1H8FA

Glycogen synthase kinase 3 beta.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
352
structure length
352
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Crystal Structure of Glycogen Synthase Kinase 3Beta . Structural Basis for Phosphate-Primed Substrate Specificity and Autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 103
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1h8fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1h8fA01
2C6OA 2J0MB 4QQ5A 4UBAA 3B2TA 2HWPA 5CZIA 4CFWA 3HAVA 4TL0A 2ITUA 4Z16A 3C9WA 3V6SA 3G6GA 2PUIA 4BVUA 3O7LD 4JBVA 4EH2A 3UQCA 2QOQA 3V5LA 3IDCA 2ONLC 3Q60A 3QKKA 4GJ2A 1P5EA 5A9UA 3FMNA 4O38A 4JVGA 4XG4A 5BVOA 5C8NA 4GVJA 3R2YA 5F1ZA 2W1IA 4XV3A 2GNJA 2YEXA 5CU2A 5AR2A 1OIUA 2XS0A 3IGOA 3I7BA 3TTIA 4NL0A 4M8TA 4NK9A 4RWKA 5FXSA 3EFWA 2X7FA 3G6HA 3GC7A 3FL4A 2BCJA 2O2UA 3WZUA 5BPYA 3EB0A 2Q0NA 4D2SA 4EOPA 3GCVA 4RC3A 3FLSA 2RGPA 2J5FA 3E88A 1PY5A 3IW5A 3FHRA 4K77A 4EC9A 3ORIA 4HJOA 3R9HA 2QODA 4Y72A 3HA8A 3RWQA 4IZ7A 2WU6A 1OPJA 1PMEA 3QRKA 3PRIA 2WMWA 4RWJA 4JXFA 4XP3A 5C4KA 2B52A 5FM2A 4IAYA 3BHTA 3PXQA 3Q2JA 3H9RA 3PWDA 5KNJA 3FSFA 3W2PA 1YHWA 4LI5A 4G3EA 3GQLA 3UO4A 4OBOA 3ACKA 3ZUUA 3H9OA 4DEBA 2UW9A 4YTCA 3VN9A 4D0XA 4LMUA 5A54A 1EH4A 4D2TA 2VGOA 4G3DA 2QD9A 5FP5A 4E6CA 1SM2A 4O0TA 2CHLA 2ETRA 3OBGA 1XH9A 1SVGA 1SYKA 3VW8A 1CM8A 5K3YA 2XVDA 3EFJA 4P2KA 3UVRA 5IH5A 4QT1A 1F5QA 5CSHA 1RQQA 3DAEA 4HPTE 4XP2A 3C4EA 3R8UA 2W1FA 3O8UA 5M56A 5GZAA 4DG2E 4USEA 5AIRA 3OW4A 5HKMA 1ZLTA 3RNIA 2EU9A 4C2WA 4ERKA 4GT4A 3GUBA 4GKHA 5KMIA 1TQPA 4GJ3A 4ZLOA 5IUHA 4WT6A 2ITVA 3I4BA 2BVAA 4FYNA 4U45A 3RBWA 3RPOA 2RFDA 4O1PA 3QALE 5HI2A 4I6HA 3R8MA 3R0TA 2VAGA 2ZB0A 4IAAA 4FNYA 4DFYA 2J6MA 4PDSA 3QU0A 4DCAA 4XG9A 3QD3A 2WQMA 2V5QA 3ZFXA 4NUSA 4PMPA 3FLNC 5F95A 3TDVA 1OITA 4FSWA 3R21A 4O86A 2SRCA 4WBOA 5GJDA 3DKOA 4FT7A 2C5XA 2QO7A 4TT7A 2GTMA 3ENMA 3T8OA 4KS7A 1JKTA 3QC4A 3MVLA 3FV8A 5HGIA 1Z5MA 4HGTA 4EONA 1HOWA 2E9VA 1FQ1B 3C4CA 4NKAA 4XUFA 4A9RA 3BHUA 4M84A 3F7WA 3DFCB 1B6CB 2RL5A 4XG6A 5A46A 1KE8A 4GH2A 4ARKA 2PPQA 4BHZA 4AGCA 3JUHA 4YJTA 4E7WA 2WTCA 2ITTA 3DAJA 2RG5A 2VU3A 4TTHB 5DRBA 3ZU7A 4BY9E 2RKUA 2HY0A 1QPDA 4XX9A 2QOOA 5IQHA 1WCCA 4NFNA 3LXLA 3FPMA 4L9IA 3OCSA 1LEWA 4OT6A 2GSFA 5L8JA 5JMSA 2VV9A 4K1BA 3UZTA 3D9VA 3GXLA 3QTZA 2XYUA 2PHKA 2PVYA 2JDRA 3L8XA 3O8PA 4IB0A 4K33A 3RPRA 3VUDA 4CEGA 2GS6A 5IQDA 4K6ZA 3ZFYA 2UW6A 2NNWB 4D4YA 5JKGA 3R1YA 5J95A 4AT3A 4EBWA 2BDJA 4M14A 4C36A 2P2IA 4A4LA 3EOCA 3GC0A 3WYYA 4EEVA 2VTLA 3H10A 3QA0A 5LVMA 3EZVA 3BBWA 2WQEA 5ANEA 3W8QA 4AZWA 5HTBA 1XBCA 3LMIA 4QYFA 5EYDA 4FTQA 1UU3A 3B2WA 3R2BA 2CNUA 4BCQA 4E4MA 5BVEA 2GQGA 2FGIA 4X2FA 4WSYA 3LM0A 2A2AA 3DTWA 3QKLA 5FEQA 4AW1A 2XNGA 2FH9A 2VO7A 4FTJA 4FV5A 4XBRA 4FUYA 2CSNA 1CDKA 4XG3A 4D5HA 1OUKA 2WHBA 3NYXA 5IQAA 1ZZLA 2JAMA 3TV7A 1XBAA 3NIEA 4MXOA 4AZVA 5CT0A 5HO7A 2XJ1A 3MA3A 4CFVA 4IDVA 4FK3A 2BZIB 3ELJA 3PXZA 4GYIA 4HYUA 4OBPA 4OR5A 4BCFA 4RIWA 2JIIA 4JQ8A 4PMTA 3L9MA 4S34A 3V01A 1H28A 3CTQA 3OHTA 5C01A 4O82A 4APCA 3R01A 4GFMA 1YOMA 2PY3A 4TWNA 2BZKB 5LVNA 3PA5A 3O2MA 3PIYA 3MVJA 3MI9A 1RDQE 4FKJA 3EKKA 3LFCA 5DG5A 3E5AA 3ITZA 1XQZA 5J7BA 4I94A 1UNHA 3NW6A 2C30A 3DA6A 4RPVA 5HEZA 5CI7A 4FKRA 4WRSA 2AC5A 3ZRKA 2PVJA 2P33A 3F61A 4D1ZA 4EOIA 3UC4A 5CAQA 4FK6A 4UWYA 3D5VA 4XOYA 5FQDC 4FIJA 3FMDA 2VWYA 3LFFA 5EOBA 4NJ3A 4X3FC 1U4DA 2C3JA 3AC1A 4FVRA 1BMKA 4L45A 4S2ZA 2C6DA 5J9ZA 1UWHA 3I79A 3OXZA 2WAJA 5CVGA 5FTOA 3P08A 4NCTA 5M4IA 2JFLA 4E3CA 4FUXA 3NRMA 1NXKA 3QWKA 3QZHA 4APPA 4KIQA 2B9JA 4QMVA 1HCKA 4ENXA 4EK5A 2QO2A 4YNOA 4IVBA 1IR3A 3P9JA 5HG9A 5HE3A 3QTXA 4BIEA 2O8YA 2VWZA 4E73A 4H58A 3VUKA 2OH4A 3R04A 2XKEA 3NUPA 3GVUA 4WOVA 3SOAA 2WMVA 4FOCA 1IASA 3C0GA 4ANMA 5E4HA 2OSCA 4W8EA 4YPDA 5E8TA 3WI6A 4C4IA 4F7SA 3Q52A 1U54A 3NGAA 4AA5A 3VF9A 4A4XA 4EORA 4I21A 4ENYA 4LRKA 1H0WA 4J99A 3QTRA 2XIRA 4O6EA 1H24A 2C3IB 3CGOA 3BYOA 3F6XA 1ZYDA 3FZOA 2Z8CA 3R1SA 4IWOA 3R9DA 2XK6A 1M2RA 2PVRA 3I5NA 1REKA 4MEDA 2UW0A 3Q4ZA 4MQ2A 4YZDA 3UMXA 4A7CA 2P3GX 3UC3A 4HZRA 3VBYA 4IX4A 4M68A 2IVUA 5M44A 2ERKA 4OW8A 3PY0A 4EHVA 2JDSA 4NM3A 4PQNA 1Q5KA 3C4WA 1ATPE 4NKSA 3LZBA 4Y73A 3RGFA 1NA7A 3GCSA 4R77A 5HX6A 1YWVA 3MN3A 4UZHA 3ORZA 4MBJA 4FIIA 3F5XA 3SRVA 3F82A 1H27A 2JDVA 4U97A 3VS4A 4XP0A 4MWIA 3BGZA 2GDOA 4O7TA 3UO6A 4LV8A 3E7OA 4HZSA 3UDBA 3EN9A 2I0HA 3EQRA 3RK9A 4C4JA 5AADA 3RJCA 2BAKA 4AE6A 3S1HA 5GHVA 2Z7SA 3QX2A 4H3QA 2WTJA 