3E3PA

Glycogen synthase kinase from leishmania major
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
337
Chain Sequence
AAADERSRKEMDRFQVEVQLGKEKSTGMSVAIKKVIQDPRFRNRELQIMQDLAVLHHPNIVQLQSYFYTLGERDRRDIYLNVVMEYVPDTLHRCCRNYYRRQVAPPPILIKVFLFQLIRSIGCLHLPSVNVCHRDIKPHNVLVNEADGTLKLCDFGSAKKLSPSEPNVAYICSRYYRAPELIFGNQHYTTAVDIWSVGCIFAEMMLGEPIFRGDNSAGQLHEIVRVLGCPSREVLRKLNPSHTDVDLYNSKGIPWSNVFSDHSLKDAKEAYDLLSALLQYLPEERMKPYEALCHPYFDELHDPATKLPNNKDLPEDLFRFLPNEIEVMSEAQKAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase, putative Glycogen synthase kinase
publication title Glycogen synthase kinase from Leishmania major
rcsb
source organism Leishmania major
molecule tags Transferase
total genus 107
structure length 337
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e3pA01
5IH6A 3V51A 4CFXA 1WMKA 3VS4A 5TKDA 4BDCA 2ZJWA 4BFMA 4MNFA 3R0TA 4ASDA 4E6QA 3TNWA 4A9RA 2W1GA 4IB1A 4RX5A 5CEOA 4LGGA 5HORA 3VS1A 3UC4A 4XBRA 3LQ3A 3OWPA 3OROA 4TYHA 5EK7A 4ZJJA 4EH6A 3C4WA 5IPJA 4JIAA 4DEDA 3EFKA 3QHRA 3FY2A 2BRHA 2R3HA 4FOCA 2UV2A 5IG1A 4QMZA 4K6ZA 3SXRA 2WIPA 3AC1A 4JDKA 4FV8A 4L3PA 4CRSA 3ZRMA 3BV3A 4J8MA 4RJ6A 3BHTA 1OIQA 3CP9A 3REPA 2WMRA 4IWDA 2OK1A 3L8VA 3DZOA 4DFUA 1FQ1B 2WU7A 4FV4A 4MTAA 4DA5A 3PTGA 5AR5A 5EW3A 3GU5A 3LJ1A 4FV0A 5F94A 1YWVA 3U4WA 4GKIA 3BI6A 1YDRE 2EB2A 3FKNA 4OTGA 4DTAA 4PPAA 2B53A 5FBOA 4U3ZA 5M07A 2RKUA 3EQDA 3LKMA 4WNOA 3FLZA 3VUDA 5I9WA 4NEUA 4M68A 2VTOA 4FKTA 4MXCA 1PMNA 2H34A 2P4IA 3UOHA 4F0IA 3OWLA 3PVUA 3R1QA 4FK6A 3UVQA 5L6OA 3QUDA 3GU7A 4QTBA 2WFYA 4P90A 5M53A 4G3FA 5E4HA 3OXTA 1OIUA 4EOJA 4JNWA 3PLSA 4JBPA 3GQIA 4QYGA 4I41A 4RG0A 4ZY6A 3EQPA 3RWQA 5E91A 5AV3A 4BI0A 2XIYA 3N4UA 1H28A 1OKYA 2FYSA 2QCSA 4FV7A 2OZAA 4C34A 2J5FA 5GNKA 5BVEA 1KE9A 4J71A 4EZ5A 5I9ZA 1O9UA 3CPCA 4NM0A 4O7ZA 2C3IB 1X8BA 3E3PA 1SMHA 2CGXA 3GI3A 4X6QC 4I5HA 4FKQA 2KULA 3C9WA 2C0OA 3R04A 3ALOA 4FV1A 4GYIA 3F6XA 4JRNA 4RWJA 4TYJA 4GCJA 4XG9A 4AGCA 3LMGA 3A8XA 4TXCA 2VTHA 4DEGA 3HV4A 5L2QA 4L6QA 4QNYA 1V1KA 2VU3A 3RM7A 3EYHA 4HCTA 3GC8A 3TV7A 3HMIA 4AAAA 5JZNA 4BTMA 3DZQA 4J95A 3VBVA 4FV9A 2WXVA 1K2PA 5KKRB 1G8SA 2XH5A 1BYGA 4AE9A 1Q24A 3K3JA 3CTJA 3QD4A 5EKOA 4DBXA 1XBAA 3UQGA 3MJ1A 5BUJA 2OO8X 3ENMA 3FLWA 4MXXA 5LMAA 5IUHA 1Q8WA 4JQ8A 3QUPA 4MEDA 5BYZA 3C4ZA 3H4JA 3LFAA 3HA8A 4W9XA 4ENXA 3MTLA 5EM8A 3HMOA 3QTXA 3IW4A 4RIYB 2P2IA 4JIKA 4AA0A 2YERA 3FKOA 1FOTA 1MP8A 4DH7A 3W2PA 2PTKA 3ZLSA 3Q32A 1OPKA 3UIBA 5AR2A 3AC4A 1VR2A 5A4CA 2BHHA 4DBNA 3BQRA 5FWKK 3HUBA 4E73A 2XS0A 5CALA 5HG9A 3NWWA 5BUIA 1M2RA 2ERKA 1YDSE 3AXWA 3LFFA 5JH6A 3COHA 3DFAA 3SRVA 2E9VA 4IDVA 3MFUA 3RP9A 5AIKA 4KBCA 4AGUA 2PVYA 4BCQA 4MD9E 2R3RA 5K5NA 4O83A 2FUMA 3N9XA 2RG5A 1B38A 3MFSA 3LW0A 4BDDA 3ANQA 3PVBA 4RX9A 2JGZA 4ERKA 3IGGA 4PMMA 3R7VA 4IM2A 4EQMA 4X2NA 5AAFA 3NZ0A 2BR1A 1W83A 1KE6A 3ZC6A 1Q41A 4MXAA 5CNOA 5B7VA 2RFSA 5CENA 3F2AA 4IAYA 3W2QA 3GBZA 4G3CA 4M69A 2CNVA 4V04A 5H3QA 1YI6A 4BBEA 5KBQA 2QOIA 2QODA 3NMUF 4E4LA 2XNGA 4FT5A 2V7OA 1QPJA 4MBJA 4FL1A 3UGCA 3G15A 4FV6A 5A4TA 4K1BA 5C4LA 2C5NA 3OTVA 5EKNA 1AGWA 2BPMA 2IWIA 2XBAA 1KV1A 4FSRA 4A9TA 3BCEA 3WE4A 4F7SA 4QP8A 5AV4A 3TUCA 4R1VA 5GZ8A 3C4FA 3DXQA 2R3KA 4FKSA 4I6HA 5L6PA 3G0FA 2DYLA 4AOIA 4MXYA 2XKCA 3KRXA 3DB6A 4I5MA 2HXLA 5FLFA 4RFZA 2XM8A 3MS9A 4DGLC 4ACGA 3OHTA 4JVGA 3PY1A 3IW8A 3F3VA 4XJ0A 3UPXA 4IM0A 4CLJA 5IMEA 1WVYA 4YHJA 3QTQA 3QZFA 4FSWA 5HG5A 1WBOA 2E9UA 4XP2A 4Z55A 3OCBA 4O6LA 5HO6A 4WRGA 3TIYA 4AACA 4D2SA 3V01A 4CYJA 4F70A 2UZUE 2QO7A 1JNKA 1NVQA 4I5PA 4L01A 3ZC5A 4EKKA 4OAUC 2YCFA 4UZDA 5EHYA 3UTOA 3E63A 3ORLA 4QQTA 4YZBA 4BYIA 2E9NA 2QOKA 2C6EA 2ETMA 3ZFXA 3ZM9A 4BTFA 4DG2E 1PF8A 1YVJA 4P2KA 4W9WA 3R2BA 4AP7A 3DNDA 4CFVA 4I6QA 1DS5A 1U46A 3LXLA 3PP1A 1SVHA 5DG5A 3GFEA 1J7IA 4LG4A 1J7UA 4FT7A 5KZ0A 2VRXA 4IX4A 3MIYA 4I23A 2JDSA 3UNKA 4YLJA 2W5BA 1NW1A 2XYUA 4Z9LA 5JQ8A 2VTSA 4RQKA 4GT4A 2X1NA 4EL9A 3ERKA 2XK8A 5AP6A 4IBMA 3THBA 3V5QA 2PVLA 2W1EA 4MNEB 1DI9A 4PP9A 4EOQA 4ANBA 2CNQA 3Q52A 1UWJA 3HL7A 3PE1A 3HGKA 4QP6A 1KOAA 5HU9A 4HGTA 4BDFA 2G9XA 2QC6A 2R7BA 3KMWA 4FIHA 3MGYA 3BU6A 3NNWA 4A4LA 4CZTA 4F9WA 3MN3A 2F7XE 4GG7A 4ZOGA 4L42A 4AN9A 2BTRA 2FSTX 2UW4A 4IZAA 2JKQA 4FTJA 4BDGA 4EYMA 4USFA 4NYEA 2XK6A 4WNMA 2R3NA 4ACDA 3NUSA 4HZRA 5L2SA 3O23A 1H1QA 4BKZA 2BZKB 4M15A 4EK4A 5A46A 4CQGA 1Q3DA 4YJSA 4G31A 5M4UA 4DCAA 1XBBA 4PDOA 5E1SA 3A4OX 4FG7A 3KCFA 3BGQA 1H24A 3QD2B 3FZOA 5BYYA 1YWNA 2PMNX 2X8IA 2XIZA 3ALNA 1YXTA 1UVRA 3QQLA 3VBWA 2F57A 3AD4A 4WT6A 1JPAA 3WZUA 4AW0A 2OGVA 4CFMA 3QKKA 3VO3A 4QP9A 3BYVA 3JUHA 2XK3A 4F99A 1IR3A 3WF6A 5J1VA 3R22A 5ANDA 5G1XA 4BI2A 4ZLYA 4R78A 4GH2A 3UC3A 1A06A 3UBDA 3CGOA 2XJ1A 4X2KA 4ZSEA 4IX6A 2VWYA 4G3DA 4MAOA 1LP4A 4YLLA 2JDVA 5K5XA 5B0XA 5T68A 1PMUA 3PYYA 1BI8A 3TNQB 4HVSA 3JR1A 4YR8A 4JJRA 4FX3A 5HCXA 1M2QA 3F5PA 3IDPA 3JPVA 4EHGA 4YPSA 2BTSA 4NCTA 4EOMA 3E87A 3GFWA 3TUBA 4LRJA 3AC8A 3GQLA 5AMNA 3DKCA 4D2RA 5A6NA 5K0KA 3LFBA 1B39A 4NW5A 4CXAA 1PMEA 4Y73A 5AUTA 3BHVA 4FKRA 1PYEA 1PYXA 3FWQA 3GNIB 4JR3A 3KU2A 3VC4A 3SW7A 1MRVA 5HKMA 3SKCA 2X7FA 2PVFA 4TYIA 4W8DA 2YDIA 2BILB 3MVMA 