4IACA

X-ray structure of camp dependent protein kinase a in complex with high mg2+ concentration, amp-pcp and pseudo-substrate peptide sp20
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
total genus 111
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iacA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iacA02
4GS6A 3DXPA 3PG3A 4AGDA 2FH9A 2VTOA 4D2WA 4DGGA 4K18A 5CASA 4ACMA 4FSTA 4UN0C 3JYAA 4FKTA 3R83A 2JIIA 3QKLA 4HGEA 5B0XA 4FSRA 4BIEA 2CGWA 4I4FA 1H4LA 3ZRKA 5I9XA 3OY3A 4P90A 3HA8A 4D4RA 4PMSA 4DINA 4TRLA 3ZEPA 1LUFA 3POZA 4TL0A 2QR7A 5CAQA 3BU6A 5HCYA 2W99B 2BRMA 4OR5A 4NCTA 3TV4A 1YOJA 1XQZA 5IF1A 2R3KA 4AT5A 5C9CA 2P33A 2X7FA 3KMUA 4GT5A 2W06A 4RGJA 3BWFA 1VJYA 3CLYA 5AR4A 4CFNA 4YTIA 4MK0A 4X0MA 2VU3A 3OCBA 2WPAA 4XG7A 1SVEA 4F6WA 2Z7SA 2GHGA 3K54A 2QURA 3EH9A 2B53A 3QL8A 4FICA 3UZTA 4KWPA 4F1OA 3BV2A 1J1BA 2XNGA 3A7FA 3HAMA 1OL7A 3FXWA 4FTRA 5F1ZA 5HE2A 5IA4A 3PXKA 5GIPE 3C13A 3IKAA 3MV5A 4TYJA 4L9IA 5HLPA 2QO9A 1GY3A 3R8LA 3ROCA 2EWAA 3VAPA 4BDDA 2B1PA 3C4FA 4FIIA 4TTHB 5EM7A 3SW4A 3F7ZA 3ZLWA 3UG1A 4FV5A 3OY1A 4S30A 5C8KA 3AC1A 3VWAA 5M4IA 3ITZA 3LJ2A 3OOGA 3QRIA 4NCTC 3WZJA 3GCQA 4L3LA 2CNUA 3PRIA 5CVHA 4AZSA 1YHVA 1TVOA 5KBRA 4DGLC 3QCXA 4MBIA 2PVKA 3ZO4A 5A6NA 4IJPA 1OKYA 3IPHA 3NNXA 4RBLA 4USEA 5DLSA 2YFXA 3KXGA 5IZFA 4F7JA 5DBXA 4GH2A 4KKHA 1QL6A 3AT3A 1JSTA 3WF6A 5K0KA 4QMVA 3R7VA 3MI9A 3FPMA 5KMIA 4RJ7A 3KXZA 1QCFA 3AC2A 3PJ2A 3SGCA 2YZLA 2BFYA 3MVMA 3ORIA 4YJTA 4JQEA 4FG9A 2H96A 3WARA 4NW6A 3Q32A 5JQ5A 3RM7A 2OJIA 3AMYA 2BZIB 3IOPA 4Q5HA 4YTCA 1JBPE 4BRXA 4DAWA 3MTFA 5CSXA 1HCLA 3NW5A 4RIXB 3VS4A 1M17A 1NVRA 3QZFA 2B55A 4HVGA 5AM7A 1ZOEA 3HL7A 3ANRA 3LLTA 5CEQA 4BYIA 4OBQA 4B8MA 2BRBA 5ANGA 4O7YA 4ASXA 2F49A 4HGSA 4FEXA 5DYJA 2PMOX 3T8OA 4NM0A 2VWXA 2X2LA 2WB8A 3BIZA 4EEVA 1FMOE 4I93A 2UVXA 3BU5A 3E64A 2X2KA 4IXPA 2YWVA 4WBBB 4ZSEA 4AA5A 4NFNA 3I5ZA 4KINA 2W1HA 3H10A 5EK7A 2A4LA 1LR4A 2HIWA 4CYJA 1APME 3FQHA 3D4QA 3F5XA 5FGKA 3C5IA 4WRSA 2ITPA 3ZSGA 4DA5A 1ZYJA 2J5FA 3M2WA 4J96A 4FK3A 3VIDA 2JIUA 3ENMA 4FIJA 3ZM4A 2WMQA 2OSCA 3WF9A 4U41A 1R3CA 1ZYSA 4IFGA 3I7BA 2UZEA 3IW6A 3RPSA 4EZ7A 2PZRA 5DH3A 2Z60A 4PNIA 4RFMA 4BZNA 4EWQA 2OJFE 4EH2A 4YNEA 3VW6A 3DTWA 3MVHA 4U45A 3UNJA 4ASZA 4C62A 3FXXA 3VUGA 2JFLA 5LXMA 4A9SA 3B2WA 3Q5IA 4FNXA 3QU0A 2DYLA 4W4XA 1R78A 2IVTA 2WELA 2ZJWA 4Y83A 5LARA 3IOKA 5H8BA 1MRYA 2QOOA 3QZHA 2WMWA 4JQ8A 4G3CA 1NW1A 5TKDA 4YLKA 3PXQA 4E4MA 4A4LA 1W84A 3FMDA 4M97A 2ITXA 3QTRA 4RC3A 3DNDA 4QPMA 2VGPA 2VUWA 3FMMA 5TE0A 4CCUA 4CGAA 3V8WA 2VX3A 1I44A 3EFJA 1XH4A 3JVRA 4HZSA 2QODA 3THBA 2YEXA 4H1MA 3VC4A 2YM6A 4NUSA 3UG2A 3G9LX 5IEVA 4ZSAA 1G3NA 2C6EA 4C59A 2DS1A 5ETIA 2R3JA 4DEGA 4YPDA 2JDTA 3AD5A 3VN9A 4F63A 4PTGA 1F5QA 4L44A 3G0FA 3PIXA 2UW8A 1GZ8A 2C6IA 5I9VA 3N4TA 4YPSA 2WTKC 4QP4A 4EJNA 4GU9A 4AZFA 4K1BA 3RPRA 1O6KA 1URWA 2GFCA 4RMZA 4S32A 4CRSA 2CKOA 1M52A 4FUYA 4AOTA 3QYWA 3NZ0A 3F2RA 2OF2A 3WI6A 2XUUA 2OJGA 3SRVB 3OHTA 1MRUA 3FV8A 3V01A 2YIWA 3G6HA 4RA4A 3ZO1A 3PA4A 5EKOA 4YLLA 4GIIA 4G2FA 5AV0A 3RI1A 4GRBA 1ZZLA 3EN4A 5CTPA 1KE9A 2VWBA 4O7RA 3WE8A 3FLQA 3CY2A 3D7TA 5B2MA 2WMTA 1T46A 5FQDC 3ZXZA 2R2PA 5DVRA 5L8JA 5E92A 4AZTA 3ORPA 4U42A 4S31A 4TWOA 1H24A 4RQKA 2WHBA 4QYHA 4FNZA 5J79A 5FDXA 4ARKA 3TI1A 5L2SA 1H0VA 4RC2A 4BL1A 2Y8OA 3OP5A 1Z5MA 4X6RA 2WIHA 4EOQA 4FGBA 3CGOA 5M4CA 2Y7JA 3A7JA 3OTVA 1DAYA 4FTKA 1IG1A 4YC8A 4AN9A 1XH6A 3FZSA 4XJ0A 4DC2A 4EYMA 3FI8A 5AIRA 3W2OA 3FZTA 3KA0A 3KN5A 4RX7A 2C0OA 3BLHA 3UQCA 2X2MA 5HD4A 4FIEA 3QTQA 2RFSA 3GP0A 3HGKA 5A4TA 3NW6A 4QMZA 3VBQA 2NP8A 1KOAA 2PL0A 5E8ZA 3VBTA 3VUIA 3WZEA 4IQ6A 4DG3E 3LQ8A 3MFTA 1WBPA 3OXTA 5EH0A 1PF8A 4PPAA 5AMNA 4G9RA 4FG7A 3LMGA 4ENYA 5AUTA 3I4BA 1YDSE 3NNUA 3NUYA 2WU7A 4WUNA 5CNOA 4ZK5A 4BGGA 5A9UA 2ITZA 4HCTA 4NKAA 4WUAA 2QU5A 2HWOA 3PRFA 3QRUA 4IX5A 3ZU7A 2O65A 4HGTA 4B8LA 3EJ1A 2C3JA 1DAWA 3E92A 5JGAA 4ZY6A 2BCJA 3RZBA 5FTGA 2XRUA 1TKIA 2VNYA 3DA6A 4IC7A 3TJDA 1OUYA 2OJJA 3LFBA 3P86A 3C4EA 2JITA 3U6JA 3VW8A 4FK6A 2CNVA 3PXYA 4MWIA 5EW8A 3ET7A 1J7IA 2VO7A 3DY7A 5IQDA 2OLCA 5ANJA 2YHVA 3GFEA 2HENA 4W4WA 2QQ7A 2Q0BA 4PV0A 3RCJA 3ZZEA 1REJA 3R7EA 2E9UA 3LAUA 4ZTMA 4QMUA 5L6PA 4AW2A 2J2IB 4J52A 4E6DA 4YC6A 2OWBA 1ZYCA 4U44A 1DM2A 4A06A 3I6UA 2CKEA 4BGQA 2PE1A 3DZOA 4YURA 1G5SA 4H58A 3L9LA 4ITJA 4R1YA 3HLLA 4IVDA 1VEBA 4WKQA 4BCQA 3TKIA 4H1JA 4MNEA 1Q8WA 3TNWA 1JKKA 3TZ8A 5LVMA 3IQ7A 4ANLA 4FL3A 4RLLA 2PZYA 4CYIA 4O6LA 1NVQA 1SM2A 3A7GA 3EOCA 3F3TA 3LHJA 3JR1A 2RFDA 3LPBA 2VWZA 3H0ZA 4MXYA 3QRJA 4HCUA 5AUUA 5E4HA 2UZVA 4APPA 5EYKA 4FIHA 4UALA 3GEQA 3VHKA 4WG4A 2V0DA 4NH1A 2WTJA 4XUFA 1M7NA 4A4XA 3MH3A 4C4FA 4OTRA 3KMMA 5IG1A 3T3VA 3R28A 4D4VA 3ALOA 1SVHA 4XEYA 2R7BA 3FYJX 3TTJA 1YXUA 3QRTA 4K8AA 3FKLA 5FXQA 2F9GA 4YHFA 3VS1A 1PXOA 4DBNA 3UPZA 3ZM9A 5AUXA 4WIHA 1OPLA 4Y5HA 4CQGA 3FMHA 4KIKA 1T45A 3ZLSA 2PUNA 5FUTA 3TZ9A 3WYXA 3GCSA 3ORMA 3FC2A 4KIQA 1Z9XA 3F9NA 2QOCA 1SNXA 4N6ZA 1BYGA 3GCUA 4FV1A 4MCVA 3HV6A 5J5TA 5DHJA 4ANSA 4G5JA 4C34A 4EC8A 2IW6A 5I4NA 4WSYA 3ZXTA 4ZTRA 