4DITA 1FMKA 3OUNB 2WMTA 3E87A 3MW1A 3JVRA 4IM2A 2UVXA 5KCVA 3OBJA 5HBEA 5CASA 4NW6A 4DFZE 1MQ4A 4BDDA 4ZZMA 4XLVA 3PY3A 3E7VA 3NUSA 4FV9A 5FEEA 2KTYA 4N4SA 5KUPA 5BYLA 2XNPA 2J0IA 4FSNA 4FEVA 2X0GA 4AOIA 2YIQA 2DUVA 3OD6X 2UZBA 5CY3A 5HICA 3VRZA 3EL8A 4USFA 5J1VA 3ZSHA 2A27A 3T9TA 3POOA 4BTMA 2C3KA 3DBEA 3EQCA 3OMVA 4JRVA 2O5KA 4K18A 5AP0A 4LL0A 2G1TA 5BUIA 2C68A 1BX6A 1J91A 2A1AB 3ZCLA 5IQIA 1H1WA 3L8SA 3W10A 4PL5A 5LXMA 5ITAA 2XIKA 4WRGA 4BI0A 4FV0A 4PL4A 1JSTA 3CIKA 3PZHA 5ANKA 1BL7A 4N57A 4FKGA 3ZXTA 5FDXA 2PVKA 3TKHA 4EHZA 4AW5A 4L67A 4YJRA 1U54B 4RSSA 3OOMA 4QMLA 5BVWA 4JRNA 2RG6A 4O7SA 2R7BA 3FY0A 3C5IA 4FTAA 2VTOA 4U6RA 3BU3A 5EHYA 3M2WA 1E9HA 5AUXA 4HCTA 4KIPA 5D9HA 3BBTB 4FT5A 2XMYA 4D2WA 2C0OA 3LCOA 4NTTA 1Q97A 4JQ7A 4ZTNA 2XK7A 1H1QA 3DBCA 3UQGA 5J5SA 1A06A 3NUXA 4AACA 3BV3A 5TR6A 4YURA 2QO9A 2BTSA 3A61A 2YJSA 4GIHA 4BHNA 4Q9ZA 1GZOA 4TKSA 4D1XA 3DNEA 3KXMA 4JNWA 3Q9WA 3CEKA 3NYOA 4KA3A 3ZBFA 4F09A 3ZRLA 3PA3A 1SNXA 3PRFA 4R8QA 5D7AA 5HD7A 2WB8A 5CYIA 1NY3A 1WBOA 2W5BA 4RA5A 5JRQA 1SZMA 3LIJA 4RVMA 4MBIA 3SRVB 4AAAA 4CRSA 2WOTA 2C4GA 4HYIA 4A07A 3KULA 4L7SA 4G5JA 4DEAA 5FM3A 1WBTA 3LE6A 4R3CA 4EHGA 3U9NA 5GZ9A 5HO6A 3OZ6A 3HMIA 4W4XA 4J53A 3RK5A 3RALA 4TPTA 4FV6A 4K11A 4UMTA 1IA8A 1OM1A 5AV2A 5JT2A 5CNNA 2CGXA 5KBQA 1Q8WA 2NO3A 4KUJA 5KX8A 4D28A 4BI2A 2PVNA 1O6YA 4HVDA 4QO9A 5EKOA 4O81A 4OTPA 3LFSA 5DBXA 4YLKA 4BKYA 3COMA 3MFRA 4A4OA 3KXGA 4HGSA 4FKSA 3MGYA 4Z7GA 3CQWA 5IDNA 3UIMA 4K9YA 5J7HA 3LJ2A 2JBOA 5AP4A 2QNJA 3OW3A 2VNWA 3ORLA 4EYMA 3PE2A 3UOLA 3CQUA 1R1WA 2NRUA 4Z9LA 4L3PA 4GVAA 5E8WA 5FGKA 4BB4A 1JKSA 4Z55A 4KBCA 1BYGA 4MF1A 3F69A 5B7VA 4QMWA 1Q4LA 4DTKA 3ORNA 4AGUA 5M08A 4BCGA 3UPXA 2ITQA 1BUHA 4IFCA 3VWAA 3ROYA 3U87A 2QONA 4QMPA 2QVSE 5CEIA 5HIEA 4QYHA 4FNWA 4ZTQA 3V8SA 5DPVA 2WD1A 5H9BA 2WXVA 4CFUA 5C1QB 2UZTA 3RNYA 5E1EA 4IMYA 1O6KA 5KKRC 4A9TA 1K3AA 3PVGA 3TNQB 3UYSA 2BDWA 3CPCA 3P86A 1JWHA 4IAFA 5KZ0A 3GU8A 3TZ9A 1IG1A 3NR9A 3W2QA 5C9CA 2J5EA 2YLEA 2J51A 2X9FA 3FZPA 3UOJA 1G8AA 2CKQA 4ZMFA 3ID6C 5B0XA 3FMKA 4EZ3A 2VWIA 5FLFA 5M07A 3LKMA 1OI9A 3DBDA 4ID7A 3EKNA 2PUNA 5AR5A 3KULB 5H8BA 3F88A 2X1NA 3U8WA 1WBWA 3VS3A 2X9EA 3PVBA 4RFMA 3GBZA 2XM9A 3DV3A 4EKKA 5EW9A 4ZIMA 2PU8A 2W1DA 1OKYA 1OKVA 4L01A 2XNOA 2GFCA 1FINA 3FLYA 3FYJX 4I0RA 3GCQA 1J3HA 3DJ6A 1ZYLA 4ZTSA 4FV4A 2UW8A 3Q4UA 2HWOA 4OT5A 4BKJA 1SVEA 2X2KA 4AA0A 3VAPA 3G15A 2OF2A 5KMJA 3MFUA 4BWXA 2C47A 3SD0A 4P90A 5CXHA 5IQCA 1JOWB 1YHSA 2C6LA 2R3LA 5AP5A 4ACDA 2ESMA 1ZXEA 3MIAA 4DGNA 2ZV9A 4CV8A 2FYSA 2ZMCA 2PZIA 3VUIA 4FT0A 4CCUA 2C5VA 4ZJVA 2JBPA 3IOKA 2XIYA 3DK3A 4FT3A 2W4OA 4LM5A 4JS8A 2A0CX 1KSWA 3NCGA 5EYCA 5I5ZA 4JJRA 4W8DA 4D58A 4G5PA 4QP4A 3GFWA 1Q24A 3RTPA 4DEIA 3C4ZA 5I9XA 4ZTLA 5LVLA 3OOGA 2AUHA 3AQVA 4CV9A 2PMOX 2WU7A 5IU2A 3A2CA 5ANOA 4EK6A 4BBEA 2QI8A 2CNQA 2R7IA 1OL5A 5AAFA 3AT3A 5EHOA 3MPAA 4PPAA 4JBQA 4DC2A 4HVSA 5DWRA 4RFYA 2F57A 4L00A 4LL5A 4S32A 2YFXA 4FSZA 4K2RA 4AA4A 5LMAA 2YISA 4M69A 3EQFA 1GAGA 4P5ZA 3RMFA 3TUCA 2PZYA 4XG2A 3CY2A 1UU7A 4C61A 3FEGA 5FDPA 3CQEA 1NW1A 4FE2A 4BC6A 3QUDA 1FMOE 3PIXA 3CS9A 4OTIA 1Q8UA 4FSMA 4DFUA 3AD4A 4NIFA 3KY2A 5I0BA 2ITNA 3TACA 2WQOA 3W16A 4FEWA 3SG9A 1PW2A 3QCSA 5JN2A 4C4EA 2AYPA 2W1CA 5DT3A 3LMHA 3WILA 3UIXA 4JAIA 4B4LA 3OWLA 5F9EA 5HG8A 2H96A 1PXOA 4B8LA 1PXLA 2YA9A 3B8RA 3RHXA 3UJGA 1ZY4A 3Q5IA 4JIAA 4W4WA 4DGLC 5IEVA 2YDJA 2PMLX 5HX8A 5ETCA 2EXMA 4NTSA 1QMZA 3TKIA 3UPZA 3FQEA 4YBKA 1OGUA 3JXWA 3EN4A 1O6LA 2BAQA 2P4IA 1Q41A 4KKHA 3ATTA 1Q62A 3I81A 4UX9A 2H8HA 3FYKX 4FV7A 4FV8A 2VO6A 1YWNA 1Q3DA 3TKUA 3KCKA 3R9RA 4S30A 2IN6A 1P2AA 1APME 2VWUA 4GFGA 5C26A 4DT8A 3ZEPA 2XKFA 2OK1A 4NW5A 5AJQA 5BX0A 5HZNA 2BIKB 3ZDUA 2RFNA 3KMMA 2XJ2A 5AA8A 3BX5A 3RZFA 2GNLA 4B8MA 4M3QA 3RAWA 5GZ8A 1KV2A 4TNDA 4HCVA 4BDEA 2G9XA 5JRSA 2CKEA 3EN5A 1E1XA 3P7BA 4E93A 4PP9A 3H0ZA 3QXOA 4AN9A 2WEVA 2YDIA 5CU4A 2ZDTA 4KS8A 5AAEA 1PXNA 3MY1A 5BNJA 5HCZA 4EZ5A 4F9CA 3TNIA 4DGGA 3SOCA 2CN8A 4KSPA 4LOPA 2YDKA 3RPVA 4IJPA 4PY1A 2JITA 3E93A 2YLFA 4FIFA 4XRJA 5HNBA 4R3RA 1JPAA 1KE5A 2P55A 2GS7A 2W9FB 3CP9A 5AR3A 3ULIA 3WF7A 1QL6A 3PIZA 1ZRZA 4TN6A 2E9PA 2JGZA 3H4JA 3NYNA 4WUNA 1PXMA 2BALA 5BVKA 3FPQA 3EQDA 3HV3A 1PXIA 4BCIA 5A4QA 1YDTE 2B9FA 1YQJA 2QKRA 4H1JA 2QU5A 2V0DA 2PMNX 3S95A 1IA9A 1YDSE 4M69B 2C0TA 5D7VA 3KRLA 4I22A 2UVYA 3C4XA 3BPRA 3ZO2A 3TDWA 3WF5A 1H26A 2G01A 3LCSA 4DAWA 1QPCA 2ETMA 2QQ7A 3F2AA 1M2QA 4UWCA 4NIFB 2YM4A 2ZVAA 2YJRA 4DN5A 3O8TA 