4BIDA 4AZVA 4XCUA 4CT2A 5J9YA 4BDJA 4JDHA 3UIUA 5E1EA 4ORKA 2YM8A 3IS5A 4GK3A 4HYHA 4M0YA 4PWNA 4HPUE 3KKVA 2CN8A 4JG6A 2J0LA 1PXLA 1JKTA 2XK9A 4UXLA 1RE8A 3QKLA 4WA9A 5B2MA 2Y9QA 1F3MC 2OIBA 4BDHA 3R8MA 1GY3A 3DOGA 4A06A 3I4BA 4LGHA 5E8WA 1YRPA 2HWPA 3RM6A 3RNIA 3FL4A 2DS1A 3H3CA 4XRLA 1SZMA 4O0TA 3GGFA 1OL6A 5CXZA 3GCPA 4QYEA 1XHAA 4LMUA 2VD5A 4LOOA 2Y6OA 3RK9A 2YJSA 4TY1A 3FMLA 4V01A 3OC1A 3ZDUA 1M14A 3Q04A 1JAMA 4PDYA 1TQPA 4FT3A 5I3OA 3I79A 3TACA 5AX9A 2VTTA 2JDTA 2GNHA 3BGPA 2XNPA 1OZ1A 4C38A 4Y83A 1IASA 3R83A 3K5UA 3MPTA 4APPA 3QTIA 3ROCA 2P33A 2ZM1A 3DB8A 3LXNA 3O8PA 3VJOA 4DFBA 2C1AA 4GK4A 4KD1A 2ITTA 1M2PA 5AX3A 4ZZNA 3LM0A 2PPQA 2YA9A 3MPAA 3DTWA 4EJNA 4DFYA 5KMKA 5CI7A 2VTIA 4LMNA 2ESMA 3WZJA 2E2BA 5FEQA 5CYIA 5EG3A 5AA9A 2XB7A 2H6DA 2CLXA 3UE4A 1E1XA 2C6LA 2ZV8A 2IN6A 3NYOA 2GNGA 2C1BA 3VWAA 2JD5A 2WTWA 4H39A 3VUKA 3G90X 5E8YA 3DJ6A 1ZAOA 4RT7A 4QMXA 3RKBA 4FVPA 5E9EA 4UBAA 3NEWA 4IIRA 3MB6A 4FYOA 3ZRKA 1MRUA 3KULA 3NNVA 2WTIA 4GU6A 1S9IA 4HCVA 4TNBA 4YJRA 2QOBA 1IA9A 1JKKA 1NA7A 5A9UA 3C13A 3FQSA 4YJUA 4F09A 4WHZA 5DFPA 4GKHA 2WMTA 2BFYA 3W8QA 3QCYA 3FZTA 4UN0C 4FTUA 5CT7A 5DR2A 3TXOA 3W2SA 2Z2WA 3VNTA 3CTHA 1HCLA 4HVDA 4M66A 3BKBA 4GFOA 4IX3A 1NT2A 4JAJA 4U40A 5EHLA 4KRCA 5E8SA 4AN2A 3AG9A 2BRGA 4AZTA 4QMNA 3R7IA 1OL7A 2JFMA 5GZAA 5DRDA 4RVLA 4B9DA 4PL4A 2JKOA 4OT6A 2JLDA 3LFDA 4OW8A 4I3ZA 2VWIA 2XNEA 4QP7A 3MW1A 4GFGA 1OPLA 3ELJA 3L9PA 4H3PA 4IAAA 2UZTA 4FV2A 5TF9A 4QQCA 5EM6A 4FL2A 3LCDA 5K0XA 5E90A 1CKJA 3AQVA 3D15A 2QR8A 5HICA 4OAVB 3MBLA 4BDAA 1XKKA 4C35A 1H25A 4NZWB 3VS5A 3QXPA 4UWYA 3CD3A 2VNWA 3H9FA 2JAMA 5LMBA 3HKOA 3OXIA 4K18A 2IW8A 2XKEA 5C4KA 2YWPA 5AUVA 5J79A 4BB4A 4DGMA 3EOCA 4BCJA 4JAIA 2B4SB 2QOCA 4CMTA 1ZYLA 5DOSA 5DN3A 5H9BA 2I6LA 3NCGA 4XG4A 3ROYA 3FKLA 1W82A 4A4XA 3SOCA 3TV6A 2ZB0A 1R0EA 4C36A 4BCNA 4D4RA 3PWDA 5CSVA 4KUJA 2PUUA 4V0GA 5ETIA 3KXMA 2OFVA 3LCKA 4ZTNA 2ACXA 4H1MA 4L7SA 3R9RA 4E6CA 4YJOA 5HD7A 1XH6A 2QI8A 5KZIA 1OGUA 2GTMA 3M1SA 3G33A 2B55A 2BMCA 4S32A 5DEYA 2ITVA 4XMOA 4O7LA 4WSYA 3SAYA 4C4GA 2V5QA 4RWLA 3VUIA 3C0GA 3QQGA 4L8MA 4FUXA 5HE2A 3WIKA 2WNTA 3QCXA 4AFEA 1OPJA 1V0OA 4O38A 3UP7A 2BKZA 5DI1A 5HX8A 3GUBA 3BBTB 2W4JA 5J8IA 2B9FA 3GP0A 3PY3A 3HMMA 2CMWA 4H3BA 4QMWA 4YTCA 1OKWA 3RPYA 4DC2A 3VUHA 3OMVA 4EOPA 5CF6A 5AAEA 4RC2A 2XUUA 3POZA 2UZBA 4EH3A 5D1JA 3ZLYA 1SYKA 3KMUA 3QYZA 2HYYA 2WHBA 3QQUA 4S31A 2YITA 1KE5A 4FZDB 2R2PA 3TJDA 4AT4A 3Q2JA 1UU9A 4YC3A 4ZSLA 4BGQA 4FTTA 2YN8A 4D58A 2R3MA 2AYPA 4BICA 3RCDA 3WZEA 3LJ0A 4HVIA 4MH7A 5KMMA 4FIIA 3DDPA 5HE1A 4EZ7A 2WTKC 5LQFA 4NT4A 5KMOA 4QTEA 4AOTA 5DEWA 1J1BA 3O51A 4O81A 1PXMA 1OBGA 1OI9A 4RX8A 4R7BA 3MPMA 3PXFA 3E93A 4E6DA 4FTMA 2UW0A 3PIXA 2OJFE 3QC4A 4C3FA 2QO2A 4QYYA 5FGKA 3COMA 4XLVA 5TE0A 5HESA 1DI8A 2RL5A 3R28A 3NW7A 4FTAA 4IB0A 3DAKA 4YZNA 5CTPA 4I0SA 1PRYA 4AZSA 3NPCA 4QYHA 2UZLA 5HLNA 2UW6A 4NFMA 4DFXE 4UALA 4O0RA 4RIXA 5ETCA 3EFLA 4UWBA 5HNBA 1YHSA 4KSPA 4C61A 3OFMA 4OLIA 2X2KA 3P78A 4A9YA 2HW6A 3LQ8A 5AA8A 5CSXA 3MH2A 2A27A 4G6OA 4RA4A 3ZSIA 4XHKB 4MCVA 2REIA 2HZIA 1WVWA 3LMHA 4R7HA 1JOWB 5F20A 3MWUA 3FSKA 3M42A 2Y4IC 1R78A 2XNNA 3AD5A 2A4LA 4EKLA 4UMTA 4RA5A 2QKRA 4UMQA 4LL0A 1IEPA 3CPBA 2OIDA 4EH2A 3BE9A 4FTLA 2JIIA 2VTPA 5AEPA 1IAHA 5JRQA 2UW8A 5EH0A 4F7JA 4X2JA 5D41A 3RGFA 4RZWA 3OF0A 4UYAA 2G1TA 4HVHA 2B0QA 3MH3A 3FQHA 3POOA 3QQFA 4FKIA 2G2HA 3D94A 4KKEA 1TQIA 3FMJA 3QWJA 5D12A 2ONLA 2X2LA 3F5XA 4YBJA 5L8KA 2GS7A 3B2WA 4RLLA 2PZPA 3KY2A 1Q61A 4BRXA 3SG8A 3V6SA 1PXIA 3LAUA 3TJCA 2YEXA 3ZDIA 4H05A 4FZAB 2OFUA 4KKGA 1ZY5A 4D2TA 5M4FA 3W8LA 2BAKA 3ZTXA 4ZSAA 3VJNA 2Q0BA 2QD9A 3F69A 4PMTA 4XG7A 3VS3A 4C33A 4DH8A 5FQDC 3OOMA 3AT3A 5HGIA 3DNEA 4AGDA 4BL1A 3IONA 3DK7A 3NS9A 3PXKA 4LL5A 4QMOA 4RJ7A 5IEVA 4RFMA 2XNMA 1H00A 3BYOA 4HYUA 3LFSA 4ID7A 4XV3A 3GXLA 4NK9A 1Y6BA 2IZSA 3HUCA 2I0VA 4E5AX 2VO6A 3DCVA 4I4EA 3S95A 2CN5A 4IC7A 4DEAA 2H9VA 4ZZOA 4RRVA 3F7ZA 3HRCA 5I3RA 5J7HA 3Q3BA 3ZS5A 1Q62A 4K2RA 3JVRA 3O2MA 2C6DA 4QPAA 5L3AA 3ATTA 4MXOA 4ITHA 4Y46A 2BVAA 5HVJA 2YLEA 4AN3A 1HOWA 3OOGA 4RGJA 5KE0A 4FR4A 3MB7A 4WD5A 3I81A 3EQIA 4CTBA 4GIIA 5HIDA 2WU6A 5CY3A 1J91A 4AZEA 1URCA 4PTGA 4D2VA 1GIIA 4I6FA 4FIGA 4GMYA 4UV0A 3T3UA 4FSNA 3FDNA 2EXCX 3FJQE 4U97A 4EQUA 5CU2A 3ZO2A 4O7VA 5EQYA 4WUAA 5FEEA 4F4PA 5TT7A 2B54A 2R0UA 4I1ZA 3MIAA 2JDRA 1SNXA 3GB2A 2RFNA 4TWNA 1MUOA 4TKSA 3AMYA 3EZRA 4KIKB 2FA2A 3OZ6A 3TZMA 2PUIA 5D10A 1J1CA 4JDJA 4YZDA 2BZJA 2O3PA 2NPQA 3QAME 1NY3A 3EKNA 5DT3A 3UOKA 2FSMX 5HIBA 3F88A 5EQEA 4M67A 3VS0A 1R3CA 4RIYA 3WZKA 4YSJA 2HXQA 4U44A 4ZTRA 3L9NA 3NUUA 4ZMEA 2Z7LA 3U6IA 3PIYA 4HGLA 3ULIA 5LMKA 2W1FA 4D28A 4MQ1A 5IA4A 3QZGA 4OTRA 3QFVA 4LOQA 2HY0A 3C7QA 3FLQA 5BVOA 1Y8YA 2HELA 1JVPP 3QU0A 5A6OA 3CIKA 4CMUA 4AOJA 3R63A 3EN4A 1OUYA 3BBWA 3JVSA 2OF2A 4Y5QA 2JKKA 5LCJA 1ZMUA 3NYXA 3Q4CA 4R3PA 5E8ZA 5F9EA 2CJMA 3P9JA 3ZZWA 4YC6A 2X6DA 4U9AA 2QU6A 4BI1A 2R3LA 4LV8A 4I0RA 1Q3WA 2HENA 2C5XA 2FO0A 3V8SA 4ENYA 4APCA 3K5VA 4CD0A 3OWKA 1XH4A 2VTAA 5DWRA 2HW7A 2KTYA 1Q8TA 5KMJA 1F5QA 1ZYCA 4EBVA 1LEZA 2OJ9A 4L9IA 3Q60A 4O0YA 5AV0A 3PPZA 3W2CA 