4IACA

X-ray structure of camp dependent protein kinase a in complex with high mg2+ concentration, amp-pcp and pseudo-substrate peptide sp20
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
333
Chain Sequence
b'VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 111
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iacA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iacA02
3RALA 4IAKA 4V04A 4EUUA 5CEOA 2UW7A 3R00A 2PUUA 3VBYA 4L67A 4QTBA 3R8PA 2GQSA 3KA0A 4FGRA 1ZYCA 3DFAA 4QP2A 4HJOA 3UODA 4BDGA 5JRQA 2BIKB 1GIJA 2WTKB 1Y91A 4MXAA 4HNFA 3DV3A 1AD5A 4HGTA 3LCOA 3CR0A 4DH7A 4KBCA 4TYHB 5CALA 1LR4A 2GNGA 4Y85A 3E3PA 1KOBA 4M3QA 4ANQA 5JSMA 4EONA 3TCPA 2QO9A 4ARKA 1WAKA 5EOLA 3EQCA 3AC8A 3MA3A 5AP6A 3MVLA 5CU6A 3SA0A 1H07A 3TZMA 5LJJA 2CGUA 4L3LA 4DBNA 4O7WA 3IW8A 3QCYA 2WMWA 1VYWA 3OBJA 4XX9A 3HV5A 3MI9A 4BL1A 4BHNA 2VX3A 2C4GA 3KK9A 4RJ6A 3O51A 4QOXA 1H4LA 4GCJA 1ZAOA 3HYHA 5HTIA 4C4GA 2F7XE 2UW3A 4EEVA 3SW7A 1REJA 2VWWA 2CPKE 2VWZA 4CFVA 2HZ0A 2O3PA 5CEKA 4IB0A 3TV4A 4DH5A 3ZBFA 3V6RA 2PK9A 4IZYA 3VS2A 4GW8A 1G8AA 2GSFA 5DT0A 3NUNA 3GNIB 3PPZA 3HDNA 3EMGA 2RFSA 3EKNA 1WCCA 1YXVA 3RHXA 1Q8WA 2VZ6A 3GI3A 3NNXA 4M8TA 2R3NA 3KXHA 5T6KA 4G1WA 2I0HA 1GJOA 4GSBA 4P7EA 4G3DA 4QMZA 1YI3A 3GBZA 3KRWA 5C9CA 4C4JA 3LXPA 1OIQA 1XHAA 3FMMA 4K9YA 2YZAA 3OP5A 5KKRC 3LFNA 2OH4A 5CU4A 1YXUA 4RWKA 1BLXA 3TL8A 2WQEA 4TRLA 2RL5A 3FMEA 1Y6BA 4F99A 1BL7A 1YQJA 2W1FA 2XA4A 3HV6A 4PDPA 5E8TA 1MP8A 3QKKA 3BHYA 3E8EA 2PWLA 5LMKA 2AUHA 2E9PA 3PXFA 2WOUA 2VTTA 1U4DA 4FX3A 3S2PA 4RJ5A 4XG8A 5EM5A 4AQCA 5CVHA 1M7NA 4BDBA 3BHVA 4Q9ZA 4ZMFA 3TUBA 2HAKA 2PHKA 5G6VA 4JBQA 4U3ZA 3ATTA 4MH7A 4EWQA 1UVRA 4PL5A 4TYGA 3POZA 1OL7A 4WG4A 2BPMA 3PWYA 4WNMA 3SXSA 4AXAA 3ITZA 1WBPA 2HOGA 2BAQA 4YHTA 4JG8A 3FZ1A 2RKUA 4AZVA 4IB1A 5C03A 4CGAA 2WO6A 5CSVA 3R7IA 3C13A 1TKIA 3W33A 2YCSA 4RJ8A 2JFMA 5KMKA 1KOAA 5E8XA 3KF7A 4UMUA 1IRKA 3ZONA 5M09A 4I0TA 3ID6C 5BVKA 3CTHA 3W16A 4Y5QA 3KRJA 3UBDA 2UZUE 2OZOA 4AX8A 4GFMA 2BTSA 3IECA 5AX3A 4U43A 4B0GA 5KKRB 5FTOA 5LCKA 5EHLA 5F20A 3FDNA 3UVPA 2W1IA 3KREA 3O8UA 1SM2A 2UVXA 3EOCA 2J0IA 3H0YA 4PV0A 3VAPA 3ZXZA 4EHGA 4YP8A 4DAWA 3VWAA 3F88A 3F2AA 3CCNA 4WKQA 4F1OA 5HEZA 4EOSA 4QYFA 4EQMA 1PXPA 2PY3A 4L44A 3TDWA 5CI7A 4LGHA 4M12A 4ID7A 4G5PA 3RPYA 4JS8A 1JBPE 2FSMX 1BI7A 3EQFA 1GOLA 4ERWA 5HE3A 3BGZA 3JY0A 4E5AX 1YI4A 2YM3A 4ASDA 3NR9A 2W1DA 3Q5IA 5ANEA 5BVWA 4FEQA 4QMLA 3PVBA 2VN9A 2XK3A 1YKRA 5IA3A 4IB3A 1A9UA 1H28A 4EOOA 4CT2A 3NYNA 4K1BA 2I0EA 3SRVA 3WF9A 1FBNA 3CS9A 3OUNB 1H8FA 5AV0A 3SHEA 3FI8A 1G3NA 2E9VA 2NO3A 4AW1A 2ZMCA 4A9SA 4XUFA 2O0UA 3DS6A 4EOQA 2VO6A 4G3CA 5J7HA 4L46A 2QI8A 5JMSA 2Y9QA 3DBFA 4BDAA 5EYKA 5J8IA 2XB7A 4CFNA 2ZVAA 1YDSE 2J5FA 3OZ6A 5AR5A 3GFEA 1XKKA 5CYIA 5FBOA 3DU8A 2ETMA 3TI1A 2W9FB 3RK7A 4YJQA 2QONA 4A07A 4AZFA 1P5EA 4LOPA 5BUJA 4F09A 4YC6A 2Y0AA 3F69A 4J99A 3TIYA 3VS5A 4FEUA 3ZM4A 3OCBA 5ANIA 3RPRA 4IM0A 5FDPA 5B2LA 2ZM4A 2YWVA 5DRDA 4C7TA 3MBLA 4JVGA 5A4EA 4CFMA 4ZY4A 4CT1A 2X2KA 2ETKA 3DJ5A 1JOWB 3POOA 4FMQA 1ZOHA 2C3JA 2F57A 5LWNA 4PP7A 1KE7A 4RLKA 4BY9E 2VWYA 4DFYA 4DGLC 4QMQA 1OIRA 3V3VA 4CCBA 1B6CB 4QQTA 2ESMA 3VIDA 4S34A 2X9FA 3KULA 2W0JA 2WTCA 3NIZA 1K9AA 3ZO3A 5M08A 4YNEA 4ASZA 5LXMA 3FV8A 2QLUA 3D0EA 3P23A 3UNJA 1NT2A 5GJDA 3C5UA 5LMAA 4OTHA 4UWYA 4ANMA 4GJ3A 1PYXA 5HNGA 4TNDA 3VJOA 4BCMA 4TY1A 3CC6A 4II5A 2QCSA 3R83A 3WE8A 1Q61A 2PULA 4D2PA 2B1PA 1HOWA 4HCUA 3BYUA 5M4IA 3TG1A 3R8LA 1JKKA 1VR2A 4DF3A 5DVRA 4DTKA 5HU9A 1QPDA 4XNEA 3TJCA 1Y8GA 4LMUA 2WTWA 1KE8A 4D4SA 3Q9XA 2CCIA 3MY5A 4KIOA 4XG6A 3LJ2A 4ZSLA 5CSPA 4X7QA 3RJCA 2YITA 3Q04A 1SYKA 5L8KA 2F4JA 4JQEA 2YZLA 5TR6A 1W98A 3EN7A 4G2FA 5AUUA 3ATSA 5CF5A 2W1ZA 2YIXA 4PQNA 4RWLA 3A7GA 3WZEA 5JGBA 3O96A 3FHRA 3LFFA 4WG3A 3BWFA 4W4VA 5CAOA 4FZFB 3E7OA 3ZUUA 4OUCA 4O82A 2C0TA 3NUSA 1IR3A 3R63A 2VO7A 3LQ5A 4TXCA 5HHWA 4EHVA 1B38A 3OCTA 3QWKA 1W82A 2RG5A 3LCDA 4GT5A 4ZP5A 3UVRA 5EHYA 2BDFA 4YHJA 3B2WA 1WZYA 5D12A 4R77A 2JIIA 1FVTA 1ZXEA 3WILA 5AR3A 1Q8TA 4FODA 3OCSA 2XS0A 3MS9A 5KO1A 2OXDA 4YURA 2VNYA 2OF2A 4YLLA 3RAIA 3ET7A 5ETAA 1XBCA 2NP8A 3LFBA 1W8CA 3PIYA 2V22A 3TNIA 4ALUA 4ZZNA 3QCXA 4BGHA 2R5TA 4E26A 4QP9A 4BIEA 3I4BA 3BV3A 5DYJA 4F0GA 4WNKA 3L8VA 2WEIA 1S9IA 4A4OA 1LP4A 3R7OA 5CU0A 3FMHA 2J7TA 5AA8A 1V0BA 4FBXA 4EYMA 2CNUA 3MPMA 3GOPA 1UNHA 4TWNA 3RAKA 3ALOA 1OVEA 4FTQA 4O7TA 3MPTA 4MNFA 2BZHB 2QD9A 2ZV7A 3Q4TA 1QPCA 3DK7A 3DBDA 1PXNA 4FTTA 3AMYA 2RGPA 4G9RA 1APME 4FVQA 1OMWA 4UWCA 1H08A 5L3AA 1CMKE 1WMKA 5D41A 3QALE 4P5QA 5FRIA 3ZSGA 3PG3A 4U0IA 3O8PA 5JQ5A 4LOQA 3AC2A 4FVRA 5K0KA 4BCKA 1SVEA 4JQ7A 3O7LB 3ZDUA 2IZTA 4PMTA 1NVQA 5DEYA 3ROCA 3QCSA 4O0XA 3LZBA 3PSBA 3TV7A 4OT5A 2OFUA 4L45A 4CEGA 4CD0A 3N4TA 3V5PA 5AAFA 3NVMB 2UVYA 4FTIA 2OXYA 3RP9A 4BBEA 2YERA 3VS3A 4GFGA 4MEDA 2XIYA 4YPSA 1KV1A 4DH3A 1XO2B 3BGPA 4MYGA 4BZOA 3NDMA 3COKA 5J7BA 3SAYA 2BRNA 4IZAA 4KB8A 3SXFA 5B7VA 1O6KA 2HZ4A 4QTCA 4BWXA 5I9XA 4QP1A 3IW7A 3DXQA 2J4ZA 3GU6A 1J3HA 3NUUA 4FSQA 2JBOA 3MVMA 4S31A 5HX6A 5HE2A 4PTCA 4FV7A 4DEEA 4YU2A 