 2XKFA 3OMVA 2B52A 4U6RA 3LFBA 5FXSA 5H2UA 2R3JA 2ZV9A 1I44A 5FTQA 3RGFA 2CN8A 4FEUA 5A4QA 3VQHA 4L42A 5EHYA 4Y73A 5AUZA 4GFOA 2XH5A 3P7CA 4KB8A 4EC8A 3L8PA 1OUKA 5EK7A 2R3QA 1MQ4A 5BVWA 1ZY4A 4K18A 4YTFA 2GS6A 2WXVA 5DA3A 3E7VA 4IVAA 3SD0A 4ANOA 4W4XA 4O7NA 4XRLA 4RVLA 3UTOA 4W9WA 2C6LA 3E8DA 3UO4A 2V22A 5AR7A 1W98A 2PVHA 4FTKA 5HBEA 4DG2E 4I93A 1XBCA 5DEWA 5JFSA 4BDEA 2GQGA 1SVGA 3MPAA 4AU8A 4D0WA 5CF6A 3Q4CA 4K8AA 5KUPA 3HV6A 4BGHA 2HWOA 4NKSA 5M56A 3QLFA 4EONA 3NUAA 2W9ZB 3A4OX 4FKSA 4P4CA 1REJA 1ZAOA 3EOCA 4O0XA 4L44A 2QOHA 5ACKA 4ZTSA 3R8VA 1Q8YA 2IZUA 3R7VA 1TZDA 4I23A 4O96A 1ZMUA 2BR1A 3GFWA 4CQGA 2BTSA 1J7LA 1FVRA 4QPAA 3TKIA 3OWKA 2I1MA 4NM0A 4EJNA 3VS1A 1VJYA 2ITUA 2VTIA 4JG8A 2IG7A 3OTVA 5CF8A 3HX4A 3EWHA 3NNVA 4YC8A 5C4LA 2PY3A 4QMXA 3NSZA 1KOBA 2XIZA 1OL5A 3K3JA 4CFFA 3DBQA 4RZWA 4KWPA 2XBAA 3BYOA 4IAIA 4CSVA 1ND4A 1REKA 2G9XA 2C4GA 2W1ZA 5HG9A 3UNZA 1TKIA 1LPUA 4L53A 2OJGA 3KMMA 3VUMA 1Q41A 5T68A 5A4TA 4PP9A 3V5WA 1A9UA 4PPCA 5HLPA 4ZTQA 1CKIA 5C4KA 4JT3A 3CJFA 3LE6A 4JVGA 2ONLC 3QQHA 4FOBA 2XA4A 4LRKA 4ITIA 4ZJJA 4GKHA 4YP8A 1IASA 3KULA 3MA6A 4J1RA 1H0VA 2HXLA 2WTCA 2ZOQA 5JFVA 4XBUA 3BRBA 4RC4A 1OKVA 2XB7A 2VTPA 1H00A 5EH0A 3W10A 2YAKA 1V0OA 3UPXA 4EWHA 4EH6A 5AMNA 4G6OA 3KREA 4Y95A 4EZ5A 3L1SA 2I0EA 2X8IA 4FOCA 4RLKA 4QYGA 3UIMA 1UNHA 2YEXA 2FGIA 3ZRLA 4BDIA 3MI9A 4ZSEA 4Z7HA 4WOVA 1DAYA 4IHPA 3W16A 2AC3A 2ITOA 3HP5A 5J9YA 2ETRA 1JVPP 2XUUA 5AP7A 4OTFA 4ZSJA 2VTNA 4GV1A 4QMZA 5A3XA 4AQKA 4C57A 4DTKA 3KGAA 2J0LA 3FQEA 3BU3A 4BTFA 3KKVA 2O63A 1KE9A 3C0HA 3FLSA 3O8UA 4FT3A 4GG5A 4FKWA 4RIXB 4RA5A 3V5PA 3AC3A 4PWNA 5K9IA 4GFMA 4C4IA 3NW6A 2ZMCA 4A4OA 