5J1WA 1BL7A 3QXOA 5EYMA 5FDPA 3W55A 5HZNA 3QCSA 5HE0A 2VN9A 3OEFX 3DAJA 4OBPA 3D7ZA 4O0VA 4C8BA 5CU4A 2GFCA 4L68A 5IQEA 2O2UA 3RWPA 4XV9A 5CU0A 5FG8A 2ITOA 4XS2A 1LEWA 2VO7A 2VNYA 4N0SA 4RFYA 4FV5A 4PNKA 4XP3A 3N4VA 4EK5A 4FKWA 2P3GX 4KSQA 2C3JA 3RMFA 2UZWE 5JFXA 3EFWA 3GC0A 5HNGA 1YQJA 3PG3A 4Q2AA 5CF8A 2JKMA 1ZLTA 5C27A 2QLQA 3BZ3A 4CGAA 3L1SA 1WBWA 3I6UA 5A54A 3PXZA 3ORNA 5CNNA 4C4JA 4EC9A 2I0HA 3A8WA 3BX5A 4I4FA 3GT8A 5JQ5A 4ZY4A 4PRJA 2CLQA 3FYJX 4ASZA 2PK9A 3TUDA 4O7NA 2YABA 1GOLA 2WQOA 2CPKE 3MH0A 2BRBA 1FGKA 5E8TA 4IANA 1OIRA 4S30A 3NDMA 4XP0A 5DPVA 1WBSA 1ZOHA 1KE8A 2YDKA 3TTJA 4NIFB 5ICPA 4BCOA 1M7QA 4E4NA 3GCQA 5M55A 4BBMA 4U8ZA 2J0JA 3NSZA 4KS8A 3FC1X 5ANKA 2HZ4A 2SRCA 2PE0A 3D7TB 3JS2A 2XRWA 2IZRA 2NRYA 4MF0A 4QYFA 2BRMA 2ZMCA 4AZWA 3KXZA 3FBVA 1YW2A 1KSWA 2YACA 1WBTA 3E8NA 2X4ZA 5CLPA 5JRSA 2GDOA 5C8MA 4FTNA 3GU8A 4U41A 1Q8UA 4C02A 4KS7A 4Q5HA 4ASXA 5FTGA 4FTOA 5HX6A 1JKLA 5J7BA 2F2CB 3COIA 4P5ZA 4ZEGA 4QT1A 1EH4A 2VTMA 4IAKA 3SVVA 2WGJA 5CEQA 4MNEA 2GQSA 4V05A 4C37A 4YZCA 3PXRA 3FC2A 5CAPA 2AC3A 4FNYA 4B8MA 4C3PA 3DU8A 4IMYA 2YZAA 4M3QA 3DPKA 4IAFA 3W10A 4OR5A 2CGWA 1VYZA 2W7XA 4PPCA 5D11A 4BCPA 3TNIA 2PZ5A 5ANJA 4Z7HA 4GFMA 2NO3A 2F2UA 5HTBA 4YC8A 5M08A 2ZYBA 4QO9A 3CCNA 4RJ5A 4R1YA 2BAQA 3OD6X 4O0WA 3U87A 1O6LA 4ZZMA 3ZUVA 3P79A 3PSDA 4HJOA 1SVEA 2LGCA 3FXZA 4B7TA 5C1QB 5JK3A 3BHUA 1M7NA 3R1SA 1WBPA 2YM3A 2PY3A 4O96A 1YHWA 4LRKA 4E26A 3DJ5A 3AC2A 4TW9A 4L3JA 4E20A 5GIPE 4I6BA 2QOOA 4D4VA 4QTDA 4ZIMA 2E9PA 4R3CA 3K3IA 5HCYA 4UMRA 2WMWA 3T3VA 2XNBA 4F63A 4CKIA 3D5WA 1U5QA 3FXXA 4WRSA 4GEOA 3M11A 4CNHA 4IVDA 3PG1A 3E64A 4GVAA 2OU7A 2CGVA 4DCEA 4TTHB 1AQ1A 2J90A 4FSZA 1QMZA 5EYDA 3G5DA 4K9YA 2O5KA 2XF0A 4NJDA 2X39A 3EKKA 4GJ3A 3R1YA 1GJOA 5H2UA 5BYLA 2FGIA 5CVFA 1FPUA 2Z60A 4UZHA 5AADA 2PE2A 4FIFA 1SM2A 3TIZA 4A7CA 3HAVA 4O7SA 2DUVA 4M14A 2IW6A 3F82A 4TYGA 2Z7RA 3PJ3A 5HTCA 2OWBA 3NUYA 4PDSA 3CR0A 5TR6A 4FEXA 5LVMA 3OP5A 4EOIA 3TZ9A 4BZDA 4DGGA 4X21A 4Y8DA 3ZEPA 3OG7A 1GZNA 3JY0A 4ZSJA 2VTQA 3QWKA 4FI1A 5AR7A 4RMZA 4YTHA 4UMUA 3JYAA 2BALA 2UW9A 2CKPA 3UDBA 4ZY5A 1P4FA 3EWHA 1IG1A 3MFTA 2OXXA 4XOZA 1FINA 4I94A 3UYSA 1UU7A 3OTUA 4FT9A 5D9HA 3D5UA 2YAAA 4B99A 3ACJA 4HCUA 4FEWA 3ANRA 2O8YA 3DBCA 2HY81 4HPTE 4XG6A 2IVUA 3HV3A 2C47A 3TDVA 4HYIA 4IX5A 4N6ZA 2C5VA 5KHWA 4GK2A 2OF4A 5FEDA 1PY5A 3P0MA 4C7TA 2XMYA 3HYHA 3QC9A 2YM7A 4YSMA 3P7AA 4EHEA 1CKIA 2C3LA 5DR6A 4BCHA 4C57A 4FT0A 5DMZA 2UZVA 4L44A 5AP3A 3D83A 3P08A 3ZFYA 2W9FB 4TL0A 2QOLA 4PP7A 2A0CX 4ZS4A 1KOBA 3LCOA 3OS3A 4RJ8A 4FZFB 1XH5A 2GS2A 4BKJA 1M17A 4X3FC 2YCQA 3HRBA 3Q4UA 3RAHA 4QTCA 4KNBA 2B52A 3DV3A 4QQJA 4CG9A 4LQMA 5ACKA 4FSQA 4F64A 3IW5A 2HWOA 5ANEA 5IQCA 3L8XA 4C0TA 5DRBA 4UEUA 1DM2A 3EL7A 4FTRA 4JLCA 2XRUA 1GZ8A 1Y91A 3UP2A 4U80A 2YIYA 3TWJA 4ANSA 2PMIA 3H10A 2OI4X 2CKQA 2IPXA 4EEVA 4QP4A 4L67A 4USEA 3OW4A 4JOAA 5LXMA 5EFQA 5BMSA 3OBGA 3MVJA 3PSBA 2ZV2A 2YLFA 4AT3A 4DYMA 3LCTA 4FSMA 4TZRA 5M44A 2Z7QA 3FZ1A 1A9UA 3F3ZA 4O1OA 1A48A 4FIJA 3Q9XA 3PJ8A 2R3OA 2WD1A 3HMPA 5HE3A 3QTZA 3ORZA 2QKWB 1JLUE 4XV2A 2VV9A 1OMWA 5FXSA 5G6VA 2GNFA 4YJQA 2ZV7A 2XZSA 2FVDA 5ITAA 1H07A 2OH0E 3EL8A 2ZMDA 5FP6A 2W05A 4DAWA 4DT9A 5M56A 2GQGA 4ZTHA 1WBNA 4CZUA 2WEVA 3UPZA 4YP8A 3PP0A 2IVVA 4LOPA 3R9OA 3IPHA 4QQ5A 4USDA 4AW2A 4F9BA 4DH1A 5H8BA 4U6RA 2W1HA 3UZRA 4RIWB 1L3RE 3HVCA 4XG8A 3A60A 3O7LB 5IUGA 4GT5A 4K11A 1URWA 3KK8A 3R8ZA 5LOHA 2FSOX 3KL8A 3BIZA 4JBOA 3I1AA 3QRUA 5HLWA 2NNWB 2JIUA 1XQZA 4FIEA 5CQUA 5BQ0A 3T8OA 3VBTA 4FEUA 4O91A 3TEIA 5CU3A 2J4ZA 3IDBA 3RZBA 3OXZA 3BU5A 4EWHA 1O6YA 2UZOA 3EQBA 3W1FA 4QMQA 5C8NA 3P7CA 5IA1A 5CX9A 3BE2A 3I7CA 3UNZA 3E62A 3VS2A 4AZFA 1H26A 2BUJA 3A2CA 3UOJA 2ITXA 3B8QA 3D2KA 1WCCA 3LFCA 2PMOX 3G9LX 1WVXA 2QO9A 3HP5A 1Y57A 4RBLA 2PE1A 4IW0A 3BHYA 1ZZLA 1QPCA 4BYJA 3QHWA 3ZUTA 4G5JA 3AT4A 1W0XC 2C5OA 4OUCA 4J7BA 4D1SA 4D9TA 3A7GA 1KUTA 4O7WA 5A4LA 2G15A 3I5ZA 3SOAA 3WF8A 2ITZA 2GHMA 3C1XA 3FY0A 1Q99A 3A7FA 3WYXA 2BDFA 4CRLA 4AA5A 5FUTA 3CSVA 3COKA 3P86A 2XK4A 2OSCA 2R64A 3ETAA 3Q4ZA 4ZXTA 4AW5A 4NWMA 4OBOA 3FQEA 1ZY4A 3OCGA 4LI5A 2VO3A 4G5PA 3R9DA 2GHLA 4MD7E 3UVPA 2F4JA 2WOTA 3C4XA 2W1ZA 2UZDA 2WMSA 3FLNC 3KN6A 3MY1A 4GYGA 4NTTA 4EBWA 4EH7A 5HU3A 3TM0A 1PHKA 4B0GA 5IUIA 4W4VA 1VYWA 2J51A 1G5SA 3I0OA 4U45A 4HOKA 5CF4A 2VWVA 3NRMA 1RW8A 3FAAA 3TZ8A 3R21A 3BLQA 2WTKB 1PXKA 3R1NA 3LFEA 4LM5A 1H1WA 5T6KA 1H0VA 4G9CA 4NSTA 4E6AA 2J5EA 3PVGA 4TWCA 5AP7A 1JQHA 4KBAA 3LPBA 4PQNA 3ZONA 4F1OA 3KF4A 4O27B 3ORTA 5KMLA 4I0TA 2EU9A 3EIDA 2Y4PA 3EQHA 3AMAA 4J96A 3RAKA 4I21A 4IE9A 4G9RA 3ZLXA 3HDNA 3CQWA 3RPVA 1OB3A 3FI4A 4RX7A 3VS6A 4FTQA 4W4XA 4DGNA 5CQWA 3UZPA 3C5IA 4KIQA 2WMXA 3C50A 4CTCA 3SGCA 3PRFA 3FI2A 2CDZA 4O0XA 3VVHA 1U4DA 3V5PA 5FXQA 3DFCB 2QHNA 4TT7A 5EI8A 3D2IA 1IA8A 3KN5A 2EXEA 5AP0A 2XCHA 3LIJA 4UB7A 3TNHA 4OTDA 2ITNA 5LCKA 3QRTA 5ETFA 5LWNA 1ZYSA 2Y4IB 4BF2A 4FG9A 4X7QA 2XEYA 3KXNA 3QKMA 4ZP5A 4S2ZA 5HOAA 3CY2A 4J1RA 4JS8A 1ZZ2A 4OT5A 3MSSA 4BY9E 5HO7A 3RALA 3SXFA 3C51A 1PXPA 4NW6A 4MBLA 3R7YA 2WTJA 2DWBA 3NYNA 5KUPA 3PXQA 1GZOA 4XOYA 2X9FA 4N70A 1L8TA 3RCJA 4L52A 