3FI2A 3UO4A 5L8LA 4FT9A 3GU6A 3SKCA 2BZKB 4BF2A 2XJ2A 3RVGA 4C7TA 2F7EE 3ORXA 3KFAA 3O17A 4E93A 4ZZNA 4BZOA 5HQ0A 3UZPA 4O81A 3CY3A 3FLSA 5KMOA 4C02A 1ZAOA 2XK9A 3CJGA 4IZ5A 2E2BA 3KY2A 5F95A 2YJSA 2WMSA 5BVKA 1H26A 4JBVA 5IUIA 3ZSIA 4ACCA 1DS5A 3E8DA 1J91A 3D0EA 4AWIA 3QKKA 2C6LA 4R8QA 3QBNA 4R6VA 4KRCA 4XCUA 4CMOA 4NSTA 2EUFB 4EORA 4LUDA 3ZTXA 4CVAA 4KB8A 2WIPA 4GUEA 2XK3A 1KE5A 2QOIA 4LG4A 4FTLA 3PFQA 3I81A 3PP1A 4EJ7A 4I0SA 4IACA 4YZDA 2OIDA 4PX6A 3V5PA 4CFXA 3S1HA 2CKPA 1K9AA 1NA7A 2HZIA 4DT9A 3UNKA 4LUEA 4GYIA 2XP2A 2EXEA 4O2PA 2J0IA 2AC3A 3BI6A 3KVWA 3ZH8A 3FLZA 5ANOA 2XF0A 3H9RA 4WO5A 4ZJJA 2CGXA 4LV5A 4AS0A 1M14A 3IDBA 5FP6A 4ZMEA 4XG6A 2HAKA 1GIIA 4QD6A 5CXHA 4FBXA 3WIGA 4CCBA 4W4VA 4GFGA 4ZJIA 3ZCLA 5M55A 4EQUA 1UA2A 4QYEA 3UDBA 1WAKA 2W5HA 2YABA 4IMYA 4YR8A 5LOHA 5KMKA 4QMOA 5AX3A 4PMMA 4TNBA 3HMOA 3F3VA 4XG2A 4M15A 2G01A 4LL0A 3KRRA 2OZAA 4NJDA 4U5JA 4A9RA 2QU6A 5L6OA 5IU2A 5L8KA 4BDHA 2XNPA 2EXMA 1VYZA 2FGIA 3R1QA 1FVTA 4AOIA 2UW3A 5HVYA 3ORTA 3ZLYA 4EHVA 1UNLA 2QO2A 4J8MA 2XH5A 3N4UA 3HUBA 4BICA 3DBFA 4YUQA 3FLWA 2HYYA 2HOGA 2P2IA 3B8QA 3AT2A 4C4HA 3Q2JA 3DS6A 3AD4A 3F7WA 1LEZA 4C37A 5JSMA 4X2KA 3NS9A 2XIKA 4J99A 4BDCA 4GYGA 3ZUVA 4QYGA 1PRYA 4NL0A 3FMNA 2WGJA 4CNHA 4JBQA 4W8EA 1QPDA 5BNJA 3ERKA 5CF4A 5LQFA 4V0GB 1ZMUA 2V62A 2OW3A 3BHHA 5AJQA 5EYMA 5IA0A 4JR7A 3I7CA 3IW7A 1GAGA 3FE3A 2ZM3A 3CP9A 4DFXE 2B9FA 4E20A 4EH5A 3OEZA 3BBTB 4U81A 3FPQA 4ANQA 4Y8DA 4EHGA 4ZSGA 3H30A 3WILA 4EWHA 4AAAA 1UKHA 3TIYA 2YCQA 3DKFA 1Q3WA 4GK3A 4G31A 4FVQA 5CYIA 3R71A 5LMAA 1PKDA 4AZWA 2BROA 3BE9A 4FTNA 2VWVA 4NW5A 3ZC6A 5DPVA 2HCKA 3P7CA 1Q3DA 4UXQA 5HVJA 4AA4A 2DWBA 1XBCA 4L67A 1H00A 2JGZA 2XNNA 4O0RA 4ZAUA 5J7BA 5K5NA 5KMNA 2ZDUA 4DEDA 2W1DA 4ZOGA 3CGFA 3UO6A 4BFMA 5HX8A 3QKMA 5LVNA 2JLDA 4O7WA 3NMUF 3BU3A 4J1RA 1S9JA 3W8QA 2QHMA 4JI9A 3P4KA 4M13A 2UV2A 4CKRA 1KSWA 3KCFA 2B4SB 4TWPA 4EUUA 2UZWE 5GIOE 2YIYA 4KKEA 4D1SA 2UZBA 3R9DA 5BUIA 4YBJA 1URCA 3R22A 5BVWA 3HYHA 3PZEA 1S9IA 2QLQA 3V5QA 4K6ZA 1G8AA 3MFUA 1OBDA 2YAAA 4LV8A 5C26A 4R3RA 4HVIA 4XV9A 2WEVA 2PVNA 3N4VA 4XG8A 2ONLA 5IEXA 4UMUA 2X6EA 2VWUA 3DCVA 4O7NA 4L00A 2XZSA 4GJ2A 2R3NA 3PVGA 5GNKA 4X2GA 3O8UA 4IWQA 4BB4A 1UNGA 2B52A 4IAIA 4DFUA 5LWMA 4YSMA 4MXOA 4UMTA 1DI9A 4R3CA 4UMRA 2VTHA 2ERZE 3BGQA 2CDZA 3GI3A 5TF9A 4AP7A 2WMBA 5K4IA 2QOLA 1Q62A 2YIRA 3BYOA 3HMPA 4RJ3A 3B2TA 2BHEA 2W96B 3QAME 2ACXA 4R7IA 2W1EA 3OXIA 4P5ZA 3KREA 1OPKA 4TZRA 3L8PA 2G15A 3BBWA 3DBDA 3EFWA 4JJRA 1Q8TA 4K2RA 2XK8A 3PJ8A 4Q5EA 2W1IA 4FTIA 5JZJA 1K2PA 2WNTA 4KBKA 1F0QA 3R8VA 3E63A 2ONLC 4IZ7A 4EOLA 4XRLA 2C0TA 4FTOA 4WG5A 4N6YA 1GNGA 4QTEA 2QOQA 4ASDA 4F9YA 4P2KA 2RIOA 2HXLA 2ITUA 3G15A 3OCGA 5CXZA 4GUBA 1OITA 3HV3A 4FV3A 4IB3A 2P0CA 3ID6C 1UU8A 1YW2A 3PY3A 5L2QA 3V51A 4CFUA 3K2LA 3CD3A 3ZRLA 2BMCA 4A7CA 5E1SA 4HVDA 5HBJA 4JG6A 3R04A 1L3RE 3ZBFA 1VZOA 4OBOA 4C36A 4GKHA 3TUBA 1R1WA 3F61A 4FSUA 3CE3A 2Z7LA 3O51A 5D10A 2R3HA 3PJ3A 4L46A 3R8UA 3ORLA 5B2LA 4C38A 2QO7A 2G1TA 4N0SA 2W4OA 5DE2A 1PMEA 3OF0A 4IAAA 2QONA 5HO7A 1JAMA 4I20A 3RKBA 5ANIA 3WF5A 4FT7A 3COIA 1UU7A 3ORZA 4PP9A 2IZSA 2PVYA 2WTWA 3NDMA 4M0ZA 2G2FA 3GU4A 4FV9A 4QTCA 3DV3A 4D5HA 2QG7A 3HRFA 2Y4IC 3TN8A 2ZDTA 4JS8A 4KKGA 4YNOA 4BVUA 4JX3A 4CMUA 2YCRA 4FX3A 5DG5A 5H2UA 1F3MC 2J7TA 2Z8CA 5F4NA 5C27A 4IX4A 2JC6A 4AF3A 2VX1A 4CQEA 5AAGA 4QNYA 3UIBA 2QG5A 3FY0A 1ZMVA 4JDIA 4O0SA 1IA9A 3LOKA 3GOKA 3I6WA 2WTDA 1MUOA 5AUYA 3CTQA 3F6XA 3OTUA 4XG9A 4PNKA 2BKZA 1RDQE 5DR2A 4FZFB 4FTJA 1PXNA 2ESMA 1IA8A 4EOJA 3KK8A 4G6NA 5D41A 4F99A 2BZHB 3KVXA 1Q61A 2PK9A 2PZPA 2RGPA 2XBAA 4L7FA 4IX3A 4RWKA 2CLXA 3E8EA 4FSWA 5CLPA 3JY0A 3QRKA 2OI4X 2R3PA 3BEGA 5BYLA 1YWVA 3PJ1A 4PF4A 4O7LA 4O0TA 1W8CA 2YIQA 5IEYA 3FJQE 2XNEA 3NYOA 4CFFA 4UX9A 1OKZA 4CKIA 3R8MA 2CCHA 2OG8A 3NW7A 5EHOA 5DT0A 3R8PA 4CG9A 4TY1A 3W2SA 3EIDA 4FTUA 4UMQA 2PUIA 5IA5A 2QVSE 1KOBA 2UW9A 3LCDA 3W32A 3HDMA 3QZIA 4I5MA 3O0GA 1MP8A 4C4IA 4V01A 4BCHA 4ANMA 4G16A 4C2WA 1KV2A 4MHAA 2GQSA 4W9XA 2CGUA 4ZLOA 2WFYA 3IW8A 4E26A 5AR3A 2HW7A 3TDVA 4UZDA 4RJ6A 3D5VA 3QA8A 4LRMA 4LOOA 2BR1A 3GQIA 3PVWA 1CKJA 4FV2A 4GEOA 3ZONA 2GS2A 2R0UA 3HZTA 1PXJA 2UW0A 5LVOA 3MA3A 4D0XA 2Q83A 2OU7A 4MD7E 5GHVA 3DK3A 3HKOA 3HNGA 3POOA 3VS7A 4DFYA 4WOVA 3DZQA 3R0TA 4EKLA 2NO3A 1JSVA 3RINA 5JGBA 2W1ZA 4AA0A 3CTJA 4LMNA 1ZRZA 5KHWA 4QMQA 4JR3A 5IQAA 4GL9A 2A27A 5FDPA 2XVDA 2YM7A 4RQVA 5GJFA 4P5QA 3PY1A 1KUTA 3EZVA 2F2CB 4Q9ZA 5FXRA 1FMKA 2I0VA 3KEXA 3MFSA 2WXVA 4Y46A 5D9HA 1GZKA 2I0YA 3LFSA 5HI2A 4ASEA 5K3YA 3UIMA 3WZKA 3MPTA 4OTFA 2FO0A 1E9HA 1Q8YA 3EQDA 4I4EA 4U0IA 5DI1A 2W9FB 1YI3A 3FC1X 4E5BA 3PA5A 5HLNA 5HU9A 2KULA 5IQFA 4QMPA 3WIKA 1P5EA 4CEGA 4RWJA 4FZ7A 5EDQA 4D2TA 4A07A 3QWKA 3LIJA 3SA0A 4KA3A 3A8XA 4IC8A 3KK9A 4IEBA 4R1VA 5CWZA 3U51A 3R73A 4RLKA 5H9BA 4TW9A 4Q2AA 5L3AA 3FMKA 2WTIA 4IJ9A 3LCTA 2Z7RA 4I3ZA 4KIOA 3UOKA 3ZLXA 4RIOA 1PMVA 3DDQA 4CTCA 3AC4A 5HTIA 5BVNA 3P0MA 3OWPA 3SDJA 2QKRA 1MRVA 4BN1A 1E1VA 3FXZA 4O0XA 2HY0A 4KAOA 3L9MA 4NM5A 4W4YA 3RPYA 3ZEWA 5HU3A 2YIXA 2C4GA 3N9XA 4G3EA 