3WZKA 4I20A 3PXFA 4KKHA 2LAVA 3A2CA 3F82A 2OZOA 4XG9A 5AUUA 5HORA 3HRFA 3PIYA 2ZM1A 5C26A 4FI1A 2IJMA 2IZSA 5GJGA 3JY9A 2QURA 3R9NA 4ACHA 2O3PA 1DAWA 4K11A 4DT8A 1KWPA 4L8MA 2WMTA 2R3MA 3GU8A 3MH1A 4F63A 5J8IA 2PTKA 4O7SA 4O4DA 4UWYA 3QKLA 2BVAA 2WMQA 1RE8A 4BL1A 5IISA 1W2CA 2GHLA 3PLSA 5BVFA 3DOGA 4UXQA 1PXOA 2B1PA 4NZWB 2PYWA 3PVUA 3POZA 4O0VA 2Y4IB 2OO8X 3NYNA 3AMAA 2XJ2A 2C30A 2PVRA 2OZAA 2WQNA 3HMNA 4IE9A 5EOBA 1DM2A 3A7HA 4FIHA 3RI1A 2RFEA 1JSVA 3ZLYA 3HV4A 4YJSA 2AC5A 5GHVA 2PVNA 2JKQA 4I21A 5JGAA 4MNEA 4IWOA 3S1HA 3ZFYA 3DAKA 3TNIA 4USDA 4F7LA 3TZ7A 4K1BA 4N70A 3FLWA 3HV5A 4OGRA 4XHKB 3LFCA 4YZBA 3FMNA 1Y6BA 2I0VA 3TG1A 3PZEA 2R3RA 2GHMA 2J7TA 5I3OA 3R8UA 4IM3A 3WZUA 4EC9A 3F69A 2XYUA 3ATSA 3TJCA 1JSTA 2BILB 5CTPA 1DI9A 4IWPA 3HVCA 5HCXA 1H28A 5IDNA 5TT7A 1KE6A 3CGOA 4E8AA 3WARA 1GZKA 3KQ7A 3OY3A 3QRJA 3R1SA 2FB8A 3AKLA 3FHRA 3Q2MA 4IAZA 3VW8A 3ZM4A 2IVSA 1U4DA 2BKZA 2R7BA 3HA8A 3C4CA 2PUPA 4WKQA 3ZEPA 2CHLA 3L8SA 1YWVA 2B53A 4EK8A 3GC0A 2ZVAA 3QTQA 4XG7A 5FDPA 3A99A 4DFLA 3V8SA 5AV2A 2GMXA 4AN9A 1OL6A 3QQUA 4HJOA 4BN1A 1JAMA 2YLFA 3RVGA 2WZJA 4HGEA 2FO0A 3DKCA 1PKGA 1BYGA 1H26A 2WTKB 3CPBA 4IX5A 3VBYA 3NZ0A 2VO7A 3QCXA 4FJVA 3W0RA 3R71A 5DG5A 4JDJA 5FEEA 2CN5A 4AGUA 3R9RA 5J5SA 2GNFA 4FTAA 4HZRA 3W55A 3BI6A 3NAYA 4FKQA 3W0SA 2JGZA 3RAIA 3HV3A 2XK8A 2EVAA 3E88A 4C3FA 2QG7A 4GJ2A 2X9EA 3EMGA 2UZWE 1Y8YA 4YTIA 2OWBA 2VTMA 4ZZNA 1G8JA 2CPKE 2VNWA 4S30A 3NEWA 4HNFA 1PF8A 2XKEA 4FSWA 5IMXA 2VTQA 3TV4A 5L6PA 4QYHA 4TWPA 5ANKA 5EOLA 5AR4A 4L7FA 4FNWA 4JDKA 1LR4A 4UYNA 3DZOA 5FBNC 3W2CA 4D4SA 1Q24A 2BIYA 3CE3A 4GIIA 5LVPA 2WMVA 5H8GA 4BZOA 5DE2A 5A6NA 4K9YA 1RJBA