1U54B 2B1PA 4EQCA 3KRWA 3IW6A 5GINE 3WZDA 2XIXA 5B2KA 3UZTA 4ZTSA 1UNGA 4DINA 4EHZA 4DT8A 1R0PA 2GHGA 4G3EA 2B7AA 5DH3A 2XIRA 5EDPA 3UG1A 5KNJA 4KIPA 2GNLA 3DKFA 2G2IA 4XBUA 1V0PA 3IO7A 2W5HA 4M97A 2X8DA 3RTPA 3QA0A 3RZFA 3F3WA 3NUNA 1I09A 4PPBA 3ZUUA 4DEBA 2XP2A 3A4PA 2JBOA 5EDQA 3UMWA 3QD0A 3R00A 3NUAA 2BCJA 4CG8A 4FGRA 3Q5ZA 2F49A 4G2FA 1ZYDA 4IAZA 2ZDTA 3FHRA 4PNIA 4CKRA 1GIHA 3EZVA 3O7LD 3CQEA 1ZYJA 4FEVA 3ZSGA 4WBOA 3PIZA 4FVRA 4QMSA 5M51A 2X9EA 3OT3A 4K0YA 4Y95A 5M4CA 1XH9A 3TN8A 4FKOA 3HV7A 2Z02A 3RNYA 4BZNA 3FSFA 3PSCA 4ZK5A 3RINA 1UA2A 1KWPA 2ZAZA 3CJFA 4FVQA 5JGAA 2NRUA 2UVXA 4GJ2A 3RBWA 2PUNA 5IMXA 3HDMA 2VTRA 3MFRA 3R7OA 4FKLA 4FSYA 3ZBFA 3QD3A 2UZEA 4O2PA 4ANNA 3HEGA 3IOPA 2J9MA 4ITJA 2OW3A 4OTFA 3RAIA 1ZXEA 5CZHA 3GU4A 4ANLA 5L4QA 4DF3A 3LQ5A 2C0IA 3QTRA 2JFLA 3F9NA 2PSQA 3Q9ZA 5CXHA 3ORXA 3ZBXA 3AD6A 5T3QA 3W2OA 2ETRA 3Q96A 4E4MA 3AC3A 4QP1A 4L45A 4F7LA 2ITWA 5AP4A 3R7EA 2R9SA 3MA3A 5I9UA 4O21A 3LHJA 2QONA 2PVRA 2C6OA 3VN9A 3S4QA 2YISA 4CLIA 2GU8A 3QGYA 4IC8A 3Q5IA 4RVMA 3LM5A 3DGKA 3WIGA 5AP1A 1H01A 4IB5A 1Q8YA 3AGMA 3NYVA 2R5TA 4BTKA 3HA6A 3PJ1A 4FMQA 4YO4A 5C03A 4AU8A 3MTFA 4PDPA 4CV9A 2I0YA 4G6LA 4UX9A 2I40A 3HECA 2VWUA 3ZMMA 4DITA 5CEPA 2O65A 3WBLA 2YWVA 4MWIA 2G2FA 2O0UA 4WNPA 4IFGA 3DT1A 5K9IA 3AC5A 4KIKA 5EDRA 3KVXA 3E8EA 3FXWA 5J9ZA 4J8NA 2YCSA 3F5GA 4QNAA 5IA2A 5FRIA 4G17A 3G9NA 3G51A 3BELA 5B2LA 3EQCA 5EQPA 3ZO1A 4YZ9A 2QU5A 3P7BA 2XYNA 4RQVA 1SNUA 4CV8A 2HZ0A 5IEYA 4NKSA 1DAYA 4IWQA 4G16A 3ZEWA 1IRKA 3II5A 2VGPA 2YIXA 2XJ2A 2RF9A 1JSVA 2PL0A 1CSNA 3V04A 4DFNA 4D4SA 4QMVA 3RHKA 2YIRA 4JG8A 1UU3A 2XK7A 4X0MA 5H8EA 5I5ZA 3R73A 2P0CA 2CNUA 4YPDA 3DS6A 5HLPA 3IQ7A 3CJGA 3OVVA 3LLTA 3PA5A 2H8HA 4NTSA 3EFJA 3QF9A 3VRYA 4DEEA 1P2AA 5CAUA 4NCTC 4MX9A 5ANIA 5EOLA 4ZTQA 2PZIA 3FMDA 2JEDA 4A07A 3E92A 2YCRA 1Y8GA 2C68A 3DA6A 4BKYA 1MRYA 2EWAA 5E8VA 3QX4A 2CHLA 2W4OA 3FZPA 3FUPA 2XKDA 4D5KA 2WOUA 1R39A 3RPOA 4RJ3A 3BEAA 5TOZA 1PXOA 4U81A 5IKWA 4M7IA 2C69A 1T46A 3GEQA 4ANMA 1XR1A 5K3YA 3NIZA 3PRIA 2YIWA 2GS6A 3R6XA 1W84A 3FI3A 3I0QA 3R9HA 3IGOA 3UO6A 3ODYX 3P23A 4I22A 2UW5A 4L53A 3GU6A 3C0HA 3A62A 4L7FA 1UU8A 5JFVA 1RQQA 4H3QA 4GRBA 4YHFA 5DLSA 3PFQA 3U55A 1APME 4EOLA 3TZ7A 5HIEA 3UG2A 4HGEA 3FI8A 1QL6A 3RAWA 3RJCA 4C3RA 4FOBA 1BLXA 4YBKA 1REKA 1ZWSA 2EB3A 2ZM4A 3DBFA 4IVAA 5CU6A 1QPEA 2GCDA 4PF4A 1AD5A 4WG5A 2WTVA 4P4CA 1BMKA 4GSBA 4R7IA 1UKHA 5EW9A 3IECA 3K54A 5IA5A 1ERKA 2QG7A 2IZUA 3V3VA 3EYGA 2Y6MA 3LXPA 4TRLA 3QRKA 5M57A 4E4XA 3I5NA 4EORA 5GJDA 3FLYA 2C6KA 3P5KA 5KHXA 3AGLA 3IKAA 3KF7A 4BVUA 4O7TA 3R8PA 3TTIA 5C01A 2WO6A 4HNIA 4U42A 4W8EA 2ZDUA 1NVSA 4XRJA 1JKSA 3QUEA 5JKGA 4QMPA 5HBHA 1UV5A 4NIFA 4GU9A 4IWOA 2PVKA 2C0TA 3L9LA 2FSLX 4D4YA 4EH5A 3D7TA 2PZYA 4D1XA 5CASA 4XX9A 4OTWA 3NW6A 3CQUA 4JDIA 2BDWA 4L3LA 2X4FA 1H0WA 5HD4A 2PU8A 4E93A 2QURA 2J7TA 3EMGA 3SD0A 4D0WA 5CANA 1YXXA 3EHAA 4CCUA 5IQDA 2Y8OA 3RK7A 3PLAE 3VW8A 3ZOSA 5HI2A 5IQBA 4R6VA 3BWJA 2UZNA 1GAGA 1YOJA 2PVHA 3QQHA 5GJGA 2VWWA 3QBNA 3EB0A 1BI7A 3O0GA 3U4UA 2ITPA 5TO8A 5C8KA 4JI9A 4M8TA 3LCSA 2CCHA 2W1IA 4BIBA 2A2AA 2WMUA 3A99A 3V8TA 3ODZX 4JG7A 2RFDA 3NX8A 4IAIA 3ORIA 3L9MA 2OLCA 3QTUA 2YM5A 4PTEA 4XYFA 4P7EA 3LOKA 3H0ZA 5AUXA 4JL9A 2VX3A 1Q4LA 5EI6A 4H1JA 3EH9A 3D9VA 5DVRA 1GIJA 2O63A 2I7QA 3VRZA 2QNJA 4O0SA 4ACMA 3D14A 4FKPA 2J50A 3D4QA 3F2NA 3UIXA 3RVGA 3TKUA 3KA0A 4HGSA 4AFJA 2W9ZB 1RDQE 2JC6A 3P4KA 3KREA 3IG7A 4JX7A 5IA0A 4BBFA 1KE7A 4ASEA 4BDKA 1PMVA 3C4CA 3RPRA 4F7NA 1E1VA 3CEKA 3SDJA 4MXZA 5DGZA 1XWSA 2W0JA 4RZVA 4D9UA 5IZFA 3NVMB 2C5YA 3E8CA 2DQ7X 2GPHA 5IDNA 2CKOA 1QCFA 3VBYA 4U0IA 3E88A 5IQIA 3ZXZA 5AUUA 2IO6A 2V55A 4D5HA 4PX6A 3BLHA 4CKJA 4F9YA 3BYSA 5D7VA 4BCIA 4U3YA 2VX0A 3FYKX 2VTLA 3U6JA 4L46A 4Z3VA 2C4GA 3PY0A 1F0QA 5LVOA 4YU2A 4NH1A 4ACHA 5CAOA 3V5WA 1P14A 2ERZE 1T45A 2C3KA 2F7ZE 1YXVA 2WZJA 2P55A 4TPTA 4R5SA 5FTQA 3VHKA 4GVJA 4HZSA 4OTQA 3R7GA 5FM2A 3IOKA 4EUUA 1ZMWA 1HCKA 1OECA 2GSFA 5GJFA 3PWYA 2HIWA 4RVTA 1FVRA 5HCZA 3KRJA 4X6RA 3U6HA 5IISA 3BU3A 2RG6A 3S3IA 4HNFA 4NU1A 3TCPA 1KV2A 3VF9A 3VUTA 4BC6A 3FPQA 1H1PA 4KB8A 1R1WA 4U7ZA 4WBBB 3BGZA 5DT0A 1FVVA 4R77A 5GIOE 3OEZA 4FTKA 2OZOA 5BVDA 5HHWA 3DXNA 5ANGA 4H58A 2WPAA 4KA3A 5L8JA 3VIDA 2CKEA 3MA6A 5AR8A 4F65A 4AW1A 3TG1A 4X3FB 4B6LA 4C59A 4CFWA 3AMBA 4W4YA 3F3TA 2ETKA 4EI4A 4C2WA 4QTAA 4M0ZA 5JGDA 2W1CA 5AAGA 5CVHA 4NM5A 3NGAA 2QLUA 4AQCA 4NKAA 2YJRA 3GC9A 5CWZA 4FK3A 5H8GA 2XBJA 5F4NA 4ALVA 2O64A 4O82A 3H0YA 1FGIA 2PHKA 3HV5A 3SA0A 4K77A 4G34A 1ZOGA 5EYCA 5AV2A 2VTJA 5CVGA 4AS0A 3ITZA 4LRMA 4WSQA 5CZIA 5BPYA 3ZCLA 3SHEA 3KFAA 5CEMA 2LAVA 2YIQA 1LUFA 3VHEA 2PULA 4FODA 4E7WA 5JN2A 5BNJA 2WTDA 4X2GA 5EW8A 4BCFA 5A14A 3R8UA 1OVEA 2XEZA 4UY9A 2A19B 4TYHB 5IH5A 4FICA 2BZHB 4CZYB 5JFSA 4AXAA 3NVKI 1YXUA 1Q5KA 1PJKA 4G6NA 5BVFA 3UQFA 4M13A 2BKKA 4WO5A 5DYJA 4BHNA 4JQEA 1OL1A 4UXQA 5D7AA 2YDJA 3KC3A 4R8QA 4O7YA 3DBEA 2J0MB 2OJJA 4GUBA 5GHVA 1VEBA 4LFIA 5BUEA 2IVTA 5HVYA 4EK8A 3O8TA 3U9NA 2ITYA 4F0GA 1OKZA 3TI1A 3FZSA 2JIVA 3IDCA 2YM6A 5FDXA 3Q6WA 4XG2A 2R3QA 3BYMA 3EJ1A 3DKGA 3G2FA 5FD2A 3VULA 4AA4A 5I9YA 5JT2A 