2RFDA 1XBAA 5BYZA 4O7NA 2WTJA 4WRGA 2YCQA 5GNKA 4C4EA 2C0IA 2R9SA 4D4VA 1Z9XA 3OEZA 5B2MA 1VYZA 4O1PA 2Z8CA 2EB3A 4ZJIA 4J97A 3DLSA 4P90A 3DQXA 5EW3A 3ZYAA 3R02A 5JGDA 3BHTA 1XH6A 4AT4A 2RF9A 2PZIA 3SRVB 2BALA 4F0FA 3EQPA 4RSSA 4IB5A 4TT7A 4UXLA 4C4IA 3TUCA 3NNUA 3PDTA 1W83A 5HVKA 4HVIA 2WHBA 2XF0A 2ZJWA 3E63A 4AG8A 5J1WA 3NMUF 1CKIA 3R7YA 3AT4A 3FZPA 4G17A 3F6XA 3R9DA 4DFLA 2VTNA 4DGOA 5GIOE 5AFVA 2OGVA 1P4FA 1ZYDA 2JDRA 3ULZA 3UO4A 5LOHA 2QVSE 4FYOA 4I6HA 4RA4A 3FJQE 4X2KA 3RNIA 3NSZA 2QOBA 3F2RA 2UW4A 4FSYA 2WIPA 2PZPA 3O50A 3MJ2A 4IXPA 4N57A 3U4WA 4BTKA 3PY3A 4FEWA 1ZMWA 3FLZA 3Q32A 2F9GA 3Q4UA 3QQGA 1L3RE 4MVFA 2YIYA 4KS8A 3FPQA 1DAWA 3NUYA 5LARA 3QKMA 3PPJA 4GVAA 3QQHA 2O2UA 3RPOA 4EOLA 3QX2A 1M52A 2H34A 2ZMDA 2QURA 3NUPA 3CXWA 3UYTA 4DITA 1H24A 1KSWA 2W7XA 3Q60A 3R1QA 4I92A 4WUAA 3QD3A 3O8TA 4IFCA 5TKDA 2CDZA 3LXLA 2C0OA 1XJDA 4LV8A 4WA9A 2BDWA 4CLJA 5CEPA 4XMOA 1OB3A 5IU2A 5GJGA 3FQHA 5IA2A 1UKIA 4ITJA 4UMQA 3BI6A 4E8AA 1XH9A 2W1EA 5AJQA 4BKYA 1GY3A 4BCOA 3CE3A 2RG6A 5IQDA 4ANOA 4EOMA 3GFWA 3CJGA 1U54A 4D2TA 5GZ9A 3FYJX 5B2KA 3FKOA 4IE9A 4EUTA 1YWVA 3UNKA 2BRBA 2JDOA 3TXOA 4C2VA 4MD8E 3ETAA 3PE1A 3ZFXA 4FT9A 2ZB0A 3QUEA 4WNPA 4FNXA 1PXKA 2C30A 2NPQA 2XKFA 3MTFA 4XG2A 3FLNC 1PMUA 2OWBA 5BVOA 4FNZA 2YM8A 4G3GA 4N0SA 2G1TA 2HW7A 3K54A 4KA3A 4CRLA 2PVLA 3R1SA 2X7FA 4USDA 5ANJA 3SC1A 4FZAB 3KU2A 5T68A 2A1AB 1JPAA 3ZOSA 2YACA 5HG7A 4O1OA 1H0VA 4DH8A 1XQZA 5DG5A 3AGLA 4BGQA 5GHVA 2G01A 3LFEA 4MTAA 3VUIA 5CSWA 1STCE 1IASA 5T3QA 4U40A 3CEKA 5FEQA 4AZWA 1PHKA 2FUMA 3NW6A 1YVJA 2XNPA 4M0ZA 3RTPA 4DGGA 4DE4A 3CD8A 3CKWA 4HGLA 4OBOA 4CVAA 5CENA 4DYMA 2JBPA 3HNGA 2ONLC 3H0ZA 3CY3A 3OD6X 1QPJA 4V05A 4ACHA 4X21A 4QPMA 5HNIX 4FV3A 4L9IA 4UY9A 3RCJA 3JVRA 2JKKA 3AMAA 2OKRA 3NW5A 4F4PA 3Q52A 3I1AA 3LM0A 3EQRA 3WYXA 4ZJVA 4M97A 3TTJA 1PRYA 4F6WA 5JZJA 5H2UA 4E20A 4UMRA 5HD4A 3UNZA 3IO7A 2VTSA 2X0GA 3MVHA 4EK3A 2F2CB 4QQ5A 4XG7A 2FH9A 2W1HA 4LOOA 5H8GA 1HCLA 4BI0A 5F94A 2ZDUA 1JLUE 3OWLA 3WZKA 5AAGA 3LMGA 3KKVA 3LCSA 4NM3A 2W9ZB 5AR4A 4DG0E 2HY0A 4O86A 2GS2A 5K5NA 4F7JA 2UW0A 4FKWA 3KK8A 2QR8A 4RC4A 4Z9LA 5E92A 4KNBA 4G3FA 1YXTA 4K2RA 5IQIA 4WRSA 2R3HA 2J0JA 2WTDA 4AAAA 4O7ZA 4O7RA 2VTQA 3PLSA 4PF4A 3THBA 4EHEA 2PVKA 3FBVA 4FI1A 2IPXA 1ZRZA 3CPBA 2R7IA 3DAKA 3FSFA 4BDDA 3UP2A 2X9EA 2R2PA 3ELJA 4D9TA 5GZAA 3OY1A 3EWHA 4YNOA 3UPXA 3G6GA 3K5UA 4EKLA 2ZV2A 3LQ8A 3W10A 2CJMA 1YXSA 2R3OA 4X2FA 4TPTA 3VF8A 1RQQA 4R3RA 3W55A 2A19B 4OTWA 5A54A 4J71A 3F3WA 1SVHA 3F5PA 5HI2A 3NS9A 3P1AA 4X3FC 3UQGA 3DKGA 3VBXA 4E5BA 5CZHA 2VRXA 3UOJA 4MNEB 4C59A 5AP7A 4JBVA 4JR3A 2XM8A 4YZNA 3I81A 2WMTA 1OL2A 4BCJA 5CF8A 4PNKA 3AOXA 1F3MC 3I0QA 3Q4CA 3BQRA 3VJNA 4GKHA 1MUOA 1UNLA 4IANA 4TYJA 5C8MA 3EQHA 4O0RA 3R01A 3FC1X 4NW6A 3PXZA 3FUPA 2OW3A 4FIJA 1NA7A 4QMWA 4FICA 2UZEA 3FE3A 4QNAA 4D1XA 2BAKA 1Y8YA 3PJ1A 1DI8A 2ZV8A 4NU1A 1RE8A 3GQLA 1VEBA 1JNKA 4L6QA 2ZV9A 3VUDA 3HV7A 5DE2A 4QP4A 3Q2MA 4YUQA 2GPHA 5CI6A 5AP0A 3N4VA 1H1SA 3GC0A 3PP1A 3TDVA 4FKRA 4IC8A 2C6EA 2F2UA 4I94A 2GQGA 3BHUA 4AF3A 3FL4A 3OC1A 2P4IA 3KB7A 4WNOA 5HCYA 5BVNA 4HYIA 4YSMA 3WARA 3ORXA 4JL9A 4A4LA 4BFMA 3G9NA 2IZUA 4F9AA 4E7WA 4U81A 2PUNA 1R39A 3ZZWA 4DFXE 4IHPA 5HTCA 5TT7A 2UZVA 4HCTA 3O7LD 3QUDA 4BCHA 1JQHA 5C4KA 3RK5A 5IQCA 2W5BA 4QP7A 4KIKA 4KIQA 5I9UA 4EZ5A 4CRSA 3WF5A 1DI9A 3ZC5A 1Q41A 3ZO4A 2ITNA 1IAHA 2VGPA 4R5YA 2AC5A 2WTKC 4A9RA 3HZTA 5FUTA 2W06A 1M7QA 3KRXA 5DBXA 3LOKA 1HCKA 5ACKA 5DPVA 2XKCA 2X7OA 4QTEA 4YR8A 4EOKA 2FYSA 4EK5A 2W96B 2UUEA 3COHA 4WBOA 3RI1A 4UALA 2C1BA 4XCUA 3ACKA 5FBNC 2CGWA 4R5SA 3TT0A 4FZ7A 4HYHA 2HXLA 4U8ZA 5HBHA 4M0YA 3CLYA 3ZLSA 4TNBA 3H9FA 4NIFA 5HO7A 4A7CA 5KCVA 3V5JA 3KCFA 3QQLA 3MB6A 5IUGA 4BB4A 5JKGA 2PVFA 3KCKA 3FMJA 1ZMVA 2B9IA 3DAJA 2BR1A 2GHLA 4EBVA 4RVLA 2IJMA 2IZSA 1W0XC 3WYYA 3PY1A 3L1SA 2OU7A 3KQ7A 4AU8A 3C0HA 2XK8A 4RFZA 5E4HA 3KGAA 2BHHA 5A4LA 1J1CA 2RFEA 3GEQA 4XEYA 5FDXA 4FKQA 4O91A 4V0GA 4YHFA 2VO0A 3EZRA 3EQGA 2HZNA 1H0WA 4E6AA 2PMOX 2HZIA 3A4OX 4S33A 3S3IA 5AM6A 1A48A 4F63A 4FV8A 3VBTA 2NNWB 2QOHA 3F3ZA 1U5QA 2PZYA 3H30A 4C3FA 4C33A 4BCPA 4F0IA 5J9LA 5CAPA 2P55A 3LCKA 3R28A 3QA0A 4JBPA 2W5AA 4O6EA 4FTJA 5IH5A 4E3CA 5EDPA 2GMXA 3AMBA 4ZS4A 2OFVA 3QZHA 4JT3A 4KKEA 3JS2A 2Y7JA 3F82A 1FINA 3NZ0A 1YHSA 3EL8A 3BPRA 5I3OA 5KMMA 5M51A 3C7QA 3JY9A 3K2LA 2XNOA 4NH1A 4Q5EA 3QD4A 3NEWA 4RFYA 2PE2A 4TTHB 3NYOA 3ZHPC 2X4ZA 5F1ZA 3QC9A 4QMPA 3BRBA 4M13A 5HICA 1J7LA 1UWJA 3H4JA 3VUKA 5GIPE 3FMLA 4AZTA 4FL1A 3HMNA 4QMSA 4FTMA 3NLBA 4LV5A 4ZSJA 2WTVA 3TM0A 1R1WA 2X7GA 3UMWA 2WEVA 4BZNA 2G2HA 3HMMA 3BEGA 4FOBA 3HAVA 2YCRA 5LQFA 3ZRMA 2WMXA 4GUBA 3FLQA 5HX8A 2I1MA 1BI8A 5CXZA 4EOJA 3BYMA 1P4OA 1WBNA 2W4KA 4G34A 3FI2A 4FIIA 4BI2A 4ZLYA 1H25A 4XLIA 2R3LA 4XRJA 4EH9A 4GH2A 2UW5A 3FHIA 3HDMA 3NW7A 4G6LA 4OTIA 3RWQA 5CAVA 3UQFA 4AS0A 3EN4A 4B6LA 5IMEA 1UU9A 4L8MA 3QQUA 5EYMA 4F7SA 2VTAA 1QMZA 5IA5A 4NSTA 1J7UA 3JYAA 4WD5A 2YABA 4TWCA 2ETRA 5FEEA 3I7BA 4DLJA 1B39A 1P14A 3QA8A 4K6ZA 4IX5A 4RT7A 5CEIA 2CKQA 5M06A 3D4QA 3D5WA 4FKJA 2IVSA 4XH6A 4AOJA 