3E3PA

Glycogen synthase kinase from leishmania major
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
337
Chain Sequence
AAADERSRKEMDRFQVEVQLGKEKSTGMSVAIKKVIQDPRFRNRELQIMQDLAVLHHPNIVQLQSYFYTLGERDRRDIYLNVVMEYVPDTLHRCCRNYYRRQVAPPPILIKVFLFQLIRSIGCLHLPSVNVCHRDIKPHNVLVNEADGTLKLCDFGSAKKLSPSEPNVAYICSRYYRAPELIFGNQHYTTAVDIWSVGCIFAEMMLGEPIFRGDNSAGQLHEIVRVLGCPSREVLRKLNPSHTDVDLYNSKGIPWSNVFSDHSLKDAKEAYDLLSALLQYLPEERMKPYEALCHPYFDELHDPATKLPNNKDLPEDLFRFLPNEIEVMSEAQKAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase, putative Glycogen synthase kinase
publication title Glycogen synthase kinase from Leishmania major
rcsb
source organism Leishmania major
total genus 107
structure length 337
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e3pA01
3MSSA 4QMSA 5H8EA 3R9OA 5HESA 4D1XA 4F9WA 2XP2A 3C5UA 2I1MA 4FV7A 3FMMA 3U6IA 3QRUA 3W55A 2IW9A 2HENA 2WEIA 3FL4A 1R0EA 1ZYDA 3LCDA 4W8EA 4O96A 5AV3A 5TKDA 3FXWA 3FC2A 4R7HA 3BHHA 4NH1A 4PP7A 3RPOA 3WIKA 4H3BA 3MY1A 2JEDA 3V5LA 5EM8A 5IQHA 4ZSEA 2R64A 4FKQA 2RSVA 1S9IA 4RGJA 3C4CA 4NJDA 4APPA 5IEYA 4K6ZA 4DEEA 3OXTA 2BUJA 4ZS0A 5JH6A 1FVVA 2WMQA 2CN5A 2PE0A 5CAQA 4YMJA 3RNIA 3POZA 5CT0A 5A4EA 2G2FA 3GNIB 3PXRA 4GW8A 4I94A 2ZDUA 3W32A 5AV1A 1ZARA 3HDNA 4RJ5A 5E8ZA 4FG7A 4U79A 5HE1A 2W1IA 3DKFA 4IJPA 3ZOSA 3VAPA 3QF9A 4P5QA 4NT4A 3SQQA 4YSJA 2EVAA 4YHTA 4G34A 2WHBA 2WMVA 1UKIA 2ZMCA 1IASA 2HOGA 1WCCA 2RFEA 3LXKA 4EC8A 2J0LA 2GNFA 3VS0A 2H96A 4OGRA 4IX4A 5DEYA 1UNLA 3DPKA 4O2PA 4X7QA 5CU0A 4JL9A 2W7XA 3MIAA 5AADA 4W4VA 2BAJA 4KRCA 4MKCA 4H58A 2W1CA 4DGNA 2QC6A 4JBOA 4XG8A 2ZV9A 5DT0A 3EKNA 1BLXA 5L2SA 5EDQA 4H05A 4PP9A 4NYEA 3QYWA 1YOLA 3MBLA 4I92A 5CVHA 5FP5A 1B38A 3ZHPC 1W82A 4ASXA 1ZYSA 4FTTA 1YXTA 3EOCA 3LFSA 3O51A 3V5QA 3TL8A 3W10A 1MUOA 1E9HA 2XJ2A 3D5XA 4RX9A 4CFNA 1PKGA 3ZDIA 3LFBA 4OT5A 4X3FA 5FP6A 3R28A 3DAKA 3R21A 4FUXA 4FX3A 4Z7HA 3QRIA 4U40A 4D2RA 3WZEA 4ZSLA 3QD3A 2VTTA 5EDPA 4OBQA 2OJIA 4IIRA 3K54A 4YBKA 4LRJA 4V05A 3IS5A 1PXJA 4ENXA 3JVRA 3FL5A 3EH9A 5DMZA 3JUHA 2X1NA 5E8WA 3R2BA 2Z7SA 1ZOGA 5AR2A 2XRUA 1KV1A 3UE4A 5CF8A 4FTIA 1YXXA 4O1OA 4FK3A 1J7IA 2FYSA 4GCJA 4QPSA 3O7LB 4R1VA 2UW8A 3AT4A 3VULA 1Q97A 2BHEA 1H1QA 3IDBA 2R5TA 4I22A 2NO3A 4BHNA 4I1ZA 5LWMA 3E8EA 3GP0A 4E6DA 3TJDA 1G5SA 4G3CA 3OCTA 4FVRA 3R9NA 3RZFA 3PRFA 5CS6A 4HCVA 2XYUA 4ZTQA 5EM6A 2R3RA 3SOAA 3MB6A 4IAIA 5HE3A 4U7ZA 3NZ0A 2CMWA 3PDTA 4QMPA 3V6RA 3AQVA 3W2OA 2QOOA 2XIZA 3LFCA 3ORZA 2Z8CA 2YACA 2WTKC 4II5A 4R78A 3IG7A 3DBQA 2WAJA 4GEOA 2CDZA 3O71A 5ETCA 4C4FA 2OIDA 4E73A 4FGBA 4QP6A 4DT8A 4I6HA 2Y4IB 4QYGA 2BTRA 4J8NA 3ZEPA 5AP6A 5K0XA 3TTIA 2J90A 3C50A 4AWIA 5IDPA 2IN6A 3MFRA 4Q9SA 3GC7A 3QZGA 4NFNA 4GIHA 3HEGA 3I79A 1SZMA 2UVZA 4FF8A 2BFYA 2WO6A 4FSYA 4U81A 4WBOA 3LFNA 5FWKK 5J79A 3FI3A 3A8WA 3N9XA 4X21A 4XOYA 4ZTHA 4BY9E 4GJ2A 2XA4A 2Q0BA 4QMVA 2BFXA 2BZKB 4PX6A 2WMUA 4FTNA 2Y7JA 1Z9XA 3BKBA 4FIIA 3QTQA 2YLFA 4C33A 1SNUA 3F5XA 3D0EA 3NUUA 3RCDA 3WI6A 4DFLA 3SW7A 2EU9A 5CU6A 2VX0A 3IKAA 1PMVA 1WBTA 2VWWA 1KWPA 1FINA 5TO8A 4L7SA 3DBEA 4A4OA 5CZIA 4IX3A 3PXZA 4RJ7A 5HU3A 2P3GX 4PDOA 5HG8A 2V55A 2ZM1A 4EH3A 4EBVA 2CLXA 1L8TA 4WUAA 2QNJA 1UA2A 5HD4A 1I09A 3COKA 3PIXA 5JKGA 4DCAA 5M09A 3ALNA 4MXCA 4FC0A 5AV0A 1LEZA 3DK7A 3LFAA 4I20A 2OXYA 4EI4A 4C02A 1NY3A 4ZEGA 4XG7A 4RWKA 2Z2WA 4MQ1A 5HLWA 2EB3A 3ZXTA 4C3RA 3HZTA 4K33A 2CPKE 3OT8A 4TYJA 1EH4A 5B2MA 2BZHB 4BYIA 1FPUA 5L2QA 3DNDA 3SVVA 2QOIA 5LMKC 2G9XA 2O65A 4LMNA 4ACDA 2XCKA 2BKKA 1TVOA 3GCPA 3Q2JA 3VS5A 4HJOA 3QKLA 4JG7A 3DU8A 4AT3A 4FV6A 3UYTA 3VN9A 2I40A 2R3QA 2ITVA 3UVPA 4EK6A 4W9XA 3TJCA 4ZAUA 5BQ0A 3Q4ZA 2LGCA 4BCOA 2XRWA 5CU4A 3M11A 3QX2A 4QP1A 1K2PA 1YOJA 3VUHA 4BCHA 5L2IA 3H3CA 4FKTA 4E1ZA 3FLZA 4ASEA 2ZVAA 3KVXA 4KS8A 4YO6A 2V7AA 3GQLA 1OPLA 5AUWA 4A4LA 4CSVA 2BILB 2OJJA 5I4NA 4FTUA 2OI4X 4LOQA 4LRKA 4V0GB 4L52A 4AW2A 1ZRZA 2PYWA 2I0HA 4G6OA 4EZ7A 1YDRE 4AAAA 5GZAA 4MHAA 3FMNA 5GJDA 2QOLA 5AM6A 5CXZA 3CQEA 4GUBA 3LOKA 2WB8A 5I9UA 4PDYA 3KRJA 4RA4A 3R2YA 4YNEA 3MVHA 4E5AX 4PDSA 3LJ0A 1WBWA 3QRJA 3BHVA 4JAJA 4C2WA 2GNJA 4C57A 4EK5A 2J5FA 3BX5A 3G5DA 2WZJA 2VWBA 4BRXA 4Z3VA 5BVDA 3PJ8A 1GIIA 1YWVA 3OCBA 5K4JA 1XH4A 2GU8A 4LRMA 2C6LA 3ERKA 1PXIA 3RVGA 5J9LA 3MVMA 4IQ6A 4O0WA 4OT6A 2QOBA 2XKCA 4QMLA 4UV0A 2CGXA 3QZIA 5K3YA 3QQKA 3E88A 5KMOA 3VW6A 2CCHA 3PP1A 5HVJA 2BR1A 4EC9A 4N6YA 1OKWA 3MESA 2UZBA 3DBCA 3CY2A 3V6SA 2CLQA 5EYCA 3VS7A 5I3RA 4EORA 4C2VA 5L3AA 3BGZA 4R7BA 5ANIA 2QODA 1ZAOA 2O2UA 4DFUA 4D55A 5EHOA 3EWHA 5E91A 1XHAA 4QMXA 5HE0A 5J9ZA 2OU7A 3E87A 3PP0A 3UG1A 3DXQA 4DN5A 5B2LA 3OVVA 4G3DA 4EOOA 5HBJA 5L8KA 4ANBA 1O9UA 4PF4A 3RCJA 5L8LA 2JDOA 1UU7A 2ITUA 3BE2A 3QKMA 4BCJA 3TUCA 3CJGA 3R7IA 2ONLA 3HGKA 2QD9A 2VTIA 2W05A 4GFOA 2YAAA 3R7VA 5C01A 4RC3A 3OY1A 2DQ7X 2DYLA 2H6DA 4FOBA 5HCZA 3OROA 3DAJA 4FK6A 3QGWA 2BDJA 4L43A 2WQEA 3R9DA 1QMZA 3BYUA 1Y8YA 2VO3A 1GNGA 4HNIA 1OKVA 1YWNA 2IWIA 3BBWA 2CN8A 3FKLA 4FNYA 4G6LA 3KMMA 4IH8A 5D41A 5HE2A 3UQCA 5J1WA 3LE6A 2C0TA 3OY3A 3WF8A 3F61A 4TYGA 2UW9A 2EB2A 3C1XA 3DQXA 5AR8A 4TZRA 3RJCA 2X7GA 4AOTA 5ANKA 4M67A 3F2AA 3FJQE 5FEQA 