3G51A 2IN6A 2X6DA 3QLGA 5CAOA 4FNWA 2R3RA 4O22A 4H39A 3NUUA 3KXHA 4PPBA 5DR9A 5FTQA 4DN5A 4PMPA 3PA3A 5FRIA 5EHYA 3A4OX 3BX5A 2R9SA 3ZDIA 4EC9A 3GC0A 3RTPA 1YI6A 3F3UA 3QX4A 3A7HA 4QP2A 3ZDUA 5HX6A 3D2IA 4IIRA 3NR9A 2WQOA 5HOAA 5KKRC 3OT8A 3DGKA 3BKBA 5DWRA 3E62A 4G3DA 3ENHA 4RFZA 3Q9ZA 1SYKA 5AP1A 5BVDA 3OMVA 3Q9XA 3PDTA 3G90X 3PJCA 4FOCA 4DFLA 3RHKA 4YSJA 4DGOA 4YZMA 4D2RA 3PG1A 3BCEA 2OGVA 3GENA 5HGIA 1SNUA 3WF7A 3R6XA 3EZRA 2XCHA 5I3RA 3FKNA 3ZUTA 3CEKA 1WBVA 4Z3VA 5ANEA 5BUJA 3V8SA 5EI8A 3VULA 1H1PA 5DOSA 2VTAA 5AAEA 4TNDA 3MYGA 3RPOA 2XCKA 4JVGA 4OTIA 3A4PA 5KCVA 2PVHA 4M0YA 4BYJA 4EOOA 4UXLA 2VTIA 1OECA 1ZLTA 4N57A 4XV1A 4U6RA 4EK6A 3TUCA 2G2HA 4USDA 3DBEA 4D55A 4MTAA 4AN3A 3R1SA 2QHNA 4LGGA 4YZCA 4Z55A 5AV1A 4DG0E 5IQCA 4M12A 2I0HA 4DEIA 5AP4A 2J0LA 2FSOX 2OZOA 3C5UA 3KF7A 4IADA 4KBCA 3AC8A 5CU3A 4QMNA 3CKWA 1PYEA 2UZNA 3S4QA 4HGLA 1QPCA 4Y85A 3Q4ZA 2B9HA 2C3IB 2F4JA 4K0YA 2OFUA 3R7OA 2A2AA 2C6KA 4O38A 3ZFYA 5HE0A 2GTMA 2J0JA 2WMUA 3V04A 3L8SA 2WD1A 2XKDA 2P4IA 1RE8A 4B7TA 4PDPA 5CEOA 3OWJA 5AP5A 2UVZA 2XNOA 4HYUA 4MF0A 3R9NA 1BI8A 4U97A 3SG9A 3FL5A 3NNVA 2XIXA 3HV7A 5M56A 5HIDA 4QP1A 2WTVA 2QCSA 2XS0A 4QYYA 3I0OA 2VX0A 5FM2A 3VUTA 4EK4A 1SZMA 3F3ZA 1ZXEA 3NCZA 4AOJA 3TWJA 1OIRA 2QD9A 1PXIA 2XRWA 2VRXA 3PVUA 4FA2A 3FMEA 3W2PA 3WBLA 5FEEA 3CQEA 3FL4A 4JLCA 3LFCA 5AUVA 3NVKI 1OIYA 3BYUA 5IKWA 1H27A 4L43A 3WF8A 2H34A 3DBQA 4XV3A 3W2RA 1TQPA 4ERKA 5JT2A 3R1YA 2I6LA 2Z2WA 1J7LA 2XNMA 2JKQA 4RVKA 3W10A 4BWKA 3FMJA 3QTWA 5DEWA 3V8TA 1BUHA 3HA6A 4BKZA 4F4PA 4ORKA 2BRGA 5G6VA 5EI2A 4BBFA 5ACBC 3C4WA 3UPXA 1HCKA 4GT4A 2JDOA 1JNKA 2C30A 2R7IA 4RVMA 2ZV2A 1H25A 4FYOA 2GNHA 3D9VA 3NUAA 2QR8A 3P08A 4PRJA 5CS6A 1CSNA 4L53A 2B7AA 3JUHA 2E9OA 3LKMA 4X3FC 5DA3A 4KIPA 5HG7A 4C4JA 1NY3A 5I9YA 1H01A 3BHVA 3DTCA 4FTCA 2JDVA 3FAAA 3QZGA 5HG8A 3RAIA 3C4XA 3E8CA 4MQ1A 3OG7A 4PWNA 5ICPA 2JFMA 5IMEA 3QQJA 3UVRA 3DB8A 4IWOA 4ENXA 1JKLA 3HP5A 3E87A 4PP7A 3EKNA 4GFMA 4QP6A 2REIA 2GNIA 2VWIA 4MF1A 3OWKA 3LM5A 4RZWA 4XLIA 1XH5A 5D1JA 5LMBA 2BDFA 2WKMA 5C03A 3NNWA 3F5UA 2UW5A 5L2WA 1ZYDA 2W17A 4IAKA 1YWNA 3ZS5A 2PVMA 4O1OA 4RIYA 2XJ1A 4M8TA 5EDRA 3AQVA 5HKMA 4C57A 4JRVA 4NFMA 2GS7A 1OGUA 3EN5A 4O84A 4IVAA 2YM8A 3FLNC 4IAYA 2JDSA 3R00A 3KULB 2BIKB 1OUKA 4A9UA 3A61A 3RCDA 4PMTA 3NCGA 3DJ6A 2QLUA 3T9IA 3QTXA 2OBJA 2Y6OA 3BRBA 3FEGA 2A0CX 5BYZA 5AR5A 1RJBA 1AD5A 2C6TA 4TWCA 5HEZA 2VTJA 4FNYA 3R7UA 4U8ZA 1YVJA 2C6DA 3EQPA 4IW0A 2HW6A 2UVYA 5FLFA 3E3PA 4F7LA 2X9FA 2ITYA 5KNJA 5BVOA 3QQLA 5E8WA 2BPMA 2PZ5A 3LM0A 3LMHA 2BAKA 4HNFA 2PUUA 3BQCA 2XJ0A 3AGMA 5DGZA 3RAWA 1XH7A 4ALUA 4AQCA 1CMKE 4ZS0A 3W2CA 3HV5A 3QUDA 3O2MA 1U54A 2V22A 4APCA 5CENA 4H05A 1WVWA 4YJPA 3VUMA 4AG8A 5IQBA 4DEAA 2WMRA 5IH6A 5J5SA 4AX8A 1OKWA 1PKGA 4LMUA 5E7RA 4MXXA 3G9NA 4PDSA 2XKEA 4FT3A 3ZFMA 4EONA 3BYMA 3CS9A 5HNBA 4O82A 2YDJA 4BDAA 4L01A 4FKWA 3RNYA 4ZMFA 1Q4LA 2GDOA 3MH0A 4XOYA 4QQ5A 3V5WA 5GZAA 3EQIA 4JT3A 3GBZA 2ZAZA 4MVFA 5BMSA 4TN6A 3I1AA 2PHKA 2PTKA 4OUCA 3TZMA 3V5LA 4DLIA 4M66A 5ETAA 3S00A 2YERA 3HMIA 4DTAA 4Y5QA 5B7VA 1XJDA 3REPA 3OBGA 2HY81 5AIKA 5LJJA 4IVCA 4F64A 3P7AA 4UV0A 4G3FA 5I9UA 4BTMA 1JQHA 2JEDA 3QCSA 3GCVA 4II5A 3TV7A 4BI0A 4CFVA 4ZJVA 4QT1A 4QP8A 5H8EA 2FB8A 5JFSA 4N70A 2ZMDA 5CNNA 2YN8A 3VBVA 4JRNA 3U6IA 3BV3A 3QQFA 1OL2A 5I0BA 4FIGA 2ZM4A 4TYIA 4U9AA 2ZV9A 4A9TA 4EK8A 3TKUA 2C3LA 4O7TA 5A6OA 5L2TA 3MPAA 1XBAA 3GU5A 5EOLA 4YJNA 5J9ZA 4UB7A 3ULIA 4B0GA 2CN5A 1QPEA 2Q0NA 3QALE 2DUVA 4D9UA 3OFMA 4D2SA 3QGWA 4IB0A 5AP6A 3PUPA 4BI2A 3HVCA 4TPTA 3ZMMA 2QOBA 3BEAA 4QRCA 3D94A 2YAKA 5FWKK 4NWMA 3I60A 3VUDA 3CIKA 4UY9A 4DEEA 3M42A 4QMLA 2X9EA 3C4ZA 5EW9A 5HBHA 2CSNA 3BQRA 2OK1A 2CLQA 3GT8A 4UMPA 3NPCA 4HYSA 4FVPA 1OL6A 2IWIA 5TOZA 4FEVA 3ZZWA 4O91A 1YHSA 5J1VA 2BILB 3KCKA 4EQCA 3QTUA 3EHAA 3RP9A 4OTHA 4MXZA 3SRVA 3MWUA 3F2NA 4KSQA 2WQBA 4ZZMA 5AEPA 2CKQA 2ZMCA 4H3BA 3R9RA 3TNIA 4DCAA 2YWPA 3DKCA 4IDVA 3EYHA 4IWPA 4QTBA 2C5VA 4I6HA 5I9WA 4QPSA 3HRBA 4JQ7A 1Y6AA 1PXPA 2RFNA 4YTHA 4UWBA 4WNKA 5HHWA 4BDIA 4DITA 4WBOA 4X21A 3E88A 3VBWA 2RFEA 4ITHA 3BHYA 4O7ZA 5DEYA 4AU8A 4JG8A 3CKXA 2QOFA 3COHA 3GXLA 3LXLA 4E5AX 1RW8A 5CAPA 4YC3A 3C9WA 3LXPA 4IE9A 4BZDA 2HELA 2I0EA 1WCCA 3QD0A 1O6YA 4ONAA 4YJOA 3VVHA 3A7IA 5FXSA 4YU2A 3EN7A 3PPZA 2QI8A 4D9TA 2JIVA 3C7QA 2ITQA 4NTTA 4QMWA 5GZ9A 4D2PA 4F6UA 4EH4A 2WAJA 3DFAA 2OF4A 4QO9A 5H3QA 4MKCA 5FM3A 5E9EA 3LJ0A 5CU4A 2AYPA 3VS3A 5CU0A 3U54A 3D83A 1UVRA 4FL2A 3RAHA 1Q8UA 3KMWA 2WQEA 3MJ1A 5HO6A 4ACHA 5CSHA 3UP7A 2GNLA 4FF8A 3EKKA 1WBTA 3IK3A 3QUEA 4I6QA 4UYAA 2AUHA 3TL8A 5IISA 2XK6A 3ODZX 3PE2A 4FKSA 3MDYA 3ZO3A 4E4XA 4E6AA 4EOSA 3UQFA 2R4BA 3ETAA 3H4JA 4DGMA 4DH3A 1YRPA 4DCEA 5HNIX 5M09A 2BDWA 4AT3A 5TR6A 3CQWA 4XLVA 4DGNA 1ATPE 2V7OA 3PSCA 3SG8A 2OKRA 1M2RA 4AZEA 2ITTA 2J5EA 2GHLA 1H1RA 4C61A 4F65A 3CPBA 2GQRA 4JOAA 4GK2A 3QHRA 4YTFA 5BVFA 1JSUA 2HZ4A 2Y6MA 3O7LB 4KRDA 1OIUA 3CTHA 3P23A 4FEUA 3D5UA 4H3PA 4C33A 5C4LA 4E73A 1E1XA 4LI5A 3BLRA 4FSZA 5FEDA 3TTIA 3W18A 5C1QB 3S0OA 1FGIA 4IDTA 2BAJA 4K33A 4ZIMA 5HTBA 