3EQIA 2CSNA 4ASXA 4EH3A 1S9JA 3HKOA 5A14A 3U55A 4U97A 2PUPA 4MHAA 3TKHA 2XK9A 3RZFA 1XH8A 3ORZA 4RA5A 2ITWA 2VNWA 3IDBA 4QYGA 4YTCA 4OT6A 3QKLA 2C5VA 2BRMA 4U42A 4ENXA 1Q4LA 2X81A 4EH4A 2XZSA 3LCTA 2VTLA 4ALVA 2A27A 5DH3A 3QCQA 5E8UA 3IW6A 3DKFA 3UE4A 4AZSA 2YLFA 3P7CA 4LUEA 3EB0A 4M68A 2QOLA 4CMTA 4A4XA 3ERKA 3DT1A 3GUBA 3Q6WA 4XS2A 2J2IB 4QTAA 4FKSA 4BDIA 5M4UA 5AUYA 3OOMA 3L9PA 3NPCA 4XOYA 5HBEA 4L52A 1VZOA 3JUHA 3R7UA 2YN8A 2C6KA 2QU6A 2BCJA 4FGBA 4C35A 2QO7A 3C4CA 4FV6A 3QU0A 1CM8A 1T45A 2PSQA 3CTJA 4YJPA 2ITQA 4L7SA 3DJ7A 2OIQA 4JOAA 4EJ7A 3DLZA 3U9NA 3VQHA 2C47A 4DEBA 4BR3A 3DK6A 4AFJA 4OLIA 3EHAA 4I41A 3RVGA 3PYYA 1WFCA 3OG7A 4IACA 4BI1A 4JIAA 2XIKA 5A9UA 2GNJA 2QOIA 1ZOEA 2XRWA 4YZBA 3BV2A 3A99A 3FMDA 3C0IA 3EYHA 2X2MA 5E7RA 2VWBA 4ZTHA 5H9BA 4B8MA 4C8BA 4AZEA 3R1NA 5JN2A 2CN5A 2XCHA 4I93A 4XBUA 5IEYA 5ANKA 3FSKA 4NZWB 2OIBA 3R73A 2YLEA 4GYIA 2X6EA 4UYAA 3PE2A 4FTUA 4R8QA 3FI4A 3F5XA 1LUFA 3ORLA 4QPAA 4IVCA 2QKWB 3GCVA 3CGFA 4J52A 5FGKA 3JXWA 5A6OA 4I5PA 2HWOA 4CQGA 2H8HA 5IDNA 4UZDA 1H00A 2I0VA 2YIRA 2Z7RA 3CQUA 4IAYA 4C3RA 4YPDA 4E4LA 1XR1A 2HWPA 5EDQA 5J9YA 3BCEA 5DNRA 4KIKB 3OTVA 4OTQA 3E8NA 4F6UA 5HVJA 3DBQA 2PPQA 1UU7A 4QMUA 1UNGA 2O63A 4KIPA 4FR4A 3S4QA 3HA6A 2PMIA 4E4MA 3OEFX 2FGIA 3DKCA 3MFRA 5GINE 4YO4A 3FLYA 3U51A 2WZJA 3WZUA 4BYJA 3UZRA 3QQFA 4IAIA 3KC3A 4GIHA 4IDTA 3PJ3A 2FB8A 4KKHA 4S2ZA 3TEIA 4I5HA 5CZIA 4Y72A 3OBGA 1XBBA 4WIHA 3TKUA 5TF9A 5HLWA 2EXCX 4FG9A 5CASA 5IG1A 2E9UA 3CTQA 3EZVA 3MIAA 5A4CA 3R8MA 4K18A 4ANBA 4XOZA 2BTRA 4G3EA 1PW2A 3E92A 3KXGA 2HXQA 4RMZA 3Q9WA 5AR8A 4JG6A 4ERKA 3NVKI 3H9OA 3VBWA 2GHMA 4AE6A 4EZ3A 5BX0A 4KRDA 2KTYA 2BROA 3QHWA 4AGDA 3FKNA 4RVTA 4O6LA 3LLTA 1GIIA 4IQ6A 4ACDA 1DAYA 3EQBA 4GYGA 2YJRA 2YDIA 4ZS0A 1YDRE 3G90X 2JGZA 4FTLA 4HZSA 4V0GB 3KVWA 3DB6A 5AR7A 4W8EA 1GZNA 4CYJA 4D4RA 2GQRA 4DT9A 4RVMA 2WQMA 2AYPA 3EYGA 4FV9A 1J91A 3BE9A 3OXIA 2IZRA 4O83A 5C1QB 4GK3A 3EN5A 4PMPA 5AP5A 5L4QA 3PVGA 4FK3A 5JZNA 3F5GA 2ACXA 2R3FA 4GG7A 2YM4A 4E6CA 2Z7SA 3WF6A 3E93A 1QCFA 3GCUA 2F7ZE 2UZOA 1TVOA 3BE2A 4LGGA 4P5ZA 4Z16A 3ORKA 3RHKA 3BQCA 4RIOA 3PA4A 1PXOA 4EBWA 3LPBA 4DEIA 4GU9A 3ZLWA 4O84A 3ZO1A 4KD1A 4OTRA 3MW1A 5CT0A 5FEDA 3UTOA 4KAOA 3V5WA 4H58A 2ITOA 3UO5A 1PYEA 2DYLA 5DOSA 4FC0A 3PJCA 4UV0A 5HD7A 3SDJA 2RSVA 3V51A 4AT3A 4Z3VA 5CS6A 5CWZA 1YWRA 4NFNA 5HNBA 3R8UA 4D4YA 5J1VA 5IPJA 2YAAA 4FIHA 5CX9A 3A60A 2X8EA 1IA8A 1Z57A 3OWPA 5IA4A 1I09A 3D7ZA 4RVKA 2UZBA 4QMTA 2V7AA 4IH8A 4F9YA 3PXYA 2W4OA 5JFWA 4ONAA 1OL5A 2ITXA 3HL7A 4WO5A 5AUZA 2OLCA 2GU8A 3QTQA 4MF1A 2OO8X 4MK0A 4YSJA 1V0OA 3UOKA 4Z7GA 2PYWA 2VV9A 4G16A 3SQQA 3QQKA 2CHLA 5C01A 3TJDA 1AGWA 4QP8A 3DZOA 5EHOA 3UOLA 4C38A 1JVPP 3LLAA 4L7FA 4YZMA 4CKIA 1RJBA 4IAZA 2BFYA 5BVEA 5AMNA 5ICPA 5HIBA 3MPAA 2VTOA 2UZNA 3N9XA 4HPTE 5I3RA 2WFYA 1BUHA 3MTLA 2VTJA 5FTQA 3TZ9A 4AWIA 3HMOA 4DHFA 2X1NA 4AT5A 3ZM9A 3QZFA 3QUPA 3W32A 1ZYSA 3UC3A 5IQGA 4R7HA 3GVUA 1CTPE 4RWIA 3E8CA 4NM0A 1NVRA 3PA3A 3UIMA 1OGUA 3BYSA 4C02A 4J96A 4Z7HA 1Q3DA 3QZGA 4Q2AA 4WSQA 3I7CA 2EVAA 3RNYA 3BZ3A 3UIXA 2QG5A 4MCVA 2BRGA 2W05A 3GU5A 5BVFA 4DA5A 4F08A 3R7GA 5EM7A 2VWVA 2IWIA 4J53A 3DTCA 1OL1A 3C4FA 3PVUA 4M14A 3M42A 5AP4A 3E5AA 4L68A 3BLRA 4D2RA 2FSLX 3C9WA 5IZFA 5KNJA 4HGEA 3P5KA 3DTWA 1QPEA 4JXFA 5D7AA 2WU6A 4KBAA 2W99B 4R6VA 4KSPA 4W4XA 5FM2A 3S0OA 5HLNA 3A7FA 4FT0A 3U6IA 3RM7A 3EFJA 4E93A 4I22A 4EWHA 5TE0A 1ATPE 2BVAA 3HRBA 3QRKA 3ZH8A 4XP0A 3QYWA 2ZYBA 4AGWA 3ZRKA 5FD2A 4MD9E 4RX9A 5KE0A 3CPCA 3MY0A 3M11A 2PE1A 4U41A 3AD4A 5M56A 3TZ7A 3MV5A 4JR7A 2Z2WA 2GNFA 3VW6A 3LJ0A 4D2VA 4BIBA 1YOJA 3PJ2A 1X8BA 4JRNA 3T3UA 3VRYA 4N4SA 5KZ0A 1Q97A 4B9DA 2BMCA 3U9CA 4LYNA 4P2KA 4RPVA 4FTAA 4BKZA 2XYNA 5BUEA 3GOKA 5IQHA 3RK9A 2ITVA 4BRXA 2UVZA 3R2YA 4KS7A 5M55A 3FQEA 1PXLA 3E64A 3VRZA 1JKSA 3U6JA 4F1TA 4WHZA 2OK1A 5JQ8A 4TYIA 1UA2A 5AADA 1YWNA 2HCKA 4I6QA 4QP6A 3WI6A 2R7BA 2P3GX 2JITA 3SGCA 4YMJA 4RFMA 4FKTA 5A4TA 4AE9A 3IGOA 5DEWA 3WE4A 5CQWA 3TIZA 3W18A 3Q3BA 3VUMA 4TYEA 3LQ3A 3GXLA 3KRLA 4FUYA 2C3KA 3R6XA 4TL0A 4FSWA 4BZDA 4QD6A 3ORIA 3HX4A 3VS4A 3PWDA 4D1SA 3IK3A 4QP3A 4GRBA 3OROA 4D28A 3F9NA 2YHVA 3TACA 4DEHA 4E4XA 5AUVA 3B8RA 3BLQA 4EJNA 4IAAA 3PRIA 2JAVA 1H1PA 2OJIA 5FM3A 3LJ1A 3CY2A 4L53A 3NNWA 4X3JA 4DG3E 1R0EA 2G15A 3PG1A 4RC2A 3V8SA 4AOIA 4XV1A 4ZTLA 2VTRA 1JSUA 2BILB 3PY0A 4BDCA 4DG2E 2YISA 3OF0A 2JIVA 1OKZA 3OS3A 3W2RA 3QRJA 3QQJA 3SW4A 3N4UA 5K4IA 4P4CA 4Y46A 4KUJA 1PMEA 4I23A 4UZHA 4DGMA 4NYEA 4NJ3A 5CNNA 4C4HA 4ACMA 2XRUA 1R0PA 2E2BA 4X3FA 5BUIA 1OIUA 2WQNA 5I4NA 2VX1A 2R3KA 1H27A 4OBQA 1UV5A 3BX5A 1PXJA 3PZHA 3UZPA 4BC6A 3D9VA 3FKLA 3KULB 1T46A 4LUDA 2PVHA 5ITAA 2QG7A 4K77A 5EQEA 4CFUA 4NM5A 4ZMEA 3Q6UA 1JSVA 3L8PA 5LVPA 2XNBA 4KBKA 3GC7A 4LG4A 3W8QA 3E88A 3LVPA 5ANOA 3PSDA 4MKCA 3GU4A 3Q2JA 4R1YA 4M66A 4TZRA 1WBVA 3KMMA 2YEXA 3HA8A 2ITPA 3RKBA 2OJJA 4QYHA 5LCJA 2PVRA 4RGJA 4ZJJA 4IWDA 3NCZA 1OI9A 1Q8YA 3QYZA 3ANRA 5BPYA 2OZAA 1G8SA 2JKQA 4CZTA 3C5IA 5DT3A 2VTIA 4YC8A 3KMWA 2R3GA 2VO3A 3LFDA 2XJ1A 5IH4A 1YDTE 2JLDA 4O7YA 4FV1A 4OAVB 