5IA1A 1M7QA 2XNEA 4YLJA 3PWYA 3ZM4A 2Q83A 3PUPA 4EQCA 3VNTA 2VX3A 5A6NA 1YOJA 3MFSA 4YLLA 2YM3A 4EUTA 4ZJIA 1GOLA 3GCUA 4FVPA 2PZPA 3SLSA 4ALVA 3MJ1A 4F9YA 3LLAA 3UGCA 3MDYA 2ZV2A 3FZRA 2XZSA 1OL1A 2JKQA 2X6DA 3OFMA 3QRUA 4KABA 4L46A 4Y8DA 2IW8A 3RPSA 4BDBA 4BYJA 3OEFX 1A48A 2CKOA 2CKPA 4CQEA 4KWPA 3HRFA 2WQBA 4TY1A 1OVEA 1ZMUA 5F4NA 3TCPA 2VWVA 4YJUA 4ASZA 2RF9A 4C7TA 1H1PA 1V0OA 5JGBA 5LMKA 5HE1A 3DCVA 3EFLA 5J87A 2ACXA 2X4ZA 4FTKA 4YC8A 4ACHA 4CZYB 4E5WA 3TZMA 3DS6A 3NPCA 4S33A 2HYYA 2Z2WA 3FUPA 2CPKE 4FG9A 2OF4A 4QP2A 4R1YA 4H3BA 3ZDIA 4MD8E 4WNKA 3QLFA 3TXOA 1YVJA 2C0IA 4ERWA 3CLYA 3PPZA 4BZOA 3MH2A 4BR3A 3M1SA 4X3JA 2ETKA 3CTJA 4CZTA 2Y0AA 3OVVA 4L44A 2G2HA 4DFBA 4WNMA 3NUUA 3TZ7A 5E8SA 4QMOA 3ZO4A 4ZS4A 4L7FA 3A7HA 2V22A 3VVHA 4DEGA 1DI9A 1WMKA 4O1OA 2YCQA 2Q0BA 4FKIA 5CI6A 4V04A 1ZYCA 2IW9A 4BCMA 4UMQA 4BI1A 5LOHA 4O7NA 5GIPE 3MPMA 4IWDA 4DE4A 2BZHB 5AV4A 3T3UA 3DJ5A 5EQEA 5AFVA 1R78A 1V1KA 4FYOA 2GU8A 4PTCA 5IQFA 3ETAA 4ZY4A 2H9VA 2VO3A 3NVKI 3Q9XA 4KKEA 5M55A 4QQCA 3PSBA 1PHKA 1YI4A 1Z57A 1OIQA 3SXSA 5BQ0A 5CSXA 1PYEA 2W9ZB 3AC5A 3QZFA 5TF9A 1I09A 2R3OA 3LFDA 4G31A 2J0LA 4WG3A 4BL1A 3UOHA 4CKJA 4JR3A 2F9GA 5IA2A 4A06A 5IA5A 1GZNA 2YCRA 3ATSA 3NVMB 4C8BA 4CVAA 1ZWSA 3FHIA 2Y7JA 4FC0A 4C58A 4O2ZA 3GB2A 2FSLX 4DEEA 5J9LA 2ZM1A 4O0UA 3FMJA 2HZNA 4AZEA 4X21A 4PTEA 2CDZA 2X4FA 3HUCA 4YZCA 2PMIA 4FKVA 5KMNA 5DEWA 3QX4A 2VTMA 3P5KA 3VUTA 5A4EA 1G8SA 3HECA 2C6EA 3KQ7A 5BMMA 5HIBA 3ZUVA 2IPXA 3SV0A 3EFKA 2WZJA 1Z9XA 3HAMA 4FL2A 4D1SA 3IKAA 2AC3A 5AUWA 3KRJA 3UNJA 2Y4IC 3MA6A 5H2UA 4TWPA 1E1VA 3GGFA 4FNZA 4WG5A 3CD8A 3UYTA 4O0XA 1NT2A 3ORKA 4F7LA 5EKNA 3DQWA 4AOTA 3D94A 3JY0A 3I7CA 3OF0A 3PJ3A 4U81A 3HV7A 5CQUA 4MQ1A 5JSMA 2JC6A 2XK9A 3OTUA 3CKXA 4O0YA 3EMGA 4YSMA 3Q4TA 4L43A 4ZSGA 1OPKA 2R5TA 3GQIA 4F9AA 1OB3A 4CFFA 4ZJJA 4CCBA 4AFJA 4ZK5A 4X0MA 3RCJA 4JBOA 4YU2A 1WBVA 2B55A 3F66A 4EOQA 4IQ6A 5EM8A 1MRVA 4W4VA 1PMVA 3BGQA 2ITYA 2QOIA 1J7LA 4QMZA 3VHKA 1AQ1A 4JL9A 5HTIA 3PLAE 2R3JA 3C0IA 2OWBA 4WNPA 5M06A 2WQNA 3UODA 3C5UA 3Q32A 1XJDA 4Q9SA 3KN6A 5EYKA 3MFTA 3DT1A 5LWNA 3PDTA 3IW7A 4FBXA 5AP2A 4FODA 2OXYA 2V62A 4YBJA 2GNFA 2UW3A 2XK4A 2R3MA 3VS1A 4TWCA 5CXZA 2HXLA 4QNYA 3FI3A 3O51A 4UZDA 2OBJA 2YIWA 3NAYA 4BN1A 4GEOA 4EQUA 3L9LA 4HGLA 4AF3A 3EN6A 5HO8A 2W4JA 3RP9A 3ZH8A 3PSCA 4WO5A 3CJFA 4FIEA 2OJIA 2IZRA 3BEGA 4BRXA 2VTSA 2C5OA 3Q6WA 4OTQA 2W06A 3MWUA 2YABA 4IFGA 4PDPA 5HNGA 3VBWA 4G3GA 4XV9A 4MXCA 4NT4A 4UXQA 2WTKC 3OXTA 5ACKA 4YO4A 4C35A 4EK3A 4YTIA 2QOKA 2C3LA 2NP8A 2BRGA 3ANRA 5AWMA 4F70A 1SNUA 1ND4A 5LQFA 5CALA 3HMOA 4I4FA 4IB5A 1RW8A 3EJ1A 3QC9A 2W17A 5KMLA 2QG7A 1OUYA 2E2BA 4DFLA 3SHEA 2V7OA 3OWJA 3PPKA 1STCE 3ZYAA 4BICA 2OO8X 4BKZA 1UKHA 3WF6A 5I9ZA 4JOAA 4C3FA 1K9AA 2O0UA 5G6VA 4J71A 3ROCA 2IZSA 2BUJA 4FTRA 4FMQA 3S3IA 4CD0A 5T68A 3PJCA 5HVKA 5FTGA 1FGIA 4PDOA 3W32A 2EXCX 2NPQA 5EFQA 2JFMA 4E6DA 5LMBA 3ULZA 1H07A 3BELA 5CVHA 4GS6A 5CZHA 3AMYA 3ZUTA 2QOFA 1GY3A 2OJJA 3A7IA 3FQSA 4XV2A 3IW8A 4QP9A 4FTOA 4ANQA 3D5XA 5IUIA 2J9MA 5BVDA 3JR1A 2BRMA 5DNRA 5AP3A 1H01A 4NFMA 3ZS5A 5AR7A 4AWIA 4E6AA 5JH6A 5LWMA 4LG4A 5EI6A 4E1ZA 1G3NA 4BGHA 1H1SA 4UB7A 3S2PA 4MCVA 2J90A 3F3VA 3LQ8A 1F3MC 3PY1A 4FL1A 5CU6A 4ZTRA 3SC1A 2GQRA 5EDQA 1FGKA 3GENA 4LOOA 3LPBA 1SMHA 3R02A 2XRWA 2ITPA 2W7XA 4P4CA 4FTCA 4DEHA 2REIA 3PA4A 4TW9A 3KA0A 4IHPA 4E8AA 2WTDA 3ZO1A 4FTIA 4BBMA 3NX8A 3DGKA 3OCTA 4X6RA 2ZV7A 3IOPA 3VUHA 3W55A 5LMKC 5DHJA 4EKLA 2YM6A 3FBVA 3VIDA 4F4PA 2PUUA 5CTPA 3VBXA 4ZAUA 5CEKA 5L8LA 2UZDA 4R1VA 2O63A 2R3FA 5DEYA 5K4JA 2FSTX 4U40A 1ZMWA 2ZB1A 1VR2A 4E4LA 4OAUC 3TZ8A 4HOKA 1BI7A 4G6LA 4EH9A 5IA4A 3OWKA 3IS5A 4EOSA 3HYHA 4P5QA 3RI1A 3KXZA 3VC4A 3KREA 1PMNA 4L42A 4I92A 4ITHA 3HVCA 1H00A 5C8MA 3DBFA 4GKIA 3HZTA 3BCEA 4X6QC 2UUEA 3U55A 3E8EA 2XCHA 3BHYA 4WBBB 3EWHA 3R22A 2F49A 3RKBA 1JVPP 1LP4A 3N4UA 1PMUA 4QTCA 4QNAA 1JNKA 2QCSA 2FSOX 2UZWE 3W8LA 3RK7A 2A19B 4ANSA 4CT2A 5JFWA 3LQ3A 4DEDA 5CF4A 5AX3A 4DH5A 2WNTA 1QPJA 3ZZWA 4FV3A 2W05A 4D4VA 2YWVA 4M7IA 1Q3WA 3DZOA 4J8NA 3A7FA 2HK5A 5C8KA 4C59A 4IXPA 5IA0A 2VTIA 3S00A 3W33A 3PJ2A 5LCJA 4USDA 4WA9A 1OKZA 2OG8A 3O17A 4FNXA 4XHKB 5L4QA 5A14A 4DGMA 2I0YA 4BCNA 4EH6A 1MP8A 3BGPA 1KE9A 3O50A 3NNXA 5IQBA 3NUYA 5CENA 4EH8A 5KO1A 4IVCA 5CLPA 2IW6A 3BE2A 3KC3A 4HPUE 4EWHA 4ZMEA 4I5CA 3UOKA 4RIYA 4RLKA 4YSJA 4I4EA 3QL8A 3DDPA 4G2FA 4IACA 4CFMA 2XEZA 2XK3A 4FZFB 3NS9A 1F0QA 3AT2A 4U8ZA 1XWSA 4BDIA 4D2RA 5CEOA 5GNKA 1WZYA 