3VRZA 2A19B 3QD4A 4BWPA 4J97A 2R3IA 1OL1A 2WOTA 3QXOA 4TWNA 4WD5A 4FL1A 5HD7A 3V6SA 3SW7A 4BIBA 1YDTE 5A4LA 2GCDA 3U87A 4WHZA 4BTJA 4OAVB 3TV6A 2Z02A 3Q6WA 5AA8A 3RK5A 2YISA 3EFKA 4XBRA 4GJ3A 2W5AA 4M68A 2X0GA 5FBNC 1GJOA 4M84A 3QGYA 4O27B 3DBCA 3KRXA 5HVKA 2C1AA 3QUPA 1JKSA 4RFYA 3UBDA 1Y57A 2V7AA 2ETKA 2IG7A 4MD9E 2HZ0A 4XHKB 1SVGA 3FI3A 3BGZA 1ZY4A 3F5PA 3LFDA 4IAFA 2FUMA 3PTGA 5BQ0A 4B99A 1WBNA 2F7XE 3OUKA 3PPJA 2C5NA 3ZOSA 5CEIA 3MJ2A 5CY3A 5ANKA 3DOGA 2PZIA 4ZSJA 4NEUA 3R9OA 4D1XA 1STCE 1UKIA 4FT0A 2PMLX 3IDPA 2XK7A 4ANBA 3HP2A 2VO3A 4EH3A 4AGUA 1CM8A 3B8RA 5FP5A 5IA3A 3E7OA 4EH6A 5GJGA 1GIHA 4USFA 1OI9A 5E8VA 4FTQA 2FVDA 1OMWA 2XYUA 2IZRA 1YQJA 4XRJA 4K11A 4CRLA 1K3AA 2BVAA 4RJ4A 3VRYA 4ERWA 4WG3A 3DJ7A 4DFBA 3EN9A 4EOMA 4CZYB 3D7ZA 4G3GA 4M69A 3NSZA 5FTOA 3FMLA 4BDFA 2ZV7A 2YCFA 3F66A 2B0QA 5E8SA 1BLXA 4Q9SA 4BTFA 2I40A 4EZ5A 5EKNA 4QQTA 3ORNA 1TQIA 4U3YA 5I5ZA 2W9ZB 4IM0A 3Q5ZA 1H07A 4FR4A 3R30A 2ZOQA 4FKPA 5FG8A 3O7LD 5E8YA 4KBAA 2WZJA 4QMTA 4TYHA 4AW5A 3MIAA 1YHWA 1R0PA 2C6OA 5TO8A 1YXSA 1U5RA 2O5KA 5AUWA 3S3IA 4C0TA 3M1SA 5M51A 4FC0A 1JPAA 3DK6A 1Z57A 5HE3A 1U46A 2GNJA 4IAZA 4JBPA 4UBAA 1HOWA 2UZUE 3IW5A 3OCSA 3VNTA 4CKJA 3FI4A 3CSVA 4CMTA 1KV1A 4DFNA 3Q9WA 2PVFA 3U8WA 3W33A 3ZHPC 4F9WA 4DTBA 4NM3A 4X2JA 4RZVA 2J6MA 3BYVA 4O96A 1OKVA 1WVXA 4RA5A 4ZY4A 4U80A 4WNOA 2C47A 3DDPA 3AMAA 1Y8YA 3MH2A 5CI7A 1CKPA 1B6CB 3VUHA 2JAVA 4BDGA 4KNBA 3C51A 2PPQA 3U4UA 3OUNB 3GB2A 4FKOA 4O7VA 2ZB0A 2GFSA 2BALA 3AOXA 3COMA 3FBVA 4DT8A 3K5VA 4IZAA 2IW8A 3ZUUA 3RK9A 4MH7A 5EYCA 5J95A 2R64A 3QHWA 2UUEA 4JDHA 4FZAB 3UMXA 2Y9QA 1XWSA 2C68A 3AC3A 3OZ6A 5ANDA 5M53A 2PMIA 5T6KA 3ELJA 3ZO2A 5EQEA 3BE2A 4MYGA 1REKA 4U3ZA 4Z9LA 2HWPA 1PXLA 3UOJA 2RSVA 4I94A 4YHTA 3MY0A 5EM8A 2ITWA 2JBPA 3RWPA 4AGWA 5HE1A 1VYWA 3C1XA 3DAEA 3FSFA 4BHNA 3G5DA 3PWDA 2VD5A 4AW0A 3EQFA 4GK4A 4BY9E 1AGWA 2PVJA 4OW8A 4FKVA 2WTKB 4IWDA 5J7HA 4XMOA 4X7QA 2W05A 4F9CA 2WMAA 3R63A 4F1TA 4BCNA 2W1FA 2FSLX 4HPTE 5EG3A 5AV2A 5JFWA 5M06A 5AM6A 3TG1A 2WOUA 2OIBA 3JVSA 3FHIA 4C35A 1H08A 2BRHA 4GU6A 4PL3A 1U5QA 2X8DA 3ACJA 2J51A 4OAUC 3V5JA 1WFCA 4DE4A 1LEWA 3MS9A 2X7GA 4FZDB 3T9TA 4O83A 2GQGA 2R3GA 4IB5A 3PLSA 1WBOA 5DT4A 2G9XA 5AX9A 5JKGA 5J8IA 2EB2A 3PZHA 4M7IA 3FLYA 3VS5A 5EW3A 4F7NA 3FZPA 3LCOA 3I5NA 5HTCA 3O71A 3I0QA 3KRWA 3RMFA 3RWQA 4PTEA 2Z7QA 4W8DA 4JDJA 3W2QA 3V5TA 3AC5A 4FKJA 5KUPA 5BX0A 1OB3A 4V0GA 4EKKA 3HMNA 2XEZA 4PL5A 5H8GA 1KWPA 3M11A 4XP3A 4TXCA 1Y91A 4FUXA 1V0PA 5LWNA 2WQMA 5EI6A 3GUBA 4I0TA 2EB3A 2ITVA 2RF9A 3KRLA 4GVAA 4JBOA 4XYFA 2C5YA 3Q2MA 3EQRA 5AV3A 3SX9A 1ZZ2A 2YCSA 3HMMA 4AN2A 4XBUA 4BHZA 5M08A 3DLZA 4M67A 4F9AA 5BYYA 5TT7A 1X8BA 4U43A 4L52A 4UWCA 4DH7A 3MB7A 3C0GA 4CD0A 2X39A 4B9DA 4Z16A 2XIRA 5IQHA 3D7TB 2R3MA 3JPVA 5HG5A 3W1FA 2VN9A 4AGCA 5J9LA 4FT5A 2G2IA 1GIJA 1BL6A 4F9BA 1MQBA 3P9JA 3E7VA 3DKGA 3MY5A 3NIZA 3QFVA 1Y6BA 4I5CA 5CEKA 3VBYA 4AFJA 3Q4UA 2WU6A 2OH4A 5A4EA 2GU8A 4FKLA 2GMXA 1DI8A 2VTRA 2X8IA 4NJ3A 2W0JA 3LFEA 4E4LA 3BHTA 5FBOA 3UGCA 4Y72A 3D14A 2CMWA 1W83A 2I1MA 3IG7A 3F3WA 4QMMA 4KABA 5CQWA 3SAYA 4QNAA 3HDNA 2W5BA 4O7SA 3FDNA 3O50A 3WZDA 3K3IA 3JXWA 4PDOA 3TCPA 3EL8A 4L8MA 1PJKA 4EHEA 1NT2A 4YBKA 3R01A 4FSNA 5HZNA 4LOQA 4ACGA 4MNFA 4BBEA 4HPUE 5D11A 5BMMA 3P78A 3R7GA 3FZRA 4NT4A 3P5KA 5T3QA 2JKKA 1ZOGA 2P55A 2RG6A 2O64A 2DQ7X 3AMBA 5IPJA 4D5KA 4D4SA 4RG0A 4U7ZA 3Q9YA 2FSTX 5CAVA 3QYZA 4ACDA 1YKRA 4I21A 4ID7A 2OJ9A 3R7YA 4RIYB 3L8VA 4F08A 1PYXA 3DT1A 3LCKA 5DNRA 3SOAA 3UE4A 5LVLA 3MBLA 4RIWA 2B9JA 5DIAA 1V1KA 4FGRA 3R7IA 2UZOA 4IM2A 3E8NA 1FQ1B 3U9NA 1CKIA 3IGOA 5EQPA 2W1GA 2J90A 2YM4A 2YLFA 2VV9A 4OTQA 4XP0A 5I9ZA 5EDPA 4EH7A 1ZMWA 1B39A 3H9OA 1U59A 4B4LA 3QTZA 4U79A 3MVJA 5CEMA 1PXMA 3I79A 1IR3A 1Q97A 3CR0A 3LZBA 4EHZA 4NIFA 5EHLA 2VNWA 2X4ZA 3UOHA 4NZWB 1PW2A 4KSPA 4BKYA 3DAJA 1BL7A 5A4QA 2QC6A 3QA0A 4M3QA 5CSWA 5AUZA 5HCZA 4EH9A 5M57A 3LVPA 2VGOA 4BCFA 5HCXA 2VWWA 1KE6A 3SQQA 5KMLA 1FINA 3QC9A 4RRVA 4I0RA 5JK3A 4FSYA 4ZLYA 4L7SA 1Q8ZA 1BMKA 1H1SA 2WQNA 3PYYA 1OM1A 4QP9A 5HNGA 4HVSA 3UO5A 5CU2A 1U54B 3HECA 3UIXA 4H3QA 4O6EA 1RQQA 1Y8GA 2VZ6A 4IX6A 2GTNA 3VS0A 3UZRA 3OXZA 2P2HA 4LQMA 3O8TA 3Q04A 4F0FA 4MNEB 5I3OA 4JIKA 3O8PA 3SLSA 4ALVA 1MQ4A 3PXZA 3NUPA 2XMYA 3ROYA 2PU8A 2GPHA 5E8TA 5EYDA 5AV4A 5AR7A 3EMGA 3OWLA 4IVBA 3VJNA 2J0KA 3KXNA 4E6QA 2J4ZA 1WMKA 3FQSA 4WNMA 1NVSA 3F88A 4DH5A 2BTRA 4XX9A 3LXKA 3K3JA 3Q4CA 4J8NA 2BUJA 5EM5A 2VTNA 4O0VA 3LQ5A 4LM5A 4YZ9A 4RWLA 2C5OA 2PVRA 2JD5A 3KU2A 4L68A 3GGFA 5HBEA 4DEHA 4NM7A 1FVVA 3TT0A 1XBBA 4AW1A 4IFCA 4K9YA 3KRJA 3MIYA 4BDBA 2RKUA 4KIKB 3SXSA 2PSQA 1A9UA 4FSQA 2I7QA 5IA2A 4FV7A 2KTYA 5AA9A 3CXWA 4GKIA 2C69A 5CZIA 4H36A 3PE1A 4O21A 5CALA 3OS3A 1ZY5A 4I92A 4GT3A 4E4NA 3GCPA 3ZBXA 3R1NA 2PULA 3N51A 3F5GA 4NK9A 5CZHA 2Y0AA 3SVVA 3W55A 3MY1A 5JQ8A 2OXXA 2OFVA 3MVLA 5KMJA 2W7XA 3KL8A 5HESA 1GZNA 2NNWB 3TUDA 4EUTA 4OBPA 2X7OA 4D58A 2XIYA 4IB1A 4DG2E 5CVFA 2JKMA 5E8XA 5KZIA 4CZUA 3FHRA 3EQBA 3FQEA 3TNQB 2YACA 2WO6A 4KUJA 4RJ8A 5M07A 4W9WA 3ZC5A 3U9CA 5IQIA 3C0IA 4YJUA 