4BF2A 4YTCA 2VTQA 4XP2A 5HO8A 2UZTA 5EW9A 2V5QA 3GOPA 3MPAA 4GK3A 3O8PA 4M13A 3SAYA 5IA2A 2H8HA 5K9IA 4QYHA 1YQJA 2CHLA 3GOKA 3WF7A 1JLUE 4F63A 1UU9A 2WTIA 3MJ1A 1VZOA 3AGLA 1BYGA 2PWLA 3M2WA 3U9CA 2PMIA 4ZOGA 1XBAA 4YJUA 3I4BA 3ZFXA 1FVTA 4C37A 4EUUA 4RIXA 2QLUA 3QQHA 4FV3A 4B8MA 3FEGA 5LCKA 3UNKA 4J52A 2GSFA 4CTBA 2P4IA 5AAFA 3IOPA 2QU6A 3WYYA 4G5PA 4WG5A 5FM2A 4H39A 4FV0A 4ANQA 1H24A 2UW7A 2V0DA 3KULB 3IPHA 2VX3A 4KINA 3OOGA 5AUXA 2Y4IC 3E62A 2XMYA 2ERKA 3SW4A 4L67A 5DN3A 3PG3A 4JT3A 3SRVB 2VTPA 4FKGA 3VRZA 4U43A 3P78A 3QZFA 2RIOA 4QTAA 5JZNA 4ZJJA 1P4FA 4APCA 1TQMA 3U9NA 4RBLA 3QZHA 1YHVA 3EN9A 1YHSA 1YXVA 1S9JA 2WTVA 3DDPA 2HY0A 4FT3A 5L6OA 3QGYA 3BELA 4U5JA 4NW6A 1FGKA 4ITJA 1NVRA 4X6RA 3ZUVA 3F66A 2R3NA 3Q32A 4QMOA 1OIQA 4WBBB 3LCOA 5CU3A 3BYMA 5EDRA 3RNYA 2C69A 3R04A 4BI0A 2OZOA 5FEDA 2GNGA 3TXOA 2ETKA 3PE1A 3VUMA 2OICA 5I9ZA 1XH9A 2YM4A 3T3UA 3K5VA 4OR5A 1UVRA 4EK8A 2G2IA 1IA8A 5IKWA 4FSNA 1YI6A 2W9FB 4TPTA 3TDVA 2Y6MA 1H26A 2WTCA 3FQEA 5BPYA 2WMAA 3G0FA 3HMPA 3K5UA 4PTEA 3ELJA 3BV3A 3WIGA 4NW5A 3R1SA 4BVUA 5LVMA 4JBQA 1Y57A 3R1NA 4BCFA 1JOWB 5KX8A 3VUDA 2FUMA 5AX3A 3WYXA 1YXSA 1W7HA 4QNYA 3D7TA 5JN2A 4Q5HA 5I9XA 3I7BA 4ZTNA 3CGOA 1O6LA 2C68A 2E9VA 4DEGA 2P2IA 5CXHA 4BKYA 4GT3A 3OHTA 3RHXA 4DCEA 4BHZA 5DR6A 3VBWA 4BCKA 2I0EA 5LCJA 3DLZA 1OM1A 4FEVA 1RW8A 1O6YA 3FZ1A 4R3CA 5JEBA 4WO5A 4HYSA 4NK9A 3G2FA 4S30A 3EFWA 3KVWA 2ITOA 2G1TA 4FNZA 5LARA 5HX8A 3PUPA 4JG8A 5HIDA 4CKRA 3BHTA 1OIYA 3AT2A 4DINA 4L7FA 4QT1A 3PZHA 1KOAA 4QP8A 4O91A 4FSQA 4CZUA 3EQFA 2XJ0A 3Q4TA 3DTCA 4IWOA 2A4LA 2XK7A 2QHMA 1PMEA 2UW5A 3KRXA 4QYFA 5I9YA 2GCDA 2UZEA 5E90A 3ACJA 5HTBA 4Y5HA 2OSCA 3MFSA 4FZDB 3AC1A 4K18A 2I7QA 1QPDA 2W9ZB 5AP2A 4CZTA 4TYHB 1PXOA 2WMRA 3C0IA 5GZ9A 4EOSA 2J50A 4JRVA 3IW5A 4BWKA 3PPJA 2PVYA 3KA0A 5L6WL 4GU9A 1U5QA 3EHAA 3ZZWA 4ZY5A 2WQNA 4MWHA 4J97A 3SV0A 3R0TA 2J6MA 3CP9A 4S31A 4O7WA 3U54A 3OWPA 4ASDA 5KBQA 4JIKA 2C5NA 3PJ2A 3B8RA 3BRBA 4FNXA 5IQEA 3F5GA 1U5RA 3MTLA 5CAPA 2A2AA 2ZAZA 2XK4A 2W4JA 1WBNA 1QCFA 1QPJA 2VO0A 4FV4A 1FQ1B 3VQUA 3W33A 5C9CA 2B55A 5AR5A 5K5XA 4I5HA 3MA3A 4WNOA 3UO4A 3QAME 5HTIA 3SG9A 1JAMA 4J71A 5IPJA 5L2WA 4JNWA 5C4LA 4C62A 4NWMA 2UVYA 1WVWA 3CQUA 4ZSGA 3GGFA 2WQBA 3H9OA 4KD1A 4KBCA 2ITZA 4LUDA 5FD2A 3VUIA 5T6KA 4IZAA 2IW8A 3PLSA 3QQJA 4QYYA 2IO6A 5AEPA 2ZB0A 4UALA 3TKIA 2R7BA 3ZM4A 3R83A 2CKEA 4MXAA 3E7OA 3NSZA 5J95A 3WILA 5JFSA 4DYMA 2YM3A 2C0IA 3LQ5A 3QRKA 3NNXA 4V01A 2J4ZA 4DFNA 5AAGA 4K0YA 1UKHA 5AR7A 3TI1A 4ENYA 2X6EA 4U45A 4YZBA 4ZJVA 5HTCA 1J7LA 2CNQA 2YJSA 1VYZA 4TTHB 4QYEA 3TM0A 4FEQA 1YW2A 4O21A 3ORXA 4AZFA 2Y0AA 3KXNA 3COHA 3RALA 5E1SA 2ETMA 1OECA 1OUKA 2W1ZA 5JFXA 4FIJA 5J5SA 2IZRA 4FTJA 4QQJA 2JITA 3HA6A 4PY1A 5M4FA 5KMKA 5H9BA 2GS7A 2WTKB 2BHHA 2JC6A 5LMAA 2Z7LA 5CSHA 5FQDC 4NZWB 5C1QB 2XK9A 2YN8A 3RPVA 5AP3A 4XUFA 4ALWA 5J5TA 4QO9A 5FXQA 4JIAA 4MWIA 3KXXA 3S2PA 4Y5QA 3TUBA 3G51A 4F7JA 3OT3A 4CT1A 4RX7A 5FM3A 1H27A 2XKFA 4AZTA 3AC4A 3UNZA 3LXNA 1GIHA 3FXXA 2OO8X 4FKRA 4U44A 4I3ZA 1ZYJA 5CVFA 1SMHA 2YFXA 3ORTA 4FG8A 3QA0A 5A4QA 3S0OA 3P7BA 3KXGA 4I5CA 1SYKA 1PXMA 4J95A 5A9UA 2XJ1A 2Y8OA 4YZNA 3HVCA 3T9TA 5HU9A 3MFUA 3A61A 2PVFA 5I0BA 1J7UA 3KL8A 1OL6A 5BX0A 2PK9A 4GVJA 4IADA 4QP9A 2FH9A 4G17A 4FNWA 4WRGA 2C3LA 5AR3A 1VYWA 2AC5A 2NRUA 2ITXA 5CEKA 5IA1A 3NNVA 3CKXA 1SM2A 4OTHA 4FSMA 4WIHA 3V5JA 2J2IB 4LGDA 1I44A 1M52A 1RJBA 4MXYA 3D9VA 3UOKA 4KIKB 2W5BA 4JDJA 4OTDA 4TRLA 3RZBA 5M53A 4O86A 5DRBA 2XYNA 2ITWA 5KZIA 4AFEA 3R22A 4LFIA 3P7CA 4EHVA 5ANGA 4ZSAA 3F2RA 2JKOA 5E4HA 1WVYA 3TZMA 3P7AA 5FGKA 3UBDA 4XV1A 4IX5A 3QRTA 3ZFYA 2QKWB 2R3GA 4FT7A 3G33A 4XCUA 2XKEA 3PTGA 4AA0A 3Q52A 2GQGA 5FG8A 5DGZA 4YGAA 3QTWA 3UOLA 4DEAA 3PPKA 2O8YA 4N0SA 2CKPA 3R00A 3UIBA 3TACA 4HCUA 4EL9A 2J0IA 1OPKA 2JIVA 2C1AA 3I5NA 5JZJA 3DNEA 3QLFA 5C8NA 4DFBA 3GFWA 4OBOA 4F6WA 4PPAA 3C13A 4ANOA 1BL6A 2UZNA 4HPUE 3ID6C 5CT7A 4FSRA 5IMXA 2W1FA 1U59A 4FV2A 4AGWA 2XK6A 4XG3A 4C35A 4EBWA 4OAVB 4EQCA 1Y8GA 4YJSA 2R0IA 3FMJA 3NPCA 3QTSA 3EQPA 4MTAA 5GIPE 4WSQA 4XBUA 1YXUA 3R8PA 4GUEA 3GCSA 4UWYA 2A1AB 2EXMA 4ZIMA 4YU2A 4UB7A 3TCPA 4JJRA 2C5XA 2WIHA 2F7ZE 3P0MA 4YP8A 4EQMA 3Q9XA 4M68A 2J0KA 2OWBA 4M84A 1LUFA 3AD5A 3BLQA 2BCJA 4IAAA 4PPBA 4G9CA 3ZO1A 1J1CA 2C5VA 3P4KA 3PSCA 4PMSA 5IA4A 4CCBA 4QQCA 2YZLA 2XM8A 3DTWA 3O50A 4JBPA 1BUHA 2WFYA 4BYJA 2NNWB 4YO4A 3ULIA 3Q6UA 3KRLA 4YZDA 3QBNA 4AXAA 4E20A 2JKMA 4AGCA 2OH4A 3DCVA 4FTKA 5EM7A 4RC4A 4NCTC 3R7OA 3QCSA 4QMNA 1A9UA 3H4JA 4IVCA 3DZQA 2QI8A 3RK7A 4C0TA 3BU5A 4WUNA 4R3PA 1REJA 3DK6A 3VBTA 4M12A 3U6JA 5LVOA 1UWJA 3BLHA 3NW7A 4TYEA 2VV9A 1UWHA 2YIYA 4GFMA 1OBDA 5K0KA 4EOMA 4FOCA 3RM6A 1V0OA 2X7FA 2PUUA 4KWPA 3EFLA 1PY5A 1ZMUA 4RFYA 3RGFA 3G6HA 1PRYA 4JDIA 4BDCA 4YJNA 4F1TA 4ID7A 3BYOA 3QQLA 2JIIA 3EQIA 4MK0A 3QD0A 5AFVA 4IZ5A 1HOWA 4AE6A 2VN9A 2B53A 5TOZA 4L44A 3MW1A 3DJ7A 4IB0A 2OZAB 4J1RA 1M2RA 4LQMA 4M0ZA 3GFEA 4AW1A 4GKHA 1FMOE 4YR8A 2WQOA 3MDYA 3A7GA 5F94A 5DT4A 1ZOEA 3MGYA 3R1YA 5EQPA 5T3QA 2YCRA 4MH7A 3KN5A 5CY3A 2WMWA 3LM0A 2E9PA 2YIQA 4X3JA 3FLQA 4IZYA 3GC8A 5IEXA 4IB3A 4RFMA 3ZU7A 3ZDUA 2CGVA 