1J1BA 4PX6A 4FSUA 5BYZA 3MY0A 1O9UA 4BWKA 2UW4A 4EOOA 1UWJA 4KD1A 1AGWA 2I0EA 3MYGA 4I1ZA 2VTTA 3CSVA 2YM8A 1SVHA 3QUEA 3COIA 4JDKA 4C38A 4H05A 5A4CA 3FZ1A 4G3FA 1TVOA 4O22A 4OBQA 4QD6A 2ZV8A 2DYLA 2QLUA 5D1JA 3OCBA 5CT7A 4DTBA 4YJSA 3FSKA 2HW6A 4BDCA 2ZAZA 2QOCA 4GU9A 4FX3A 5ANIA 2LAVA 3LM5A 5HOAA 5E8YA 5A3XA 3FY2A 5D10A 3ANQA 2R2PA 3QRJA 1XKKA 2PZ5A 4GK2A 5DR6A 3VJNA 5I3RA 2WPAA 4EOKA 3OT3A 1XHAA 3QTUA 4GUEA 4DFNA 3H9FA 4RX9A 4CNHA 1OMWA 2XNBA 3L9NA 4EOJA 4KINA 5HQ0A 4O84A 3KMWA 3AXWA 4D2PA 2J4ZA 3RHKA 4KNBA 4N0SA 4IC7A 4OTRA 5HORA 4JDHA 3QRIA 5IA3A 3BQCA 3HX4A 4ZZOA 5M09A 3ERKA 2XNMA 3BV2A 3EYGA 3K2LA 5DH3A 4D4RA 3G90X 4LGDA 3TEIA 2HOGA 3DQXA 4QRCA 4FIHA 2YITA 4QMUA 3R83A 4C33A 4YJOA 1PKGA 5HTCA 3CC6A 1U5QA 3WYXA 4FKUA 4FTNA 5IH4A 4NM0A 2UZNA 4RC2A 3T3VA 2XRUA 1TKIA 4OLIA 4QTAA 4F6WA 3R63A 2ITOA 1VZOA 2RIOA 3HGKA 3DXQA 3C13A 3V8WA 5DFPA 1JBPE 2YIRA 3JVSA 3TI1A 2XBAA 4DHFA 3HMPA 3BLHA 3L1SA 4CLJA 2WMSA 4KRCA 4TZRA 3ODZX 1XH8A 3SX9A 2J0JA 1UNLA 3HUBA 4TYGA 4YGAA 1OZ1A 1GIJA 3NDMA 3VBTA 5K9IA 1ZMVA 4RIYB 5AV1A 3QGWA 2OFVA 2OJGA 2W99B 2OXDA 3FZTA 3LFBA 2VO0A 2XNNA 3NEWA 4BTJA 1MRUA 2Z7QA 2XF0A 3DFAA 3ZO3A 3RAIA 4LRJA 3HKOA 3H0YA 3NNWA 1OKWA 4LGHA 3FC2A 2GFSA 4I0SA 2R3RA 4F64A 1PXKA 4BDJA 3ZFMA 2C6IA 3U4UA 3E3BX 3F3TA 1JAMA 5CF5A 3MB6A 5AUTA 4QP6A 3K54A 4R7IA 4TYHA 3VUGA 5HHWA 1DAWA 2C6KA 4IWQA 4BCHA 3DXPA 1Y91A 4IAIA 4YJPA 3ZHPC 1W82A 2Y6MA 2OGVA 4II5A 3A7GA 4O96A 1NVQA 3LAUA 1XH4A 3QCYA 5EDRA 3QAME 5AM6A 2B1PA 3S0OA 3DLSA 2CGVA 4RA4A 4CSVA 5AEPA 3IDPA 5FTQA 1OL2A 3KF4A 4EK4A 2PYWA 4FVQA 5J9YA 1L3RE 2PWLA 3AC4A 3PXRA 5IZFA 4XRLA 3F3UA 5KMOA 3OC1A 4ZXTA 3R8LA 3HMMA 5JFVA 2B7AA 2VWWA 4O27B 3R6XA 4X2JA 4M66A 2V7AA 3ZLWA 3QTQA 2EUFB 2J0KA 4OTWA 4KIKA 1CKIA 1NVRA 3PFQA 4XOZA 1AD5A 2EB2A 3T9IA 4IDTA 4MYGA 2JKMA 2XIZA 3K5VA 3R71A 5HBHA 2OIQA 1GIIA 4G16A 3VBVA 4YJQA 2QHMA 4WD5A 2BFYA 2OZOA 4M97A 3EQPA 3ORMA 3QGYA 4PPBA 2ITWA 1UVRA 1M14A 2OU7A 5HVJA 4AE9A 4FIGA 2PVLA 5AUZA 4I20A 5HU9A 1Y8GA 2Z60A 4NWMA 4OAVB 2XBJA 3TTJA 3ZZEA 4WUAA 2EB3A 3A4OX 2ZYBA 3QWJA 1H25A 4IX5A 3QD0A 2QOBA 3RINA 2JLDA 3UBDA 5JK3A 3NNUA 3F3ZA 4KAOA 3WZKA 3E8CA 3CD3A 4RC4A 4C2VA 1NVSA 1YHVA 5HBJA 3KRXA 3TIYA 4AU8A 1KOBA 4W4YA 5CWZA 4DH7A 2WMRA 2HZ4A 2WMAA 1UU8A 1DI8A 2JEDA 3WZEA 4QOXA 3QD4A 2JDOA 4E5BA 5CNOA 4D5KA 3LVPA 5D12A 3VBQA 5CSVA 4D9TA 4O7YA 4LGGA 4EOMA 1T45A 3C51A 3KXHA 3BHHA 3U6JA 2GHGA 3OP5A 4I5MA 3CY3A 3DK6A 4O0WA 4AQCA 3OG7A 4C57A 2C1BA 5ETFA 4X3FA 2JKOA 2VGPA 3SA0A 2C5YA 4EH4A 4QQTA 2PVHA 4ZZNA 3IO7A 2HCKA 4TYIA 4TYHB 5DA3A 4UMUA 3CJGA 2X7OA 4AS0A 1ZOEA 4LUDA 4C37A 3UIUA 4AGDA 4F63A 5E92A 2X2LA 5AUVA 2WTIA 1YXUA 3QLGA 1KOAA 3LFQA 2XH5A 2XIXA 3NYVA 3RCDA 2XK8A 2R4BA 2WMBA 5I4NA 1ZYSA 4JDIA 3VJOA 3L8PA 3BEAA 5DI1A 2I40A 3Q5ZA 1H0VA 3UE4A 4RQKA 3G2FA 2R64A 4JI9A 5ETAA 1W7HA 2BRBA 5K5NA 5BUEA 1IRKA 2OLCA 3I60A 4IANA 4QPSA 4GT5A 4LQMA 2BRNA 4KIKB 3F5UA 5FBNC 3ACJA 2GNGA 5A4TA 4FEQA 1PRYA 2GTNA 4CFXA 5M4UA 5T6KA 3G5DA 3ZC6A 4BCPA 4F7JA 4D9UA 4U5JA 5KHXA 2YHVA 4PNKA 1V0BA 3A8WA 4FG8A 3DAKA 4QPAA 4I41A 4G3CA 3QXPA 4GU6A 5FG8A 3A8XA 3SDJA 1IEPA 5CAVA 2IVTA 1HCLA 1R0PA 5GJGA 3MH3A 5JEBA 4GW8A 3VS2A 3C4FA 4QYEA 4ALUA 3R7OA 5L3AA 4IW0A 4O83A 2ITZA 3LFEA 3VHEA 3VS7A 4ASDA 3ORPA 4GG7A 4J97A 3GU6A 3VUMA 4D0WA 3A99A 2R0UA 3HV4A 3D2KA 4FTMA 5CF8A 3HDMA 4EH3A 2H6DA 4D2VA 4ACMA 2HIWA 3PXKA 4NEUA 3AMAA 5IEYA 4BF2A 3C1XA 3QTIA 1CKJA 3BRBA 4YHJA 3V5WA 3FKLA 3MV5A 4FKWA 4ZY6A 3PG3A 4DBNA 3QYWA 3DDQA 3VS0A 4AXAA 4EC8A 3I6UA 2W1GA 1WBSA 4YZNA 5DN3A 5E8XA 3PVWA 2PE0A 3D14A 3EL7A 3OY1A 4FSRA 4XG7A 3TWJA 1MQBA 4DA5A 5DYJA 4TXCA 5AUYA 1BKXA 3MIYA 1Q61A 1H4LA 3KMUA 4IVAA 4O0VA 4R3PA 4XG8A 4RZWA 1Q8TA 4ZP5A 3ALOA 4U7ZA 2OXXA 4X3FB 4U80A 2DS1A 2B4SB 3HRBA 5EI8A 1L8TA 4NCTC 3KGAA 3D7TA 4CRLA 4RWIA 5K0KA 1XBBA 2X8DA 4IC8A 2YZAA 3IG7A 1YWRA 1A9UA 2C1AA 3DKCA 3Q96A 4I23A 3ZC5A 3NW7A 5L2QA 5HE0A 2V55A 2VTHA 2O65A 1R3CA 5DVRA 4C02A 2CNVA 4IB3A 3R7YA 4PDYA 2X7GA 3HMNA 3C7QA 3M11A 2XM8A 2VTNA 1CMKE 3ZM9A 5K4IA 4O6LA 4PMSA 3PYYA 2Y9QA 2I1MA 2W4KA 4W9XA 4A9SA 1Y6BA 4EH7A 3JY9A 3R73A 5DR2A 5CAUA 2UZOA 4N6ZA 3GT8A 2IZTA 2R3IA 1OECA 4CG9A 3K5UA 2HXQA 4AZFA 4LFIA 4XMOA 3DOGA 3GFEA 4AN2A 4E4NA 4DINA 3IECA 3QQHA 4IADA 2RFSA 4EH5A 5EM5A 5KE0A 4G17A 3NNVA 3U4WA 2VTQA 4I5PA 4CMTA 3QTWA 4HNFA 4CKRA 1J1CA 1XH5A 4O7WA 5EW3A 3THBA 5C4LA 4O7VA 4F0IA 4ZLYA 4F6SA 4EBVA 3K3IA 4O2PA 4XJ0A 3TNWA 3FE3A 3GU4A 3MH1A 5FXQA 4R6VA 3RVGA 3VQHA 4N6YA 