3ZYAA 1Q41A 2O63A 3Q3BA 3L9NA 4X3FA 4YLJA 5J87A 3HAVA 1OIQA 5CI6A 3ZSHA 2R3OA 4C4GA 5A4CA 4O0WA 2V55A 4HYHA 3UIUA 4NU1A 4F6SA 1YXXA 3JY9A 4FTTA 4S33A 4N4SA 4CT2A 4D28A 4IBMA 1V0BA 3EFLA 4G1WA 5D7VA 3IGGA 3VS2A 4E7WA 4KD1A 3ACKA 3FZOA 1W7HA 3VO3A 2Y4PA 1PMNA 2IZUA 3OC1A 1IASA 4HCVA 4GSBA 2XM9A 3TXOA 3V6RA 1L8TA 4OLIA 4JXFA 4C3RA 4FTMA 5K4JA 4BWXA 3C0HA 4R7BA 1FPUA 1JLUE 4AXAA 3EYGA 3PXRA 4WT6A 4XOZA 3VS6A 5JZNA 3A2CA 4BDJA 5LCJA 4RX8A 1YXTA 2FYSA 4G5PA 2OXYA 5GZ8A 1IAJA 2BKKA 4LRKA 3MSSA 5D12A 4DFZE 3G33A 3UTOA 2R3FA 2WTCA 3II5A 3Q96A 5IQEA 4CV9A 2C5XA 3QTIA 2PMNX 4G9CA 4L3PA 3UC3A 3MW1A 4X2FA 1FVRA 2EVAA 1J3HA 2OZAB 5L2IA 4EI4A 4CV8A 5K0XA 5HIEA 2IVSA 1LP4A 5CT0A 2VTPA 5ETCA 4BCMA 5CF6A 4Y95A 3D5WA 4AACA 1U4DA 3QXPA 4P7EA 4FSMA 4Y73A 3K5UA 5JEBA 3F82A 5JN2A 4TYEA 4FMQA 3QF9A 2W4JA 1M2QA 4EK3A 3BZ3A 4EYJA 4YO4A 3TNHA 3QD3A 2JKOA 3EN6A 1IRKA 2VTSA 2YJRA 3TACA 4ZY5A 2ITNA 3HEGA 4YHJA 3VBXA 5J9YA 5EFQA 3FY2A 4TKSA 3FWQA 4CTBA 3L8XA 1FBNA 3LXNA 4RVLA 4IH8A 3EL7A 2R5TA 4J98A 3F69A 4OTGA 4UYNA 3P7BA 4QPAA 3T3UA 4BKJA 4YJQA 1Q24A 1VR2A 5CF8A 5DRBA 5CX9A 4XG4A 3VF8A 3O23A 4QP7A 4C3FA 3L1SA 4FE2A 4RX5A 5E90A 4R78A 4LL5A 3PLAE 4ZLZA 2B9IA 3D2KA 3OEFX 5CSPA 1BKXA 3ANQA 2PE0A 4FYNA 5CANA 2RG5A 1A06A 4D4YA 1YWRA 2IJMA 4ZSLA 4CLIA 3NWWA 1H0WA 2HK5A 3CC6A 3Q52A 4JIAA 2LAVA 1H1QA 3RM6A 3MESA 3FZ1A 3VF9A 4D1ZA 5IUHA 5T68A 3WZUA 2J9MA 3UYSA 2ZYBA 2C3KA 4A4OA 4RIXA 4ZZOA 3DAKA 1GOLA 1XHAA 4DH8A 4YZBA 4ZTSA 3E93A 3NGAA 3UMWA 4ZXTA 4C8BA 2YM5A 1QPJA 1XO2B 3EQHA 3WE4A 2F57A 3BPRA 3GOPA 4IM3A 5ETFA 2YDKA 4CZTA 3DK7A 4BCGA 2GNFA 4R5YA 3NAYA 4BCIA 4FEWA 2IPXA 3U55A 4QTDA 4FKUA 2HXQA 1OBGA 3Q6UA 5ITAA 2X4FA 1UV5A 4MQ2A 1Q99A 3QQHA 4I5PA 1Q5KA 5CF5A 3DB6A 3KB7A 3E5AA 5AADA 4E3CA 4AT4A 3H9FA 3VQHA 4BR3A 3KXXA 4OTDA 1FGKA 4L45A 2OICA 3SXRA 5M44A 4QOXA 3VJOA 3NRMA 3OD6X 4XH6A 3A8WA 4B6LA 4MEDA 2NPQA 3RZFA 4HOKA 3QQGA 4CXAA 1LPUA 4RC4A 2C6MA 2VAGA 4LGDA 3NIEA 3MH1A 4L6QA 3LFAA 2EU9A 4MAOA 4J71A 3RNIA 2O0UA 3MA6A 3ATTA 1NXKA 3CD8A 2IVVA 4GVJA 4M69B 5AP7A 4NTSA 3QD2B 3DXNA 1M2PA 3UOLA 3W8LA 4EH8A 1JVPP 4NYEA 4I6FA 4JL9A 4AE9A 5HO8A 2WEIA 4L3JA 4HW7A 4GV1A 4ZTHA 5L4QA 3RHXA 3GC7A 4NKSA 3ULZA 2JBOA 2BAQA 2NRUA 3C50A 3NYVA 4G17A 3WYYA 5CT7A 4IHPA 3S2PA 3HRCA 3IONA 4JX7A 5AP3A 3ODYX 2H6DA 2ZM1A 3CQUA 3IDCA 3OROA 3PXFA 3Q53A 4TYHB 5DRDA 4DLJA 4X2NA 3KN6A 1P4FA 4E6CA 2PWLA 4BDEA 3TKHA 4X6QC 4XP2A 2C0IA 3E3BX 4AZVA 4AE6A 4S34A 3UVPA 5BVEA 5IDPA 4BCPA 3GVUA 2PY3A 2H9VA 2LGCA 2YZAA 4FEQA 4RX9A 1YDRE 3EWHA 4ANOA 4BC6A 3P1AA 3KF4A 1WBSA 3CCNA 4FTAA 3FUPA 2Y4IB 2YDIA 3G6GA 4ITIA 3DNEA 2BFXA 4PY1A 4TYGA 3QQUA 5AP0A 3COKA 2JDRA 5C8MA 4LGHA 4WSQA 3MGYA 5A46A 3TNPC 2EXCX 5F20A 3A99A 1R0EA 3OT3A 3OVVA 4I22A 4J53A 4FI1A 3Q60A 4QTAA 3RK7A 4CSVA 4YZNA 2IO6A 2XEYA 4DH1A 3LFNA 4GFOA 4IZYA 1ERKA 2XIZA 2PYWA 4QP3A 5IQGA 3RGFA 1OZ1A 4DBXA 1WBWA 1XR1A 5JRQA 5K5XA 2UW6A 5AR2A 4UEUA 3LJ1A 5JGDA 3LE6A 5EQYA 5M4UA 4WA9A 3KXMA 5LVPA 5B2KA 5C01A 2QKWB 3UQGA 5IH5A 3UJGA 4EBWA 2QOHA 4XS2A 2O8YA 4CT1A 4RJ5A 3VUKA 5AAFA 3LFFA 3QLFA 1O6LA 4ALWA 2PUPA 2QNJA 4R5SA 3SXFA 5HLWA 2CJMA 4BBMA 2IZTA 3AXWA 3H0YA 3ZFXA 4BTKA 3VQUA 1H28A 4JDKA 4F7SA 4BIDA 4CLJA 3KQ7A 2BZJA 3NUXA 4IANA 3VHEA 2VWYA 2HZNA 2ITOA 2UZLA 1W98A 3R2BA 3UC4A 4FKRA 1QMZA 2NRYA 3RBWA 2YA9A 3NYNA 4EOPA 3BWJA 4A9YA 5AFVA 1UU3A 3PSDA 2YM3A 3QTSA 3IS5A 4Z7GA 4M14A 4F0IA 1UWHA 3GC9A 3AD6A 5IMXA 4GG5A 2VTTA 4BI1A 4PTCA 3KGAA 1BI7A 3SD0A 2ERKA 4G6LA 3RALA 2PVLA 1OVEA 1YOMA 2VTMA 3PWYA 3DLSA 2E9NA 1ZOHA 4PL4A 5EM6A 4C2VA 4R3PA 2IW9A 2OIQA 1W82A 5HG9A 2GNGA 1JWHA 3P79A 4DTKA 1AQ1A 3UVQA 1JOWB 2OH0E 4OTPA 5GINE 3QWJA 3KULA 3DPKA 4KS8A 4KS7A 4YMJA 4R7HA 4O1PA 3OCTA 3U4WA 2SRCA 3CBLA 1XH8A 3GQLA 2H8HA 3DXQA 4O0UA 5ACKA 3NVMB 3R02A 4YP8A 2CCIA 3FKOA 1V0OA 1XKKA 3IECA 2ZV8A 4PDYA 2V5QA 3RJCA 4F0GA 3IO7A 3NEWA 4EL9A 5M4FA 5AR8A 1OPJA 4RPVA 3KKVA 4PQNA 4ZTNA 4I1ZA 5LMKA 4YJRA 3DQWA 4FV8A 1WVYA 3AGLA 2R3LA 3LCSA 4FZ6A 2XYNA 2OXDA 3RAKA 2XNBA 1JKTA 2X1NA 4MX9A 5A3XA 2GS6A 2BIYA 2GHMA 4XNEA 4K77A 4BCKA 1P2AA 4QQCA 1UWJA 3C4CA 2UZTA 2E9VA 3UYTA 2BDJA 5IUGA 4G6OA 3ALNA 2O2UA 3UODA 5KMMA 4FODA 4OGRA 2CNQA 2UW7A 3NUNA 4E1ZA 5IH4A 2ETMA 2FSMX 4JAIA 3F2AA 4HNIA 2CN8A 3LFQA 4X3JA 4V05A 1W0XC 4BGHA 4D2VA 4O0YA 3L9PA 1KE8A 2VTQA 3MFRA 3PPKA 2WMXA 3NUSA 4WRGA 2AC5A 3LW0A 3LLAA 2FA2A 4E5WA 3AT4A 4FV4A 3TDWA 5CU6A 3R2YA 3TEIA 4ZS4A 4WNPA 3SV0A 5J1WA 2YLEA 4EK5A 4FV0A 3CJFA 4L42A 5DT3A 4QMYA 4EOKA 3DJ5A 5LMKC 4U40A 4LOPA 3BHUA 4BCJA 5HIBA 4O86A 3PVBA 4G34A 1PY5A 2UW4A 2WMVA 4QMSA 4YGAA 4MXAA 4S2ZA 4ZTLA 1J1CA 2YITA 4DYMA 3HV4A 5HORA 4DF3A 2VTLA 3EB0A 3HUCA 2CPKE 3ATSA 1O9UA 2A1AB 3EQGA 4MWHA 3BELA 2W4KA 4JG7A 1G8SA 4C58A 2RL5A 4RWIA 1OL5A 4FVRA 2F2UA 5D7AA 5KKRB 3UP2A 2P3GX 2ZB1A 5CSVA 5DR6A 4FKIA 1J7UA 5FD2A 3SC1A 4ZEGA 1B38A 2J0MB 4I6BA 4QQJA 4CFWA 4E8AA 5KX8A 3U6HA 5G1XA 3NAXA 1ZYLA 3A60A 4FOBA 1CTPE 5E8UA 3G0EA 3MTLA 4FIFA 2VO6A 3RPVA 4I23A 4UZHA 5CVGA 4MBLA 4RIWB 4OT5A 2R3QA 4YJSA 4UWYA 3SOCA 2JAMA 4BDKA 3TIZA 3OOMA 5CAUA 4R77A 2GSFA 