3FC1X 3HMNA 2BVAA 2QCSA 2R7IA 3L9PA 5L8JA 4Y85A 4I0SA 4GMYA 3RK5A 2BMCA 3UC3A 4OTPA 3IK3A 3I6UA 3RINA 3F3TA 4ZY4A 3OWLA 1ZY4A 3FZPA 3NCGA 2ZOQA 3E64A 4D9UA 5HNIX 2Z60A 5IQGA 1JVPP 3EN6A 3VVHA 4A4XA 4NTTA 3PJCA 3JY0A 4ZTSA 5HIBA 3OWJA 4HZRA 5AIKA 5DA3A 5BMMA 1JBPE 4EEVA 4X2JA 4WA9A 1CKJA 1W0XC 3COIA 3Q9YA 5CSVA 3TIYA 3WZKA 4D58A 5CEMA 5LQFA 3TTJA 3WZUA 2ITYA 4QMWA 2YERA 3PY1A 2OXDA 1YI3A 2CGWA 4PL3A 4IBMA 4XMOA 4BGGA 2ACXA 5CEIA 4PTGA 4YNOA 3EL7A 3QC4A 1PMNA 1Y6BA 2UW4A 3KXMA 4DTBA 2OG8A 3D5VA 3IDCA 3AT3A 3OTVA 4YJOA 4DBXA 4NM3A 3THBA 3VF8A 4IANA 4J99A 1UU8A 5AP1A 4YPSA 3HMOA 4L8MA 4DEHA 1PYXA 4FV5A 4XOZA 5HX6A 4GKIA 5IQFA 4AU8A 3U4UA 4A9SA 2I6LA 4QPAA 3OEZA 3D7ZA 5EOLA 4BFMA 5EK7A 2QQ7A 2VWVA 1GZKA 3CQWA 1JKSA 4FZ6A 4QMQA 4RSSA 4I6FA 1YKRA 2R3LA 2YA9A 4K2RA 4M0YA 4TWCA 1H0VA 2AYPA 4USFA 1XJDA 4GG7A 5J7BA 3FAAA 4KKHA 4PTCA 1MRYA 4I6BA 4FIGA 3BWFA 3HECA 4FTMA 4LG4A 4AZSA 2EXEA 3IW6A 3O17A 4Y46A 3KGAA 2YM8A 4NSTA 4RA5A 5DVRA 3UGCA 4EH6A 4OTIA 4E7WA 2PULA 2GNHA 3RPRA 4CKIA 3L8XA 4IAZA 4PNIA 4B6LA 4R1YA 3DDQA 3PA3A 2PVNA 4JS8A 4EQUA 3LCSA 3W1FA 4N6ZA 2HXLA 2ITNA 3KEXA 4CYIA 1V0BA 2J7TA 3KK8A 4FVQA 5DG5A 5TR6A 3EIDA 3FMDA 3ANRA 4CV8A 3W2PA 2HCKA 4X6QC 4V0GA 3LLTA 1ND4A 2ERZE 5I5ZA 3KY2A 1CMKE 3ZO3A 4Y83A 2C6IA 5CLPA 4AN2A 3KK9A 3HRCA 3HYHA 4GL9A 3I6WA 4D0WA 3TNPC 3U87A 1W84A 2PE1A 4OBPA 3RWPA 2WD1A 4UMRA 2OIQA 1CDKA 4PV0A 3HX4A 4BWXA 4DEBA 4RG0A 4R77A 4HZSA 1MRVA 3FLYA 4MX9A 5HG5A 4FODA 5JFWA 3PVUA 3L1SA 3EQHA 3TNQB 2XNMA 2QURA 3UPZA 1YOMA 4LOOA 2BRHA 3GQIA 3PWYA 5CTPA 4M97A 5AR4A 2YHVA 3KN6A 4O27B 3WZDA 4IWDA 3BV2A 4NKSA 5CASA 4L42A 2W5HA 4QMUA 3F6XA 3ACKA 2I0YA 5B2KA 2BRMA 3V8WA 2RFNA 3VC4A 4E3CA 3CD3A 3UYSA 2WTDA 5D9HA 4ZTLA 2BZJA 2VWUA 3KMUA 4KUJA 4YPDA 3FZTA 2RFDA 1KSWA 3TUDA 4JOAA 3R63A 4GVAA 4ALVA 3HAVA 2CKQA 5FUTA 4EHEA 3TIZA 3GU5A 4GT4A 5KZ0A 2JDVA 5IUIA 4BI1A 4YJVA 5ETIA 5KCVA 2X8DA 4PMTA 1ZZ2A 3NIEA 3NUNA 4ACHA 5CF4A 3UMWA 1H25A 1H01A 4F64A 4U6RA 2R2PA 2QU5A 2CCIA 1Q3WA 2X39A 3E8DA 3DAEA 4LGGA 3UTOA 3PLAE 4KNBA 4FI1A 4EH4A 3EFKA 2W99B 1ZMVA 3R7YA 1Y6AA 3HAMA 4F6UA 3LQ8A 4MNEB 4J53A 5CI6A 5L4QA 1OVEA 3H0ZA 3ZRMA 3CPBA 2VD5A 4BGHA 3I1AA 4ZZNA 3QTXA 2VWXA 5AV4A 4NKAA 3Q4CA 4O0XA 3R9HA 5HOAA 3BU3A 2BRBA 3EQRA 2XKDA 5KMNA 5DT3A 3LQ3A 1WBPA 3MVJA 2HXQA 3QUEA 4FSWA 4BDEA 4Z9LA 3RAKA 4G6NA 4CFUA 4GJ3A 3HV4A 3WZJA 4O7LA 1LEWA 2FSLX 2GHLA 3JPVA 4AT5A 5J87A 3CLYA 4F0FA 2GHMA 4O0VA 3E7VA 2ZMDA 1M7NA 5D1JA 5DNRA 4C4EA 4D5HA 5HG7A 2OLCA 1AGWA 2HAKA 2VUWA 3QXOA 5F9EA 3MI9A 5EOBA 4QTDA 4BDGA 1WVXA 3N4UA 3NMUF 3MH3A 4XP3A 1E1XA 2C3KA 4RIWB 4RT7A 3ZLSA 3V51A 4EOQA 4O7ZA 1DI9A 3W8QA 1DS5A 3DKGA 4PPCA 2IZTA 2PUNA 5A4CA 3KF7A 2X6DA 3CTJA 4F9CA 2WNTA 3S00A 2QO7A 1Q99A 2X8IA 3ORLA 4U3YA 3M1SA 4UYAA 5M4CA 4JQ7A 2PTKA 3G15A 4TL0A 2WMTA 5DPVA 4U3ZA 4FEUA 3VS2A 4KSQA 5CU2A 4MBLA 3KRRA 4FKUA 3ZO2A 3R9RA 4H36A 3KULA 2X7OA 2YIRA 1GJOA 4Q9ZA 3ZEWA 4ORKA 3FY2A 4QMZA 4WNKA 3DOGA 4E93A 2XIXA 4BDKA 1R78A 2V22A 5EG3A 4RIYB 1JKTA 3NDMA 4C34A 3TKHA 4NM7A 4L6QA 4QRCA 4ZP5A 4DGMA 4E4MA 3MFTA 2PZ5A 3VF9A 3GU8A 5HVKA 1Q62A 4S32A 4M66A 4KS7A 3UZPA 2X8EA 3I7CA 5E8YA 3UO5A 4J7BA 4EH2A 4R8QA 1OIRA 4IM3A 3SG8A 3NW6A 3SXSA 5EI2A 4FV9A 4D5KA 3B2WA 4RVTA 4E6QA 3ZONA 3E5AA 4MD7E 3WE8A 4HVSA 5BMSA 3CTQA 1IRKA 1QPEA 5G6VA 2XCHA 3KFAA 5HCXA 3WBLA 3I0QA 2PZYA 4RFZA 1ZXEA 3C0GA 4QMYA 3PSBA 3A2CA 5IQIA 2OJGA 1DAWA 4FIFA 5TE0A 2FSOX 4GIIA 2B9HA 4UXQA 3A4PA 3E3BX 1VJYA 4H1JA 2J0JA 3Q53A 4F70A 5ACBC 5DLSA 3DA6A 1JKKA 3QHWA 5EHYA 3WARA 4BCPA 3GUBA 3NS9A 1KE9A 3OD6X 3NYNA 4O0RA 1ZLTA 1JSUA 5FXSA 4BDBA 5D7AA 4ZLZA 4IVBA 1G8AA 2YWVA 2IVTA 4UMQA 1GZ8A 2XZSA 4X2KA 5ANJA 1KV2A 4CRLA 1YDTE 4KRDA 4G3FA 4CV9A 4YTFA 3CTHA 4BBFA 4UMPA 3D94A 4XG4A 3DY7A 3TDWA 3DS6A 4O81A 3PXQA 5BVKA 1FMKA 2QR7A 3NYOA 3UOHA 3HKOA 3NNUA 1ERKA 4S2ZA 4UYNA 2XUUA 5CNNA 3ZBFA 5A4LA 5AUTA 4BTJA 5LJJA 3ITZA 2HIWA 4HGSA 5M44A 3POOA 3LXPA 4AFJA 3U4WA 4FA2A 4DA5A 2DS1A 2CSNA 4NM0A 2XBAA 4WHZA 3S4QA 1V1KA 3DKCA 4MNFA 2XBJA 4MF1A 2YIXA 5B7VA 2JKQA 3EQGA 5E8SA 3LW0A 2CNVA 4GH2A 2ZV2A 4P5ZA 3KCFA 5JK3A 1IG1A 3FSFA 3EB0A 4WKQA 3WF5A 3D5UA 4W4XA 2ZDTA 5GJFA 4FKIA 5CNOA 4TYHA 4ITIA 3AC2A 4BDHA 2IG7A 4CVAA 1WAKA 2C5OA 2VX1A 1OKYA 2BAKA 1PKDA 3QCYA 1M17A 3DB6A 1MQ4A 3QWJA 4XLVA 3LPBA 4R5YA 4YJTA 4AOIA 2H34A 2BRGA 5HQ0A 1IEPA 4AN3A 2XEYA 1WFCA 2X9EA 2VO6A 2IJMA 4CRSA 4O7SA 2XM9A 4OTGA 2W5AA 1TQPA 2W06A 3HLLA 4IX6A 1ZOHA 2FVDA 4KBAA 4O2ZA 3OXZA 5AM7A 4AW5A 2KULA 5LVLA 4AF3A 1HCLA 3UDBA 3MJ2A 3ORKA 3Q9WA 2PMLX 5CAUA 3DFCB 5C03A 4MBJA 2YCSA 3WOWA 2WOUA 3OP5A 5KHXA 4MYGA 4TNBA 4C4GA 2VWZA 3L9NA 3FPQA 3LFDA 3NUPA 3AC5A 1Q41A 4UN0C 3TZ7A 1H00A 2BKZA 4RQVA 2WPAA 3NX8A 3QLGA 1GAGA 2GS2A 4WRSA 2W1HA 3C4FA 4CMTA 3EYGA 3QWKA 3AC8A 4RMZA 4EH5A 4ZTRA 2OFVA 2G15A 3VBVA 3PPZA 4FKPA 3OF0A 3FV8A 3E8CA 2C6EA 4CD0A 3BPRA 3VWAA 1JSVA 2GS6A 4X3FC 3PZEA 4CG9A 5KO1A 5DBXA 2YCQA 3VJOA 3DZOA 5K5NA 1FOTA 3UVRA 2VGOA 2W96B 3RKBA 2YITA 3IW4A 3ZFMA 4TWPA 4E4NA 5FTGA 4GK4A 3F2NA 5FDXA 5M55A 3FLSA 4RZWA 1G3NA 4RC2A 3MY0A 3TV6A 2XNNA 2E9NA 5EI6A 3RPYA 4EZ5A 3ODYX 4EOPA 4G16A 4DH8A 4DGLC 