4D0XA 3IPHA 3P86A 4TN6A 4XV3A 2QU5A 3V8TA 2V5QA 2KULA 1BKXA 5TOZA 1GZKA 3D2IA 3M1SA 3R7EA 3DA6A 4M84A 2R3RA 2UZWE 5I0BA 3PRFA 3VS1A 4M67A 2BDJA 2C6DA 4EOPA 3QRIA 4E73A 4X0MA 4B4LA 3KXZA 2OH0E 4BWPA 2XEYA 4PUZA 3ZFYA 1FOTA 3NRMA 2QOCA 5J5TA 2H6DA 4IDVA 4KRCA 4U5JA 5AP1A 3EN9A 1GNGA 1NW1A 4LMNA 3G2FA 3ZXTA 2PU8A 3LXNA 5AUWA 5HIDA 3UQCA 3F7WA 5DN3A 5AUXA 1PXIA 5IEVA 2GHGA 4IJ9A 1UU3A 3OMVA 2PMNX 4MD7E 5IKWA 5JH6A 1U5RA 1GAGA 2FSTX 3I5ZA 1V0PA 2PVYA 3KMUA 2YWPA 4LFIA 4R1VA 4UBAA 1BX6A 4TW9A 5LVOA 4DH1A 3ODYX 3MESA 4YGAA 3K3IA 2B55A 4IMYA 4LQMA 2WTIA 4Q9SA 5HE0A 3GENA 1Q8ZA 4PTGA 4MWIA 4O27B 5AIKA 2EWAA 2J90A 1OITA 3E7VA 2WELA 4QQJA 4RIXA 4CXAA 2G2FA 3QL8A 3DNEA 3P4KA 3U6HA 3VO3A 1OZ1A 4GJ2A 4J98A 3WIGA 2R3QA 4R3CA 4HZRA 2W1GA 2B9JA 5CT7A 3BIZA 4EQCA 5AP2A 3FZTA 4JG7A 4RQKA 4CFFA 3RAHA 5IISA 2GFSA 4C3PA 2WU7A 5DLSA 1PXMA 3A8WA 2BKZA 3FLWA 5K9IA 1F5QA 4I6BA 4L43A 3CIKA 2R0IA 5LWMA 4FNYA 3NWWA 2J5EA 3NAXA 2C3IB 4JDJA 4IX6A 3W2CA 3A8XA 2G2IA 4C36A 5CU3A 5AV4A 3PFQA 4PL3A 5AIRA 5EOBA 2CLXA 4OTPA 3U8WA 4NFMA 4AGUA 5EKNA 4XG3A 4J8NA 5ACBC 4ITHA 4LL5A 2W4JA 3HGKA 2X8DA 4D5KA 4ZSEA 3ENMA 4X6RA 4O22A 4ZOGA 4MQ1A 4BF2A 1FPUA 2ZB1A 4JDHA 1KV2A 1OPLA 2EU9A 4HVHA 4FKGA 1L8TA 4E5WA 4RIYA 3VBVA 4AW2A 3AC1A 4NCTC 4YTIA 1M14A 3QTWA 2BIYA 3MH2A 2YIQA 4AFEA 2CGXA 1BMKA 2WMRA 4I0RA 2I6LA 4D9UA 2Z60A 3P7AA 4ANNA 4ZLZA 3RBWA 2QLQA 4ZK5A 4U7ZA 2FVDA 3R9OA 3O0GA 3UZTA 4S30A 5FWKK 3QTIA 1OM1A 3FPMA 1CSNA 4F1MA 4APCA 3Q5ZA 5J5SA 3BBWA 2WQBA 4NK9A 4WOVA 3SOCA 3PPKA 5EH0A 2PVNA 3P9JA 3OTUA 4EZ7A 4E6QA 5ETIA 3VS0A 1ZMUA 3JVSA 5FTGA 4PY1A 4FK6A 3HLLA 5HORA 2Q0NA 2XBJA 4B7TA 4QMNA 4K11A 2YIWA 3MH1A 3I6UA 3OT3A 2CLQA 1R78A 2P2IA 1OKWA 1XH7A 3HRFA 5IQFA 2X8IA 4NKSA 4FYNA 2QOKA 4HCVA 4JQ8A 4KSQA 5CTPA 3TKIA 3VUTA 3ORNA 5JT2A 3GU8A 3AGMA 1YOMA 4A06A 4EOIA 4AN3A 3EJ1A 4DEDA 4Y83A 4F7LA 5HIEA 5J79A 4RZWA 3PP0A 4YLKA 3R04A 4FKIA 3F3UA 4I21A 3ENHA 4ZIMA 5BYLA 3U54A 3G0FA 4X2GA 4DCAA 2BRHA 3OOGA 3V04A 3D5VA 2RFNA 3DY7A 3FYKX 3GB2A 3HMPA 4RQVA 1EH4A 2QO2A 3D7TA 4IWOA 4MF0A 4BHZA 2JEDA 2PMLX 2OJGA 2GNIA 3FY2A 3MJ1A 4FKPA 3V8WA 2E9OA 3DAEA 3HEGA 3HVCA 4HW7A 3NX8A 4GK2A 2VD5A 4FUXA 2XP2A 4HYUA 4R78A 4V01A 2ERZE 4FZ6A 2LAVA 3DK3A 3I60A 3MGYA 2GTNA 5IQEA 3FQSA 1H01A 3F5UA 3BLHA 2I7QA 2HIWA 3G6HA 4J1RA 4DGNA 5L6OA 5IA1A 3A61A 4CLIA 5DMZA 2ITUA 2J9MA 3QD2B 4DFNA 5EYDA 2GDOA 3EIDA 4H1MA 4E6DA 4ZLOA 2XEZA 2BZJA 4QPSA 3QZIA 3VHEA 4MXXA 4HVGA 3OWJA 4D5HA 4JIKA 3CQWA 1KWPA 3EKKA 3U87A 4APPA 4FIEA 1OUKA 4OTFA 2W5HA 3EL7A 3ZUTA 1U54B 3RAWA 5KMOA 3COMA 2GS6A 1AQ1A 4F70A 3ALNA 3ZTXA 4I5MA 3ZSIA 3FAAA 3FXWA 5EKOA 4ASEA 2A4LA 5E8ZA 5IMXA 4EH5A 1XH4A 4BYIA 3ZBXA 2R64A 3C4ZA 3IKAA 4BTFA 2P0CA 3AC3A 4FVPA 4O2ZA 1FVVA 5DA3A 4IM2A 4PMMA 3KXXA 4MWHA 2BFXA 3E8DA 5CVGA 4UEUA 4XYFA 2C6IA 2WAJA 3HECA 3IDCA 3QBNA 2G9XA 3CD3A 3DBCA 1I44A 4FIGA 4FSUA 4RZVA 4E4NA 3NGAA 3K3JA 4EC8A 4FA2A 2W17A 4K8AA 4QMXA 1H1WA 3FL5A 4FSMA 5KMJA 5L2WA 1Q8UA 2C1AA 3QFVA 3ZCLA 3ODZX 4BGGA 3CQEA 4DEGA 3LHJA 4NWMA 3LFCA 2CMWA 2QC6A 3RPSA 3WF8A 3AD6A 3IOKA 3UMXA 4CTCA 4RX5A 2ERKA 4W4YA 5IH6A 3D15A 3GC9A 4O0WA 4A9TA 4USEA 3A4PA 3OWKA 4FV2A 4USFA 5CSXA 5EQPA 3V6SA 3MB7A 4FKLA 3NCGA 4X6QC 3ORTA 4UB7A 4O21A 4MX9A 3WZDA 4XBRA 2CCHA 4M7IA 4TKSA 3F2NA 3CGOA 1MRUA 2WMVA 2WKMA 3SD0A 4NTSA 3HMIA 4XRLA 4CG9A 3GT8A 2CKPA 1YW2A 2O64A 2JDSA 4NL0A 2EB2A 4IX3A 3CJFA 4Y8DA 4Z55A 4FKOA 4CG8A 2JAMA 4PNIA 2JKOA 5IUHA 3E62A 2C3LA 3C4XA 4ANSA 1PMVA 3OXTA 4ZY5A 4IVDA 5HZNA 4LI5A 4NKAA 2GNHA 1OUYA 5DIAA 4RIXB 3UG1A 3QTUA 4UYNA 3D5UA 3RGFA 2CNVA 1URCA 2CN8A 5KMLA 3UG2A 3NNVA 3PLAE 3WOWA 2JFLA 4B99A 1M2QA 4QTDA 3T9TA 1E1XA 5F95A 3W2SA 1M2PA 5IF1A 4BWKA 4OTGA 4KABA 5A3XA 4BCNA 3KFAA 3UGCA 5EW9A 2B9FA 4PPBA 4I1ZA 5LMBA 2VWIA 3GCQA 3MA6A 4YC3A 3R9NA 3H3CA 2X2LA 4C61A 4DFZE 4I3ZA 2J0KA 4O7SA 2C5NA 2XMYA 2X6DA 3UC4A 4DLIA 3BELA 4MBLA 2YA9A 4QQCA 3C50A 3H9RA 3OCGA 2XK4A 1U59A 2WGJA 5E8VA 3SXRA 1BYGA 1P2AA 4ZEGA 4FTOA 3VUHA 2Q0BA 3RPVA 3W2OA 3S1HA 4W9WA 4IWQA 5HO8A 2GTMA 4IEBA 4RRVA 5CF6A 4QYYA 5I5ZA 3OHTA 5DHJA 4F9WA 5HBJA 4PWNA 2EXEA 3IS5A 1WBOA 2UW6A 4WUNA 2OF4A 2HYYA 5CEMA 5FLFA 3I6WA 4N70A 2O5KA 4RIYB 3FZSA 4EK4A 5EQYA 1IG1A 3QF9A 3QGYA 5DWRA 4C2WA 3UDBA 3QWJA 4W9XA 1H26A 4LRJA 5K3YA 3GQIA 2WOTA 4EH6A 3A62A 1FMOE 3DDQA 3IW4A 3G0EA 4YBKA 3KXNA 1Q3WA 1J7IA 2PZ5A 4QYEA 1MRYA 4NTTA 2VWUA 1ZLTA 3HV4A 3GGFA 2H96A 3MIYA 4NEUA 4IVAA 4U45A 4FOCA 4L00A 3R9HA 3UVQA 4HOKA 4IX4A 4CSVA 2XKDA 1E1VA 3DFCB 5E1EA 3VQUA 3MFSA 1U46A 4PPCA 5EYCA 1KUTA 1W84A 1OECA 2JIUA 4BCFA 4FF8A 3MWUA 2DS1A 2IVUA 3QGWA 3C51A 3RM6A 3HAMA 4G5JA 2IW9A 4BBFA 4DINA 1FMKA 3TNWA 1K2PA 1FGIA 3MFUA 5DR9A 4LGDA 4H36A 3FMNA 3ZU7A 4XHKB 1SNUA 1E9HA 3E87A 1ND4A 4FZDB 3U4UA 1NY3A 4YBJA 4YJOA 4BDHA 3EFKA 4PDYA 4FSZA 4UMPA 3Q9YA 4N6YA 4OGRA 1MRVA 4AGCA 5BVDA 3AG9A 5E8WA 2V55A 5EW8A 3SV0A 2YM7A 1OKVA 4O7VA 3QLFA 3WZJA 3D94A 4HYSA 5M4CA 3ZFMA 3VS7A 3D7TB 2CKEA 4QT1A 4ZXTA 4I24A 1UKHA 2OBJA 2QKRA 3R8ZA 4GT3A 5CF4A 3FC2A 4I20A 3R71A 5EM8A 4FE2A 2VAGA 4QNYA 5CSHA 4GFOA 5ANGA 5EI8A 5BMSA 