4AFEA 4EQMA 5KZ0A 4HYIA 5CQUA 4FG8A 4LYNA 5JMSA 1YXVA 5GJDA 1UNHA 3OW3A 5BUEA 2CHLA 4EZ3A 4NIFB 1ZARA 5LCKA 4PUZA 4DEBA 1ZWSA 3TJCA 2XBJA 2XK4A 3QQKA 4JNWA 5AWMA 5DN3A 4YO6A 3CPCA 5JH6A 3PY0A 4J7BA 3DU8A 4FKQA 5KE0A 4DHFA 3PP0A 5DMZA 4HZRA 5F94A 3ZRMA 2X81A 4I41A 3A62A 1IAHA 3MPMA 3R21A 5A14A 1ND4A 5F9EA 2X8EA 1H1WA 4ANNA 4F09A 3ORKA 3OW4A 2BRNA 3HX4A 3UNZA 5E91A 3PIZA 1SMHA 3QCYA 2R0IA 3S95A 4GMYA 2E9PA 4I5HA 5DFPA 4P4CA 1IEPA 2C1BA 3GU8A 4LRJA 2O3PA 1UU9A 3SHEA 4EOIA 4J95A 2B54A 4EBVA 3BYSA 3FSKA 1PXKA 5EOBA 3R9HA 5K9IA 4F1MA 3GU7A 3IW4A 4MXCA 2XKFA 2CGVA 4CG8A 1KE7A 5CEPA 5KO1A 1TQMA 3LMIA 4ZP5A 3QCQA 5JRSA 2IVUA 5IA1A 2XKCA 1CDKA 4HVHA 4Z7HA 1PMUA 3H3CA 4XV2A 5FEQA 3GFWA 3PIYA 1WZYA 5KBQA 1M7QA 3KC3A 4CFMA 4RSSA 1FOTA 3PSBA 4GW8A 2OO8X 1YI4A 2F7ZE 4HJOA 4TT7A 1YOLA 5AP2A 4V04A 2J50A 4MD8E 3EQCA 5HICA 3TM0A 1R39A 3GNIB 5L6WL 4FKGA 3OBJA 4F70A 3WOWA 3O96A 1P4OA 4GIHA 1P14A 4QYFA 3JS2A 3Q4TA 2BTSA 3NLBA 4I24A 5C4KA 3BLQA 4OTWA 1GZOA 4OT6A 2XA4A 3R8ZA 3MN3A 1A48A 3NX8A 4PPCA 1I09A 4JAJA 1EH4A 4QMXA 3TZ7A 3DKOA 5C8NA 3LQ3A 3DQXA 4GG7A 2QOKA 4LFIA 4YJVA 4O2ZA 4ZTQA 3NYXA 3V3VA 3BGPA 3G2FA 2ETRA 3AG9A 2ZVAA 3GC8A 3QX2A 2PE2A 4FV6A 1PHKA 1XH9A 5E1EA 4RVTA 5A54A 4RT7A 4GCJA 4X3FB 4MBJA 2VO0A 3D5XA 3W16A 5JFVA 4AUAA 4C4EA 5JFXA 1H8FA 3D15A 3MB6A 4XG3A 4C3PA 2BHHA 4BCOA 4D0WA 2W1CA 1BX6A 5BPYA 3FYKX 2UZDA 3QC4A 5KHXA 2XM8A 3DFCB 2XB7A 5IDNA
chains in the Genus database with same CATH superfamily
4GS6A 3DXPA 3PG3A 4AGDA 2FH9A 2VTOA 4D2WA 4DGGA 4K18A 5CASA 4ACMA 4FSTA 4UN0C 3JYAA 4FKTA 3R83A 2JIIA 3QKLA 4HGEA 5B0XA 4FSRA 4BIEA 2CGWA 4I4FA 1H4LA 3ZRKA 5I9XA 3OY3A 4P90A 3HA8A 4D4RA 4PMSA 4DINA 4TRLA 3ZEPA 1LUFA 3POZA 4TL0A 2QR7A 5CAQA 3BU6A 5HCYA 2W99B 2BRMA 4OR5A 4NCTA 3TV4A 1YOJA 1XQZA 5IF1A 2R3KA 4AT5A 1XMLA 5C9CA 2P33A 2X7FA 3KMUA 4GT5A 2W06A 4RGJA 3BWFA 1VJYA 3CLYA 5AR4A 4CFNA 3AKLA 4YTIA 4MK0A 4X0MA 2VU3A 3OCBA 2WPAA 4XG7A 1SVEA 4F6WA 2Z7SA 2GHGA 3K54A 2QURA 3EH9A 2B53A 3QL8A 4FICA 3UZTA 3W0SA 4KWPA 4F1OA 3BV2A 1J1BA 2XNGA 3A7FA 3HAMA 1OL7A 3FXWA 4FTRA 5F1ZA 5HE2A 5IA4A 3PXKA 5GIPE 3C13A 3IKAA 3MV5A 4TYJA 4L9IA 5HLPA 2QO9A 1GY3A 3R8LA 3ROCA 2EWAA 3VAPA 4BDDA 2B1PA 3C4FA 4FIIA 4TTHB 5EM7A 3SW4A 3F7ZA 3ZLWA 4O4CA 3UG1A 4FV5A 3OY1A 4S30A 5C8KA 3AC1A 3VWAA 5M4IA 3ITZA 3LJ2A 3OOGA 3QRIA 4NCTC 3WZJA 3GCQA 4L3LA 2CNUA 3PRIA 5CVHA 4AZSA 1YHVA 1TVOA 5KBRA 4QDVA 4DGLC 3QCXA 4MBIA 2PVKA 3NFGB 3ZO4A 5A6NA 4IJPA 1OKYA 3IPHA 3NNXA 4RBLA 4USEA 5DLSA 2YFXA 3KXGA 5IZFA 4F7JA 5DBXA 4GH2A 4KKHA 1QL6A 3AT3A 1JSTA 3WF6A 5K0KA 4QMVA 3R7VA 3MI9A 3FPMA 5KMIA 4RJ7A 3KXZA 1QCFA 3AC2A 3PJ2A 3SGCA 2YZLA 2BFYA 3MVMA 3ORIA 4YJTA 4JQEA 4FG9A 3NFFB 2H96A 3WARA 4NW6A 3Q32A 5JQ5A 3RM7A 2OJIA 3AMYA 2BZIB 3IOPA 4Q5HA 4YTCA 1JBPE 4BRXA 4DAWA 3MTFA 5CSXA 1HCLA 3NW5A 4RIXB 3VS4A 1M17A 1NVRA 3QZFA 2B55A 4HVGA 5AM7A 1ZOEA 3HL7A 3ANRA 3LLTA 5CEQA 4BYIA 4OBQA 4B8MA 3VONA 2BRBA 5ANGA 4O7YA 4ASXA 2F49A 4HGSA 4FEXA 5DYJA 2PMOX 3T8OA 4NM0A 2VWXA 2X2LA 2WB8A 3BIZA 4EEVA 1FMOE 4I93A 2UVXA 3BU5A 3E64A 2X2KA 4IXPA 2YWVA 4WBBB 4ZSEA 4AA5A 4BJJB 4NFNA 3I5ZA 4KINA 2W1HA 3H10A 5EK7A 2A4LA 1LR4A 2HIWA 4CYJA 1APME 3FQHA 4O4DA 3D4QA 3F5XA 5FGKA 3C5IA 4WRSA 2ITPA 3ZSGA 4DA5A 1ZYJA 2J5FA 3M2WA 4J96A 4FK3A 3VIDA 2JIUA 3ENMA 4FIJA 3ZM4A 2WMQA 2OSCA 3WF9A 4U41A 1R3CA 1ZYSA 4IFGA 3I7BA 2UZEA 3IW6A 3RPSA 4EZ7A 2PZRA 5DH3A 2Z60A 4PNIA 4RFMA 4BZNA 4EWQA 2OJFE 4EH2A 4YNEA 1W2CA 3VW6A 3DTWA 3MVHA 4U45A 3UNJA 4ASZA 4C62A 3FXXA 3TYKA 3VUGA 2JFLA 5LXMA 4A9SA 3B2WA 3Q5IA 4FNXA 3QU0A 2DYLA 4W4XA 1R78A 2IVTA 2WELA 2ZJWA 4Y83A 5LARA 3IOKA 5H8BA 1MRYA 2QOOA 3QZHA 2WMWA 4JQ8A 4G3CA 1NW1A 5TKDA 4YLKA 3PXQA 4E4MA 4A4LA 1W84A 3FMDA 4M97A 2ITXA 3QTRA 4RC3A 3DNDA 4QPMA 2VGPA 2VUWA 3FMMA 5TE0A 4CCUA 4CGAA 3V8WA 2VX3A 1I44A 3EFJA 1XH4A 3JVRA 4HZSA 2QODA 3THBA 2YEXA 4H1MA 3VC4A 2YM6A 4NUSA 3UG2A 3G9LX 5IEVA 4ZSAA 1G3NA 2C6EA 4C59A 2DS1A 5ETIA 2R3JA 4DEGA 4YPDA 2JDTA 3AD5A 3VN9A 4F63A 4PTGA 1F5QA 4L44A 3G0FA 3PIXA 2UW8A 1GZ8A 2C6IA 5I9VA 3N4TA 4YPSA 2WTKC 4QP4A 4EJNA 4GU9A 4AZFA 4K1BA 3RPRA 1O6KA 1URWA 2GFCA 4RMZA 4S32A 4CRSA 2CKOA 1M52A 4FUYA 4AOTA 3QYWA 3NZ0A 3F2RA 2OF2A 3WI6A 2XUUA 2OJGA 3SRVB 3OHTA 1MRUA 3FV8A 3V01A 2YIWA 3G6HA 4RA4A 3ZO1A 3PA4A 5EKOA 4YLLA 3W0NA 4GIIA 4G2FA 5AV0A 3RI1A 4GRBA 1ZZLA 3EN4A 5CTPA 1KE9A 2VWBA 4O7RA 3WE8A 3FLQA 3CY2A 3D7TA 5B2MA 2WMTA 4DDIA 1T46A 5FQDC 3ZXZA 2R2PA 5DVRA 5L8JA 5E92A 4AZTA 3ORPA 4U42A 4S31A 4TWOA 1H24A 4RQKA 2WHBA 4QYHA 4FNZA 5J79A 5FDXA 4ARKA 3TI1A 5L2SA 1H0VA 4RC2A 4BL1A 2Y8OA 3OP5A 1Z5MA 4X6RA 2WIHA 4EOQA 4FGBA 3CGOA 5M4CA 2Y7JA 3A7JA 3OTVA 1DAYA 4FTKA 1IG1A 4YC8A 4AN9A 1XH6A 3FZSA 4XJ0A 4DC2A 4EYMA 3FI8A 5AIRA 3W2OA 3FZTA 3KA0A 3KN5A 4RX7A 2XAMA 2C0OA 3BLHA 3UQCA 2X2MA 5HD4A 4FIEA 3QTQA 2RFSA 3GP0A 3HGKA 5A4TA 3NW6A 4QMZA 3VBQA 2NP8A 1KOAA 2PL0A 5E8ZA 3VBTA 3VUIA 3WZEA 4IQ6A 4DG3E 3LQ8A 3MFTA 1WBPA 3OXTA 5EH0A 1PF8A 4PPAA 5AMNA 4G9RA 4FG7A 3LMGA 4ENYA 5AUTA 3I4BA 1OGYA 1YDSE 3NNUA 3NUYA 2WU7A 4WUNA 5CNOA 4ZK5A 4BGGA 5A9UA 2ITZA 4HCTA 