2JAVA 1S9JA 3UVPA 3HDNA 1ZARA 4ANBA 4V05A 5FXRA 3OT8A 3F7ZA 4GK3A 1VYZA 3MTFA 4DBXA 5FD2A 4B99A 2BROA 4PV0A 3GC8A 3L9PA 3N9XA 5IISA 3AGLA 5IMXA 2F4JA 1QCFA 3EQIA 5K0XA 3UG1A 3W1FA 2J2IB 3AT4A 1U5RA 5B2KA 3F3WA 5L2WA 1OBGA 2VUWA 4HW7A 5IH6A 3QHWA 1IAHA 4L53A 5CAOA 4KIOA 3LCKA 4JR7A 4YZMA 5IG1A 3SW7A 4QMNA 1MRYA 2HZIA 3EYHA 4RJ4A 2VWBA 4BIDA 4DG0E 5JGAA 4HGEA 3IQ7A 3D4QA 4PTGA 3AOXA 5EQPA 4O7ZA 2VZ6A 3RWPA 5HG5A 1J7UA 5TOZA 5L6PA 2ITXA 4YHFA 3I6WA 3KXXA 5AX9A 5HU3A 3R7EA 4FI1A 1LUFA 3KRRA 4IJ9A 4R7HA 2FVDA 2QOHA 3QKMA 4OTHA 4EHEA 4EI4A 1FVVA 3D7TB 4KBAA 3PE1A 5AV3A 2IVVA 4I93A 3IDBA 1PF8A 3DPKA 5E91A 3WZJA 2BFXA 4AGWA 2GQSA 4WHZA 4FZAB 4YTHA 5F20A 1S9IA 4PL3A 3CTHA 4YC3A 5BVNA 3P4KA 3CCNA 2WMXA 5FUTA 1OL6A 2X8EA 4FL3A 1H1RA 4I0TA 4RT7A 4U3ZA 3QZGA 5JZJA 3UIBA 5BUJA 5E7RA 2HENA 3EQBA 3FI4A 4ZSJA 1YDRE 3UNZA 3H3CA 4BGQA 2WGJA 4E6QA 5I3OA 4JQEA 3TJCA 4MKCA 4TYEA 1OPLA 2YIYA 2VX1A 4IX6A 3QF9A 1M17A 2O3PA 2WIPA 4TYJA 4Y83A 2GNIA 4RWLA 4NSTA 4X2GA 4MXXA 3KU2A 5IPJA 2VTJA 3PP1A 3FXWA 4L8MA 2Y4PA 4F6UA 2HELA 4AX8A 2QU6A 4WG4A 2WEIA 1WAKA 4AFEA 4CG8A 3FC1X 3BU6A 4UALA 4Y46A 3OWPA 5TT7A 3V5TA 4EUUA 4MWHA 4U3YA 2XB7A 3NZ0A 4DYMA 1YW2A 3HV5A 4MX9A 2P0CA 3GU5A 3QYZA 4A9UA 4Y5QA 2E9OA 4GMYA 2C6TA 4NZWB 4Q2AA 5AV0A 3TL8A 3AD5A 4BTKA 4Z7HA 5IMEA 2C6MA 2I6LA 2OJFE 4O0SA 4ZEGA 4ANNA 3F9NA 4H36A 4JG7A 4I6FA 4NM7A 3RM6A 1KWPA 5LCKA 4RGJA 4G1WA 5FBOA 4OUCA 5AAGA 1YRPA 4I3ZA 3QZIA 3ZLSA 2ERZE 3V6RA 2X39A 3V5PA 4MXAA 3ZLYA 4E20A 3ZSIA 3GNIB 2BILB 1YXVA 2X6EA 5CANA 3QD2B 5IEXA 3DTCA 4PUZA 5HVYA 2WKMA 1KE7A 4KKGA 3TV6A 3NMUF 2P2HA 4BIBA 3BE9A 4KSQA 2ZJWA 3TV4A 1OIYA 1KV1A 3VW6A 3VQUA 4RVLA 1YI6A 2G15A 3OCGA 4M15A 5HCYA 3ZRMA 4ASEA 3UZPA 3TNPC 4C62A 5CF6A 2PK9A 3F5GA 4AUAA 4AT4A 4B6LA 2FSMX 1V0PA 4JG8A 3UG2A 4KBKA 4F9WA 3LW0A 2BTRA 4DGOA 4EJ7A 1UKIA 4TRLA 2UZUE 1DS5A 2GS2A 3EHAA 4J95A 2GHLA 1OL7A 5J8IA 4GYGA 3SAYA 2BKKA 4FEXA 4QQJA 2J50A 5J5TA 5E8ZA 4ANOA 3MVHA 4JG6A 5EK7A 3S4QA 4ZSEA 1W84A 5L6WL 5L2SA 3F2NA 3F5PA 5EH0A 4BCJA 1UU9A 4ANLA 5AMNA 4DCEA 3JPVA 3SQQA 4FGBA 4D55A 5A6OA 4UXLA 5EHLA 2PE2A 4MHAA 4PPCA 4YZ9A 3R8ZA 1WFCA 1FVRA 2LGCA 2R3GA 2WMQA 4IIRA 5CSWA 3RAKA 3IGGA 4MVFA 3FMHA 3FXXA 3QHRA 4FKTA 4PRJA 1ZY5A 4J98A 5E9EA 4IM0A 4BTFA 3WE4A 3ORTA 5CVFA 4F0GA 3U6IA 2FUMA 1Y8YA 4CKIA 4G9CA 3WBLA 1DM2A 2ZOQA 4LYNA 4WSQA 4HVHA 3U54A 1TQIA 3UZRA 2WIHA 3QCQA 2E9UA 4ASXA 5B2LA 3R9NA 4BFMA 4DF3A 5JQ8A 5KKRB 3DB6A 4F65A 5B2MA 5CAPA 4XH6A 3D83A 4FEUA 3W2CA 1XH7A 2Z7RA 2GMXA 3A7JA 1R39A 3KEXA 4FOBA 3PXFA 5DGZA 4A9YA 2EXEA 5E90A 1ZAOA 4ITJA 5H8EA 4EL9A 3CXWA 2RFEA 4F08A 4C4HA 3WE8A 3CBLA 4RJ5A 3TJDA 1QPEA 2QC6A 2XEYA 3H30A 4C4GA 3EQGA 3G9NA 3BZ3A 5EM6A 4ONAA 3SVVA 4MXYA 3L8VA 2ZMDA 2R3KA 3GEQA 1U46A 4U42A 4IAZA 1YXXA 5EG3A 4XCUA 3UNKA 3MPTA 4MBLA 4QMSA 4DH8A 5J1WA 3WIKA 1FPUA 3KB7A 4FG7A 4IM3A 4NU1A 4E4XA 3VO3A 2CCHA 4M13A 1P4FA 3P79A 4GG5A 2JDTA 2PTKA 3W2SA 4BDFA 3QQJA 2EVAA 3P7AA 3PG1A 4FSYA 2IWIA 4CLIA 4GL9A 4QP8A 4RG0A 4GK4A 4J52A 3LJ0A 4QMYA 5M57A 4PP7A 2BKZA 2WMUA 4GUBA 5GINE 4IEBA 3P23A 3QRTA 4X2NA 5EOLA 3ZMMA 5TE0A 3TM0A 2YWPA 4CQGA 4RX8A 4F1OA 4HVGA 1IAJA 2R3NA 4LRMA 4RMZA 3W2OA 4DFXE 3EH9A 4M12A 4CZUA 2H34A 4X2KA 3NSZA 3OTVA 4QYYA 4FZ6A 5CS6A 3SW4A 4D4SA 3D0EA 2QKWB 4CYJA 2XKDA 4OTFA 5BVFA 2QHNA 2JIUA 4ITIA 4IZYA 5JZNA 4U0IA 3BYVA 3LFNA 3UTOA 4P7EA 3VS6A 5TKDA 3WF9A 3DK7A 2WTWA 2OJ9A 3D2IA 4AN3A 3BWJA 3P78A 4FTTA 2OFUA 5GIOE 4RBLA 5AIKA 4PWNA 3V5JA 3LHJA 3FAAA 3LMGA 3MBLA 3QBNA 3TT0A 4GFOA 4U79A 4F0FA 2VNYA 2UZVA 3HLLA 4Y95A 2W1EA 4FTLA 3MTLA 3LQ5A 3POZA 4O7LA 4Z3VA 5KZIA 1URCA 4EOLA 2OZAA 5BMSA 1KUTA 2BPMA 5EYMA 2XJ0A 4YTFA 4LV5A 1LR4A 3GC9A 3W2RA 5A4LA 3NWWA 4WKQA 4BDHA 2B9IA 2XKCA 1XO2B 3BU5A 4H39A 4ACCA 2B9HA 5JFSA 3QQFA 2QURA 4IWPA 4H3PA 3NW5A 1WVYA 4OGRA 2IG7A 4YP8A 3E8DA 4L3LA 4XLIA 4IVDA 4ACGA 5IKWA 4QPMA 3FKOA 4BCKA 4R7BA 2CJMA 4XNEA 3WARA 2CLXA 3GOKA 3PJ1A 3R7GA 4FSTA 3MSSA 3R8PA 3IONA 1VJYA 3DNDA 2I0VA 3FXZA 4F1MA 4J96A 1GIHA 4WIHA 2KULA 3I0OA 3QCXA 3RPYA 3Q9ZA 3HP5A 4X7QA 2GCDA 1PKDA 2B54A 3UP7A 2ONLA 3QUPA 5G1XA 5T3QA 1JKLA 2XUUA 2VTAA 4ZSLA 5HLWA 3KK8A 2BMCA 4JBPA 4RIWB 4QP7A 3JS2A 3QQGA 2ZDUA 4DT9A 4V01A 4O21A 4HVIA 5AR8A 2IO6A 1W83A 4CTBA 1URWA 4AW2A 2ZM4A 5M4CA 1Y57A 3Q6UA 4OTGA 1Q8YA 2YCFA 3VRYA 4BZNA 2VX0A 1W0XC 4YHTA 4ORKA 5C27A 3AC8A 4G34A 3A4PA 2FB8A 4IZAA 4MD9E 3SG8A 1GNGA 1BL6A 1ZZ2A 4HCUA 2YCSA 3OXIA 4NJDA 5HE2A 2BHEA 1BLXA 3TN8A 5DLSA 3OROA 4EK8A 5KHWA 