4OTQA 4L3JA 4XEYA 4C8BA 2VTSA 5IDNA 4WT6A 4ZMFA 1H07A 3OC1A 5E1EA 5A46A 2JFLA 3OEFX 2B9FA 1F5QA 2HELA 4GG5A 4JBVA 2YISA 3FLWA 3II5A 3PVGA 4FTLA 4JDHA 4JLCA 4L01A 3DBDA 5EKOA 5GINE 1RQQA 1YVJA 4FSZA 3HL7A 5HICA 2NRYA 3ENMA 2UZUE 4BTKA 5KE0A 4HVGA 1MQBA 3FZSA 3UJGA 4O1PA 4IVAA 3GU4A 4DG0E 2ETRA 4GT5A 4PNKA 3SLSA 1PMUA 2O5KA 4GYIA 4O6LA 4BI2A 2C3IB 4Y72A 1U54B 1AQ1A 3B2TA 4YZ9A 4YLLA 4BICA 4DGOA 3FUPA 4CTCA 4EOLA 1XH8A 3P79A 3Q6WA 4QTEA 2JDTA 4ZK5A 4XRJA 4LV5A 5L2TA 4EKKA 3FKNA 3TWJA 2VO7A 2QG5A 1WBOA 3SC1A 3C4WA 3FKOA 3HUBA 4QOXA 4EWHA 3JXWA 2X4FA 4YC8A 4DF3A 3QTRA 2J5EA 4OTRA 3ROYA 1JQHA 5I9WA 5IUGA 2CGUA 3RAIA 1GOLA 4CCUA 4EOIA 3OZ6A 5GIOE 4MVFA 4DAWA 3LZBA 4FKJA 4HVHA 3R7GA 3BQCA 2PVHA 4FKSA 4AX8A 1OL2A 4KIKA 5E8UA 1FVRA 1XR1A 2AUHA 3ZUTA 3PVWA 5CYIA 4DLIA 3QX4A 5DRDA 1P5EA 2ITTA 3VS4A 4CQEA 3V8SA 4CFWA 4MQ2A 4R3RA 5F1ZA 4NL0A 4QPMA 4QNAA 4C4HA 5CEPA 2VWIA 4FVPA 5CEQA 4B99A 4BCIA 1TQIA 5AP7A 1B39A 2HW7A 1LP4A 2VTHA 3CC6A 3EL8A 3QYZA 5EI8A 5M51A 3TN8A 5IQDA 2REIA 4K8AA 4WG4A 3FWQA 3MIYA 1VR2A 1NXKA 3K3JA 2QG7A 4K1BA 4LI5A 1Z5MA 2BDFA 4RWLA 2XK3A 1KE7A 3NAYA 1WBVA 2BPMA 3D7TB 3R02A 5IISA 3NAXA 2YZAA 3BLRA 4L45A 5ANEA 5LMKA 2PPQA 3F7WA 1H1RA 3A4OX 4NM5A 3UP2A 5AAEA 1V0PA 3EQBA 3FMLA 2VTMA 2BDWA 4OUCA 4RWJA 3UIMA 4AGUA 1QPCA 4A9UA 2RG5A 3D2IA 1YRPA 2HY81 4LGHA 3TNIA 3KF4A 5FEEA 5AX9A 3ET7A 2GDOA 2JFMA 3MY5A 3P1AA 3UG2A 2GQSA 3ORIA 3U55A 4RVMA 4IE9A 3GENA 4QP4A 4RJ8A 4E6AA 4XG2A 4D2PA 5H8BA 1SVGA 3EQDA 3D83A 4O0YA 4FT5A 4ANMA 4F1OA 5EKNA 4N57A 4JQ8A 3SXFA 2XNBA 3FBVA 5CX9A 5AA8A 5ETFA 4HVDA 1F3MC 4IZ7A 3CD8A 2QO2A 2GFSA 4BB4A 2VAGA 2OJFE 4YBJA 2BAQA 5AUVA 3VS3A 4ANLA 3QFVA 4S34A 2QKRA 5AP4A 3DB8A 4UWCA 1ATPE 3A60A 2WIPA 4LYNA 4B4LA 2FA2A 1P2AA 3ULZA 4HYUA 5C8KA 2QLQA 4M7IA 3FZRA 5BVWA 4O7RA 1OB3A 4B0GA 1GZOA 4BDJA 3FE3A 5E92A 1PXNA 4IAYA 5J7HA 2ZV8A 4EHGA 3ZXZA 2FO0A 4DT9A 3ZM9A 2A19B 4JR7A 3HP2A 4O0TA 2HK5A 1REKA 4C4IA 3PXFA 5JGBA 3K3IA 3RTPA 4I4EA 3O96A 3TKUA 3ZMMA 5IH5A 5FBOA 2YCFA 4EK3A 3PVBA 3PFQA 1UNHA 5HVYA 2PSQA 4G2FA 4RX5A 3O8UA 4P90A 4QP7A 5KMLA 5IU2A 4CNHA 4C58A 2O0UA 2O64A 1R3CA 4ACGA 4W4YA 3FI4A 3PSDA 1YWRA 4CT2A 2C0OA 4F65A 3W8LA 4AOJA 5HNBA 3DV3A 3DXNA 4U42A 4EH8A 3W2RA 4FGRA 2VNYA 2OKRA 5EYDA 5GJGA 3C9WA 3TT0A 2Z7RA 4ZMEA 2UW6A 3Q3BA 4I93A 4GU6A 3V5TA 4AN9A 2OZAA 1Q8WA 2X2KA 2OJ9A 3JVSA 5DR9A 5DE2A 3VBQA 4AP7A 4C3PA 3A8XA 3NCZA 4FTCA 3SA0A 1FGIA 5M4UA 4D0XA 5AUZA 4MXOA 3DK3A 3KRWA 3MS9A 4LM5A 4XV2A 4P7EA 5D10A 2IVSA 3HA8A 4IC8A 3C51A 3LMIA 4E4XA 4BZNA 1OL7A 3CGFA 4ZJIA 2R4BA 2JDSA 3L9MA 4G3GA 3IW8A 3V3VA 4C38A 3BYSA 4JR3A 1R1WA 3HV7A 4DTKA 2JAVA 4K77A 3OOMA 3C5IA 2PMNX 2R3OA 3P23A 4EONA 2WGJA 2ZM3A 4NIFB 2OBJA 3MN3A 4B7TA 2PVMA 4I5PA 2QO9A 4M3QA 3CEKA 5LVNA 4J96A 3BZ3A 4BGQA 1OBGA 3C4XA 5HG9A 4YLKA 1ZZLA 4ZLOA 1BX6A 2DWBA 2F4JA 3SXRA 5KUPA 4XG6A 2OXXA 4MF0A 4AA4A 2E9UA 4BCQA 4DG3E 4YURA 5A4TA 4N70A 3GBZA 5F95A 1CKPA 3QD4A 4LL5A 2ONLC 3R7EA 2ZYBA 3IOKA 1G8SA 4FL3A 4U41A 4DTAA 5BYZA 3MVLA 1STCE 5AWMA 4BTFA 3SX9A 3P08A 1CM8A 3IDPA 3L8VA 4JVGA 3ZO4A 4A9TA 3P5KA 1PW2A 2I0VA 4F7NA 3FQHA 2RGPA 5LMBA 3QCXA 2JKKA 2PU8A 2R3FA 3FI8A 3G0EA 4JRNA 4U80A 2F2CB 5JT2A 2UUEA 3PIZA 4FICA 4EKLA 2C6KA 3O2MA 5HBEA 3ROCA 3DQWA 3GC0A 3SDJA 4F08A 4J8MA 2C6DA 5LVPA 4FZAB 3KKVA 1XH7A 3EN5A 2A0CX 1WZYA 3VS1A 1XO2B 3LXLA 4AZWA 2PHKA 3C7QA 1T45A 3PRIA 3R1QA 4FT9A 3OW4A 4FV8A 4EOJA 2YDJA 3ATTA 1OIUA 2X2LA 3NUYA 5HBHA 2B9JA 4NEUA 1DAYA 2VU3A 1XH6A 2F2UA 5HHWA 2VTAA 3VJNA 4DH1A 2IPXA 3JY9A 4E8AA 5HIEA 3UO6A 4BKZA 4D2WA 4DLJA 3UZTA 3DGKA 1XKKA 5D11A 2WKMA 5E7RA 2W1DA 5GHVA 4DH7A 2BIYA 4P2KA 3ZH8A 5BUIA 4DEIA 5CALA 5LXMA 2HWPA 3LFFA 4LMUA 2VZ6A 1KE6A 3MWUA 4CLIA 4CKJA 3KQ7A 4KAOA 1IAHA 3FYKX 4ALUA 2YIWA 3D4QA 5LWNA 2WTJA 3BE9A 3AMBA 1ZWSA 5A54A 3MTFA 3HUCA 4CZYB 4DFZE 5H3QA 4M69B 5T68A 5KHWA 3EN7A 3AMAA 2XIYA 3F9NA 3OCGA 5AP0A 5H8GA 4EH7A 4O0UA 4ZXTA 2B1PA 4MXZA 2EWAA 3WF6A 5JRSA 4UWBA 4YTHA 1OGUA 4IAKA 4Q2AA 2A27A 3ZLXA 4MAOA 5IF1A 4W4WA 2ITPA 3H9FA 4FSTA 2OH0E 3IONA 4ACMA 4LUEA 4GFGA 3UPXA 4ERKA 2PMOX 3BEAA 3NW5A 2B52A 2W0JA 2QOKA 1GY3A 1SVEA 4D4SA 2X4ZA 5E9EA 3NWWA 1R0PA 2JDRA 5FXRA 5FLFA 5TT7A 5EM5A 4F6SA 4F0GA 2PUPA 3DLSA 4RVKA 1VEBA 5FDPA 3HP5A 4WNPA 1XWSA 2F49A 3I0OA 3W16A 5IUHA 5EYKA 4AE9A 4ZZMA 4YTIA 1L3RE 4F4PA 4XV9A 4LL0A 3HMMA 2AC3A 3Q04A 4ZTMA 2Z7QA 3AD4A 5ICPA 1PXKA 1M7QA 3F3WA 3I60A 4FZ7A 3ZSIA 3G9NA 2YM7A 2HW6A 3TZ8A 4A06A 4ANSA 2DUVA 2FSTX 2B7AA 2QOHA 3OG7A 3OTUA 3ZLWA 4AZEA 4DC2A 4YUQA 4ZZOA 2RF9A 1O6KA 4QTCA 3QCQA 1RE8A 2FB8A 4EJNA 2G01A 4IM2A 5DFPA 3BBTB 4XHKB 4D28A 5A6NA 3L8PA 5HO7A 4CFXA 3LMHA 3NUAA 1CTPE 4XRLA 3VQHA 3PE2A 4IB1A 3CJFA 2X2MA 3ANQA 4MNEA 2ESMA 3OMVA 3AD6A 4D1SA 1YHWA 3BGQA 3RI1A 4O7NA 5IQCA 4IM0A 3E92A 3RK9A 3RWQA 5JRQA 1H1WA 1U4DA 3MV5A 4ZY6A 3E63A 3ZS5A 2PL0A 4UEUA 3KB7A 5CVGA 4I4FA 1QL6A 4K11A 5HI2A 5BVOA 1H0WA 4G9RA 1R39A 5M07A 3EKKA 4BZOA 3LCTA 5CZHA 3D14A 3TZ9A 3CR0A 5K4IA 4UX9A 3ZRKA 4QMMA 4C59A 1A48A 1M2QA 4FE2A 2ZB1A 2XNPA 1TKIA 3FY0A 4TKSA 3REPA 2R3PA 2R0UA 3CIKA 5EQYA 2CNUA 4ASZA 2XNGA 4EYMA 5EW8A 2YM5A 3ETAA 3ORPA 2CJMA 3R73A 