4CZUA 4MXZA 4BICA 3VC4A 4I0SA 4BIDA 5DR2A 5H8EA 1CKJA 3K5VA 1O6LA 3G51A 5EI2A 2JKMA 2VGOA 4GT4A 4ACGA 4WG5A 3FMKA 3DPKA 4FT3A 4YLJA 3HP5A 5L6PA 5HESA 3OY3A 4O0YA 2WPAA 2DUVA 5J87A 2J51A 3DJ6A 3V5TA 2WIHA 4GV1A 3REPA 5IQBA 4NIFB 1J1BA 1H1RA 4CV9A 3MH0A 4QMVA 2GNLA 2VUWA 4I4EA 2CKOA 4HVDA 4U79A 5HCZA 5TO8A 4OAUC 5AWMA 3MYGA 3MDYA 2X4FA 4DC2A 2Y4PA 3D14A 2VWXA 3L9LA 5HKMA 3PA5A 1Y57A 5H3QA 3PXRA 3PUPA 3C4EA 3DGKA 4GK4A 1REKA 2C6MA 2VTHA 4FG8A 3NYXA 4KINA 2J6MA 2WXVA 2J0MB 1URWA 5FXQA 2IG7A 5C26A 3PIZA 1IEPA 2ZM1A 4IW0A 4W4WA 3W1FA 5L2TA 3N51A 4UN0C 4R7IA 3W2QA 4AA5A 3KEXA 1YHWA 5CEQA 1WBSA 3TNQB 1TQPA 3VUGA 4DFBA 3TZ8A 4FG7A 1TQIA 1SNXA 1UWHA 4NT4A 2BZKB 1WVYA 1V1KA 2HW6A 3NAYA 4IC7A 5CQUA 2WMSA 2XBAA 5B0XA 3F61A 4U9AA 4O0VA 3UJGA 3DXNA 3PJ8A 1RDQE 3DB8A 2VTPA 3SLSA 3ORMA 2J0LA 3KY2A 3PXQA 5KZIA 3QAME 4H05A 3KN6A 3HUBA 5M44A 3QXPA 1OBDA 3FY0A 3ROYA 1OKYA 5L2IA 3WIKA 4OBPA 5JK3A 1PF8A 4H3QA 3W2PA 2YCFA 5LMKC 3G5DA 3OFMA 5GZ8A 5AP3A 5J9ZA 2Z7QA 2V7OA 3L9MA 5CU2A 3DNDA 4BDJA 4GL9A 2Z7LA 4ZTQA 4QMMA 3CSVA 3P78A 3AD5A 3II5A 4O2PA 3V5LA 3KRRA 2WNTA 4NM7A 1PKDA 3ANQA 3ZC6A 3TNPC 3AC4A 4XG4A 2OI4X 3FZRA 4U80A 2XIRA 4M69A 5CXHA 3IGGA 4AN9A 4F9BA 3VN9A 3EFLA 3QRUA 3LXKA 5E8YA 3LFAA 4A9YA 1SVGA 5AR2A 5C8NA 2R3PA 3RWPA 5EFQA 1ZY5A 4AW5A 4E1ZA 4YJRA 3P7BA 5KBQA 2R4BA 1OBGA 3EQDA 5HE1A 2XIZA 4A9UA 4ALWA 4DFUA 1R3CA 4L42A 5DI1A 5LVLA 3S00A 4D58A 1YOLA 5AV2A 5FP6A 3OXZA 5HGIA 4JAJA 2IN6A 2XVDA 4IADA 2OJFE 5KHWA 3UIBA 4JLCA 3UYSA 3COIA 3AT3A 3RMFA 3G15A 4DN5A 3GCPA 2YM5A 4MXCA 2J50A 5FP5A 3F3VA 4BTJA 3JPVA 3KF4A 2FO0A 4PDSA 4IBMA 5HOAA 4AOTA 5KMNA 2HELA 3B8QA 5BQ0A 3QC4A 1SZMA 2GCDA 4AW0A 5BMMA 3VS6A 3G33A 2QHNA 2XKEA 3QTXA 1PY5A 1Y6AA 2IO6A 4BCQA 4K33A 3IQ7A 1GZ8A 4DBXA 5DR6A 4GMYA 4PL4A 3ULIA 3VBQA 5K0XA 5D1JA 3ZEWA 4BDEA 4O7LA 4FKUA 2V62A 3BHHA 4FSTA 2O8YA 2PL0A 5ETCA 4JNWA 4JRVA 5KBRA 1JSTA 3TWJA 1ZYJA 4OW8A 4RLLA 3BKBA 3SG8A 1XWSA 3DZQA 2B7AA 4PP9A 4ZTRA 1QL6A 1OPJA 5FG8A 4L3PA 3BU3A 2HENA 1Q5KA 1YXXA 4PRJA 4LL0A 1SMHA 3OUKA 4UXQA 4RIWA 3QRTA 2FSOX 2C6TA 3PTGA 5HU3A 4ZTSA 3ACJA 2B9HA 2ONLA 4IFGA 2YJSA 4AA4A 5HQ0A 3V5QA 3TTIA 4YZCA 2XK7A 5FXSA 5L6WL 4J8MA 3GP0A 3A7IA 3BYOA 4FTNA 4RWJA 4PPAA 2C68A 2NRYA 3UPZA 4Y73A 1IAJA 4RJ4A 3AT2A 3OW4A 2BUJA 3R2BA 4MXOA 5JFVA 2XYUA 4D2SA 4XV9A 4FV5A 2V0DA 1CDKA 4CMOA 4FV0A 4MBJA 4F64A 3QD0A 4NJDA 3QTRA 2OXXA 3CP9A 4MNEA 1H1QA 4R3PA 4RC3A 3VULA 2VX0A 4QMOA 5K5XA 3R9RA 4RX8A 3O2MA 5M53A 5CAUA 5D10A 3FXZA 3TNHA 4IAFA 4BBMA 2OJ9A 2XK6A 3DKOA 3RCDA 2W1CA 3JR1A 2OICA 4ITIA 4FTKA 4QRCA 1KE6A 4YJVA 4IZ5A 2BAJA 2BKKA 3F66A 2YDJA 4L3JA 4N6ZA 4ZZMA 3ZLYA 2XNGA 3ZZEA 4CFWA 4BCIA 4XP2A 4CQEA 5KMIA 1JKTA 2WD1A 1LEZA 5CLPA 5H8BA 4ACCA 5KX8A 1ZWSA 2YFXA 4IZ7A 4LM5A 5F4NA 4FL2A 5BYYA 3ZSHA 3UP7A 2WQOA 5AEPA 4H39A 4F7NA 4F9CA 2DQ7X 1O6YA 3B2TA 2FA2A 4ENYA 4JX7A 3R22A 4FT5A 2C6LA 2UW8A 3Q4ZA 3LMIA 3W8LA 2JDTA 3SKCA 1UU8A 4YJUA 4R7BA 5C27A 2C5YA 5E9EA 3IONA 5M4FA 3UIUA 4JAIA 5IUIA 5JRSA 3DBEA 1ERKA 3MH3A 2Z02A 5J95A 4EC9A 3EN6A 4NCTA 4C0TA 1ZOGA 1A06A 4RG0A 3PXKA 2B52A 2IVTA 3MN3A 3QXOA 4QO9A 4YO6A 5HO6A 3MFTA 1BL6A 2Y6MA 4F65A 3F7ZA 3LMHA 5L8LA 3AXWA 2IW8A 2QHMA 3QX4A 3VW8A 3Q96A 3VVHA 4AA0A 2SRCA 1PMNA 3RZBA 4GU6A 2IW6A 2R3JA 4GEOA 5DT4A 4EKKA 3A7JA 1DM2A 5A6NA 3F3TA 1FGKA 4GVJA 1KE5A 3CBLA 4X2NA 5AV3A 5D9HA 3FZOA 3I0OA 2ITYA 2WMBA 3HRCA 5ETFA 5JFXA 1YRPA 3KVXA 4GUEA 1JWHA 1MQ4A 2BHEA 2XH5A 4FSRA 4H3PA 3IDPA 4XP3A 4IWPA 4ZZOA 5I9ZA 2R3IA 2P2HA 2C6OA 3GC8A 4HGSA 4M15A 4RJ3A 3LFQA 5K4JA 3Q53A 1ZYLA 4MQ2A 3HP2A 2VU3A 1WVWA 1CKPA 2B54A 1MQBA 2PE0A 3ZS5A 4D1ZA 2CNQA 4BDKA 3PIXA 1Q24A 1IA9A 5AV1A 2P33A 2ZM3A 3OW3A 5HCXA 1YI6A 3SX9A 2UW9A 5JEBA 2O65A 3ZUVA 1Q62A 4LRKA 1F0QA 5IEXA 4J95A 4S32A 4XJ0A 4TWPA 4XV2A 4ZTMA 3T9IA 2REIA 3T3VA 1ZZLA 4CV8A 4MBIA 4U6RA 4Q5HA 3VF9A 4XG9A 4EH7A 5CVFA 5DFPA 4TYHA 4GG5A 4KKGA 4RX7A 3BU6A 5FXRA 4M69B 4EH2A 2UZTA 5EG3A 5EM6A 3A2CA 2B0QA 3QTZA 4I4FA 5AM7A 2QOOA 4G6OA 2YAKA 3ZMMA 5FQDC 3LAUA 4DT8A 2HK5A 3D2KA 2PTKA 3E3BX 3IG7A 1WVXA 3PVWA 4H1JA 5D11A 2Y4IC 4L01A 4I5CA 1LPUA 5G1XA 5I9WA 3FWQA 3LE6A 4C58A 2E9NA 1NXKA 2I0YA 3WBLA 2WMQA 4DEAA 4Y95A 4FV4A 1XH5A 4O0TA 4FTCA 3SG9A 2CGVA 3TV6A 2Y6OA 3V01A 4C4FA 4EHZA 4HVSA 3DOGA 5CNOA 1FVRA 3HUCA 2QODA 4U3YA 2F49A 3C0GA 2Y8OA 4MAOA 4NUSA 2NRUA 2HY81 3KN5A 5DRBA 5E1SA 3C1XA 5IQAA 4FIFA 4PTEA 4AP7A 1DS5A 4EORA 5L2SA 5C4LA 4G31A 3PSCA 4CFXA 5BNJA 4WSYA 2ZDTA 3LM5A 4DTBA 4IIRA 4JBOA 5E91A 2YDKA 3R21A 3GCSA 4YZ9A 1VJYA 4C34A 2OIDA 3ZEPA 5DGZA 4I6FA 1PKGA 3LW0A 4UWBA 4JX3A 2UZDA 4RJ7A 3R8VA 4C37A 3DXPA 4EL9A 4CTBA 5L2QA 4BN1A 4O81A 2A0CX 3UO6A 4AN2A 3ZO2A 3GU7A 2PUIA 4IM3A 4UMTA 4G9CA 1NVSA 4AACA 3C4WA 1JAMA 4YJTA 2EUFB 5E8SA 3O71A 4FTRA 3RINA 4WBBB 2Y4IB 5CY3A 4EYJA 3QLGA 1ZARA 4JI9A 4EK6A 3LKMA 3PZEA 5IDPA 4ZY6A 4RIWB 2LGCA 2R0UA 3KXMA 2C69A 4K0YA 5I9YA 3L8SA 1OPKA 4PDOA 4D0WA 3T8OA 2XCKA 4ORKA 3O17A 2C5OA 4YTHA 1M2RA 3H10A 4KWPA 2ITZA 2I40A 4CCUA 2WB8A 3P0MA 4YJNA 3LFSA 5CAQA 1Z5MA 3EH9A 2B4SB 3R7VA 4UX9A 5M07A 5HLPA 3QTSA 2XM9A 3ORPA 1GIHA 1KE9A 