4NKAA 4WUAA 4AQKA 2QU5A 2HWOA 3PRFA 3QRUA 4IX5A 3ZU7A 2O65A 4HGTA 4B8LA 3EJ1A 2C3JA 1DAWA 3E92A 5JGAA 4ZY6A 2BCJA 3RZBA 5FTGA 2XRUA 1TKIA 2VNYA 3DA6A 4IC7A 3TJDA 1OUYA 2OJJA 3LFBA 3P86A 3C4EA 2JITA 3U6JA 3VW8A 4FK6A 2CNVA 3PXYA 4MWIA 5EW8A 3ET7A 1J7IA 2VO7A 3DY7A 5IQDA 2OLCA 5ANJA 2YHVA 3GFEA 2HENA 4W4WA 2QQ7A 2Q0BA 4PV0A 3RCJA 3ZZEA 4AXDA 1REJA 3R7EA 2E9UA 3LAUA 4ZTMA 4AAYA 4QMUA 5L6PA 4AW2A 2J2IB 4J52A 4E6DA 4YC6A 2OWBA 1ZYCA 4U44A 1DM2A 4A06A 3I6UA 2CKEA 4BGQA 2PE1A 3DZOA 4YURA 1G5SA 4H58A 3L9LA 4ITJA 4R1YA 3HLLA 4IVDA 1VEBA 4WKQA 4BCQA 3TKIA 4H1JA 4MNEA 1Q8WA 3TNWA 1JKKA 3TZ8A 5LVMA 3IQ7A 4ANLA 4FL3A 4RLLA 2PZYA 4CYIA 4O6LA 1NVQA 1SM2A 3A7GA 3EOCA 3F3TA 3LHJA 3JR1A 2RFDA 3LPBA 2VWZA 3H0ZA 4MXYA 3QRJA 4HCUA 5AUUA 5E4HA 2UZVA 4APPA 5EYKA 4FIHA 4UALA 3GEQA 3VHKA 4WG4A 2V0DA 4NH1A 2WTJA 4XUFA 1M7NA 4A4XA 3MH3A 4C4FA 4OTRA 3KMMA 5IG1A 3T3VA 3R28A 4D4VA 1TFFA 3ALOA 1SVHA 4XEYA 2R7BA 3FYJX 3TTJA 1YXUA 3QRTA 4K8AA 3FKLA 5FXQA 2F9GA 4YHFA 3VS1A 1PXOA 4DBNA 3UPZA 3ZM9A 5AUXA 4WIHA 1OPLA 4Y5HA 4CQGA 3FMHA 4KIKA 1T45A 3ZLSA 2PUNA 5FUTA 3TZ9A 3WYXA 3GCSA 3ORMA 3FC2A 4KIQA 1Z9XA 3F9NA 2QOCA 1SNXA 4N6ZA 1BYGA 3GCUA 4FV1A 4MCVA 3HV6A 5J5TA 5DHJA 4ANSA 4G5JA 4C34A 4EC8A 2IW6A 5I4NA 4WSYA 3ZXTA 4ZTRA 3FI2A 3UO4A 5L8LA 4FT9A 3GU6A 3SKCA 2BZKB 4BF2A 2XJ2A 3RVGA 4C7TA 2F7EE 3ORXA 3KFAA 3O17A 4E93A 4ZZNA 4BZOA 5HQ0A 3UZPA 4O81A 3CY3A 3FLSA 5KMOA 4C02A 1ZAOA 2XK9A 3CJGA 4IZ5A 2E2BA 3KY2A 5F95A 2YJSA 2WMSA 5BVKA 1H26A 4JBVA 5IUIA 3ZSIA 4ACCA 1DS5A 3E8DA 1J91A 3D0EA 4AWIA 3QKKA 2C6LA 4R8QA 3QBNA 4R6VA 4KRCA 4XCUA 4CMOA 4NSTA 2EUFB 4EORA 4LUDA 3ZTXA 4CVAA 4KB8A 5BV3A 2WIPA 4GUEA 2XK3A 1KE5A 2QOIA 4LG4A 4FTLA 3PFQA 3I81A 3PP1A 4EJ7A 4I0SA 4IACA 4YZDA 2OIDA 4PX6A 3V5PA 4CFXA 3S1HA 2CKPA 1K9AA 1NA7A 2HZIA 4DT9A 3UNKA 4LUEA 4GYIA 2XP2A 2EXEA 4O2PA 2J0IA 2AC3A 3BI6A 3KVWA 3ZH8A 3FLZA 5ANOA 2XF0A 3H9RA 4WO5A 4ZJJA 2CGXA 4LV5A 4AS0A 1M14A 3IDBA 5FP6A 4ZMEA 4XG6A 2HAKA 1GIIA 4QD6A 5CXHA 4FBXA 3WIGA 4CCBA 4W4VA 4GFGA 4ZJIA 3ZCLA 5M55A 4O4BB 4EQUA 1UA2A 4QYEA 3UDBA 1WAKA 2W5HA 2YABA 4IMYA 4YR8A 5LOHA 5KMKA 4QMOA 5AX3A 4PMMA 4TNBA 3HMOA 3F3VA 4XG2A 4M15A 2G01A 1TZDA 4LL0A 3KRRA 2OZAA 4NJDA 4U5JA 4A9RA 2QU6A 5L6OA 5IU2A 5L8KA 4BDHA 2XNPA 2EXMA 1VYZA 2FGIA 3R1QA 1FVTA 4AOIA 2UW3A 5HVYA 3ORTA 3ZLYA 4EHVA 1UNLA 2QO2A 4J8MA 2XH5A 3N4UA 3HUBA 4BICA 3DBFA 4YUQA 3FLWA 2HYYA 2HOGA 2P2IA 3B8QA 3AT2A 4C4HA 3Q2JA 3DS6A 3AD4A 3F7WA 1LEZA 4C37A 5JSMA 4X2KA 3NS9A 2XIKA 4J99A 4BDCA 4GYGA 3ZUVA 4QYGA 1PRYA 4NL0A 3FMNA 2WGJA 4CNHA 4JBQA 4W8EA 1QPDA 5BNJA 3ERKA 5CF4A 5LQFA 4V0GB 2ZFYA 1ZMUA 2V62A 2OW3A 3BHHA 5AJQA 5EYMA 5IA0A 4JR7A 3I7CA 3IW7A 1GAGA 3FE3A 2ZM3A 3CP9A 4DFXE 2B9FA 4E20A 4EH5A 3OEZA 3BBTB 4U81A 3FPQA 4ANQA 4Y8DA 4EHGA 4ZSGA 3H30A 3WILA 4EWHA 3W0MA 4AAAA 1UKHA 3TIYA 2YCQA 3DKFA 1Q3WA 4GK3A 4G31A 4FVQA 5CYIA 3R71A 5LMAA 1PKDA 4AZWA 2BROA 3BE9A 4FTNA 2VWVA 4NW5A 3ZC6A 5DPVA 2HCKA 3P7CA 1Q3DA 4UXQA 5HVJA 4AA4A 2DWBA 1XBCA 4L67A 1H00A 2JGZA 2XNNA 4O0RA 4ZAUA 5J7BA 5K5NA 5KMNA 2ZDUA 4DEDA 2W1DA 4ZOGA 3CGFA 3UO6A 4BFMA 5HX8A 3QKMA 5LVNA 2JLDA 4O7WA 3NMUF 3BU3A 4J1RA 1S9JA 3W8QA 2QHMA 4JI9A 4QDEA 3P4KA 4M13A 2UV2A 4CKRA 1KSWA 3KCFA 2B4SB 4TWPA 4EUUA 2UZWE 5GIOE 2YIYA 4KKEA 4D1SA 2UZBA 3R9DA 5BUIA 4YBJA 1URCA 3R22A 5BVWA 3HYHA 3PZEA 1S9IA 2QLQA 3V5QA 4K6ZA 1G8AA 4AXEA 3MFUA 1OBDA 3PFYA 2YAAA 4LV8A 5C26A 4R3RA 4HVIA 4XV9A 2WEVA 2PVNA 3N4VA 4XG8A 2ONLA 5IEXA 4UMUA 2X6EA 2VWUA 3DCVA 4O7NA 4L00A 2XZSA 4GJ2A 2R3NA 3PVGA 5GNKA 4X2GA 3O8UA 4IWQA 4BB4A 1UNGA 2B52A 4IAIA 4DFUA 5LWMA 4YSMA 4MXOA 4UMTA 1DI9A 4R3CA 4UMRA 2VTHA 2ERZE 3BGQA 2CDZA 3GI3A 5TF9A 4AP7A 2WMBA 3BL7A 5K4IA 2QOLA 1Q62A 2YIRA 3BYOA 3HMPA 4RJ3A 3B2TA 2BHEA 2W96B 3QAME 2ACXA 4R7IA 2W1EA 3OXIA 4P5ZA 3KREA 1OPKA 4TZRA 3L8PA 2G15A 3BBWA 3DBDA 3EFWA 4JJRA 1Q8TA 4K2RA 2XK8A 3PJ8A 4Q5EA 2W1IA 4FTIA 5JZJA 1K2PA 2WNTA 4KBKA 1F0QA 3R8VA 3E63A 2ONLC 4IZ7A 4EOLA 4XRLA 2C0TA 4FTOA 4WG5A 4N6YA 1GNGA 4QTEA 2QOQA 4ASDA 4JMQA 4F9YA 4P2KA 2RIOA 2HXLA 2ITUA 3G15A 3OCGA 5CXZA 4GUBA 1OITA 3HV3A 4FV3A 4IB3A 2P0CA 3ID6C 1UU8A 1YW2A 3PY3A 5L2QA 3V51A 4CFUA 3K2LA 3CD3A 3ZRLA 2BMCA 4A7CA 5E1SA 4HVDA 5HBJA 4JG6A 3R04A 1L3RE 3ZBFA 1VZOA 4OBOA 4C36A 4GKHA 3TUBA 1R1WA 3F61A 4FSUA 3CE3A 2Z7LA 3O51A 5D10A 2R3HA 1G8KA 3PJ3A 4L46A 3R8UA 3ORLA 5B2LA 4C38A 2QO7A 2G1TA 4N0SA 2W4OA 5DE2A 1PMEA 3OF0A 4IAAA 2QONA 5HO7A 1JAMA 4I20A 3RKBA 5ANIA 3WF5A 4FT7A 3COIA 1UU7A 3ORZA 4PP9A 2IZSA 2PVYA 2WTWA 3NDMA 4M0ZA 2G2FA 3GU4A 4FV9A 4QTCA 3DV3A 4D5HA 2QG7A 3HRFA 2Y4IC 3TN8A 2ZDTA 4JS8A 4KKGA 4YNOA 4BVUA 4JX3A 4CMUA 2YCRA 4FX3A 5DG5A 5H2UA 1F3MC 2J7TA 2Z8CA 5F4NA 5C27A 4IX4A 2JC6A 4AF3A 2VX1A 4CQEA 5AAGA 4QNYA 3UIBA 2QG5A 3FY0A 1ZMVA 4JDIA 4O0SA 1IA9A 3LOKA 3GOKA 3I6WA 2WTDA 1MUOA 5AUYA 3CTQA 3F6XA 3OTUA 4XG9A 4PNKA 2BKZA 1RDQE 5DR2A 4FZFB 4FTJA 1PXNA 2ESMA 1IA8A 4EOJA 3KK8A 4G6NA 5D41A 4F99A 2BZHB 3KVXA 1Q61A 2PK9A 2PZPA 2RGPA 2XBAA 4L7FA 4IX3A 4RWKA 2CLXA 3E8EA 4FSWA 5CLPA 3JY0A 3QRKA 2OI4X 2R3PA 3BEGA 5BYLA 1YWVA 3PJ1A 4PF4A 4O7LA 