2WMBA 5JZJA 5AFVA 5AV1A 4B4LA 3B2TA 2WAJA 3PJ2A 4EC8A 3EQRA 4N6YA 2RIOA 3LJ2A 3Q9YA 4PUZA 3ZU7A 3ORKA 2JAVA 3SXSA 3MY5A 4YTIA 3EN5A 4EOKA 4TWOA 3VF8A 3ZZEA 4YO6A 4ONAA 4DH5A 3DJ7A 2WQNA 4RIWA 3U51A 4RWIA 3N4TA 4YJTA 2ONLC 1Z9XA 4NM7A 3DQWA 3L8SA 4NUSA 5L8LA 3TL8A 4KKHA 4D1ZA 3QZHA 2X81A 5I0BA 2YHVA 3QQJA 4O22A 4FTCA 4IJPA 4HVGA 1OM1A 2VX1A 4ZSGA 5FXRA 2OZAB 5F95A 5AUYA 3VBXA 3R8LA 2IJMA 4I93A 2IG7A 4GW8A 4GT3A 3VUGA 2QOHA 3BV2A 2CGUA 3ID6C 5M4IA 1WBVA 1XJDA 4S33A 4KABA 2WB8A 3QX2A 3PVWA 3VQHA 5A4EA 2RFEA 4BCKA 3S00A 4IEBA 4FV3A 3IW7A 3QRIA 4OTIA 5EM7A 4CMOA 3KCKA 3G6HA 3FMKA 3D5XA 4JXFA 3HAMA 3WOWA 2EVAA 3T9TA 5I4NA 4EH8A 2R7IA 2J0IA 4A4OA 2W4KA 4N57A 3DLZA 5LJJA 3KEXA 2R3IA 2BFXA 2XJ0A 4G1WA 2OICA 3CD8A 2GMXA 3ATSA 3MVHA 3WE8A 2EUFB 4O2ZA 3BYUA 3SC1A 4BDBA 3TKIA 4FKVA 4EUTA 4MYGA 3NUXA 3QZIA 3LFNA 4UYNA 2ZM3A 4WUNA 5JMSA 3ACKA 4IQ6A 3KMMA 4C2VA 2WMAA 3LE6A 4O86A 2OXDA 3F61A 4JT3A 4FBXA 3GENA 3FZRA 4QPSA 4CEGA 3DXPA 4E8AA 4PL5A 3FL5A 5LARA 4JBQA 5KKRC 5AM6A 5E8XA 2R3GA 4RWKA 4K33A 4YJPA 5DE2A 2OG8A 4EK6A 3QLFA 2X2MA 3R9NA 2YAKA 4LUDA 3VUMA 5J9LA 3V6RA 1B6CB 3FV8A 4PV0A 2OH4A 4EH4A 5GZ9A 2VWZA 5M06A 1OKVA 1K9AA 3FPMA 4U43A 2JDOA 4WOVA 3TDWA 4DE4A 2QHMA 4FSUA 1QPDA 4DTBA 3SRVB 3T9IA 4XUFA 5M09A 5IU2A 4IVBA 3D5VA 3KVWA 2YFXA 2HZNA 3WILA 4ZLOA 1PKGA 4IZ7A 4RJ4A 5HO8A 5J95A 4E5WA 3EQFA 4ZAUA 3KXHA 5LMKC 4EJ7A 4FE2A 2QVSE 2VUWA 4J98A 4CFNA 4YZMA 3R8VA 5J5SA 4FGBA 3UOLA 3I60A 4DFZE 4FF8A 4FTIA 3UODA 4CFUA 4J99A 2WMQA 5K4IA 3GCVA 4ITIA 3V8WA 3MESA 4O6EA 3CS9A 5CAVA 2BROA 3V5LA 3F5UA 5C26A 4M69B 3BLRA 1U5RA 4IZ5A 4BN1A 4IH8A 1TQMA 4RSSA 1Q8ZA 1OIYA 3SG9A 4RIOA 4QPMA 3A7HA 4MBIA 5DA3A 3R30A 4HYSA 3CC6A 5HQ0A 4DH3A 4ZJIA 3MYGA 3A7JA 3NNUA 4L43A 2F9GA 3CGFA 3O96A 1YOMA 2W99B 4MWHA 2NP8A 3ZO3A 1P5EA 4C62A 3PDTA 1IAJA 4RVKA 1U54A 3ZXTA 4CQEA 3OBJA 3E5AA 2E9OA 2PVJA 1LR4A 2B9IA 1STCE 2OJGA 3HNGA 4NFNA 1H27A 3DBDA 3VQUA 4F0FA 3WYYA 3FE3A 2GNIA 4AG8A 3H30A 2ITUA 2VAGA 4XV1A 1TKIA 1OITA 5E7RA 5ETAA 4LYNA 5ANOA 5LVPA 2YZLA 2X6EA 5L6WL 4F6WA 4I92A 3NCZA 2PYWA 4DTKA 4FNXA 4NL0A 3U9CA 4PMPA 4RC3A 2F7EE 3PJCA 4JR7A 5KX8A 5IQGA 3WF7A 4NJ3A 3OCSA 4C4FA 4EYJA 4DN5A 4Z7GA 2BIYA 4FKGA 1G3NA 5CS6A 5IH4A 5CSWA 3QLGA 2Y0AA 3HLLA 4MKCA 3TNPC 4F9CA 1G8AA 4P5QA 4BIEA 4PTCA 1NVRA 2OIQA 2GNJA 4DHFA 3OWJA 4BDIA 2IZTA 3PXYA 2XCKA 4U79A 3E3BX 2H96A 3AT2A 4WNKA 1XBCA 4FG8A 4F08A 3P1AA 1H1RA 4D2WA 4EZ3A 3QTWA 3GCSA 5FM3A 3C0IA 3R01A 3KXGA 4XEYA 1K3AA 4IWPA 4MQ2A 4CFFA 2CCIA 3K2LA 4BWXA 5BVNA 3DAEA 4ALUA 4ANQA 4DLIA 3ZSHA 5AUWA 1Y6AA 4IADA 5CF5A 3PPKA 5IDPA 4X3JA 4I5CA 4FEQA 4ACCA 5FTOA 4ZLZA 4BWKA 4EHVA 2J6MA 4J52A 1YDTE 4LGDA 1MQ4A 2R4BA 5EOBA 4ZTMA 2PUPA 1ATPE 5AUZA 4FYNA 3QGWA 5IQHA 2VGOA 1H8FA 4PY1A 3SW4A 3UIMA 3S1HA 2PWLA 5J87A 3SX9A 4YTFA 4A9SA 4D55A 5FBNC 5HNIX 4BGHA 2UUEA 2XIKA 5EI2A 3W18A 3GOPA 3Q53A 2I0EA 5IF1A 1ND4A 3ET7A 3O50A 4X2FA 5BVWA 2IW9A 5FP5A 3BPRA 4BCMA 4YUQA 3C4EA 3EN6A 2AC5A 4AT5A 4NM3A 4AUAA 3G0EA 2ZV9A 2Z8CA 4MVFA 5ACBC 2PZRA 3VS7A 4GV1A 4KAOA 1J7LA 4KIOA 3HP2A 5DHJA 3DK3A 3KB7A 4AE6A 4YHTA 2BDJA 2V62A 3GOKA 4H36A 3CKXA 4AF3A 1ZARA 3JY9A 3GCUA 2B9HA 5KMIA 1PW2A 1YHVA 4BDEA 4GUEA 1XO2B 3FLSA 2C6TA 3QA8A 3VAPA 5DIAA 4R5YA 4ZTLA 3I7BA 5AR4A 4YJVA 3Q6UA 2XKFA 2ZB1A 2UW3A 3KK9A 4IACA 4QMUA 3W32A 4AWIA 2UVZA 4Y5HA 5HEZA 3ENHA 4BCGA 3CTQA 5KO1A 3UQCA 2XNOA 3LVPA 4OBQA 3WARA 3CY3A 3PUPA 5L2TA 4Q9ZA 4FL3A 1WZYA 4C4HA 1PXNA 3DKOA 3OY3A 4JX3A 4WKQA 1RJBA 3UVRA 4C58A 3DDQA 1VZOA 4FZ6A 3ZO4A 3SLSA 4DGOA 3EN9A 5BMMA 4YJNA 3EQGA 4DG0E 3PE2A 3NW5A 2VWBA 5IQAA 4KWPA 4WG4A 4BZOA 4BHZA 3CLYA 4ERWA 1Z5MA 5HBJA 1UKIA 2FH9A 3SV0A 2GTNA 2WQBA 3ZLWA 5HG7A 3MDYA 4QD6A 5EHOA 5A4QA 1JSUA 4U5JA 1Q97A 3KQ7A 4QMTA 3O17A 3OUNB 4IJ9A 4TWPA 5CI6A 1TVOA 2WIHA 3KGAA 5CT0A 3BWFA 1W7HA 4CSVA 4F6SA 2BAJA 3MY0A 4GG5A 5HTIA 4FC0A 4G3GA 3TKHA 4B8LA 2HCKA 2R3JA 3ZYAA 3LLAA 3PPJA 1M52A 1E9HA 3VBQA 3OUKA 2W1DA 2WQEA 2Q83A 3CBLA 2QG5A 2Z7SA 1CM8A 4M84A 2G01A 4OGRA 5AR3A 3FEGA 3B8RA 3PA3A 4EH9A 5IEXA 2C6MA 1W98A 2VWXA 3UO4A 4F1MA 5BX0A 3E8DA 5F1ZA 1H4LA 4QP2A 1CTPE 3ZFMA 4E3CA 4UMPA 3RPSA 3E7OA 4YNOA 3O8UA 2JITA 4QMLA 1OUKA 3F7WA 2GQRA 1FVTA 3DLSA 2X7OA 1GNGA 1ZOEA 4AGWA 3OT8A 2OKRA 2JBPA 2W17A 3TV4A 3ORMA 3QQKA 4R3RA 2B9JA 2OJIA 3PA4A 3H9OA 4GIHA 2Y7JA 3QTSA 3EN7A 4L00A 3W16A 1V0BA 5HBEA 4CT1A 5JGBA 1MQBA 3F3UA 4YGAA 1YKRA 3PZHA 5K4JA 3QALE 4RLKA 3KRRA 3LFQA 1PKDA 3M2WA 2GFSA 5HG8A 5AIRA 3NAYA 3BEGA 4FZ7A 1I44A 3NLBA 4TN6A 5JSMA 1JSTA 4O84A 1ZRZA 3L8PA 3FMNA 2ZVAA 3PZEA 5DNRA 1UNLA 3A7IA 3W33A 2WELA 2XM9A 2PVNA 4MD8E 3HRFA 4Q5EA 4QMYA 3KRLA 2BHEA 3CKWA 5LWMA 4IHPA 3QYWA 1BKXA 3FMHA 3WF5A 3KULB 5IA3A 5BVKA 2EXMA 3ZM4A 4QRCA 4DEHA 3BRBA 4ARKA 3JXWA 2BRNA 2UVYA 3HV6A 5I9VA 1WFCA 4J97A 1ZMVA 4MK0A 3R7UA 4EWQA 3N51A 4XNEA 4IM3A 1OBDA 4ZMFA 2RSVA 1BX6A 3AOXA 2ZOQA 4F1TA 3MI9A 2QQ7A 3NR9A 3DK6A 4C4IA 3QRJA 3UMXA 3NAXA 4FNZA 5AM7A 3RI1A 4K8AA 2XA4A 4BR3A 3R02A 4Y85A 5E92A 2ITQA 2YM4A 4WIHA 1WAKA 5HVKA 5CSHA 5LVNA 2X7GA 4O7RA 1XH7A 3GVUA 1Z57A 3MJ2A 4IZYA 2HAKA 2BZIB 2WKMA 3HZTA 2VTNA 3Q4TA 4BTJA 3LMIA 4O0UA 4N4SA 3D0EA 