4DTAA 5HVYA 5CANA 1LEWA 3BBTB 3HV3A 4YZDA 1M17A 5LVNA 5KHXA 3R0TA 4FEVA 1G5SA 4HPUE 3BWJA 5HG8A 1OIYA 2XNNA 3Q9ZA 3P79A 4NW5A 5HG5A 3NUAA 4TWOA 5IA0A 4FL3A 3BGQA 3LIJA 3SVVA 2QNJA 4O38A 4U44A 3TUDA 2VTMA 4JDKA 3R1YA 3O23A 3OT8A 3WF7A 4AUAA 1PJKA 2QQ7A 4G6NA 4BTMA 4ZSAA 4YTFA 4BDFA 4FKVA 2H9VA 3FLSA 2JC6A 3SOAA 3OVVA 4BKJA 2ITTA 4O0SA 3L8XA 1W7HA 4XLVA 4D55A 2XJ0A 1FQ1B 2JD5A 5HG9A 4BCGA 4Y5HA 2ZAZA 5AAEA 2PZRA 3KL8A 4WT6A 3S95A 4C57A 4D2WA 5I9VA 3VHKA 2PVJA 3I79A 3ZRLA 5C8KA 3IW5A 2IVVA 3FXXA 4CYIA 3L9NA 4W8DA 5L8JA 4ZAUA 3DCVA 4JJRA 5KUPA 4HNIA 3D5XA 2WMAA 5AA9A 4IVBA 1K3AA 5LVMA 3NIEA 2EXMA 3G9LX 4O0UA 3ZDIA 3ZLXA 4J7BA 4ANLA 2QR7A 2XJ2A 4PX6A 4MXYA 4CKJA 5A46A 3MSSA 5EDRA 4CMUA 2UV2A 4DCEA 4QMYA 5EK7A 4RBLA 4EH8A 1ZZ2A 3BU5A 4X3FB 5E90A 5A4QA 4IJPA 4FEXA 2F7EE 1JKLA 3BYVA 4OTDA 1WBTA 3VNTA 2B53A 1TQMA 4CNHA 2DWBA 1GZOA 4FT7A 5JFSA 5D7VA 2YM6A 3CKXA 4GS6A 1YHVA 3A7HA 3DDPA 2UZLA 4EQUA 4OR5A 4CKRA 2Q83A 5AX9A 4EK8A 3NYVA 4H3BA 5F9EA 2OG8A 3FI3A 3FEGA 2XNEA 2QOQA 4ZTNA 4C62A 5JGAA 4F6SA 3AQVA 2X39A 4CZYB 3UOHA 1ZY4A 2BZIB 2ZOQA 2R3MA 3D83A 3IOPA 2RIOA 2XNMA 3M2WA 3MY1A 3NUXA 4B8LA 3MVJA 3I5NA 1O9UA 5M57A 1OL6A 2JDVA 5EI6A 3QHRA 4X2JA 4PMSA 4GIIA 2XUUA 5AUTA 4FSNA 3P08A 2AC3A 2C5XA 2OZAB 2OSCA 2PVMA 2QOFA 2WMUA 2A2AA 4FNWA 4JDIA 1RW8A 3AC5A 4ZSGA 3DQWA 4YJSA 3TN8A 3EFWA 4LRMA 2GS7A 5ANDA 3R30A 4BVUA 3BEAA 2XIXA 1WBWA 5HTBA 4EI4A 1Q99A 2GFCA 5GJFA 4O96A 4GKIA
chains in the Genus database with same CATH superfamily
3RALA 4IAKA 4V04A 4EUUA 5CEOA 2UW7A 4MUQA 3R00A 2PUUA 3VBYA 4L67A 4QTBA 3R8PA 2GQSA 3KA0A 4FGRA 1ZYCA 3DFAA 4QP2A 4HJOA 3UODA 4BDGA 5JRQA 2BIKB 1GIJA 2WTKB 1Y91A 4MXAA 4HNFA 3DV3A 1AD5A 4HGTA 3LCOA 3CR0A 4DH7A 4KBCA 4TYHB 5CALA 1LR4A 2GNGA 4Y85A 3E3PA 1KOBA 4M3QA 4ANQA 5JSMA 4EONA 3TCPA 2QO9A 4ARKA 1WAKA 5EOLA 3EQCA 3AC8A 3MA3A 5AP6A 3MVLA 5CU6A 3SA0A 1H07A 3TZMA 5LJJA 2CGUA 4L3LA 4DBNA 4O7WA 3IW8A 3QCYA 2WMWA 1VYWA 3OBJA 4XX9A 3HV5A 3MI9A 4BL1A 4BHNA 2VX3A 2C4GA 3KK9A 4RJ6A 3O51A 4QOXA 1H4LA 4GCJA 1ZAOA 3HYHA 5HTIA 4C4GA 2F7XE 2UW3A 4EEVA 3SW7A 2XALA 1REJA 2VWWA 2CPKE 2VWZA 4CFVA 2HZ0A 2O3PA 5CEKA 4IB0A 3TV4A 4DH5A 3ZBFA 3V6RA 2PK9A 4IZYA 3VS2A 4GW8A 1G8AA 2GSFA 5DT0A 3NUNA 3GNIB 3PPZA 3HDNA 3EMGA 2RFSA 3EKNA 1WCCA 1YXVA 3RHXA 1Q8WA 2VZ6A 3GI3A 3NNXA 4M8TA 2R3NA 3KXHA 5T6KA 4G1WA 2I0HA 1GJOA 4GSBA 4P7EA 4G3DA 4QMZA 1YI3A 3GBZA 3KRWA 5C9CA 4C4JA 3LXPA 1OIQA 1XHAA 3FMMA 4K9YA 2YZAA 3OP5A 5KKRC 3LFNA 2OH4A 5CU4A 1YXUA 4RWKA 1BLXA 3TL8A 2WQEA 4TRLA 2RL5A 3FMEA 1Y6BA 4F99A 1BL7A 1YQJA 2W1FA 2XA4A 3HV6A 4PDPA 5E8TA 1MP8A 3QKKA 3BHYA 3E8EA 2PWLA 5LMKA 2AUHA 2E9PA 3PXFA 2WOUA 2VTTA 1U4DA 4FX3A 3S2PA 4RJ5A 4XG8A 5EM5A 4AQCA 5CVHA 1M7NA 4BDBA 3BHVA 4Q9ZA 4ZMFA 3TUBA 2HAKA 2PHKA 5G6VA 4JBQA 4U3ZA 3ATTA 4MH7A 4EWQA 1UVRA 4PL5A 4TYGA 3POZA 1OL7A 4WG4A 2BPMA 3PWYA 4WNMA 3SXSA 4AXAA 3ITZA 1WBPA 2HOGA 2BAQA 4YHTA 4JG8A 3FZ1A 2ZFYA 2RKUA 4AZVA 4IB1A 5C03A 4CGAA 2WO6A 5CSVA 3R7IA 3C13A 1TKIA 3W33A 2YCSA 4RJ8A 2JFMA 5KMKA 1KOAA 5E8XA 3KF7A 4UMUA 1IRKA 3ZONA 5M09A 4I0TA 3ID6C 5BVKA 3CTHA 3W16A 4Y5QA 3KRJA 3UBDA 2UZUE 2OZOA 4AX8A 4GFMA 2BTSA 3IECA 5AX3A 4U43A 4B0GA 5KKRB 5FTOA 5LCKA 5EHLA 5F20A 3FDNA 3UVPA 2W1IA 3KREA 3O8UA 1SM2A 2UVXA 3EOCA 2J0IA 3H0YA 4PV0A 3VAPA 3ZXZA 4EHGA 4YP8A 4DAWA 3VWAA 3F88A 3F2AA 3CCNA 4WKQA 4F1OA 5HEZA 3W0QA 4EOSA 4QYFA 4EQMA 1PXPA 2PY3A 4L44A 3TDWA 5CI7A 4LGHA 4M12A 4ID7A 4G5PA 3RPYA 4JS8A 1JBPE 2FSMX 1BI7A 3EQFA 1GOLA 4ERWA 5HE3A 3BGZA 3JY0A 4E5AX 1YI4A 2YM3A 4ASDA 3NR9A 2W1DA 2XANA 3Q5IA 5ANEA 5BVWA 4FEQA 4QMLA 3PVBA 2VN9A 2XK3A 1YKRA 5IA3A 4IB3A 1A9UA 1H28A 4EOOA 4CT2A 3NYNA 4K1BA 2I0EA 3SRVA 3WF9A 1FBNA 3CS9A 3OUNB 1H8FA 5AV0A 3SHEA 3FI8A 1G3NA 2E9VA 2NO3A 4AW1A 2ZMCA 4A9SA 4XUFA 2O0UA 3DS6A 4EOQA 2VO6A 4G3CA 5J7HA 4L46A 2QI8A 5JMSA 2Y9QA 3DBFA 4BDAA 5EYKA 5J8IA 2XB7A 4CFNA 2ZVAA 1YDSE 2J5FA 3OZ6A 5AR5A 3GFEA 1XKKA 5CYIA 5FBOA 3DU8A 2ETMA 3TI1A 2W9FB 3RK7A 4YJQA 2QONA 4A07A 4AZFA 1P5EA 4LOPA 5BUJA 4F09A 4YC6A 2Y0AA 3F69A 4J99A 3TIYA 3VS5A 4FEUA 3ZM4A 3OCBA 5ANIA 3RPRA 4IM0A 5FDPA 5B2LA 2ZM4A 2YWVA 5DRDA 4C7TA 3MBLA 4JVGA 5A4EA 4CFMA 4ZY4A 4CT1A 2X2KA 2ETKA 3DJ5A 1JOWB 3POOA 4FMQA 1ZOHA 2C3JA 2F57A 5LWNA 4PP7A 1KE7A 4RLKA 4BY9E 2VWYA 4DFYA 4DGLC 4QMQA 1OIRA 3V3VA 4CCBA 1B6CB 4QQTA 2ESMA 3VIDA 4S34A 2X9FA 3KULA 2W0JA 2WTCA 3NIZA 1K9AA 3ZO3A 5M08A 4YNEA 4ASZA 5LXMA 3FV8A 2QLUA 3D0EA 3P23A 3UNJA 1NT2A 5GJDA 3C5UA 4FJVA 5LMAA 4OTHA 4UWYA 4ANMA 4GJ3A 1PYXA 5HNGA 4TNDA 3VJOA 4BCMA 4TY1A 3CC6A 4II5A 2QCSA 3R83A 3WE8A 1Q61A 2PULA 4D2PA 2B1PA 1HOWA 4HCUA 3BYUA 5M4IA 3TG1A 3R8LA 1JKKA 1VR2A 4DF3A 5DVRA 4DTKA 5HU9A 1QPDA 4XNEA 3TJCA 1Y8GA 4LMUA 2WTWA 1KE8A 4D4SA 3Q9XA 2CCIA 3MY5A 4KIOA 4XG6A 3LJ2A 4ZSLA 5CSPA 4X7QA 3RJCA 2YITA 3Q04A 1SYKA 5L8KA 2F4JA 4JQEA 2YZLA 5TR6A 1W98A 3EN7A 4G2FA 5AUUA 3ATSA 5CF5A 2W1ZA 2YIXA 4PQNA 4RWLA 3A7GA 3WZEA 5JGBA 3O96A 3FHRA 3LFFA 4WG3A 3BWFA 4W4VA 5CAOA 4FZFB 3E7OA 3ZUUA 4OUCA 4O82A 2C0TA 3NUSA 1IR3A 3R63A 2VO7A 3LQ5A 4TXCA 5HHWA 4EHVA 1B38A 3OCTA 3QWKA 1W82A 