4O0TA 1W8CA 2YIQA 5IEYA 3FJQE 2XNEA 3NYOA 4CFFA 4UX9A 1OKZA 4CKIA 3R8MA 2CCHA 2OG8A 3NW7A 5EHOA 5DT0A 3R8PA 4CG9A 4TY1A 3W2SA 3EIDA 4FTUA 4UMQA 2PUIA 5IA5A 2QVSE 1KOBA 2UW9A 3LCDA 3W32A 3HDMA 3QZIA 4I5MA 3O0GA 1MP8A 4C4IA 4V01A 4BCHA 4ANMA 4G16A 4C2WA 1KV2A 4MHAA 2X0OA 4W9XA 2GQSA 2CGUA 4ZLOA 2WFYA 3IW8A 4E26A 5AR3A 2HW7A 3TDVA 3P5JC 4UZDA 4RJ6A 3D5VA 3QA8A 4LRMA 4LOOA 2BR1A 3GQIA 3PVWA 1CKJA 4FV2A 4GEOA 3ZONA 2GS2A 2R0UA 3HZTA 1PXJA 2UW0A 5LVOA 3MA3A 4D0XA 2Q83A 2OU7A 4MD7E 5GHVA 3DK3A 3HKOA 3HNGA 3POOA 3VS7A 4DFYA 4WOVA 3DZQA 3R0TA 4EKLA 2NO3A 1JSVA 3RINA 5JGBA 2W1ZA 4AA0A 3CTJA 4LMNA 1ZRZA 5KHWA 4QMQA 4JR3A 5IQAA 4GL9A 2A27A 5FDPA 2XVDA 2YM7A 4RQVA 5GJFA 4P5QA 3PY1A 1KUTA 3EZVA 2F2CB 4Q9ZA 5FXRA 1FMKA 2I0VA 3KEXA 3MFSA 2WXVA 4Y46A 5D9HA 1GZKA 2I0YA 3LFSA 5HI2A 4ASEA 5K3YA 3UIMA 3WZKA 3MPTA 4OTFA 2FO0A 1E9HA 1Q8YA 3EQDA 4I4EA 4U0IA 5DI1A 2W9FB 1YI3A 3FC1X 4E5BA 3PA5A 5HLNA 5HU9A 2KULA 5IQFA 4QMPA 3WIKA 1P5EA 4CEGA 4RWJA 4FZ7A 5EDQA 4D2TA 4A07A 3QWKA 3LIJA 3SA0A 4KA3A 3A8XA 4IC8A 3KK9A 4IEBA 4R1VA 5CWZA 3U51A 3R73A 4RLKA 5H9BA 4TW9A 4Q2AA 5L3AA 3FMKA 2WTIA 4IJ9A 3LCTA 2Z7RA 4I3ZA 4KIOA 3UOKA 3ZLXA 4RIOA 1PMVA 3DDQA 4CTCA 3AC4A 5HTIA 5BVNA 3P0MA 3OWPA 3SDJA 2QKRA 1MRVA 4BN1A 1E1VA 3FXZA 4O0XA 2HY0A 4KAOA 3O5AA 3L9MA 4NM5A 4W4YA 3RPYA 3ZEWA 5HU3A 2YIXA 2C4GA 3N9XA 4G3EA 3G51A 2IN6A 2X6DA 3QLGA 5CAOA 4FNWA 2R3RA 4O22A 4H39A 3NUUA 3KXHA 4PPBA 5DR9A 5FTQA 4DN5A 4PMPA 3PA3A 5FRIA 5EHYA 3A4OX 3BX5A 2R9SA 3ZDIA 4EC9A 3GC0A 3RTPA 1YI6A 3F3UA 3QX4A 3A7HA 4QP2A 3ZDUA 5HX6A 3D2IA 4IIRA 3NR9A 2WQOA 5HOAA 5KKRC 3OT8A 3DGKA 3BKBA 5DWRA 3E62A 4G3DA 3ENHA 4RFZA 3Q9ZA 1SYKA 5AP1A 5BVDA 3OMVA 3Q9XA 3PDTA 3G90X 3PJCA 4FOCA 4DFLA 3RHKA 4YSJA 4DGOA 4YZMA 4D2RA 3PG1A 3BCEA 2OGVA 3GENA 5HGIA 1SNUA 3WF7A 3R6XA 3EZRA 2XCHA 5I3RA 3FKNA 3ZUTA 3CEKA 1WBVA 4Z3VA 5ANEA 5BUJA 1G8JA 3V8SA 5EI8A 3VULA 1H1PA 5DOSA 2VTAA 5AAEA 4TNDA 3MYGA 3RPOA 2XCKA 4JVGA 4OTIA 3A4PA 5KCVA 2PVHA 4M0YA 4BYJA 4EOOA 4UXLA 2VTIA 1OECA 1ZLTA 4N57A 4XV1A 4U6RA 4EK6A 3TUCA 2G2HA 4USDA 3DBEA 4D55A 4MTAA 4AN3A 3R1SA 2QHNA 4LGGA 4YZCA 4LDTA 4Z55A 5AV1A 4DG0E 5IQCA 4DDGA 4M12A 2I0HA 4DEIA 5AP4A 2J0LA 2FSOX 2OZOA 3C5UA 3KF7A 4IADA 4KBCA 3AC8A 5CU3A 4QMNA 3CKWA 1PYEA 2UZNA 3S4QA 4HGLA 1QPCA 4Y85A 3Q4ZA 2B9HA 2C3IB 2F4JA 4K0YA 2OFUA 3R7OA 2A2AA 2C6KA 4O38A 3ZFYA 5HE0A 2GTMA 2J0JA 2WMUA 3V04A 3L8SA 2WD1A 2XKDA 2P4IA 1RE8A 4B7TA 4PDPA 5CEOA 4I6LA 3OWJA 5AP5A 2UVZA 2XNOA 4HYUA 4MF0A 3R9NA 1BI8A 4U97A 3SG9A 3FL5A 3NNVA 2XIXA 3HV7A 5M56A 5HIDA 4QP1A 2WTVA 2QCSA 2XS0A 4QYYA 3I0OA 2VX0A 5FM2A 3VUTA 4EK4A 1SZMA 3F3ZA 1ZXEA 3NCZA 4AOJA 3TWJA 1OIRA 2QD9A 1PXIA 2XRWA 2VRXA 3PVUA 4FA2A 3FMEA 3W2PA 3WBLA 5FEEA 3CQEA 3FL4A 4JLCA 3LFCA 5AUVA 3NVKI 1OIYA 3BYUA 5IKWA 1H27A 4L43A 3WF8A 2H34A 3DBQA 4MUQA 4XV3A 3W2RA 1TQPA 4ERKA 5JT2A 3R1YA 2I6LA 2Z2WA 1J7LA 2XNMA 2JKQA 4RVKA 3W10A 4BWKA 3FMJA 3QTWA 5DEWA 3V8TA 1BUHA 3HA6A 4BKZA 4F4PA 4ORKA 2BRGA 5G6VA 5EI2A 4BBFA 5ACBC 3C4WA 3UPXA 1HCKA 4GT4A 2JDOA 1JNKA 2C30A 2R7IA 4RVMA 2ZV2A 1H25A 4FYOA 2GNHA 3D9VA 3NUAA 2QR8A 3P08A 4PRJA 5CS6A 1CSNA 4L53A 2B7AA 3JUHA 2E9OA 3LKMA 4O4FA 4X3FC 5DA3A 4KIPA 5HG7A 4C4JA 1NY3A 5I9YA 1H01A 3BHVA 3DTCA 4FTCA 2JDVA 3FAAA 3QZGA 5HG8A 3RAIA 3C4XA 3E8CA 4MQ1A 3OG7A 4PWNA 5ICPA 2JFMA 5IMEA 3QQJA 3UVRA 3DB8A 4IWOA 4ENXA 1JKLA 3HP5A 3E87A 4PP7A 3EKNA 4GFMA 4QP6A 2REIA 2GNIA 2VWIA 4MF1A 3OWKA 3LM5A 4RZWA 4XLIA 1XH5A 5D1JA 5LMBA 2BDFA 2WKMA 5C03A 3NNWA 3F5UA 2UW5A 5L2WA 1ZYDA 2W17A 4IAKA 1YWNA 3ZS5A 2PVMA 4O1OA 4RIYA 2XJ1A 4M8TA 5EDRA 3AQVA 5HKMA 4C57A 4JRVA 4NFMA 2GS7A 1OGUA 3EN5A 4O84A 4IVAA 2YM8A 3FLNC 4IAYA 2JDSA 3R00A 3KULB 2BIKB 1OUKA 4A9UA 3A61A 3RCDA 4PMTA 3NCGA 3DJ6A 2QLUA 3T9IA 3QTXA 2OBJA 2Y6OA 3BRBA 3FEGA 2A0CX 5BYZA 5AR5A 1RJBA 1AD5A 2C6TA 4TWCA 5HEZA 2VTJA 4FNYA 3R7UA 3W0PA 4U8ZA 1YVJA 2C6DA 3EQPA 4IW0A 2HW6A 2UVYA 5FLFA 3E3PA 4F7LA 2X9FA 2ITYA 5KNJA 5BVOA 3QQLA 5E8WA 2BPMA 2PZ5A 3LM0A 3LMHA 2BAKA 4HNFA 2PUUA 3BQCA 2XJ0A 3AGMA 5DGZA 3RAWA 1XH7A 4ALUA 4AQCA 2XAOA 2XANA 4QEBA 1CMKE 4ZS0A 3W2CA 3HV5A 3QUDA 3O2MA 1U54A 2V22A 4APCA 5CENA 4H05A 1WVWA 4YJPA 3VUMA 4AG8A 5IQBA 4DEAA 2WMRA 5IH6A 5J5SA 4AX8A 1OKWA 1PKGA 4LMUA 5E7RA 4MXXA 3G9NA 4PDSA 2XKEA 4FT3A 3ZFMA 4EONA 3BYMA 3CS9A 5HNBA 4O82A 2YDJA 4BDAA 4L01A 4FKWA 3RNYA 4ZMFA 1Q4LA 2GDOA 3MH0A 4XOYA 4QQ5A 3V5WA 5GZAA 3EQIA 4JT3A 3GBZA 2ZAZA 4MVFA 5BMSA 4TN6A 3I1AA 2PHKA 2PTKA 4OUCA 3TZMA 3V5LA 3AKJA 4DLIA 4M66A 5ETAA 3S00A 2YERA 3HMIA 4DTAA 4Y5QA 5B7VA 1XJDA 3REPA 3OBGA 2HY81 5AIKA 5LJJA 4IVCA 4F64A 3P7AA 4UV0A 4G3FA 5I9UA 4BTMA 1JQHA 2JEDA 3QCSA 3GCVA 4II5A 3TV7A 4BI0A 4CFVA 4ZJVA 4QT1A 4QP8A 5H8EA 2FB8A 5JFSA 4N70A 2ZMDA 5CNNA 2YN8A 3VBVA 4JRNA 4O4EA 3BV3A 3QQFA 1OL2A 3U6IA 5I0BA 4FIGA 2ZM4A 4TYIA 4U9AA 2ZV9A 4A9TA 4EK8A 3TKUA 2C3LA 4O7TA 5A6OA 5L2TA 3MPAA 1XBAA 3GU5A 5EOLA 4YJNA 5J9ZA 4UB7A 3ULIA 4B0GA 2CN5A 1QPEA 2Q0NA 3QALE 2DUVA 4D9UA 3OFMA 4D2SA 3QGWA 4IB0A 5AP6A 3PUPA 4BI2A 3HVCA 4TPTA 3ZMMA 2QOBA 3BEAA 4QRCA 3D94A 2YAKA 5FWKK 4NWMA 3I60A 3VUDA