2C30A 4XH6A 2V0DA 5CEKA 2R3PA 4O1PA 4ZS0A 3DY7A 4II5A 4AX8A 4DEIA 5CAQA 2OBJA 1PXJA 3G6GA 4FKJA 1XH8A 4XLIA 4OTPA 3OY1A 3LZBA 1J3HA 1UNHA 5LVLA 3ULZA 4PMSA 2I1MA 4Y72A 2IVSA 4E5BA 4EOOA 1SVGA 4PL3A 1CKPA 3S0OA 3U8WA 3GC7A 3QCQA 3FHIA 4GL9A 4RC4A 5L2WA 1YWRA 2J2IB 2CSNA 5AP2A 5EM5A 3RK5A 2C6IA 2X8EA 3A61A 4EONA 3LXKA 3DQXA 4S34A 4J53A 3SQQA 4YMJA 1W8CA 2FB8A 1CMKE 3R2YA 4Q9SA 4Z16A 4JBVA 4V0GB 1YI4A 1FBNA 2X0GA 1H08A 5AJQA 5A3XA 2A1AB 4WG3A 3F2RA 3IK3A 2QOFA 4RPVA 3NNXA 4M12A 2BIKB 4KRDA 4CVAA 4JQ7A 3BHHA 3U54A 1REJA 3VW6A 2PVMA 4OTHA 4D0XA 1FMKA 2V22A 3HX4A 4FUYA 2QOQA 2V7AA 2VZ6A 4TYEA 2W06A 3FMEA 3UJGA 3ZRLA 5JFWA 3Q2MA 4E1ZA 1H1SA 4UWCA 4EK3A 4FNWA 3V5JA 4HW7A 3UNJA 3E7VA 3UYTA 3QL8A 5DT4A 2OXYA 5CEIA 4QOXA 4JRVA 3MV5A 1GZKA 2Q0NA 4IFCA 2P2HA 4IDTA 4DFLA 3CE3A 4LV5A 4TNDA 4CCBA 3BQCA 2WEIA 4I20A 3WI6A 4DLJA 4FA2A 3OW3A 5C9CA 4ALWA 2UW7A 2XVDA 4KBKA 1U59A 3S2PA 4F6UA 5L2IA 2J0KA 4EOSA 1P4OA 4MHAA 4A9UA 4MF1A 1LPUA 3ZH8A 3NIEA 3UO5A 1OL5A 3CXWA 4GS6A 1O6KA 3I6WA 4FSTA 1NXKA 4FKUA 2QR7A 4YLKA 5AP5A 4I24A 3F66A 3OCTA 1S9JA 2R3FA 3DBQA 3MH1A 2WTCA 5E8UA 2W96B 3ZHPC 4C4EA 2PMLX 5EYKA 4YNEA 3W2RA 4CYIA 3Q9WA 3TT0A 4QP3A 2WQMA 1UWHA 2VO0A 1VJYA 3WF9A 4ANOA 1DAWA 1YI3A 4X3FA 5DR9A 2AUHA 3C5UA 1YOLA 4LUEA 4QMMA 3V5TA 4BWPA 3NUPA 5DBXA 4KINA 4XG3A 4ZJVA 5CSPA 1JWHA 5KCVA 5JEBA 3MVLA 4IB3A 1BUHA 1FMOE 4D2PA 2W5AA 3DTCA 3ORPA 2WMVA 3KXXA 5AWMA 4DG3E 5KBRA 3FMMA 3H9RA 1JBPE 1YXSA 1BL6A 1CDKA 1OL2A 4W4WA 4IVCA 2RGPA 3RHXA 4BGGA 4YURA 5I9XA 5J5TA 4F9AA 5KMNA 5IQFA 3R71A 2HK5A 4IXPA 3O71A 2R0IA 4RIXB 2HOGA 3HMNA
chains in the Genus database with same CATH superfamily
5IH6A 3V51A 4CFXA 1WMKA 3VS4A 5TKDA 4BDCA 2ZJWA 4BFMA 4MNFA 3R0TA 4ASDA 4E6QA 3TNWA 4A9RA 2W1GA 4IB1A 4RX5A 5CEOA 4LGGA 5HORA 3VS1A 3UC4A 4XBRA 3LQ3A 3OWPA 3OROA 4TYHA 5EK7A 4ZJJA 4EH6A 3C4WA 5IPJA 4JIAA 4DEDA 3EFKA 3QHRA 3FY2A 2BRHA 2R3HA 4FOCA 2UV2A 5IG1A 4AAYA 4QMZA 4K6ZA 3SXRA 2WIPA 3AC1A 4JDKA 4FV8A 4L3PA 4CRSA 3ZRMA 3BV3A 4J8MA 4RJ6A 3BHTA 1OIQA 3CP9A 3REPA 2WMRA 4IWDA 2OK1A 3L8VA 3DZOA 4DFUA 3PUFC 1FQ1B 2WU7A 4FV4A 4MTAA 4DA5A 3PTGA 5AR5A 5EW3A 3GU5A 3LJ1A 4FV0A 5F94A 1YWVA 3U4WA 4GKIA 3BI6A 1YDRE 2EB2A 3FKNA 4OTGA 4DTAA 2X0PA 4PPAA 2B53A 5FBOA 4U3ZA 5M07A 2RKUA 3EQDA 1G8KA 3LKMA 4WNOA 3FLZA 3VUDA 5I9WA 4NEUA 4M68A 2VTOA 4FKTA 4MXCA 1PMNA 2H34A 2P4IA 3UOHA 4F0IA 3OWLA 3PVUA 3R1QA 4FK6A 3UVQA 5L6OA 3QUDA 3GU7A 4QTBA 2WFYA 4P90A 5M53A 4G3FA 5E4HA 3OXTA 1OIUA 4EOJA 4JNWA 3PLSA 4JBPA 3GQIA 4QYGA 4I41A 4RG0A 4ZY6A 3EQPA 3RWQA 5E91A 5AV3A 4BI0A 2XIYA 3N4UA 1H28A 1OKYA 2FYSA 2QCSA 4FV7A 2OZAA 4C34A 2J5FA 5GNKA 5BVEA 1KE9A 4J71A 4EZ5A 5I9ZA 1O9UA 3CPCA 4NM0A 4O7ZA 2C3IB 1X8BA 3E3PA 1SMHA 2CGXA 3GI3A 4X6QC 4I5HA 4FKQA 2KULA 3C9WA 2C0OA 3R04A 3ALOA 4FV1A 4GYIA 3F6XA 4JRNA 4RWJA 4TYJA 4GCJA 4XG9A 4AGCA 3LMGA 3A8XA 4TXCA 2VTHA 4DEGA 3HV4A 5L2QA 4L6QA 4QNYA 1V1KA 2VU3A 3RM7A 3EYHA 4HCTA 3GC8A 3ML1A 3TV7A 3HMIA 4AAAA 5JZNA 4BTMA 3DZQA 4J95A 3VBVA 4FV9A 2WXVA 1K2PA 5KKRB 1G8SA 2XH5A 1BYGA 4AE9A 1Q24A 3K3JA 3CTJA 3QD4A 5EKOA 4DBXA 1XBAA 3UQGA 3MJ1A 5BUJA 2OO8X 3ENMA 3FLWA 4MXXA 5LMAA 5IUHA 1Q8WA 4JQ8A 3QUPA 4MEDA 5BYZA 3C4ZA 3H4JA 3LFAA 3HA8A 4W9XA 4ENXA 3MTLA 5EM8A 3HMOA 3QTXA 3IW4A 4RIYB 2P2IA 4JIKA 4AA0A 2YERA 3FKOA 1FOTA 1MP8A 4DH7A 3W2PA 2PTKA 3ZLSA 3Q32A 1OPKA 3UIBA 5AR2A 3AC4A 1VR2A 5A4CA 2BHHA 4DBNA 3BQRA 5FWKK 3HUBA 4E73A 2XS0A 5CALA 5HG9A 3NWWA 5BUIA 1M2RA 2ERKA 1YDSE 3AXWA 3LFFA 5JH6A 3COHA 3DFAA 3SRVA 2E9VA 4IDVA 4FRFA 3MFUA 3RP9A 5AIKA 4KBCA 4AGUA 2PVYA 4BCQA 4MD9E 2R3RA 5K5NA 4O83A 2FUMA 3N9XA 2RG5A 1B38A 3MFSA 3LW0A 4BDDA 3ANQA 3PVBA 4RX9A 2JGZA 4ERKA 3IGGA 4PMMA 3R7VA 4IM2A 4EQMA 4X2NA 5AAFA 3NZ0A 2BR1A 1W83A 1KE6A 3ZC6A 1Q41A 4MXAA 5CNOA 5B7VA 2RFSA 5CENA 3F2AA 4IAYA 3W2QA 3GBZA 4G3CA 4M69A 2CNVA 4V04A 5H3QA 1YI6A 4BBEA 5KBQA 2QOIA 2QODA 3NMUF 4E4LA 2XNGA 4FT5A 2V7OA 1QPJA 4MBJA 4FL1A 3UGCA 3G15A 4FV6A 5A4TA 4K1BA 5C4LA 2C5NA 3OTVA 5EKNA 1AGWA 2BPMA 2IWIA 4F78A 2XBAA 1KV1A 4FSRA 4A9TA 3BL7A 3BCEA 3WE4A 4F7SA 4QP8A 5AV4A 3TUCA 4R1VA 5GZ8A 3C4FA 3DXQA 2R3KA 4FKSA 4I6HA 5L6PA 3G0FA 2DYLA 4AOIA 4MXYA 2XKCA 3KRXA 3DB6A 4I5MA 2HXLA 5FLFA 4RFZA 2XM8A 3MS9A 4DGLC 1VLRA 4ACGA 3OHTA 4JVGA 3PY1A 3IW8A 3F3VA 4XJ0A 3UPXA 4IM0A 4CLJA 5IMEA 1WVYA 4YHJA 3QTQA 3QZFA 4FSWA 5HG5A 1WBOA 2E9UA 4XP2A 4Z55A 3OCBA 4O6LA 5HO6A 4WRGA 3TIYA 4AACA 4D2SA 1TFFA 3V01A 4CYJA 4F70A 2UZUE 2QO7A 1JNKA 1NVQA 4I5PA 4L01A 3ZC5A 4EKKA 4OAUC 2YCFA 4UZDA 2A98A 5EHYA 3UTOA 3E63A 3ORLA 4QQTA 4YZBA 4BYIA 2E9NA 2QOKA 2C6EA 2ETMA 3ZFXA 3ZM9A 4BTFA 4DG2E 1PF8A 1YVJA 4P2KA 4W9WA 3R2BA 4AP7A 3DNDA 4CFVA 4I6QA 1DS5A 1U46A 3LXLA 3PP1A 1SVHA 5DG5A 3GFEA 1J7IA 4LG4A 1J7UA 4FT7A 5KZ0A 2VRXA 4IX4A 3MIYA 4I23A 2JDSA 3UNKA 4YLJA 2W5BA 1NW1A 2XYUA 4Z9LA 5JQ8A 2VTSA 4RQKA 4GT4A 2X1NA 4EL9A 3ERKA 2XK8A 5AP6A 4IBMA 3THBA 3V5QA 2PVLA 2W1EA 4MNEB 1DI9A 4PP9A 4EOQA 4ANBA 2CNQA 3Q52A 1UWJA 3HL7A 3PE1A 3HGKA 4QP6A 1KOAA 5HU9A 4BJJB 4HGTA 4BDFA 2G9XA 2QC6A 2R7BA 3KMWA 4FIHA 3MGYA 3TMOA 3BU6A 3NNWA 4A4LA 4CZTA 4F9WA 3MN3A 2F7XE 4GG7A 4ZOGA 4L42A 4AN9A 2BTRA 2FSTX 