2NP8A 4UY9A 4U97A 4KSPA 4BIDA 3LVPA 3HRBA 2G2HA 4FMQA 4EYJA 4HW7A 5F4NA 5ITAA 3IW7A 5ACKA 1H4LA 2R3KA 2QOFA 3VUTA 2C30A 1BI8A 3RAWA 4W8DA 3LM5A 5EYMA 4RIWA 4AS0A 2YAKA 1Q8TA 4TT7A 4TW9A 5DEWA 4QD6A 5H2UA 3ZLYA 3MPTA 2VTLA 3U51A 3H30A 3W2QA 2JBPA 3FHRA 3CKWA 2E2BA 3BYVA 3IQ7A 4HOKA 3EZVA 2HWOA 3ZTXA 3QTUA 4UMUA 1H8FA 3NNWA 4I23A 4QQ5A 4DFXE 3UMXA 2PVRA 4PL5A 3G90X 5J9YA 4J98A 1BMKA 1IA9A 1JSTA 4X2FA 5AUUA 3TV4A 2YDIA 2WQMA 5DIAA 4Y73A 1A06A 5ANOA 5FBNC 4DGGA 1LR4A 4X3FB 1J91A 1UU3A 4YJPA 5A14A 4MBIA 5BVEA 5IZFA 4EHZA 2GFCA 5FTOA 4CYJA 2YDKA 3FQSA 2VRXA 5I3OA 4FKVA 5EHLA 1PYEA 2RG6A 4NTSA 3VHEA 2YLEA 3QD2B 3ZC5A 4EH9A 4RIYA 5A6OA 3A99A 3UP7A 3MYGA 4L46A 2HZ0A 2X9FA 3BEGA 3V01A 3Q5IA 4V04A 4B8LA 5HORA 4DFYA 2R9SA 3QL8A 3EQCA 3JR1A 5C4KA 3ZUUA 3SOCA 4BTMA 4EK4A 5L6PA 1P14A 3BQRA 2WU6A 5KKRC 3T3VA 4Z55A 4PQNA 2PUIA 3UZRA 5DYJA 5BNJA 3MPMA 4H1MA 4C61A 4UZDA 2F9GA 2UZDA 4E26A 4EWQA 3EFJA 2P2HA 3BI6A 3N4TA 1OMWA 1Q5KA 3N51A 1YDSE 4I24A 4L9IA 2IZUA 4FL1A 4HPTE 3NUSA 2JBOA 3L9LA 4P4CA 4EOKA 3FZOA 4YJQA 2VTNA 2YM6A 3DBFA 4TYIA 1M14A 5A3XA 3IGOA 4ZSJA 4WSYA 4AUAA 3QA8A 2Z02A 2FSMX 2HZNA 4IFCA 5M06A 5F20A 5DWRA 3LMGA 4GK2A 4O7TA 4CMUA 1OKZA 3QQGA 3ZSHA 3F7ZA 3KREA 5CEOA 2YWPA 4IAFA 3Q96A 3VUGA 5IQAA 4L3PA 4FR4A 3NYVA 4BN1A 2R3IA 3F3ZA 2X81A 5C8MA 4FEWA 1BL7A 2QOQA 5IMEA 3PIYA 5BYLA 2VNWA 3FI2A 4Z7GA 3GXLA 2C4GA 4JDKA 1Q8YA 4KIPA 3WE4A 5KMIA 2VTOA 3RMFA 4MEDA 1W8CA 1E1VA 1JKLA 4MD9E 1SVHA 2IVVA 4FKWA 5JFVA 3GU6A 1NT2A 5EW3A 3V5WA 4ZLYA 2J9MA 3ZZEA 3FXZA 5IH4A 3HV6A 3GVUA 4MXXA 2GNIA 3KC3A 2JGZA 2FGIA 4U8ZA 1KE8A 4NJ3A 4G31A 3SRVA 4D4YA 4F99A 2PY3A 3R8UA 1K9AA 1ZYCA 3AOXA 2C3JA 3NYXA 3UC4A 3PXKA 4HVIA 4JI9A 3M42A 3R71A 5CQWA 2KTYA 4FTOA 5CAOA 3G9LX 3V04A 1W83A 2C6MA 2EUFB 2QR8A 2ZM4A 3BHUA 3SKCA 1Q61A 4HGTA 4IC7A 4O6EA 4XG9A 3O0GA 4MCVA 3DXPA 4FIHA 2LAVA 4W9WA 4HNFA 2JAMA 4RIOA 2F57A 3NIZA 4YSMA 3I81A 4JG6A 5BVFA 5EQEA 4FKOA 3OBGA 3PJ1A 1H1PA 1UNGA 3F82A 3Q2MA 3GC9A 4XH6A 4WD5A 3PY3A 3LKMA 4M14A 3FSKA 3ORNA 2WOTA 2BZIB 5IA5A 2GNLA 4ARKA 3F69A 3LJ2A 3H9RA 2PVJA 4D2SA 2C6OA 5M08A 3V8TA 3FHIA 2XB7A 5G1XA 3UQFA 3ZCLA 4FTRA 4RLKA 4RLLA 4QMTA 3O8TA 3R01A 2OFUA 4L00A 3QALE 4DE4A 4Q5EA 2W1EA 4HYHA 2GTNA 3A7IA 4NCTA 2BALA 4GS6A 5CQUA 5CANA 3AC3A 3GU7A 3S3IA 2OK1A 3VRYA 3FMHA 2ZJWA 4RZVA 2UW3A 4GV1A 4FTAA 5TF9A 4O7VA 3OWKA 4NU1A 3R7UA 4L53A 2OF2A 4R5SA 2Q83A 5AA9A 4PL4A 4TXCA 3W18A 2Y4PA 3FDNA 5J8IA 1J1BA 2PE2A 3OW3A 3QTIA 4QTBA 2B0QA 2ITQA 2H9VA 5IA3A 4UXLA 1KOBA 1GZNA 1URCA 4G1WA 5EH0A 1KE5A 2V7OA 2UV2A 2PZPA 3C4EA 3H0YA 3OCSA 4FV1A 3KU2A 1URWA 4YZCA 4DBNA 1JWHA 4O84A 3FMEA 5I9VA 4I6QA 5AUYA 4RJ3A 4DHFA 4I21A 5ETAA 2PVLA 4QP2A 3VNTA 3QUDA 3EMGA 5CI7A 4M8TA 4IFGA 2HZIA 3UIXA 3FPMA 3CPCA 1WMKA 2OW3A 3QXPA 4UMTA 4D1ZA 1IR3A 2P33A 4RVLA 3D5WA 5JMSA 1JPAA 3BU6A 2GMXA 4AT4A 1KUTA 2YEXA 5IQBA 1CKIA 2P0CA 3QC9A 1Q8ZA 5GNKA 2WMSA 4YHFA 3MA6A 4IJ9A 2XH5A 4TN6A 4IMYA 4A7CA 3EN4A 2B54A 2OIBA 1NVSA 2PZRA 3F88A 3V5PA 4EJ7A 1U54A 4EZ3A 1SNXA 1T46A 1PF8A 2XNEA 3EYHA 3IECA 3PA5A 5CWZA 3BCEA 3R8LA 3MH2A 3HV3A 1XBCA 4HGLA 4Y95A 2VWYA 3SGCA 5HCYA 3D2KA 4A9YA 5GZ8A 4O83A 2XF0A 2QOCA 4PRJA 3UODA 4D4VA 1MRUA 4TWOA 4M15A 3VO3A 4E6CA 3HNGA 2W4KA 3ENHA 4QP3A 4FZFB 4L68A 3LFQA 4XS2A 3NGAA 5AMNA 4YZMA 5DOSA 2R3MA 4IEBA 4XV3A 5HEZA 4FG9A 4XX9A 4OTFA 4AG8A 4E5BA 1H28A 2UW0A 4BBEA 1Q4LA 2F7XE 3I5ZA 3T9IA 3BIZA 3CCNA 3C4ZA 4IWPA 5DHJA 4CXAA 3DFAA 1ZMWA 2WMXA 2IVUA 4ANNA 1MP8A 4C3FA 4FIEA 4G5JA 2J51A 5BUJA 1ZYLA 4PMPA 2GHGA 3E8NA 4FSUA 3RBWA 4BDDA 4ONAA 1DM2A 3AG9A 3DJ5A 4I41A 2BROA 2WTWA 2XNOA 3OUKA 3BGPA 4KIOA 5AJQA 3QUPA 4IACA 1IAJA 3HV5A 3P9JA 3R8ZA 4FYNA 3RHKA 4F09A 5HLNA 2O63A 5DR2A 3FMKA 4CFFA 2GQRA 2V62A 4YLJA 4DEDA 4RPVA 3LAUA 5CF5A 4USDA 4D2VA 4JXFA 4WNMA 4XBRA 4YC3A 5KBRA 3MH1A 4L3LA 4X2GA 1GIJA 3GCQA 4KIQA 3AXWA 3RAHA 4N4SA 3F3UA 2HZ4A 3MB7A 5BUEA 1OL1A 4XJ0A 2VGPA 5IG1A 5C27A 4NUSA 5AIRA 4OAUC 3L8SA 4KBKA 4O0SA 2WEVA 5EFQA 3ZBXA 4AQCA 4DITA 3Q4UA 5D7VA 1XBBA 3KCKA 3OUNB 2CKOA 4XLIA 2E9OA 4RIXB 4O82A 5HGIA 4I5MA 3CSVA 4F9BA 4YC6A 3NEWA 1XH5A 1PXPA 2R3HA 3NLBA 4BL1A 5J1VA 3PXYA 4JQEA 3A7FA 3A62A 4IW0A 3QKKA 1OZ1A 5D12A 1B6CB 1OL5A 2UZVA 3W2CA 4DG2E 5IEVA 2UZWE 2XIRA 5LOHA 3PA4A 2Y6OA 4XYFA 2XIKA 1JNKA 3LFEA 2C1BA 1X8BA 3HRFA 4Y8DA 3UOJA 4S33A 5E8XA 4RRVA 3QHRA 4KA3A 3NVKI 2RL5A 3PWDA 3Q9ZA 1BKXA 3O23A 1U46A 4FL2A 1ZY5A 4LOPA 5HNGA 2VTJA 4AGDA 3D15A 3E93A 3GCUA 5JGDA 3R30A 2X0GA 1OPJA 4I0TA 2R3JA 4YHJA 3C0HA 3DKOA 1WBSA 5JSMA 2YJRA 1Z57A 3MH0A 5DI1A 3TV7A 3CS9A 3FYJX 2GTMA 4IVDA 3CE3A 1PHKA 4RQKA 4CQGA 3CXWA 3ORMA 4BKJA 4PDPA 4BDIA 3OS3A 3LCKA 4U9AA 3U8WA 3JS2A 4U0IA 3NR9A 3EJ1A 5FRIA 4BIBA 4EUTA 3E3PA 4BZDA 3B8QA 3JYAA 4WOVA 4AZVA 3AGMA 3RM7A 2RKUA 4C7TA 3PJ3A 5CSPA 4BR3A 1OI9A 4D2TA 3HMIA 1AD5A 2IW6A 1W98A 4DH5A 1BI7A 4IDTA 3O7LD 3QTZA 2IZSA 2JLDA 4WG3A 5E8VA 3TEIA 3IO7A 3WF9A 1K3AA 4CLJA 2QONA 4H3PA 2B9IA 3OXIA 3W2SA 4E5WA 4FEXA 4CMOA 2BRNA 3F5UA 3LHJA 4ACCA 2WMBA 2YABA 3FLNC 3ZC6A 3TG1A 4AW0A 2W1GA 3R6XA 3LLAA 1P4OA 2PVKA 1FBNA 5HD7A 2O3PA 4PWNA 4NIFA 5AV2A 3T8OA 2PZIA 3R8VA 3VBXA 3VHKA 4GRBA 