2RG5A 3LCDA 4GT5A 4ZP5A 3UVRA 5EHYA 2BDFA 4YHJA 3B2WA 1WZYA 5D12A 4R77A 2JIIA 1FVTA 1ZXEA 3WILA 5AR3A 1Q8TA 4FODA 3OCSA 2XS0A 3MS9A 5KO1A 2OXDA 4YURA 2VNYA 2OF2A 4YLLA 3RAIA 3ET7A 5ETAA 1XBCA 2NP8A 3LFBA 1W8CA 3PIYA 2V22A 3TNIA 4ALUA 4ZZNA 3QCXA 3TYKA 4BGHA 2R5TA 4E26A 4QP9A 4BIEA 2XAMA 3I4BA 3BV3A 5DYJA 4F0GA 4WNKA 3L8VA 2WEIA 1S9IA 4A4OA 1LP4A 3R7OA 5CU0A 3FMHA 1G8JA 2J7TA 3NFGB 5AA8A 1V0BA 4FBXA 4EYMA 2CNUA 3MPMA 3GOPA 1UNHA 4TWNA 3RAKA 3ALOA 1OVEA 4FTQA 3BLAA 4O7TA 3MPTA 4MNFA 2BZHB 2QD9A 2ZV7A 3Q4TA 1QPCA 3DK7A 3DBDA 1PXNA 4FTTA 3AMYA 2RGPA 4G9RA 1APME 4FVQA 1OMWA 4UWCA 1H08A 5L3AA 1CMKE 1WMKA 5D41A 3QALE 4P5QA 5FRIA 3ZSGA 3PG3A 4U0IA 3O8PA 5JQ5A 4LOQA 3AC2A 4FVRA 5K0KA 4BCKA 1SVEA 4JQ7A 3O7LB 3ZDUA 2IZTA 4PMTA 1NVQA 5DEYA 3ROCA 3QCSA 4O0XA 3LZBA 3PSBA 3TV7A 4OT5A 2OFUA 4L45A 4CEGA 4CD0A 3N4TA 3V5PA 5AAFA 3NVMB 2UVYA 4FTIA 2OXYA 3RP9A 4BBEA 2YERA 3VS3A 4GFGA 4MEDA 2XIYA 4YPSA 1KV1A 4DH3A 1XO2B 3BGPA 4MYGA 4BZOA 3NDMA 3COKA 5J7BA 3SAYA 2BRNA 4IZAA 4KB8A 3SXFA 5B7VA 1O6KA 2HZ4A 4QTCA 4BWXA 5I9XA 4QP1A 3IW7A 3DXQA 2J4ZA 3GU6A 1J3HA 3NUUA 4FSQA 2JBOA 3MVMA 4S31A 5HX6A 5HE2A 4PTCA 4FV7A 4DEEA 4YU2A 2RFDA 1XBAA 5BYZA 4O7NA 2WTJA 4WRGA 2YCQA 5GNKA 4C4EA 2C0IA 2R9SA 4D4VA 1Z9XA 3OEZA 5B2MA 1VYZA 4O1PA 2Z8CA 2EB3A 4ZJIA 4J97A 3DLSA 4P90A 3DQXA 5EW3A 3ZYAA 3R02A 5JGDA 3BHTA 1XH6A 4AT4A 2RF9A 2PZIA 3SRVB 2BALA 4F0FA 3EQPA 4RSSA 4IB5A 4TT7A 4UXLA 4C4IA 3TUCA 3NNUA 3PDTA 1W83A 5HVKA 4HVIA 2WHBA 2XF0A 2ZJWA 3E63A 4AG8A 5J1WA 3NMUF 1CKIA 3R7YA 3AT4A 3FZPA 4G17A 3F6XA 3R9DA 4DFLA 2VTNA 4DGOA 5GIOE 5AFVA 2OGVA 1P4FA 1ZYDA 2JDRA 3ULZA 3UO4A 5LOHA 2QVSE 4FYOA 4I6HA 4RA4A 3FJQE 4X2KA 3RNIA 3NSZA 2QOBA 3F2RA 2UW4A 4FSYA 2WIPA 2PZPA 3O50A 3MJ2A 4IXPA 4N57A 3U4WA 4BTKA 3PY3A 4FEWA 1ZMWA 3FLZA 3Q32A 2F9GA 3Q4UA 3QQGA 1L3RE 4MVFA 2YIYA 4KS8A 3FPQA 1DAWA 3NUYA 5LARA 3QKMA 3PPJA 4GVAA 3QQHA 2O2UA 3RPOA 4EOLA 3QX2A 1M52A 2H34A 2ZMDA 2QURA 3NUPA 3CXWA 3UYTA 4DITA 1H24A 1KSWA 2W7XA 3Q60A 3R1QA 4I92A 4WUAA 3QD3A 3O8TA 4IFCA 5TKDA 2CDZA 3LXLA 2C0OA 1XJDA 4F78A 4LV8A 4WA9A 2BDWA 4CLJA 5CEPA 4XMOA 1OB3A 5IU2A 5GJGA 3FQHA 5IA2A 1UKIA 4ITJA 4UMQA 3BI6A 4E8AA 1XH9A 2W1EA 5AJQA 4BKYA 1GY3A 4BCOA 3CE3A 2RG6A 5IQDA 4ANOA 4EOMA 3GFWA 3UDTA 3CJGA 1U54A 4D2TA 5GZ9A 3FYJX 5B2KA 3AKKA 3FKOA 4IE9A 4EUTA 1YWVA 3UNKA 2BRBA 2JDOA 3TXOA 4C2VA 4MD8E 3ETAA 3PE1A 3ZFXA 4FT9A 2ZB0A 3QUEA 4WNPA 4FNXA 1PXKA 2C30A 2NPQA 2X0PA 2XKFA 3MTFA 4XG2A 3FLNC 1PMUA 2OWBA 5BVOA 4FNZA 2YM8A 4G3GA 4N0SA 2G1TA 2HW7A 3K54A 4KA3A 4CRLA 2PVLA 3R1SA 2X7FA 4USDA 5ANJA 3SC1A 4FZAB 1G8KA 3KU2A 5T68A 2A1AB 1JPAA 3ZOSA 2YACA 5HG7A 4O1OA 1H0VA 4DH8A 1XQZA 5DG5A 3AGLA 4BGQA 5GHVA 2G01A 3LFEA 4MTAA 3VUIA 5CSWA 1STCE 1IASA 5T3QA 4U40A 3CEKA 5FEQA 4AZWA 1PHKA 2FUMA 3NW6A 1YVJA 2XNPA 4M0ZA 3RTPA 4DGGA 4DE4A 3CD8A 3CKWA 4HGLA 4OBOA 4CVAA 5CENA 4DYMA 2JBPA 3HNGA 2ONLC 3H0ZA 3CY3A 3OD6X 1QPJA 4V05A 4ACHA 4X21A 4QPMA 5HNIX 4FV3A 4L9IA 4UY9A 3RCJA 3JVRA 2JKKA 3AMAA 2OKRA 3NW5A 4F4PA 3Q52A 3I1AA 3LM0A 3EQRA 3WYXA 4ZJVA 4M97A 3TTJA 1PRYA 4F6WA 5JZJA 5H2UA 4E20A 4UMRA 5HD4A 3UNZA 3IO7A 2VTSA 2X0GA 3MVHA 4EK3A 4JMQA 2F2CB 4QQ5A 4XG7A 2FH9A 4DHZA 2W1HA 4LOOA 5H8GA 1HCLA 4BI0A 5F94A 2ZDUA 1JLUE 3OWLA 3WZKA 5AAGA 3LMGA 3KKVA 3LCSA 4NM3A 2W9ZB 5AR4A 4DG0E 2HY0A 4O86A 2GS2A 5K5NA 4F7JA 2UW0A 4FKWA 1OGYA 3KK8A 2QR8A 4RC4A 4Z9LA 5E92A 4KNBA 4G3FA 1YXTA 4K2RA 5IQIA 4WRSA 2R3HA 2J0JA 2WTDA 4AAAA 4O7ZA 4O7RA 2VTQA 3PLSA 4PF4A 3THBA 4EHEA 2PVKA 3FBVA 4FI1A 2IPXA 1ZRZA 3CPBA 2R7IA 3DAKA 3FSFA 4BDDA 3UP2A 2X9EA 2R2PA 3ELJA 4D9TA 5GZAA 3OY1A 3EWHA 4YNOA 3UPXA 3G6GA 3K5UA 4EKLA 2ZV2A 3LQ8A 3W10A 2CJMA 1YXSA 2R3OA 4X2FA 4TPTA 3VF8A 1RQQA 4R3RA 3W55A 2A19B 4OTWA 5A54A 4J71A 3F3WA 1SVHA 3F5PA 5HI2A 3NS9A 3P1AA 4X3FC 3UQGA 3DKGA 3VBXA 4E5BA 5CZHA 2VRXA 3UOJA 4MNEB 4C59A 5AP7A 4JBVA 3W0PA 4JR3A 2XM8A 4YZNA 3I81A 2WMTA 1OL2A 4BCJA 5CF8A 4PNKA 3AOXA 1F3MC 3I0QA 3Q4CA 3BQRA 3VJNA 4GKHA 3W0MA 1MUOA 1UNLA 4IANA 4DDIA 4TYJA 5C8MA 3EQHA 4O0RA 3R01A 3FC1X 4NW6A 3PXZA 3FUPA 2OW3A 4FIJA 1NA7A 4QMWA 4FICA 2UZEA 3FE3A 4QNAA 4D1XA 2BAKA 1Y8YA 3PJ1A 1DI8A 2ZV8A 4NU1A 1RE8A 3GQLA 1VEBA 1JNKA 4L6QA 2ZV9A 3VUDA 3HV7A 5DE2A 4QP4A 3Q2MA 4YUQA 2GPHA 4O4EA 5CI6A 5AP0A 1H1SA 3GC0A 3PP1A 3N4VA 3TDVA 4FKRA 4IC8A 2C6EA 2F2UA 4I94A 2GQGA 3BHUA 4AF3A 3FL4A 3OC1A 2P4IA 3KB7A 4WNOA 5HCYA 5BVNA 4HYIA 4YSMA 3WARA 3ORXA 4JL9A 4A4LA 4BFMA 3KIOC 3G9NA 2IZUA 4F9AA 4E7WA 4U81A 2PUNA 1R39A 3ZZWA 4DFXE 4IHPA 5HTCA 5TT7A 2UZVA 4HCTA 3O7LD 3QUDA 4BCHA 1JQHA 5C4KA 3RK5A 5IQCA 2W5BA 4QP7A 4KIKA 4KIQA 5I9UA 4EZ5A 4CRSA 3WF5A 1DI9A 3ZC5A 1Q41A 3ZO4A 2ITNA 1IAHA 2VGPA 4R5YA 2AC5A 2WTKC 4A9RA 3HZTA 5FUTA 2W06A 1M7QA 3KRXA 5DBXA 3LOKA 1HCKA 5ACKA 5DPVA 2XKCA 2X7OA 4QTEA 4YR8A 4EOKA 2FYSA 4EK5A 2W96B 2UUEA 3COHA 4WBOA 3RI1A 4UALA 2C1BA 4XCUA 3ACKA 5FBNC 2CGWA 4R5SA 3TT0A 4FZ7A 4HYHA 2HXLA 4U8ZA 5HBHA 4M0YA 3CLYA 3ZLSA 4TNBA 3H9FA 4NIFA 5HO7A 4A7CA 5KCVA 3V5JA 3KCFA 3QQLA 3MB6A 5IUGA 4BB4A 5JKGA 2PVFA 3KCKA 3FMJA 1ZMVA 2B9IA 3DAJA 2BR1A 2GHLA 4EBVA 4RVLA 2IJMA 2IZSA 