2UW4A 4IZAA 2JKQA 4FTJA 4BDGA 4EYMA 4USFA 4NYEA 2XK6A 4WNMA 2R3NA 4ACDA 3NUSA 4HZRA 5L2SA 3O23A 1H1QA 4BKZA 2BZKB 4M15A 4EK4A 5A46A 4CQGA 1Q3DA 4YJSA 4G31A 5M4UA 4DCAA 1XBBA 4PDOA 5E1SA 3A4OX 4FG7A 3KCFA 3BGQA 1H24A 3QD2B 3FZOA 5BYYA 1YWNA 2PMNX 2X8IA 2XIZA 3ALNA 1YXTA 1UVRA 3QQLA 3VBWA 2F57A 3AD4A 4WT6A 1JPAA 3WZUA 4AW0A 2OGVA 4CFMA 3QKKA 3VO3A 4QP9A 3BYVA 3JUHA 2XK3A 4F99A 1IR3A 3WF6A 5J1VA 3R22A 5ANDA 5G1XA 4BI2A 4ZLYA 4R78A 4GH2A 3UC3A 1A06A 3UBDA 3CGOA 2XJ1A 4X2KA 4ZSEA 4IX6A 2VWYA 4G3DA 4MAOA 1LP4A 4YLLA 2JDVA 5K5XA 5B0XA 5T68A 1PMUA 3PYYA 1BI8A 3TNQB 4HVSA 3JR1A 4YR8A 4JJRA 4FX3A 5HCXA 1M2QA 3F5PA 3IDPA 3JPVA 4EHGA 4YPSA 2BTSA 4NCTA 4EOMA 3E87A 3GFWA 3TUBA 4LRJA 3AC8A 3GQLA 5AMNA 3DKCA 4D2RA 5A6NA 5K0KA 3LFBA 1B39A 4NW5A 4CXAA 1PMEA 4Y73A 5AUTA 3BHVA 4FKRA 1PYEA 1PYXA 3FWQA 3GNIB 4JR3A 3KU2A 3VC4A 3SW7A 1MRVA 5HKMA 3SKCA 2X7FA 2PVFA 4TYIA 4W8DA 2YDIA 2BILB 3MVMA 4BIDA 4AZVA 4XCUA 4CT2A 5J9YA 4BDJA 4JDHA 3UIUA 5E1EA 4ORKA 2YM8A 3IS5A 4GK3A 4HYHA 4M0YA 4PWNA 4HPUE 3KKVA 2CN8A 4JG6A 2J0LA 1PXLA 1JKTA 2XK9A 4UXLA 1RE8A 3QKLA 4WA9A 5B2MA 2Y9QA 1F3MC 2OIBA 4BDHA 3R8MA 1GY3A 3DOGA 4A06A 3I4BA 4LGHA 5E8WA 1YRPA 2HWPA 3RM6A 3RNIA 3FL4A 2DS1A 3H3CA 4XRLA 1SZMA 4O0TA 3GGFA 1OL6A 5CXZA 3GCPA 4QYEA 1XHAA 4LMUA 2VD5A 4LOOA 2Y6OA 3RK9A 2YJSA 4TY1A 3FMLA 4V01A 3OC1A 3ZDUA 1M14A 3Q04A 1JAMA 4PDYA 1TQPA 4FT3A 4AXEA 5I3OA 3I79A 3TACA 5AX9A 2VTTA 2JDTA 2GNHA 3BGPA 2XNPA 1OZ1A 4C38A 4Y83A 1IASA 3R83A 3K5UA 3MPTA 4APPA 3QTIA 3ROCA 2P33A 2ZM1A 3DB8A 3LXNA 3O8PA 3VJOA 4DFBA 2C1AA 4GK4A 4KD1A 2ITTA 1M2PA 5AX3A 4ZZNA 3LM0A 2PPQA 2YA9A 3MPAA 3DTWA 4EJNA 4DFYA 5KMKA 5CI7A 2VTIA 4LMNA 2ESMA 3WZJA 2E2BA 5FEQA 5CYIA 5EG3A 5AA9A 2XB7A 2H6DA 2CLXA 3UE4A 1E1XA 2C6LA 2ZV8A 2IN6A 3NYOA 2GNGA 2C1BA 3VWAA 2JD5A 2WTWA 4H39A 3VUKA 3G90X 5E8YA 3DJ6A 1ZAOA 4RT7A 4QMXA 3RKBA 4FVPA 5E9EA 4UBAA 4O4EA 3NEWA 4IIRA 3MB6A 4FYOA 3ZRKA 1MRUA 3KULA 3NNVA 2WTIA 4GU6A 1S9IA 4HCVA 4TNBA 4YJRA 2QOBA 1IA9A 1JKKA 1NA7A 5A9UA 3C13A 3FQSA 4YJUA 4F09A 4WHZA 5DFPA 4GKHA 2WMTA 2BFYA 3W8QA 3QCYA 3FZTA 4UN0C 4FTUA 5CT7A 5DR2A 3TXOA 3W2SA 2Z2WA 3VNTA 3CTHA 1HCLA 4HVDA 4M66A 3BKBA 4GFOA 4IX3A 1NT2A 4JAJA 4U40A 5EHLA 4KRCA 5E8SA 4AN2A 3AG9A 2BRGA 4AZTA 4QMNA 4AXCA 3R7IA 1OL7A 2JFMA 5GZAA 5DRDA 4RVLA 4B9DA 4PL4A 2JKOA 4OT6A 2JLDA 3LFDA 4OW8A 4I3ZA 2VWIA 2XNEA 4QP7A 3MW1A 4GFGA 1OPLA 3ELJA 3L9PA 4H3PA 4IAAA 2UZTA 4FV2A 5TF9A 4QQCA 5EM6A 4FL2A 3LCDA 5K0XA 5E90A 1CKJA 3AQVA 3D15A 2QR8A 5HICA 4OAVB 3MBLA 4BDAA 1XKKA 4C35A 1H25A 4NZWB 3VS5A 3QXPA 4UWYA 3CD3A 2VNWA 3H9FA 2JAMA 5LMBA 3HKOA 3OXIA 4K18A 2IW8A 2XKEA 5C4KA 2YWPA 5AUVA 5J79A 4BB4A 4DGMA 3EOCA 4BCJA 4JAIA 2B4SB 2QOCA 4CMTA 1ZYLA 5DOSA 5DN3A 5H9BA 2I6LA 3NCGA 4XG4A 3ROYA 3FKLA 1W82A 4A4XA 3SOCA 3TV6A 2ZB0A 1R0EA 4C36A 4BCNA 4D4RA 3PWDA 5CSVA 4KUJA 2PUUA 4V0GA 5ETIA 3KXMA 2OFVA 3LCKA 4ZTNA 2ACXA 4H1MA 4L7SA 3R9RA 4E6CA 4YJOA 5HD7A 1XH6A 2QI8A 5KZIA 1OGUA 2GTMA 3M1SA 3G33A 2B55A 2BMCA 4S32A 5DEYA 2ITVA 4XMOA 4O7LA 4WSYA 3SAYA 4C4GA 2V5QA 4RWLA 3VUIA 3C0GA 3QQGA 4L8MA 4FUXA 5HE2A 3WIKA 2WNTA 3QCXA 4AFEA 1OPJA 1V0OA 4O38A 3UP7A 2BKZA 5DI1A 5HX8A 3GUBA 3BBTB 2W4JA 5J8IA 2B9FA 3GP0A 3PY3A 3HMMA 2CMWA 4H3BA 4QMWA 4YTCA 1OKWA 3RPYA 4DC2A 3VUHA 3OMVA 4EOPA 5CF6A 2XAMA 5AAEA 4RC2A 2XUUA 3POZA 2UZBA 4EH3A 5D1JA 3ZLYA 1SYKA 3KMUA 3QYZA 2HYYA 2WHBA 3QQUA 4S31A 2YITA 1KE5A 4FZDB 2R2PA 3TJDA 4AT4A 3Q2JA 1UU9A 4YC3A 4ZSLA 4BGQA 4FTTA 2YN8A 4D58A 2R3MA 2AYPA 4BICA 3RCDA 3WZEA 3LJ0A 4HVIA 4MH7A 5KMMA 4FIIA 3DDPA 5HE1A 4EZ7A 2WTKC 5LQFA 1XMLA 4NT4A 5KMOA 4QTEA 4AOTA 5DEWA 1J1BA 3O51A 4O81A 1PXMA 1OBGA 1OI9A 4RX8A 4R7BA 3MPMA 3PXFA 3E93A 4E6DA 4FTMA 2UW0A 3PIXA 2OJFE 3QC4A 4C3FA 2QO2A 4QYYA 5FGKA 3COMA 4XLVA 5TE0A 5HESA 1DI8A 2RL5A 3R28A 3NW7A 4FTAA 4IB0A 3DAKA 4YZNA 5CTPA 4I0SA 1PRYA 4AZSA 3NPCA 4QYHA 2UZLA 5HLNA 2UW6A 4NFMA 4DFXE 4UALA 1TZDA 4O0RA 4RIXA 3EFLA 4UWBA 5ETCA 5HNBA 1YHSA 4KSPA 4C61A 3OFMA 4OLIA 2X2KA 3P78A 4A9YA 2HW6A 3LQ8A 5AA8A 3NFGB 5CSXA 3MH2A 2A27A 4G6OA 4RA4A 3ZSIA 4XHKB 4MCVA 2REIA 2HZIA 1WVWA 3LMHA 4R7HA 1JOWB 5F20A 3MWUA 3FSKA 3M42A 2Y4IC 1R78A 2XNNA 3AD5A 2A4LA 4EKLA 4UMTA 4RA5A 2QKRA 4UMQA 4LL0A 1IEPA 3CPBA 2OIDA 4EH2A 3BE9A 4FTLA 2JIIA 2VTPA 5AEPA 1IAHA 5JRQA 2UW8A 5EH0A 4F7JA 4X2JA 5D41A 3RGFA 4RZWA 3OF0A 4UYAA 2G1TA 4HVHA 2B0QA 3MH3A 3FQHA 3POOA 3QQFA 4FKIA 2G2HA 3D94A 4KKEA 1TQIA 3FMJA 3QWJA 5D12A 2ONLA 2X2LA 3F5XA 4YBJA 5L8KA 2GS7A 3B2WA 4RLLA 2PZPA 3KY2A 1Q61A 4BRXA 3SG8A 3V6SA 1PXIA 3LAUA 3TJCA 2YEXA 3ZDIA 4H05A 4FZAB 2OFUA 4KKGA 1ZY5A 4D2TA 5M4FA 3W8LA 2BAKA 3ZTXA 4ZSAA 3VJNA 2Q0BA 2QD9A 3F69A 4PMTA 4XG7A 3VS3A 4C33A 4DH8A 5FQDC 3OOMA 3AT3A 5HGIA 3DNEA 4AGDA 4BL1A 3IONA 3DK7A 3NS9A 3PXKA 4LL5A 4QMOA 4RJ7A 5IEVA 4RFMA 2XNMA 1H00A 3BYOA 4HYUA 3LFSA 4ID7A 4XV3A 3GXLA 4NK9A 1Y6BA 2IZSA 3HUCA 2I0VA 4E5AX 2VO6A 3DCVA 4I4EA 3S95A 2CN5A 4IC7A 4DEAA 2H9VA 4ZZOA 4RRVA 3F7ZA 3HRCA 5I3RA 5J7HA 3Q3BA 3ZS5A 1Q62A 4K2RA 3JVRA 3O2MA 2C6DA 4QPAA 5L3AA 3ATTA 4MXOA 4ITHA 4Y46A 2BVAA 5HVJA 3W0MA 2YLEA 4AN3A 1HOWA 3OOGA 4RGJA 5KE0A 4FR4A 3MB7A 4WD5A 3I81A 3EQIA 4CTBA 