4B9DA 3VS6A 2W17A 4O7YA 3UQGA 2WXVA 3GB2A 3GCVA 3GI3A 3RP9A 1PXLA 2F7EE 2XS0A 4JX3A 1DI8A 1Y91A 1F0QA 2C6TA 4O22A 3PYYA 5CF6A 3TNHA 3U6HA 3CBLA 3PY0A 4KKEA 2VTRA 4LV8A 3ZYAA 3F3VA 2RFSA 3LJ1A 1NVQA 3A7JA 3KXHA 4FT0A 4CG8A 5JQ5A 4F9AA 4FYOA 4BDFA 4R7IA 3F5PA 3QQFA 4O38A 3LIJA 3DT1A 4FKLA 2HYYA 4GYGA 3BHYA 4XP0A 3ATSA 4HYIA 4F0IA 2UZOA 5KMJA 2WU7A 4NFMA 5HLPA 1OUYA 3VW8A 3GT8A 4X2NA 3HDMA 3KMWA 4C4JA 2Y9QA 3ALOA 4A9RA 4UBAA 5HO6A 4RJ6A 1Q24A 4BCMA 4KKGA 2NPQA 3S95A 4A07A 4I0RA 2ZV7A 3G6GA 4OW8A 4BWPA 3UVQA 3ODZX 5BYYA 3Q5ZA 2XK8A 3P86A 1HCKA 4UZHA 3QQUA 5CAVA 3ZRLA 5KNJA 3NUXA 4HCTA 5FTQA 4IHPA 4CFVA 5M57A 4F7LA 4XNEA 4BCNA 4OLIA 4ERWA 1Q3DA 4IWQA 5BVNA 4C36A 3QU0A 1PJKA 4F9YA 5CSXA 1J3HA 1APME 4BCGA 3COMA 1Q8UA 4USEA 3OBJA 2EXCX 3VUKA 3PG1A 4TNDA 2OF4A 3A7HA 4TWNA 4F1MA 3H10A 4D4RA 3SHEA 2JIUA 4RWIA 5HZNA 2J0MB 4AACA 3N4VA 4K9YA 1XQZA 4OTWA 2BTSA 2JD5A 4MD8E 2SRCA 5E8TA 5C26A 5ANDA 5AP5A 2GPHA 1LPUA 5B0XA 4BC6A 2P55A 1H08A 2WELA 4RX8A 3UNJA 4RJ4A 5DH3A 5HKMA 4R6VA 3VBYA 4PMMA 4Z16A 4H3QA 3EZRA 2UVXA 4GSBA 5KKRB 4CGAA 3ZSGA 5JGAA 3Q60A 2B4SB 4AA5A 4M69A 5CENA 4DH3A 4HGEA 1YI4A 1M2PA 4PUZA 4FBXA 3OFMA 5IH6A 2XEZA 4IB5A 4BDAA 4F7SA 1OITA 2C5YA 2OGVA 2XVDA 1RDQE 3DJ6A 4FTQA 4ITHA 4IXPA 2Q0NA 3RPSA 4KB8A 5M56A 2QVSE 1CSNA 4CFMA 5KMMA 3NVMB 2QHNA 4TY1A 3VIDA 4FUYA 3SD0A 3NRMA 5CSWA 4D9TA 4QQTA 3BWJA 3CY3A 5IA0A 4BIEA 2BIKB 4JAIA 5JQ8A 5M4IA 4BBMA 2UZLA 4YJRA 1H1SA 3GEQA 4X0MA 3TNWA 4JX7A 2C47A 4KABA 4E4LA 1NA7A 1UV5A 3K2LA 3R8MA 3S1HA 4G3EA 3IGGA 3AMYA 2W4OA 3UIUA 4CEGA 4ZS4A 3KXZA 4IDVA 1NW1A
chains in the Genus database with same CATH superfamily
3MSSA 3VONA 4QMSA 5H8EA 3R9OA 5HESA 4D1XA 4F9WA 2XP2A 3C5UA 2I1MA 4FV7A 3FMMA 3U6IA 3QRUA 3W55A 2IW9A 2HENA 2WEIA 3FL4A 1R0EA 1ZYDA 3LCDA 4W8EA 4O96A 5AV3A 5TKDA 3FXWA 3FC2A 4R7HA 3BHHA 4NH1A 4PP7A 3RPOA 3WIKA 4H3BA 3MY1A 2JEDA 3V5LA 5EM8A 5IQHA 4ZSEA 2R64A 4FKQA 2RSVA 1S9IA 4RGJA 3C4CA 4NJDA 4APPA 5IEYA 4K6ZA 4DEEA 3OXTA 2BUJA 4ZS0A 5JH6A 1FVVA 2WMQA 2CN5A 2PE0A 5CAQA 4YMJA 3RNIA 3POZA 5CT0A 5A4EA 2G2FA 3GNIB 3PXRA 4GW8A 4I94A 2ZDUA 3W32A 5AV1A 1ZARA 3HDNA 4RJ5A 5E8ZA 4FG7A 4U79A 5HE1A 2W1IA 3DKFA 4IJPA 3ZOSA 3VAPA 3QF9A 4P5QA 4NT4A 3SQQA 4YSJA 2EVAA 4YHTA 4G34A 2WHBA 2WMVA 1UKIA 2ZMCA 1IASA 3BL7A 1VLRA 2HOGA 1WCCA 2RFEA 3LXKA 4EC8A 2J0LA 2GNFA 3VS0A 2H96A 4OGRA 4IX4A 5DEYA 1UNLA 3DPKA 4O2PA 4X7QA 5CU0A 4JL9A 2W7XA 3MIAA 5AADA 4W4VA 2BAJA 4KRCA 4MKCA 4H58A 2W1CA 4DGNA 2QC6A 4JBOA 4XG8A 2ZV9A 5DT0A 3EKNA 1BLXA 5L2SA 5EDQA 4H05A 4PP9A 4NYEA 3QYWA 1YOLA 3MBLA 4I92A 5CVHA 5FP5A 1B38A 3ZHPC 1W82A 4ASXA 1ZYSA 4FTTA 1YXTA 3EOCA 3LFSA 3O51A 3V5QA 3TL8A 3W10A 1MUOA 1E9HA 2XJ2A 3D5XA 4RX9A 4CFNA 1PKGA 3ZDIA 3LFBA 4OT5A 4X3FA 5FP6A 3R28A 3DAKA 3R21A 4FUXA 4FX3A 4Z7HA 3QRIA 4U40A 4D2RA 3WZEA 4ZSLA 3QD3A 2VTTA 5EDPA 4OBQA 2OJIA 4IIRA 3K54A 4YBKA 4LRJA 4V05A 3IS5A 1PXJA 4ENXA 3JVRA 5BV3A 3FL5A 3EH9A 5DMZA 3JUHA 2X1NA 5E8WA 3R2BA 2Z7SA 1ZOGA 5AR2A 2XRUA 1KV1A 3UE4A 5CF8A 4FTIA 1YXXA 4O1OA 4FK3A 1J7IA 2FYSA 4GCJA 4QPSA 3O7LB 4R1VA 2UW8A 3AT4A 3VULA 1Q97A 2BHEA 1H1QA 3IDBA 2R5TA 4I22A 2NO3A 4BHNA 4I1ZA 5LWMA 3E8EA 3GP0A 4E6DA 3TJDA 1G5SA 4G3CA 3OCTA 4FVRA 3R9NA 4AXEA 3RZFA 3PRFA 5CS6A 4HCVA 2XYUA 4ZTQA 5EM6A 2R3RA 3SOAA 1W2FA 3MB6A 4IAIA 5HE3A 4U7ZA 3NZ0A 2CMWA 3PDTA 4QMPA 3V6RA 3AQVA 3W2OA 2QOOA 2XIZA 3LFCA 3ORZA 2Z8CA 2YACA 2WTKC 4II5A 3P5JC 3IG7A 3DBQA 4R78A 2WAJA 4GEOA 2CDZA 3O71A 5ETCA 4C4FA 2OIDA 4E73A 4FGBA 4QP6A 4DT8A 4I6HA 2Y4IB 4QYGA 2BTRA 4J8NA 3ZEPA 5AP6A 5K0XA 3TTIA 2J90A 3C50A 4AWIA 5IDPA 2IN6A 3MFRA 4Q9SA 3GC7A 3QZGA 4NFNA 4GIHA 3HEGA 3I79A 1SZMA 2UVZA 4FF8A 2BFYA 2WO6A 4FSYA 4U81A 4WBOA 3LFNA 5FWKK 5J79A 3FI3A 3A8WA 3N9XA 4X21A 4XOYA 4ZTHA 4BY9E 3PUFC 4GJ2A 2XA4A 2Q0BA 4QMVA 2BFXA 2BZKB 4PX6A 2WMUA 4FTNA 2Y7JA 1Z9XA 3BKBA 4FIIA 3QTQA 2YLFA 4C33A 1SNUA 3F5XA 3D0EA 3NUUA 3RCDA 3WI6A 4DFLA 3SW7A 2EU9A 5CU6A 2VX0A 3IKAA 1PMVA 1WBTA 2VWWA 1KWPA 1FINA 5TO8A 4L7SA 3DBEA 4A4OA 5CZIA 4IX3A 3PXZA 4RJ7A 5HU3A 2P3GX 4PDOA 3NFGB 5HG8A 2V55A 2ZM1A 4EH3A 4EBVA 2CLXA 1L8TA 4WUAA 2QNJA 1UA2A 5HD4A 1I09A 3COKA 3PIXA 5JKGA 2XAOA 4DCAA 5M09A 3ALNA 4MXCA 4FC0A 5AV0A 1LEZA 3DK7A 3LFAA 4I20A 2OXYA 4EI4A 4C02A 1W2CA 1NY3A 4ZEGA 4XG7A 4RWKA 2Z2WA 4MQ1A 5HLWA 2EB3A 3ZXTA 4C3RA 3HZTA 4K33A 2CPKE 3OT8A 4TYJA 1EH4A 5B2MA 2BZHB 4BYIA 1FPUA 5L2QA 3DNDA 3SVVA 2QOIA 5LMKC 2G9XA 2O65A 4LMNA 4ACDA 2XCKA 2BKKA 1TVOA 3GCPA 3Q2JA 2X0OA 3VS5A 4HJOA 3QKLA 4JG7A 3DU8A 4AT3A 4FV6A 3UYTA 3VN9A 2I40A 2R3QA 2ITVA 3UVPA 4EK6A 4W9XA 3TJCA 4ZAUA 5BQ0A 3Q4ZA 2LGCA 4BCOA 2XRWA 5CU4A 3M11A 3QX2A 4QP1A 1K2PA 1YOJA 3VUHA 4BCHA 5L2IA 3H3CA 4FKTA 4E1ZA 3FLZA 4ASEA 2ZVAA 3KVXA 4KS8A 4YO6A 2V7AA 3GQLA 1OPLA 5AUWA 4A4LA 4CSVA 2BILB 2OJJA 5I4NA 4FTUA 2OI4X 4LOQA 4LRKA 1W2DA 4V0GB 4L52A 4AXCA 4AW2A 1ZRZA 2PYWA 2I0HA 4G6OA 4EZ7A 1YDRE 4AAAA 5GZAA 4MHAA 3FMNA 5GJDA 2QOLA 5AM6A 5CXZA 3CQEA 4GUBA 3LOKA 2WB8A 5I9UA 4PDYA 3KRJA 4RA4A 3R2YA 4YNEA 3MVHA 4E5AX 4PDSA 3LJ0A 1WBWA 3QRJA 3W0QA 3BHVA 4JAJA 4C2WA 2GNJA 4C57A 4EK5A 2J5FA 3BX5A 3G5DA 2WZJA 2VWBA 4BRXA 4Z3VA 5BVDA 3PJ8A 