3GOPA 5M51A 1RE8A 2F7ZE 3MJ2A 3B8QA 1B38A 4GIIA 5EM7A 5CSPA 4PNIA 3ORXA 4UEUA 4UV0A 3E92A 2C69A 4MNFA 3EIDA 2GPHA 5HESA 4RVTA 3E62A 2R0IA 1JSUA 5H3QA 3NUNA 4WNOA 3HP2A 1YXTA 4B9DA 3EN7A 5AP6A 3KL8A 3NUAA 1CTPE 4QP3A 2WELA 1ZOHA 4TWOA 4XV1A 4HNIA 5I9VA 4QMXA 4CXAA 1K2PA 3P1AA 3CKWA 3PXYA 2XYNA 1FVTA 3FZSA 3N4TA 1W8CA 5IQGA 3BHVA 3GCPA 4L3JA 4NH1A 2YAKA 2OZAB 4GT3A 3LCDA 2FO0A 3KF7A 5DRDA 4ZTHA 3I1AA 4ZLZA 4HYSA 4FZDB 2X2MA 5CX9A 4YUQA 4NYEA 4MTAA 3Q2MA 1JLUE 1WVXA 2JIVA 2W96B 3Q53A 3TUDA 3PP0A 4J8MA 3LOKA 5KMMA 5HLNA 3E3PA 3EZRA 2RSVA 3FDNA 4IE9A 3OEZA 4XBUA 1JQHA 1JKKA 2B0QA 1CKPA 1XH6A 4FR4A 5L6OA 4JDJA 4BZDA 2F7XE 2R3PA 4JIKA 4YPSA 3BIZA 2UV2A 4RVKA 4FV2A 3ZXZA 4ZSAA 5FRIA 4PF4A 3WZDA 5CU0A 4DLJA 3KN5A 2OW3A 2OH0E 3Q04A 5JGDA 1GJOA 2VRXA 1UA2A 3R30A 5AP7A 2YN8A 2Z7LA 3FMLA 3BWFA 3IK3A 4IB1A 3KFAA 5J79A 3MY5A 4Y5HA 4XEYA 4AG8A 5AA9A 2C5NA 4FT9A 2Z02A 1PYXA 1YKRA 4Q5EA 2HZ0A 4F1TA 1OIRA 3ZTXA 1CSNA 2W1ZA 3I0QA 4R5SA 3LCTA 4QMMA 3NCZA 2A4LA 1T46A 3FL5A 4Y85A 4YNEA 1YOLA 4O7RA 2IZUA 3A60A 4GSBA 4LOQA 2VN9A 3W18A 3CR0A 2NRYA 3G51A 2I7QA 4MK0A 4NM5A 3V3VA 2Y6OA 3VULA 1MUOA 2GHMA 5EDPA 4EWQA 2QR8A 3QQKA 1H8FA 5AP1A 3MESA 3G0EA 2VWXA 4AZSA 3C50A 5ANDA 2OICA 3K3JA 4MNEA 4CFNA 5IDPA 3DJ7A 3V04A 2YAAA 3E63A 3FKNA 3IW6A 4CTCA 3DB8A 2IVSA 4B7TA 2CGUA 4YR8A 3HRCA 3KVXA 3UMWA 3LXNA 1P4OA 5AM7A 5CEQA 3WF8A 3REPA 5EW8A 3R7VA 4BGGA 4YJNA 3Q9YA 3AC3A 5AR4A 4BDAA 2WOUA 5HD4A 5HCXA 3KKVA 3PLSA 2UVZA 5F94A 3QQLA 4RLLA 5E8UA 4C3RA 2PULA 3DKFA 3G0FA 3HEGA 1XR1A 4GCJA 4LUEA 4KRDA 3V51A 3BYSA 3D5UA 4I6QA 3DZQA 4JT3A 4I5HA 1VYWA 2PL0A 3DXNA 3MH0A 3ZLXA 3LFAA 2BIYA 2OIDA 2PVFA 3DBQA 4F7NA 3BLQA 2W5HA 2VD5A 2YZLA 3RZBA 3ET7A 4K0YA 4MF0A 2CMWA 4UY9A 5KBRA 1M2PA 3GI3A 4YC6A 4AZTA 4BCOA 3R7IA 5L8KA 3NIZA 1M52A 2J7TA 5JFXA 4AW0A 3FMEA 2CCIA 5ANJA 3FMMA 2E9NA 3GP0A 4RJ6A 3P7CA 3OUKA 2BAJA 5DT0A 4UN0C 4RQVA 3N4VA 1ZYJA 5HG7A 4QTDA 4FF8A 5C03A 3WOWA 2QG5A 3A62A 3FLZA 4G6OA 1H08A 2YM7A 3LXKA 4EYJA 3KRWA 5IQEA 4RIXA 2Y4IB 2UZLA 5ACBC 2QR7A 3G33A 2PVMA 4JX7A 4KB8A 4S31A 1Y6AA 5DOSA 4LMNA 4YJVA 1PXJA 4B0GA 4XYFA 4RFZA 5CU3A 3VF8A 2F7EE 4FZ7A 3R7UA 5AUUA 3FLQA 5L2TA 4UYAA 2HW7A 3Q3BA 1TQMA 2Y8OA 2UZEA 1R0EA 3DLZA 4XS2A 4RX5A 2UW5A 3MS9A 3QTSA 2X81A 5HLPA 2W5AA 4BDKA 4L6QA 4JAJA 4W9WA 2JKKA 5TO8A 5HNIX 2XCKA 3GU7A 5CEMA 4AT5A 4Q5HA 4U41A 4AOJA 4MNEB 4QMQA 4G9RA 3QQUA 4V0GA 1U59A 2PE1A 3DKGA 4FSQA 3KCFA 4PMMA 3MVMA 5LVOA 3FLWA 4CT1A 3D5WA 3ODYX 3BQRA 4QTBA 3ENHA 1GZKA 4GRBA 4O0RA 5DT4A 4BWPA 4CYIA 3AG9A 4RJ3A 4K8AA 3UO5A 4U44A 1LPUA 3C0HA 3HA6A 3O7LB 3PSDA 5I9UA 3KXNA 1BI8A 4RJ7A 4YO6A 5IUGA 4DLIA 3NAXA 5LJJA 1B39A 4FICA 3ZSGA 4L68A 1PJKA 4BYIA 1OBDA 4CMOA 4U43A 2YACA 3KK9A 4UYNA 5BYYA 2QLQA 2R3QA 2BDFA 3BYMA 4M67A 3R1QA 4DH3A 4L52A 4RRVA 5M53A 4RJ8A 3CGFA 3HL7A 3OY3A 3HNGA 4EZ7A 4R78A 2QOLA 3PJ8A 4F99A 4FKPA 3D7ZA 5I9YA 4E26A 1Q8ZA 3R1NA 2G2IA 5FWKK 3R9OA 2YM5A 3FQHA 1WVWA 2XP2A 1UV5A 2BRHA 2WTKB 4I6BA 4UWBA 5ETIA 3CPBA 3PTGA 5LARA 3UVQA 5ICPA 3O23A 4FA2A 3ZONA 1YI3A 2VTPA 2VTRA 1Q99A 1G5SA 4OTDA 1P14A 4FTUA 3PPJA 3LLTA 2F2CB 2OIBA 4MH7A 2BR1A 3U9CA 4EQMA 5CEPA 1UNGA 4C4FA 3U6HA 4FGRA 2JD5A 4C34A 2YERA 3G9LX 5L2IA 3PVUA 2CGWA 4MAOA 5I9WA 4ALWA 5IF1A 3N51A 3AMBA 3P0MA 4IX3A 4M0YA 4JX3A 3ZEWA 2OI4X 3V5QA 3OS3A 2PZRA 3AD6A 3LXPA 4RIXB 4RZVA 3NLBA 4O91A 5D41A 1WBNA 3M42A 4IH8A 2R3HA 2GNHA 3BLRA 2W0JA 4E5AX 4BDGA 2UW7A 2OKRA 4UMRA 3COKA 4M0ZA 5DE2A 4EJNA 3RAHA 4JLCA 3FI8A 3R28A 3E64A 2FA2A 1ZOGA 2PSQA 4FV1A 3JYAA 2WFYA 2BZJA 3Q4CA 4QP1A 3VS5A 3FWQA 4YMJA 4J7BA 2HY81 4RX7A 4AP7A 4IBMA 4QMTA 1REJA 5FP6A 5DR9A 1YXSA 3MB7A 3LJ1A 5EI2A 2WO6A 3IW4A 5FEDA 4UMPA 1GZ8A 3QFVA 1JSVA 4DH1A 3E8NA 3SXRA 4F9BA 4V0GB 4IZ5A 3TNHA 4QYGA 5D11A 3TIZA 2HAKA 3UQFA 2B53A 3O0GA 3O71A 3WIGA 3SKCA 4YZBA 3R8VA 3TG1A 2BHHA 1LEZA 3CE3A 4ZTMA 5M4FA 3SGCA 3SXFA 4DTAA 4CGAA 5HIDA 3KVWA 2O64A 3PZEA 4R5YA 3V8TA 4J1RA 3EQHA 3RM7A 1ERKA 1M7NA 5LVPA 4FKLA 3II5A 1FOTA 4MXZA 4ZOGA 4FKQA 3UP2A 3BI6A 3O96A 4ZY5A 3BKBA 3U51A 5EQYA 3D15A 2EWAA 4N70A 3AGMA 5CQWA 4ZS0A 1I44A 2YIXA 3BYUA 2G2FA 4FKOA 1FBNA 3ZBXA 2X8IA 5DIAA 4QTEA 4CMUA 2R9SA 3I5ZA 3R00A 4BBFA 1X8BA 5E8VA 3COHA 5JQ5A 1W98A 2DQ7X 5H8GA 1DAYA 3FI2A 4C3PA 4C0TA 4I24A 2CN5A 3ALNA 4MD7E 5E1SA 4DG3E 2W1HA 1RJBA 3QA8A 4TNBA 3ZOSA 2PUPA 4GV1A 1KE6A 2ZM3A 4RIOA 3IPHA 5ANGA 3AC2A 5KMKA 2XA4A 3DU8A 4U9AA 5DMZA 1VEBA 5GJFA 5K5XA 2F2UA 2WTVA 2IJMA 1J7IA 4G6NA 2DWBA 1PXPA 4H1MA 4HYHA 3TUBA 3FJQE 1WBPA 2CLQA 3F2RA 4IAKA 3DY7A 3HV6A