1W0XC 2IEWA 3WYYA 3PY1A 3L1SA 2OU7A 3KQ7A 4AU8A 3C0HA 2XK8A 4RFZA 5E4HA 3KGAA 2BHHA 5A4LA 1J1CA 2RFEA 3GEQA 4XEYA 5FDXA 4FKQA 4O91A 4V0GA 4YHFA 2VO0A 3EZRA 3EQGA 2HZNA 1H0WA 4E6AA 2PMOX 2HZIA 3A4OX 4S33A 3S3IA 5AM6A 1A48A 4F63A 4FV8A 3VBTA 2NNWB 2QOHA 3F3ZA 1U5QA 2PZYA 3H30A 4C3FA 4C33A 4BCPA 4F0IA 5J9LA 5CAPA 2P55A 3LCKA 3R28A 3QA0A 4JBPA 2W5AA 4O6EA 4FTJA 5IH5A 4E3CA 5EDPA 2GMXA 3AMBA 4ZS4A 2OFVA 3QZHA 4JT3A 4KKEA 3JS2A 2Y7JA 3F82A 1FINA 3NZ0A 1YHSA 3EL8A 3BPRA 5I3OA 5KMMA 5M51A 3C7QA 3JY9A 3K2LA 2XNOA 4NH1A 4Q5EA 3QD4A 3NEWA 4RFYA 2PE2A 4TTHB 3NYOA 3ZHPC 2X4ZA 5F1ZA 3QC9A 4QMPA 3BRBA 4M13A 5HICA 1J7LA 1UWJA 3H4JA 3VUKA 5GIPE 3FMLA 4AZTA 4FL1A 3HMNA 4QMSA 4FTMA 3NLBA 4LV5A 4ZSJA 2WTVA 3TM0A 1R1WA 2X7GA 3UMWA 2WEVA 4BZNA 2G2HA 3HMMA 3BEGA 4FOBA 3HAVA 2YCRA 5LQFA 3ZRMA 2WMXA 4GUBA 3FLQA 5HX8A 2I1MA 1BI8A 5CXZA 4EOJA 3BYMA 1P4OA 1WBNA 2W4KA 4G34A 3FI2A 4FIIA 4BI2A 4ZLYA 1H25A 4XLIA 2R3LA 4XRJA 4EH9A 4GH2A 2UW5A 3FHIA 3HDMA 3NW7A 4G6LA 4OTIA 3RWQA 5CAVA 3UQFA 4AS0A 3EN4A 4B6LA 5IMEA 1UU9A 4L8MA 3QQUA 5EYMA 4F7SA 2VTAA 1QMZA 5IA5A 4NSTA 1J7UA 3JYAA 4WD5A 2YABA 4TWCA 2ETRA 5FEEA 3I7BA 4DLJA 1B39A 1P14A 3QA8A 4K6ZA 4IX5A 4RT7A 5CEIA 2CKQA 5M06A 3D4QA 3D5WA 4FKJA 2IVSA 4XH6A 4AOJA 3EQIA 4O4CA 2CSNA 4ASXA 4EH3A 1S9JA 3HKOA 5A14A 3U55A 2X0QA 4U97A 2PUPA 4MHAA 3TKHA 2XK9A 3RZFA 1XH8A 3ORZA 4RA5A 2ITWA 2VNWA 3IDBA 4QYGA 4YTCA 4OT6A 3QKLA 2C5VA 2BRMA 4U42A 4ENXA 1Q4LA 2X81A 4EH4A 2XZSA 3LCTA 2VTLA 4ALVA 2A27A 5DH3A 3QCQA 5E8UA 3IW6A 3DKFA 3UE4A 4AZSA 2YLFA 3P7CA 4LUEA 3EB0A 4M68A 2QOLA 4CMTA 4A4XA 3ERKA 3DT1A 3GUBA 3Q6WA 4XS2A 2J2IB 4QTAA 4FKSA 4BDIA 5M4UA 5BV3A 5AUYA 3OOMA 3L9PA 3NPCA 4XOYA 5HBEA 4L52A 1VZOA 3JUHA 3R7UA 2YN8A 2C6KA 2QU6A 2BCJA 4FGBA 4C35A 2QO7A 3C4CA 4FV6A 3QU0A 1CM8A 1T45A 2PSQA 3CTJA 4YJPA 2ITQA 4L7SA 3DJ7A 2OIQA 4JOAA 4EJ7A 3DLZA 3U9NA 3VQHA 2C47A 4DEBA 4BR3A 3DK6A 4AFJA 4OLIA 3EHAA 4I41A 3RVGA 3PYYA 1WFCA 3OG7A 4IACA 4BI1A 4JIAA 2XIKA 5A9UA 2GNJA 2QOIA 1ZOEA 2XRWA 4YZBA 2AQXA 3BV2A 3A99A 3FMDA 3C0IA 3EYHA 2X2MA 5E7RA 2VWBA 4ZTHA 5H9BA 4B8MA 4C8BA 4AZEA 3R1NA 5JN2A 2CN5A 2XCHA 4I93A 4XBUA 5IEYA 5ANKA 3FSKA 4NZWB 4DDGA 2OIBA 3R73A 2YLEA 4GYIA 2X6EA 4UYAA 3PE2A 4FTUA 4R8QA 3FI4A 3F5XA 1LUFA 3ORLA 4QPAA 4IVCA 2QKWB 3GCVA 3CGFA 4J52A 5FGKA 3JXWA 5A6OA 4I5PA 2HWOA 4CQGA 2H8HA 5IDNA 4UZDA 1H00A 2I0VA 2YIRA 2Z7RA 3CQUA 4IAYA 4C3RA 4YPDA 4E4LA 1XR1A 2HWPA 5EDQA 5J9YA 3W0RA 3BCEA 5DNRA 4KIKB 3OTVA 4OTQA 3E8NA 4F6UA 5HVJA 3DBQA 2PPQA 1UU7A 4QMUA 1UNGA 2O63A 4KIPA 4FR4A 3S4QA 3HA6A 2PMIA 4E4MA 3OEFX 2FGIA 3DKCA 3MFRA 5GINE 4YO4A 3FLYA 3U51A 2WZJA 3WZUA 4BYJA 3UZRA 3QQFA 4IAIA 3KC3A 4GIHA 4IDTA 3PJ3A 2FB8A 4KKHA 4S2ZA 3TEIA 4I5HA 5CZIA 4Y72A 3OBGA 1XBBA 4WIHA 3TKUA 5TF9A 5HLWA 2EXCX 4FG9A 5CASA 5IG1A 2E9UA 3CTQA 3EZVA 3MIAA 5A4CA 3R8MA 4K18A 4ANBA 4XOZA 2BTRA 4G3EA 1PW2A 3E92A 3KXGA 2HXQA 4RMZA 3Q9WA 5AR8A 4JG6A 4ERKA 3NVKI 3H9OA 3VBWA 2GHMA 4AE6A 4EZ3A 5BX0A 4KRDA 2KTYA 2BROA 3QHWA 4AGDA 3FKNA 4RVTA 4O6LA 3AKJA 3LLTA 1GIIA 4IQ6A 4ACDA 1DAYA 3EQBA 4GYGA 2YJRA 2YDIA 4ZS0A 1YDRE 3G90X 2JGZA 4FTLA 4HZSA 4V0GB 3KVWA 3DB6A 5AR7A 4W8EA 1GZNA 4CYJA 4D4RA 2GQRA 4DT9A 4RVMA 2WQMA 2AYPA 3EYGA 4FV9A 1J91A 3BE9A 3OXIA 2IZRA 4O83A 4BJJA 5C1QB 4GK3A 3EN5A 4PMPA 5AP5A 5L4QA 3PVGA 4FK3A 5JZNA 3F5GA 2ACXA 2R3FA 4GG7A 2YM4A 4E6CA 2Z7SA 3WF6A 3E93A 1QCFA 3GCUA 2F7ZE 2UZOA 1TVOA 3BE2A 4LGGA 4P5ZA 4Z16A 3ORKA 3RHKA 3BQCA 4RIOA 3PA4A 1PXOA 4EBWA 3LPBA 4DEIA 4GU9A 3ZLWA 4O84A 3ZO1A 4KD1A 4OTRA 3MW1A 5CT0A 5FEDA 3UTOA 4KAOA 3V5WA 4H58A 2ITOA 3UO5A 1PYEA 2DYLA 5DOSA 4FC0A 2X0OA 3PJCA 4UV0A 5HD7A 3SDJA 2RSVA 3V51A 4AT3A 4Z3VA 5CS6A 5CWZA 1YWRA 4NFNA 5HNBA 3R8UA 4D4YA 5J1VA 5IPJA 1XMLA 2YAAA 4FIHA 5CX9A 3A60A 2X8EA 1IA8A 1Z57A 3OWPA 5IA4A 1I09A 3D7ZA 4RVKA 2UZBA 4QMTA 2V7AA 4IH8A 4F9YA 4QDEA 3PXYA 2W4OA 5JFWA 4ONAA 1OL5A 2ITXA 3HL7A 4WO5A 5AUZA 2OLCA 2GU8A 3QTQA 4MF1A 2OO8X 4MK0A 4YSJA 1V0OA 3UOKA 4Z7GA 2PYWA 2VV9A 4G16A 3SQQA 3QQKA 2CHLA 5C01A 3TJDA 1AGWA 4QP8A 3DZOA 5EHOA 3UOLA 4C38A 1JVPP 3LLAA 4L7FA 4YZMA 4CKIA 4O4BB 1RJBA 4IAZA 2BFYA 5BVEA 5AMNA 5ICPA 5HIBA 3MPAA 2VTOA 2UZNA 3N9XA 4HPTE 5I3RA 2WFYA 1BUHA 3MTLA 2VTJA 5FTQA 3TZ9A 4AWIA 3HMOA 4DHFA 2X1NA 4AT5A 3ZM9A 3QZFA 3QUPA 3W32A 1ZYSA 3UC3A 5IQGA 4R7HA 3GVUA 1CTPE 4RWIA 3E8CA 4NM0A 1NVRA 3PA3A 3UIMA 1OGUA 3BYSA 4C02A 4J96A 4Z7HA 1Q3DA 3QZGA 4Q2AA 4WSQA 3I7CA 2EVAA 3RNYA 3BZ3A 3UIXA 2QG5A 4MCVA 2BRGA 2W05A 3GU5A 5BVFA 4DA5A 4F08A 3R7GA 5EM7A 2VWVA 2IWIA 4J53A 3DTCA 1OL1A 3C4FA 3PVUA 4M14A 3M42A 5AP4A 3E5AA 4L68A 3BLRA 4D2RA 2FSLX 3C9WA 5IZFA 5KNJA 4HGEA 1XMMA 3P5KA 3DTWA 1QPEA 4JXFA 5D7AA 2WU6A 4KBAA 2W99B 4R6VA 4KSPA 4W4XA 5FM2A 3S0OA 5HLNA 3A7FA 4FT0A 3U6IA 3RM7A 3EFJA 4E93A 4I22A 4EWHA 5TE0A 1ATPE 2BVAA 3HRBA 3QRKA 3ZH8A 4XP0A 3QYWA 2ZYBA 4AGWA 3ZRKA 5FD2A 4MD9E 4RX9A 5KE0A 3CPCA 3MY0A 3M11A 2PE1A 4U41A 3AD4A 5M56A 3TZ7A 3MV5A 4JR7A 2Z2WA 2GNFA 3VW6A 3LJ0A 4D2VA 4BIBA 1YOJA 3PJ2A 1X8BA 4JRNA 3T3UA 3VRYA 4N4SA 5KZ0A 1Q97A 4B9DA 2BMCA 3U9CA 4LYNA 4P2KA 4RPVA 4FTAA 4BKZA 2XYNA