1GIIA 1YWVA 3OCBA 5K4JA 1XH4A 2GU8A 4LRMA 2C6LA 3ERKA 1PXIA 3RVGA 5J9LA 3MVMA 4IQ6A 4O0WA 4OT6A 2QOBA 2XKCA 4QMLA 4MUQA 4UV0A 2CGXA 3QZIA 5K3YA 3QQKA 3E88A 5KMOA 3VW6A 2CCHA 3PP1A 5HVJA 2BR1A 4EC9A 4N6YA 1OKWA 3MESA 2UZBA 3DBCA 3CY2A 3V6SA 4QDEA 2CLQA 5EYCA 3VS7A 5I3RA 4EORA 4C2VA 5L3AA 3BGZA 4R7BA 4JMQA 5ANIA 2QODA 1ZAOA 2O2UA 4DFUA 4D55A 5EHOA 3EWHA 5E91A 1XHAA 4QMXA 5HE0A 5J9ZA 2OU7A 3E87A 3PP0A 3UG1A 3DXQA 4DN5A 5B2LA 3OVVA 4G3DA 4EOOA 5HBJA 5L8KA 4ANBA 1O9UA 4PF4A 3RCJA 5L8LA 2JDOA 1UU7A 2ITUA 3BE2A 3QKMA 4BCJA 3TUCA 3CJGA 3R7IA 2ONLA 3HGKA 2QD9A 2VTIA 2W05A 4GFOA 2YAAA 3R7VA 5C01A 4RC3A 3OY1A 2DQ7X 2DYLA 2H6DA 4FOBA 5HCZA 3OROA 3DAJA 4FK6A 3QGWA 2BDJA 4L43A 2WQEA 3R9DA 1QMZA 3BYUA 1Y8YA 2VO3A 1GNGA 4HNIA 1OKVA 1YWNA 2IWIA 3BBWA 2CN8A 3FKLA 4FNYA 4G6LA 3KMMA 4IH8A 5D41A 5HE2A 3UQCA 5J1WA 3LE6A 2C0TA 3OY3A 3WF8A 3F61A 4TYGA 2UW9A 2EB2A 3C1XA 3DQXA 5AR8A 4TZRA 3RJCA 2X7GA 4AOTA 5ANKA 4M67A 3F2AA 3FJQE 5FEQA 4BF2A 4YTCA 2VTQA 4XP2A 5HO8A 2UZTA 5EW9A 2V5QA 3GOPA 3MPAA 4GK3A 3O8PA 4M13A 3SAYA 5IA2A 2H8HA 5K9IA 4QYHA 1YQJA 2CHLA 3GOKA 3WF7A 1JLUE 4F63A 1UU9A 2WTIA 3MJ1A 1VZOA 4LDTA 3AGLA 1BYGA 2PWLA 3M2WA 3U9CA 3W0SA 2PMIA 4ZOGA 1XBAA 4YJUA 3I4BA 3ZFXA 1FVTA 4C37A 4EUUA 4RIXA 2QLUA 3QQHA 4FV3A 4B8MA 3FEGA 5LCKA 3UNKA 4J52A 2GSFA 4CTBA 2P4IA 5AAFA 3IOPA 2QU6A 3WYYA 4G5PA 4WG5A 5FM2A 4H39A 4FV0A 4ANQA 1H24A 2UW7A 2V0DA 3KULB 3IPHA 2VX3A 4KINA 3OOGA 5AUXA 2Y4IC 3E62A 2XMYA 2ERKA 3SW4A 4L67A 5DN3A 3PG3A 4JT3A 3SRVB 2VTPA 4FKGA 3VRZA 4U43A 3P78A 3QZFA 2RIOA 4QTAA 5JZNA 4ZJJA 1P4FA 4APCA 1TQMA 3U9NA 4RBLA 3QZHA 1YHVA 3EN9A 1YHSA 1YXVA 1S9JA 2WTVA 3DDPA 3W0MA 2HY0A 4FT3A 5L6OA 3QGYA 3BELA 4U5JA 4NW6A 1FGKA 4ITJA 1NVRA 4X6RA 3ZUVA 3F66A 2R3NA 3Q32A 4QMOA 1OIQA 1TZDA 3LCOA 4WBBB 3BYMA 5CU3A 5EDRA 2C69A 3RNYA 3R04A 4BI0A 2OZOA 5FEDA 2GNGA 3TXOA 2ETKA 3PE1A 3VUMA 4O4EA 2OICA 5I9ZA 1XH9A 2YM4A 3T3UA 3K5VA 4OR5A 1UVRA 4EK8A 2G2IA 1IA8A 5IKWA 4FSNA 1YI6A 2W9FB 4TPTA 3TDVA 2Y6MA 1H26A 2WTCA 3FQEA 5BPYA 2WMAA 3G0FA 3HMPA 3K5UA 4PTEA 1ST0A 3ELJA 3BV3A 3WIGA 4NW5A 3R1SA 4BVUA 5LVMA 4JBQA 1Y57A 3R1NA 4BCFA 1JOWB 5KX8A 3VUDA 2FUMA 5AX3A 3WYXA 1YXSA 1W7HA 4QNYA 3D7TA 5JN2A 4Q5HA 5I9XA 3I7BA 4LV7A 4ZTNA 3CGOA 1O6LA 2C68A 2E9VA 4DEGA 2P2IA 5CXHA 4BKYA 4GT3A 3OHTA 3RHXA 4DCEA 4BHZA 5DR6A 3VBWA 4BCKA 4DDIA 2I0EA 5LCJA 3DLZA 1OM1A 4FEVA 1RW8A 1O6YA 3FZ1A 4R3CA 5JEBA 4WO5A 4HYSA 4NK9A 3G2FA 4S30A 3EFWA 3KVWA 2ITOA 2G1TA 4FNZA 5LARA 5HX8A 3PUPA 4JG8A 5HIDA 4CKRA 3BHTA 1OIYA 3AT2A 4DINA 4L7FA 4QT1A 3PZHA 1KOAA 4QP8A 4O91A 4FSQA 4CZUA 3EQFA 2XJ0A 3Q4TA 3DTCA 4IWOA 2A4LA 2XK7A 2QHMA 1PMEA 2UW5A 3KRXA 4QYFA 5I9YA 2GCDA 2UZEA 5E90A 3ACJA 5HTBA 4Y5HA 2OSCA 3MFSA 4FZDB 3AC1A 4K18A 2I7QA 1QPDA 2W9ZB 5AP2A 4CZTA 4TYHB 1PXOA 2WMRA 3C0IA 5GZ9A 4EOSA 2J50A 4JRVA 3IW5A 4BWKA 3PPJA 2PVYA 3KA0A 5L6WL 4GU9A 1U5QA 3EHAA 3ZZWA 4ZY5A 2XAMA 2WQNA 4MWHA 4J97A 3SV0A 3R0TA 2J6MA 3CP9A 4S31A 4O7WA 3U54A 3OWPA 4ASDA 5KBQA 4JIKA 2C5NA 3PJ2A 3B8RA 3BRBA 4FNXA 5IQEA 3F5GA 1U5RA 3MTLA 5CAPA 2A2AA 2ZAZA 2XK4A 2W4JA 1WBNA 1QCFA 1QPJA 2VO0A 4FV4A 1FQ1B 3VQUA 3W33A 5C9CA 2B55A 5AR5A 5K5XA 4I5HA 3MA3A 4WNOA 3UO4A 3QAME 5HTIA 3SG9A 1JAMA 4J71A 5IPJA 5L2WA 4JNWA 5C4LA 4C62A 4NWMA 2UVYA 1WVWA 3CQUA 4ZSGA 3GGFA 2WQBA 3H9OA 4KD1A 4KBCA 2ITZA 4LUDA 5FD2A 3VUIA 5T6KA 4IZAA 2IW8A 3PLSA 3QQJA 4QYYA 2IO6A 5AEPA 2ZB0A 4UALA 3TKIA 2R7BA 3ZM4A 3R83A 2CKEA 4MXAA 3E7OA 3NSZA 5J95A 3WILA 5JFSA 4DYMA 2YM3A 2C0IA 3LQ5A 3QRKA 3NNXA 4V01A 2J4ZA 4DFNA 5AAGA 4K0YA 1UKHA 5AR7A 3TI1A 4ENYA 2X6EA 4U45A 4YZBA 4ZJVA 5HTCA 1J7LA 2CNQA 2YJSA 1VYZA 4TTHB 4QYEA 3TM0A 4FEQA 1YW2A 4O21A 3ORXA 4AZFA 2Y0AA 3KXNA 3COHA 3RALA 5E1SA 2ETMA 1OECA 1OUKA 2IF8A 2W1ZA 5JFXA 4FIJA 5J5SA 2IZRA 4FTJA 4QQJA 2JITA 3HA6A 4PY1A 5M4FA 5KMKA 5H9BA 2GS7A 2WTKB 2BHHA 2JC6A 5LMAA 2Z7LA 5CSHA 5FQDC 4NZWB 5C1QB 2XK9A 2YN8A 3RPVA 5AP3A 4XUFA 4ALWA 5J5TA 4QO9A 5FXQA 4JIAA 4MWIA 3KXXA 3S2PA 4Y5QA 3TUBA 3G51A 4F7JA 3OT3A 4CT1A 4RX7A 5FM3A 1H27A 2XKFA 4AZTA 3AC4A 3UNZA 3LXNA 1GIHA 3FXXA 2OO8X 4FKRA 4U44A 4I3ZA 1ZYJA 5CVFA 1SMHA 2YFXA 3ORTA 4FG8A 3QA0A 5A4QA 3S0OA 3P7BA 3KXGA 4I5CA 1SYKA 1PXMA 4J95A 5A9UA 2XJ1A 2Y8OA 4YZNA 3HVCA 3T9TA 5HU9A 3MFUA 3A61A 2PVFA 5I0BA 1J7UA 3KL8A 1OL6A 5BX0A 2PK9A 4GVJA 4IADA 4QP9A 2FH9A 4G17A 4FNWA 4WRGA 2C3LA 5AR3A 1VYWA 2AC5A 2NRUA 2ITXA 5CEKA 5IA1A 3NNVA 3CKXA 1SM2A 4OTHA 4FSMA 4WIHA 3V5JA 2J2IB 4LGDA 1I44A 1M52A 1RJBA 4MXYA 3D9VA 3UOKA 4KIKB 2W5BA 4JDJA 4OTDA 4TRLA 3RZBA 5M53A 4O86A 5DRBA 2XYNA 2ITWA 5KZIA 4AFEA 3R22A 4LFIA 4BJJB 3P7CA 4EHVA 5ANGA 4ZSAA 3F2RA 2JKOA 5E4HA 1WVYA 3TZMA 3P7AA 5FGKA 3UBDA 4XV1A 4IX5A 3QRTA 3ZFYA 2QKWB 2R3GA 4FT7A 3G33A 4XCUA 2XKEA 3PTGA 4AA0A 3Q52A 2GQGA 5FG8A 5DGZA 4YGAA 3QTWA 3UOLA 4DEAA 3PPKA 2O8YA 4N0SA 2CKPA 3R00A 3UIBA 3TACA 4HCUA 4EL9A 2J0IA 1OPKA 2JIVA 2C1AA 3I5NA 5JZJA 3DNEA 3QLFA 5C8NA 4DFBA 3GFWA 4OBOA 4F6WA 4PPAA 3C13A 4ANOA 1BL6A 2UZNA 4HPUE 3ID6C 4DHJA 5CT7A 4FSRA 5IMXA 2W1FA 1U59A 4FV2A 4AGWA 2XK6A 4XG3A 4C35A 4EBWA 4OAVB 4EQCA 1Y8GA 4YJSA 2R0IA 3FMJA 3NPCA 3QTSA 3EQPA 4MTAA 5GIPE 4WSQA 4XBUA 1YXUA 