4GIIA 5HIDA 2WU6A 5CY3A 1J91A 4AZEA 1URCA 4PTGA 4D2VA 1GIIA 4I6FA 4FIGA 4GMYA 4UV0A 3T3UA 4FSNA 2AQXA 3FDNA 2EXCX 3FJQE 4U97A 4EQUA 5CU2A 3ZO2A 4O7VA 4QDEA 4WUAA 5FEEA 4F4PA 5TT7A 2B54A 2R0UA 4I1ZA 3MIAA 5EQYA 2JDRA 1SNXA 3GB2A 2RFNA 4TWNA 1MUOA 4TKSA 3AMYA 3EZRA 4KIKB 2FA2A 3OZ6A 3TZMA 2PUIA 5D10A 1J1CA 4JDJA 4YZDA 2BZJA 2O3PA 2NPQA 3QAME 1NY3A 3EKNA 5DT3A 3UOKA 2FSMX 5HIBA 3F88A 5EQEA 4M67A 3VS0A 1R3CA 4RIYA 3WZKA 4YSJA 2HXQA 4U44A 4ZTRA 3L9NA 3NUUA 4ZMEA 2Z7LA 3U6IA 3PIYA 4HGLA 3ULIA 5LMKA 2W1FA 4D28A 4MQ1A 5IA4A 3QZGA 4OTRA 3QFVA 4LOQA 2HY0A 3C7QA 3FLQA 5BVOA 1Y8YA 2HELA 1JVPP 3QU0A 5A6OA 3CIKA 4CMUA 4AOJA 3R63A 3EN4A 1OUYA 4O4FA 3BBWA 3JVSA 2OF2A 4Y5QA 2JKKA 5LCJA 1ZMUA 3NYXA 3Q4CA 4R3PA 5E8ZA 5F9EA 2CJMA 3P9JA 3ZZWA 4YC6A 2X6DA 4U9AA 2QU6A 4BI1A 2R3LA 4LV8A 4I0RA 1Q3WA 2HENA 2C5XA 2FO0A 3V8SA 4ENYA 4APCA 3K5VA 4CD0A 3OWKA 1XH4A 2VTAA 5DWRA 2HW7A 2KTYA 1Q8TA 5KMJA 1F5QA 1ZYCA 4EBVA 1LEZA 2OJ9A 4L9IA 3Q60A 4O0YA 5AV0A 3PPZA 3W2CA 5J1WA 1BL7A 3QXOA 5EYMA 5FDPA 3W55A 5HZNA 3QCSA 5HE0A 2VN9A 3OEFX 3DAJA 4OBPA 3D7ZA 4O0VA 4C8BA 5CU4A 2GFCA 4L68A 5IQEA 2O2UA 3RWPA 4XV9A 5CU0A 5FG8A 2ITOA 4XS2A 1LEWA 2VO7A 2VNYA 4N0SA 4RFYA 4FV5A 2IEWA 4XP3A 4PNKA 3N4VA 4EK5A 4FKWA 2P3GX 4KSQA 2C3JA 3NFFB 3RMFA 2UZWE 5JFXA 3EFWA 3GC0A 5HNGA 1YQJA 3PG3A 4Q2AA 5CF8A 2JKMA 1ZLTA 5C27A 2QLQA 3BZ3A 4CGAA 3L1SA 1WBWA 3I6UA 5A54A 3PXZA 3ORNA 5CNNA 4C4JA 4EC9A 3W0NA 2I0HA 3A8WA 3BX5A 4I4FA 3GT8A 5JQ5A 4ZY4A 4PRJA 2CLQA 3FYJX 4ASZA 2PK9A 3TUDA 4O7NA 2YABA 1GOLA 2WQOA 2CPKE 3MH0A 2BRBA 1FGKA 5E8TA 4IANA 2AEGA 1OIRA 4S30A 3NDMA 4XP0A 5DPVA 1WBSA 1ZOHA 1KE8A 2YDKA 3TTJA 4NIFB 5ICPA 4BCOA 1M7QA 4E4NA 3GCQA 5M55A 4BBMA 4U8ZA 2J0JA 3NSZA 4KS8A 3FC1X 5ANKA 2HZ4A 2SRCA 2PE0A 3D7TB 3JS2A 2XRWA 2IZRA 2NRYA 4MF0A 4QYFA 2BRMA 2ZMCA 4AZWA 3KXZA 3FBVA 1YW2A 1KSWA 2YACA 1WBTA 3E8NA 2X4ZA 5CLPA 5JRSA 2GDOA 5C8MA 4FTNA 3GU8A 4U41A 1Q8UA 4C02A 4KS7A 4Q5HA 4ASXA 5FTGA 4FTOA 5HX6A 1JKLA 5J7BA 2F2CB 3COIA 4P5ZA 4ZEGA 4QT1A 1EH4A 2VTMA 4IAKA 3SVVA 2WGJA 5CEQA 4MNEA 2GQSA 4V05A 4C37A 4DHJA 4YZCA 4BJJA 3PXRA 3FC2A 5CAPA 2AC3A 4FNYA 4B8MA 4C3PA 3DU8A 4IMYA 2YZAA 4M3QA 3DPKA 4IAFA 3W10A 4OR5A 2CGWA 3W0PA 1VYZA 2W7XA 4PPCA 5D11A 4BCPA 3TNIA 2PZ5A 5ANJA 4Z7HA 4GFMA 2NO3A 2F2UA 5HTBA 4YC8A 5M08A 2ZYBA 4QO9A 3CCNA 4RJ5A 4R1YA 2BAQA 3OD6X 4O0WA 3U87A 1O6LA 4ZZMA 3ZUVA 3P79A 3PSDA 4HJOA 1SVEA 2LGCA 3FXZA 4B7TA 5C1QB 5JK3A 3BHUA 1M7NA 3R1SA 1WBPA 2YM3A 2PY3A 4O96A 1YHWA 4LRKA 4E26A 3DJ5A 3AC2A 4TW9A 4L3JA 4E20A 5GIPE 4I6BA 2QOOA 4D4VA 4QTDA 4ZIMA 2E9PA 4R3CA 3K3IA 5HCYA 4UMRA 2WMWA 3T3VA 2XNBA 4F63A 4CKIA 3D5WA 1U5QA 3FXXA 4WRSA 4GEOA 3M11A 4CNHA 4IVDA 3PG1A 3E64A 4GVAA 2OU7A 3W0OA 2CGVA 4DCEA 4TTHB 1AQ1A 2J90A 4FSZA 1QMZA 5EYDA 3G5DA 4K9YA 2O5KA 2XF0A 4NJDA 2X39A 3EKKA 3PFYA 4GJ3A 3R1YA 1GJOA 5H2UA 5BYLA 2FGIA 5CVFA 1FPUA 2Z60A 4UZHA 5AADA 2PE2A 4FIFA 1SM2A 3TIZA 4A7CA 3HAVA 4O7SA 2DUVA 4M14A 2IW6A 3F82A 4TYGA 2Z7RA 3PJ3A 5HTCA 2OWBA 3NUYA 4PDSA 3CR0A 5TR6A 4FEXA 5LVMA 3OP5A 4EOIA 3TZ9A 4BZDA 4DGGA 4X21A 4Y8DA 3ZEPA 3OG7A 1GZNA 3JY0A 4ZSJA 2VTQA 3QWKA 4FI1A 5AR7A 4RMZA 4YTHA 4UMUA 3JYAA 2BALA 2UW9A 2CKPA 3UDBA 4ZY5A 1P4FA 3EWHA 1IG1A 3MFTA 2OXXA 4XOZA 1FINA 4I94A 3UYSA 1UU7A 3OTUA 4FT9A 5D9HA 3D5UA 2YAAA 4B99A 3ACJA 4HCUA 4FEWA 3ANRA 2O8YA 3DBCA 2HY81 4HPTE 4XG6A 2IVUA 3HV3A 2C47A 3TDVA 4HYIA 4IX5A 4N6ZA 2C5VA 5KHWA 4GK2A 2OF4A 5FEDA 1PY5A 3P0MA 4O4CA 4C7TA 2XMYA 3HYHA 3QC9A 2YM7A 4YSMA 3P7AA 4EHEA 1CKIA 2C3LA 5DR6A 4BCHA 4C57A 4FT0A 5DMZA 2UZVA 4L44A 5AP3A 3D83A 3P08A 3ZFYA 2W9FB 4TL0A 2QOLA 4PP7A 2A0CX 4ZS4A 1KOBA 3LCOA 3OS3A 4RJ8A 4FZFB 1XH5A 2GS2A 4BKJA 1M17A 4X3FC 2YCQA 3HRBA 3Q4UA 3RAHA 4QTCA 4KNBA 2B52A 3DV3A 4QQJA 4CG9A 4LQMA 5ACKA 4FSQA 4F64A 3IW5A 2HWOA 5ANEA 5IQCA 3L8XA 4C0TA 5DRBA 4UEUA 1DM2A 3EL7A 4FTRA 4JLCA 4QDVA 2XRUA 1GZ8A 1Y91A 3UP2A 4U80A 2YIYA 3TWJA 4ANSA 2PMIA 3H10A 2OI4X 2CKQA 2IPXA 4EEVA 4QP4A 4L67A 4USEA 3OW4A 4JOAA 5LXMA 5EFQA 5BMSA 3OBGA 3MVJA 3PSBA 2ZV2A 2YLFA 4AT3A 4DYMA 3LCTA 4FSMA 4TZRA 5M44A 2Z7QA 3FZ1A 1A9UA 3F3ZA 4O1OA 1A48A 4FIJA 3Q9XA 3PJ8A 2R3OA 2WD1A 3HMPA 5HE3A 3QTZA 3ORZA 2QKWB 1JLUE 2XALA 4XV2A 2VV9A 1OMWA 5FXSA 5G6VA 2GNFA 4YJQA 2ZV7A 2XZSA 2FVDA 5ITAA 1H07A 3BL9A 2OH0E 3EL8A 2ZMDA 5FP6A 2W05A 4DAWA 4DT9A 5M56A 2GQGA 4ZTHA 1WBNA 4CZUA 2WEVA 3UPZA 4YP8A 3PP0A 2IVVA 4LOPA 3R9OA 3IPHA 4QQ5A 4USDA 4AW2A 4F9BA 4DH1A 5H8BA 4U6RA 2W1HA 3UZRA 4RIWB 1L3RE 3HVCA 4XG8A 3A60A 3O7LB 5IUGA 4GT5A 4K11A 1URWA 3KK8A 2X0QA 3R8ZA 2FSOX 3KL8A 5LOHA 4AXDA 4QEBA 3BIZA 4JBOA 3I1AA 3QRUA 5HLWA 2NNWB 2JIUA 1XQZA 4FIEA 5CQUA 5BQ0A 3T8OA 3VBTA 4FEUA 4O91A 3TEIA 5CU3A 2J4ZA 3IDBA 3RZBA 3OXZA 3BU5A 4EWHA 1O6YA 2UZOA 3EQBA 3W1FA 4QMQA 5C8NA 3P7CA 5IA1A 5CX9A 3BE2A 3I7CA 3UNZA 3E62A 3VS2A 4AZFA 1H26A 2BUJA 3A2CA 3UOJA 2ITXA 3B8QA 3D2KA 1WCCA 3LFCA 2PMOX 3G9LX 1WVXA 2QO9A 3HP5A 1Y57A 4RBLA 2PE1A 4IW0A 3W0RA 3BHYA 1ZZLA 1QPCA 4BYJA 3QHWA 3ZUTA 4G5JA 3AT4A 1W0XC 2C5OA 4OUCA 4J7BA 4D1SA 4D9TA 3A7GA 1KUTA 4O7WA 5A4LA 2G15A 3I5ZA 3SOAA 3WF8A 2ITZA 2GHMA 3C1XA 3FY0A 1Q99A 3A7FA 3WYXA 2BDFA 4CRLA 4AA5A 5FUTA 3CSVA