chains in the Genus database with same CATH superfamily
2C6OA 2J0MB 4QQ5A 4UBAA 3B2TA 2HWPA 5CZIA 4CFWA 3HAVA 4TL0A 2ITUA 4Z16A 3C9WA 3V6SA 3G6GA 2PUIA 4BVUA 3O7LD 4JBVA 4EH2A 3UQCA 2QOQA 3V5LA 3IDCA 2ONLC 3Q60A 3QKKA 4GJ2A 1P5EA 5A9UA 3FMNA 4O38A 4JVGA 4XG4A 5BVOA 5C8NA 4GVJA 3R2YA 5F1ZA 2W1IA 4XV3A 2GNJA 2YEXA 5CU2A 5AR2A 1OIUA 2XS0A 3IGOA 1VLRA 3I7BA 3TTIA 4NL0A 4M8TA 4NK9A 4RWKA 5FXSA 3EFWA 4LDTA 2X7FA 4FRFA 3G6HA 3GC7A 3FL4A 2BCJA 2O2UA 3WZUA 5BPYA 3EB0A 2Q0NA 4D2SA 4EOPA 3GCVA 4RC3A 3FLSA 2RGPA 2J5FA 3E88A 1PY5A 3IW5A 3FHRA 4K77A 4EC9A 3ORIA 4HJOA 3R9HA 2QODA 4Y72A 3HA8A 3RWQA 4IZ7A 2WU6A 1OPJA 1PMEA 3QRKA 2XAOA 3PRIA 2WMWA 4RWJA 4JXFA 4XP3A 5C4KA 2B52A 5FM2A 4IAYA 3BHTA 3PXQA 3Q2JA 3H9RA 3PWDA 5KNJA 3FSFA 3W2PA 1YHWA 4LI5A 4G3EA 3GQLA 3UO4A 4OBOA 3ACKA 3ZUUA 3H9OA 4DEBA 2UW9A 4YTCA 3VN9A 4D0XA 4LMUA 5A54A 1EH4A 4D2TA 2VGOA 4G3DA 2QD9A 5FP5A 4E6CA 1SM2A 4O0TA 2CHLA 2ETRA 3OBGA 1XH9A 1SVGA 1SYKA 3VW8A 1CM8A 5K3YA 2XVDA 3EFJA 4P2KA 3UVRA 5IH5A 4QT1A 1F5QA 5CSHA 1RQQA 3DAEA 4HPTE 4XP2A 3C4EA 3R8UA 2W1FA 3O8UA 3O5AA 5M56A 5GZAA 4DG2E 4USEA 5AIRA 3OW4A 5HKMA 1ZLTA 3RNIA 2EU9A 4C2WA 4ERKA 4GT4A 3GUBA 4GKHA 5KMIA 1TQPA 4GJ3A 4ZLOA 5IUHA 4WT6A 2ITVA 3I4BA 2BVAA 4FYNA 4U45A 3RBWA 3RPOA 2RFDA 4O1PA 3QALE 2X0OA 5HI2A 4I6HA 3R8MA 3R0TA 2VAGA 2ZB0A 4IAAA 4FNYA 4DFYA 2J6MA 4PDSA 3QU0A 4DCAA 4XG9A 3QD3A 2WQMA 2V5QA 3ZFXA 4NUSA 4PMPA 3FLNC 5F95A 3TDVA 1OITA 4FSWA 3R21A 4O86A 2SRCA 4WBOA 5GJDA 3DKOA 4FT7A 2C5XA 2QO7A 4TT7A 2GTMA 3ENMA 3T8OA 4KS7A 3W0RA 1JKTA 3QC4A 3MVLA 3FV8A 5HGIA 1Z5MA 4HGTA 4EONA 1HOWA 2E9VA 1FQ1B 3C4CA 4NKAA 4XUFA 4A9RA 3BHUA 4M84A 3F7WA 3DFCB 1B6CB 2RL5A 4XG6A 5A46A 1KE8A 4GH2A 4ARKA 2PPQA 4BHZA 4AGCA 3JUHA 4YJTA 4E7WA 2WTCA 2ITTA 3DAJA 2RG5A 2VU3A 4TTHB 5DRBA 3ZU7A 4BY9E 2RKUA 2HY0A 1QPDA 4XX9A 2QOOA 5IQHA 1WCCA 4NFNA 3LXLA 3FPMA 4L9IA 3OCSA 1LEWA 4OT6A 2GSFA 5L8JA 5JMSA 2VV9A 4K1BA 3UZTA 3D9VA 3GXLA 3QTZA 2XYUA 2PHKA 2PVYA 2JDRA 3L8XA 3O8PA 4IB0A 4K33A 3RPRA 3VUDA 4CEGA 2GS6A 5IQDA 4K6ZA 3ZFYA 2UW6A 2NNWB 4D4YA 5JKGA 3R1YA 5J95A 4AT3A 4EBWA 2BDJA 4M14A 4C36A 2P2IA 4A4LA 3EOCA 3GC0A 3WYYA 4EEVA 2VTLA 3H10A 3QA0A 5LVMA 3EZVA 3BBWA 2WQEA 5ANEA 3W8QA 4AZWA 5HTBA 1XBCA 3LMIA 4QYFA 5EYDA 4FTQA 1UU3A 3B2WA 3R2BA 2CNUA 4BCQA 4E4MA 5BVEA 2GQGA 2FGIA 4X2FA 4WSYA 3LM0A 2A2AA 3DTWA 3QKLA 5FEQA 4AW1A 2XNGA 2FH9A 2VO7A 4FTJA 4FV5A 4XBRA 4FUYA 2CSNA 1CDKA 4XG3A 4D5HA 1OUKA 2WHBA 3NYXA 5IQAA 1ZZLA 2JAMA 3TV7A 1XBAA 3NIEA 4MXOA 4AZVA 5CT0A 5HO7A 2XJ1A 3MA3A 4CFVA 4IDVA 4FK3A 2BZIB 3ELJA 3PXZA 4GYIA 4HYUA 4OBPA 4OR5A 4BCFA 4RIWA 2JIIA 4JQ8A 4PMTA 3L9MA 4S34A 3V01A 1H28A 3CTQA 3OHTA 5C01A 4O82A 4APCA 3R01A 4GFMA 3NFFB 1YOMA 2PY3A 4TWNA 2BZKB 5LVNA 3PA5A 3O2MA 3PIYA 3MVJA 3MI9A 1RDQE 4FKJA 3EKKA 3LFCA 5DG5A 3E5AA 3ITZA 1XQZA 5J7BA 4I94A 1UNHA 3NW6A 2C30A 3DA6A 4RPVA 5HEZA 5CI7A 4FKRA 4WRSA 2AC5A 3ZRKA 2PVJA 2P33A 3F61A 4D1ZA 4EOIA 3UC4A 5CAQA 4FK6A 4UWYA 3D5VA 4XOYA 5FQDC 4FIJA 3FMDA 2VWYA 3LFFA 5EOBA 4NJ3A 4X3FC 1U4DA 2C3JA 3AC1A 4FVRA 1BMKA 4L45A 4S2ZA 2C6DA 5J9ZA 1UWHA 3I79A 3OXZA 2WAJA 5CVGA 5FTOA 3P08A 4NCTA 5M4IA 2JFLA 4QEBA 4E3CA 4FUXA 3NRMA 1NXKA 3QWKA 3QZHA 4APPA 4KIQA 2B9JA 4QMVA 1HCKA 4ENXA 4EK5A 2QO2A 4YNOA 4IVBA 1IR3A 3P9JA 5HG9A 5HE3A 3QTXA 4BIEA 2O8YA 2VWZA 4E73A 4H58A 3VUKA 2OH4A 3R04A 2XKEA 3NUPA 3GVUA 4WOVA 3SOAA 2WMVA 4FOCA 1IASA 3C0GA 4ANMA 5E4HA 2OSCA 4W8EA 4YPDA 5E8TA 3WI6A 4C4IA 4F7SA 3Q52A 1U54A 3NGAA 4AA5A 3VF9A 4A4XA 4EORA 4I21A 4ENYA 4LRKA 1H0WA 4J99A 3QTRA 2XIRA 4O6EA 1H24A 2C3IB 3CGOA 3BYOA 3F6XA 1ZYDA 3FZOA 2Z8CA 3R1SA 4IWOA 3R9DA 2XK6A 1M2RA 2PVRA 3I5NA 1REKA 4MEDA 2UW0A 3Q4ZA 4MQ2A 4YZDA 3UMXA 4A7CA 3KIOC 2P3GX 3UC3A 4HZRA 3VBYA 4IX4A 4M68A 2IVUA 5M44A 2ERKA 4OW8A 3PY0A 4EHVA 2JDSA 4NM3A 4PQNA 1Q5KA 3C4WA 1ATPE 4NKSA 3LZBA 4Y73A 3RGFA 1NA7A 3GCSA 4R77A 5HX6A 1YWVA 3MN3A 4UZHA 3ORZA 4MBJA 4FIIA 3F5XA 3SRVA 3F82A 1H27A 2JDVA 4U97A 3VS4A 4XP0A 4MWIA 3BGZA 2GDOA 4O7TA 3UO6A 4LV8A 3E7OA 4HZSA 3UDBA 3EN9A 2I0HA 3EQRA 3RK9A 4C4JA 5AADA 3RJCA 2BAKA 4AE6A 3S1HA 5GHVA 2Z7SA 3QX2A 4H3QA 2WTJA 4DITA 1FMKA 4FJVA 3OUNB 3TYKA 2WMTA 3E87A 3MW1A 3JVRA 4IM2A 2UVXA 5KCVA 3OBJA 5HBEA 5CASA 4NW6A 4DFZE 1MQ4A 4BDDA 4ZZMA 4XLVA 3PY3A 3E7VA 3NUSA 4FV9A 5FEEA 2KTYA 4N4SA 5KUPA 5BYLA 2XNPA 2J0IA 4FSNA 4FEVA 2X0GA 4AOIA 2YIQA 2DUVA 3OD6X 2UZBA 5CY3A 5HICA 3VRZA 3EL8A 4USFA 5J1VA 3ZSHA 2A27A 3T9TA 3POOA 4BTMA 2C3KA 3DBEA 