3R8PA 4GUEA 3GCSA 4UWYA 2A1AB 2EXMA 4ZIMA 4YU2A 4UB7A 3TCPA 4JJRA 2C5XA 2WIHA 2F7ZE 3P0MA 4YP8A 4EQMA 3Q9XA 4M68A 2J0KA 2OWBA 4M84A 1LUFA 3AD5A 3BLQA 2BCJA 4IAAA 4PPBA 4G9CA 3ZO1A 1J1CA 2C5VA 3P4KA 3PSCA 4PMSA 5IA4A 4CCBA 4QQCA 2YZLA 2XM8A 3DTWA 3O50A 4JBPA 1BUHA 2WFYA 4BYJA 2NNWB 4YO4A 3ULIA 3Q6UA 3KRLA 4YZDA 3QBNA 4AXAA 4E20A 2JKMA 4AGCA 2OH4A 3DCVA 4FTKA 5EM7A 4RC4A 4DDGA 4NCTC 3R7OA 3QCSA 4QMNA 1A9UA 3H4JA 4IVCA 3DZQA 2QI8A 3RK7A 4C0TA 3BU5A 4WUNA 4R3PA 1REJA 3DK6A 3VBTA 4M12A 3U6JA 5LVOA 1UWJA 3BLHA 3NW7A 4TYEA 2VV9A 1UWHA 2YIYA 4GFMA 1OBDA 5K0KA 4EOMA 4FOCA 3RM6A 1V0OA 2X7FA 2PUUA 4KWPA 3EFLA 1PY5A 1ZMUA 4RFYA 3RGFA 3G6HA 1PRYA 4JDIA 4BDCA 4YJNA 4F1TA 4ID7A 3BYOA 3QQLA 2JIIA 3EQIA 4MK0A 3QD0A 5AFVA 4IZ5A 1HOWA 4AE6A 2VN9A 2B53A 5TOZA 4L44A 3MW1A 3DJ7A 4IB0A 2OZAB 4J1RA 1M2RA 2IEWA 4LQMA 3GFEA 4M0ZA 4AW1A 4GKHA 1FMOE 4YR8A 2WQOA 3MDYA 3A7GA 5F94A 5DT4A 1ZOEA 3MGYA 3R1YA 5EQPA 5T3QA 2YCRA 4MH7A 3KN5A 5CY3A 2WMWA 3LM0A 2E9PA 2YIQA 4X3JA 3FLQA 4IZYA 3AKLA 3GC8A 5IEXA 4IB3A 4RFMA 3ZU7A 3ZDUA 2CGVA 3FC1X 3HMNA 2BVAA 2QCSA 2R7IA 3L9PA 5L8JA 4Y85A 4I0SA 4GMYA 3RK5A 2BMCA 3UC3A 4OTPA 3IK3A 3I6UA 3RINA 3F3TA 4ZY4A 3OWLA 1ZY4A 3FZPA 3NCGA 2ZOQA 3E64A 4D9UA 5HNIX 2Z60A 5IQGA 1JVPP 3EN6A 3VVHA 4A4XA 4NTTA 3PJCA 3JY0A 4ZTSA 5HIBA 3OWJA 4HZRA 5AIKA 5DA3A 5BMMA 1JBPE 4EEVA 4X2JA 4WA9A 1CKJA 1W0XC 3COIA 3Q9YA 4O4DA 5CSVA 3TIYA 3WZKA 4D58A 5LQFA 3TTJA 3WZUA 2ITYA 4QMWA 2YERA 3PY1A 2OXDA 1YI3A 2CGWA 4PL3A 4IBMA 4XMOA 4BGGA 2ACXA 5CEIA 4PTGA 4YNOA 3EL7A 3QC4A 1PMNA 1Y6BA 2UW4A 3KXMA 4DTBA 2OG8A 3D5VA 3IDCA 3AT3A 3OTVA 4YJOA 4DBXA 4NM3A 3THBA 3VF8A 4IANA 4J99A 3KIOC 1UU8A 5AP1A 4YPSA 3HMOA 4L8MA 4DEHA 1PYXA 4FV5A 4XOZA 5HX6A 4GKIA 5IQFA 4AU8A 3U4UA 4A9SA 2I6LA 4QPAA 3OEZA 3BL9A 3D7ZA 5EOLA 4BFMA 5EK7A 2QQ7A 2VWVA 1GZKA 3CQWA 1JKSA 4FZ6A 4QMQA 4RSSA 4I6FA 1YKRA 2R3LA 2YA9A 4K2RA 4M0YA 4TWCA 1H0VA 2AYPA 2X0QA 1XJDA 4USFA 4GG7A 5J7BA 3FAAA 4KKHA 4PTCA 1MRYA 4I6BA 4FIGA 3BWFA 3HECA 4FTMA 4LG4A 4AZSA 2EXEA 3IW6A 3O17A 4Y46A 3KGAA 2YM8A 4NSTA 4RA5A 5DVRA 3UGCA 4EH6A 4OTIA 4E7WA 2PULA 2GNHA 3RPRA 4CKIA 3L8XA 4IAZA 4PNIA 4B6LA 4R1YA 3DDQA 3PA3A 2PVNA 4JS8A 4EQUA 3LCSA 3W1FA 4N6ZA 2HXLA 2ITNA 3KEXA 4CYIA 1V0BA 2J7TA 3KK8A 4FVQA 5DG5A 5TR6A 3EIDA 3FMDA 3ANRA 4CV8A 3W2PA 2HCKA 4X6QC 4V0GA 3LLTA 1ND4A 2ERZE 5I5ZA 2X0PA 3KY2A 1CMKE 3ZO3A 4Y83A 2C6IA 5CLPA 4AN2A 3KK9A 3HRCA 3HYHA 4GL9A 3I6WA 4D0WA 3TNPC 3U87A 1W84A 2PE1A 4OBPA 3RWPA 2WD1A 4UMRA 2OIQA 1CDKA 4PV0A 3HX4A 4BWXA 4DEBA 4RG0A 4R77A 4HZSA 1MRVA 3FLYA 4MX9A 5HG5A 4FODA 5JFWA 3PVUA 3L1SA 3EQHA 3TNQB 2XNMA 2QURA 3UPZA 1YOMA 4LOOA 2BRHA 2AQXA 3GQIA 3PWYA 5CTPA 4M97A 5AR4A 2YHVA 3KN6A 4O27B 3WZDA 4IWDA 3BV2A 4NKSA 5CASA 4L42A 2W5HA 4QMUA 3F6XA 3ACKA 2I0YA 5B2KA 2BRMA 3V8WA 2RFNA 3VC4A 4E3CA 3CD3A 3UYSA 2WTDA 5D9HA 4ZTLA 2BZJA 2VWUA 3KMUA 4KUJA 4YPDA 3FZTA 2RFDA 1KSWA 3TUDA 4JOAA 3R63A 4GVAA 4ALVA 3HAVA 2CKQA 5FUTA 4EHEA 3TIZA 3GU5A 4GT4A 5KZ0A 2JDVA 5IUIA 4BI1A 4YJVA 5ETIA 5KCVA 2X8DA 4PMTA 1ZZ2A 3NIEA 3NUNA 4ACHA 3W0PA 5CF4A 3UMWA 1H25A 1H01A 4F64A 4U6RA 2R2PA 2QU5A 2CCIA 1Q3WA 2X39A 3E8DA 3DAEA 4LGGA 3UTOA 3PLAE 4KNBA 4FI1A 4EH4A 3EFKA 2W99B 1ZMVA 3R7YA 1Y6AA 3HAMA 4F6UA 3LQ8A 4MNEB 4J53A 5CI6A 5L4QA 1OVEA 3H0ZA 3ZRMA 3CPBA 2VD5A 4BGHA 3I1AA 4ZZNA 3QTXA 1XMMA 2VWXA 5AV4A 4NKAA 3Q4CA 4O0XA 3R9HA 5HOAA 3BU3A 2BRBA 3EQRA 2XKDA 5KMNA 5DT3A 3LQ3A 1WBPA 3MVJA 2HXQA 3QUEA 4FSWA 4BDEA 4Z9LA 3RAKA 4G6NA 4CFUA 4GJ3A 3HV4A 3WZJA 4O7LA 1LEWA 2FSLX 2GHLA 3JPVA 4AT5A 5J87A 3CLYA 4F0FA 2GHMA 4O0VA 3E7VA 2ZMDA 1M7NA 5D1JA 5DNRA 4C4EA 4D5HA 5HG7A 2OLCA 1AGWA 2HAKA 2VUWA 3QXOA 5F9EA 3MI9A 5EOBA 4QTDA 4BDGA 1WVXA 3N4UA 3NMUF 3MH3A 4XP3A 1E1XA 2C3KA 4RIWB 4RT7A 3ZLSA 3V51A 4EOQA 4O7ZA 1DI9A 3W8QA 1DS5A 3DKGA 4PPCA 2IZTA 2PUNA 5A4CA 3KF7A 2X6DA 3CTJA 4F9CA 2WNTA 3S00A 2QO7A 1Q99A 2X8IA 3ORLA 4U3YA 3M1SA 4UYAA 5M4CA 4JQ7A 2PTKA 3G15A 4TL0A 2WMTA 5DPVA 4U3ZA 4FEUA 3VS2A 4KSQA 5CU2A 4MBLA 3KRRA 4FKUA 3ZO2A 3R9RA 4H36A 3KULA 2X7OA 2YIRA 1GJOA 4Q9ZA 3ZEWA 4ORKA 3FY2A 4QMZA 4WNKA 3DOGA 4E93A 2XIXA 4BDKA 3W0RA 1R78A 1G8KA 2V22A 1TFFA 5EG3A 4RIYB 1JKTA 3NDMA 4C34A 3TKHA 4NM7A 4L6QA 4QRCA 4ZP5A 4DGMA 4E4MA 3MFTA 2PZ5A 3VF9A 3GU8A 5HVKA 1Q62A 4S32A 4M66A 4KS7A 3UZPA 4FJVA 2X8EA 3I7CA 5E8YA 3UO5A 4J7BA 4EH2A 4R8QA 1OIRA 4IM3A 3SG8A 3NW6A 3SXSA 5EI2A 4FV9A 4D5KA 3B2WA 4RVTA 4E6QA 3UDZA 3ZONA 3E5AA 4MD7E 3WE8A 4HVSA 5BMSA 3CTQA 1IRKA 1QPEA 5G6VA 2XCHA 3KFAA 5HCXA 3WBLA 3I0QA 2PZYA 4RFZA 4DHZA 1ZXEA 3C0GA 4QMYA 3PSBA 3A2CA 5IQIA 2OJGA 1DAWA 4FIFA 5TE0A 2FSOX 4GIIA 2B9HA 4UXQA 3A4PA 3E3BX 1VJYA 4H1JA 2J0JA 3Q53A 4F70A 5ACBC 5DLSA 3DA6A 1JKKA 3QHWA 5EHYA 3WARA 4BCPA 3GUBA 3NS9A 1KE9A 3OD6X 3NYNA 4O0RA 1ZLTA 1JSUA 5FXSA 4BDBA 5D7AA 4ZLZA 4IVBA 1G8AA 2YWVA 2IVTA 4UMQA 1GZ8A 2XZSA 4X2KA 5ANJA 1KV2A 4CRLA 1YDTE 4KRDA 4G3FA 4CV9A 4YTFA 3CTHA 4BBFA 4UMPA 3D94A 4XG4A 3DY7A 3TDWA 3DS6A 4O81A 3PXQA 5BVKA 3UDSA 1FMKA 2QR7A 3NYOA 3UOHA 3HKOA 3NNUA 1ERKA 4S2ZA 4UYNA 2XUUA 5CNNA 3ZBFA 5A4LA 5AUTA 4BTJA 5LJJA 3ITZA 2HIWA 4HGSA 5M44A 3POOA 3LXPA 4AFJA 3U4WA 4FA2A 4DA5A 2DS1A