3EQCA 3OMVA 4JRVA 2O5KA 4K18A 5AP0A 4LL0A 2G1TA 5BUIA 2C68A 1BX6A 1J91A 2A1AB 3ZCLA 5IQIA 1H1WA 3L8SA 3W10A 4PL5A 5LXMA 5ITAA 2XIKA 4WRGA 4BI0A 4FV0A 4PL4A 1JSTA 3CIKA 3PZHA 5ANKA 1BL7A 4N57A 4FKGA 3ZXTA 5FDXA 2PVKA 3TKHA 4EHZA 4AW5A 4L67A 4YJRA 1U54B 4RSSA 3OOMA 4QMLA 5BVWA 4JRNA 2RG6A 4O7SA 2R7BA 3FY0A 3C5IA 4FTAA 2VTOA 4U6RA 3BU3A 5EHYA 3M2WA 1E9HA 5AUXA 4HCTA 4KIPA 5D9HA 3BBTB 4FT5A 2XMYA 4D2WA 2C0OA 3LCOA 4NTTA 1Q97A 4JQ7A 4ZTNA 2XK7A 1H1QA 3DBCA 3UQGA 5J5SA 1A06A 3NUXA 4AACA 3BV3A 5TR6A 4YURA 2QO9A 2BTSA 3A61A 2YJSA 4GIHA 4BHNA 4Q9ZA 1GZOA 4TKSA 4D1XA 3DNEA 3KXMA 4JNWA 3Q9WA 3CEKA 3NYOA 4KA3A 3ZBFA 4F09A 3ZRLA 3PA3A 1SNXA 3PRFA 4R8QA 5D7AA 5HD7A 2WB8A 5CYIA 1NY3A 1WBOA 2W5BA 4RA5A 5JRQA 1SZMA 3LIJA 4RVMA 4MBIA 3SRVB 4AAAA 4CRSA 2WOTA 2C4GA 4HYIA 4A07A 3KULA 4L7SA 4G5JA 4DEAA 5FM3A 1WBTA 3LE6A 4R3CA 4EHGA 3U9NA 5GZ9A 5HO6A 3OZ6A 3HMIA 4W4XA 4J53A 3RK5A 3RALA 4TPTA 4FV6A 4K11A 4UMTA 1IA8A 1OM1A 5AV2A 5JT2A 5CNNA 2CGXA 5KBQA 1Q8WA 2NO3A 4KUJA 5KX8A 4D28A 4BI2A 2PVNA 1O6YA 4HVDA 4QO9A 5EKOA 4O81A 4OTPA 3LFSA 5DBXA 4YLKA 4BKYA 3COMA 3MFRA 4A4OA 3KXGA 4HGSA 4FKSA 3MGYA 4Z7GA 3CQWA 2IEWA 5IDNA 3UIMA 4K9YA 5J7HA 3LJ2A 2JBOA 5AP4A 2QNJA 3OW3A 2VNWA 3ORLA 4EYMA 3PE2A 3UOLA 3CQUA 1R1WA 2NRUA 4Z9LA 4L3PA 4GVAA 5E8WA 5FGKA 4BB4A 1JKSA 4Z55A 4KBCA 1BYGA 4MF1A 3F69A 5B7VA 4QMWA 1Q4LA 4DTKA 3ORNA 3BL7A 4AGUA 5M08A 2XANA 4BCGA 3UPXA 2ITQA 1BUHA 4IFCA 3VWAA 3ROYA 3U87A 2QONA 4QMPA 2QVSE 5CEIA 5HIEA 4QYHA 4FNWA 4ZTQA 3V8SA 5DPVA 2WD1A 5H9BA 2WXVA 4CFUA 5C1QB 2UZTA 3RNYA 5E1EA 4IMYA 1O6KA 5KKRC 4A9TA 1K3AA 3PVGA 3TNQB 3UYSA 2BDWA 3CPCA 3P86A 1JWHA 4IAFA 5KZ0A 3GU8A 3TZ9A 1IG1A 3NR9A 3W2QA 5C9CA 2J5EA 2YLEA 2J51A 2X9FA 3FZPA 3UOJA 1G8AA 2CKQA 4ZMFA 3ID6C 5B0XA 3FMKA 4EZ3A 2VWIA 5FLFA 5M07A 3LKMA 1OI9A 3DBDA 4ID7A 3EKNA 2PUNA 5AR5A 3KULB 2IF8A 5H8BA 3F88A 2X1NA 3U8WA 1WBWA 3VS3A 2X9EA 3PVBA 4O4BB 4RFMA 3GBZA 2XM9A 3DV3A 4EKKA 5EW9A 4ZIMA 2PU8A 2W1DA 1OKYA 1OKVA 4L01A 2XNOA 2GFCA 1FINA 3FLYA 3FYJX 4I0RA 3GCQA 1J3HA 3DJ6A 1ZYLA 4ZTSA 4FV4A 2UW8A 3Q4UA 2HWOA 4OT5A 4BKJA 1SVEA 2X2KA 4AA0A 3VAPA 3G15A 2OF2A 5KMJA 3MFUA 4BWXA 2C47A 3SD0A 4P90A 5CXHA 5IQCA 1JOWB 1YHSA 2C6LA 2R3LA 5AP5A 4ACDA 2ESMA 1ZXEA 3MIAA 4DGNA 2ZV9A 4CV8A 2FYSA 2ZMCA 2PZIA 3VUIA 4FT0A 4CCUA 2C5VA 4ZJVA 2JBPA 3IOKA 2XIYA 3DK3A 4FT3A 2W4OA 4LM5A 4JS8A 2A0CX 1KSWA 3NCGA 5EYCA 5I5ZA 4JJRA 4W8DA 4D58A 4G5PA 4QP4A 3GFWA 1Q24A 3RTPA 4DEIA 3C4ZA 5I9XA 4ZTLA 1ST4A 5LVLA 3OOGA 2AUHA 3AQVA 4CV9A 2PMOX 2WU7A 5IU2A 3A2CA 5ANOA 4EK6A 4BBEA 2QI8A 2CNQA 2R7IA 1OL5A 5AAFA 3AT3A 5EHOA 3MPAA 4PPAA 4JBQA 4DC2A 4HVSA 5DWRA 4RFYA 2F57A 4L00A 4LL5A 4S32A 2YFXA 4FSZA 4K2RA 4AA4A 5LMAA 2YISA 4M69A 3EQFA 1GAGA 4P5ZA 3RMFA 3TUCA 2PZYA 4XG2A 3CY2A 1UU7A 4C61A 3FEGA 5FDPA 3VONA 3CQEA 1NW1A 4FE2A 4BC6A 3QUDA 1FMOE 3PIXA 3CS9A 4OTIA 1Q8UA 4FSMA 4DFUA 3AD4A 4NIFA 3KY2A 5I0BA 2ITNA 3TACA 2WQOA 3AKLA 3W16A 4FEWA 3SG9A 1PW2A 3QCSA 5JN2A 4C4EA 2AYPA 2W1CA 5DT3A 3LMHA 3WILA 3UIXA 4JAIA 4B4LA 3OWLA 5F9EA 5HG8A 2H96A 1PXOA 4B8LA 1PXLA 2YA9A 3B8RA 3RHXA 3UJGA 1ZY4A 3Q5IA 4JIAA 4W4WA 4DGLC 5IEVA 2YDJA 2PMLX 5HX8A 5ETCA 2EXMA 4NTSA 1QMZA 3TKIA 3UPZA 3FQEA 4YBKA 1OGUA 3JXWA 3EN4A 1O6LA 2BAQA 2P4IA 1Q41A 4KKHA 3ATTA 1Q62A 3I81A 4UX9A 2H8HA 3FYKX 4FV7A 4FV8A 2VO6A 1YWNA 1Q3DA 3TKUA 3KCKA 3R9RA 4S30A 2IN6A 1P2AA 1APME 2VWUA 4GFGA 5C26A 4DT8A 3ZEPA 2XKFA 2OK1A 4NW5A 5AJQA 5BX0A 5HZNA 3UDZA 2BIKB 3ZDUA 2RFNA 3KMMA 2XJ2A 5AA8A 3BX5A 3RZFA 2GNLA 4B8MA 4M3QA 3RAWA 5GZ8A 1KV2A 4TNDA 4HCVA 4BDEA 2G9XA 5JRSA 2CKEA 3EN5A 1E1XA 3P7BA 4E93A 4PP9A 3H0ZA 3QXOA 4AN9A 2WEVA 2YDIA 5CU4A 2ZDTA 4KS8A 5AAEA 1PXNA 3MY1A 5BNJA 5HCZA 4EZ5A 4F9CA 3TNIA 4DGGA 3SOCA 2CN8A 4KSPA 4LOPA 2YDKA 3RPVA 4IJPA 4PY1A 2JITA 3E93A 2YLFA 4FIFA 4XRJA 5HNBA 4R3RA 1JPAA 1KE5A 2P55A 2GS7A 2W9FB 3CP9A 5AR3A 3ULIA 3WF7A 1QL6A 3PIZA 1ZRZA 4TN6A 2E9PA 2JGZA 3H4JA 3NYNA 4WUNA 1PXMA 2BALA 5BVKA 3FPQA 3EQDA 3HV3A 1PXIA 4BCIA 5A4QA 1YDTE 2B9FA 1YQJA 2QKRA 4H1JA 2QU5A 2V0DA 2PMNX 3S95A 1IA9A 1YDSE 4M69B 2C0TA 5D7VA 3KRLA 4I22A 2UVYA 3C4XA 3BPRA 3ZO2A 3TDWA 3WF5A 1H26A 2G01A 3LCSA 4DAWA 1QPCA 2ETMA 2QQ7A 3F2AA 1M2QA 4UWCA 4NIFB 2YM4A 3UDSA 2ZVAA 2YJRA 4DN5A 3O8TA 5IA1A 1M7QA 2XNEA 4YLJA 3PWYA 3ZM4A 2Q83A 3PUPA 4EQCA 3VNTA 2VX3A 5A6NA 1YOJA 3MFSA 4YLLA 2YM3A 4EUTA 4ZJIA 1GOLA 3GCUA 4FVPA 2PZPA 3SLSA 4ALVA 4QDVA 3MJ1A 4F9YA 3LLAA 3UGCA 3MDYA 2ZV2A 3FZRA 2XZSA 1OL1A 2JKQA 2X6DA 3OFMA 3QRUA 4KABA 4L46A 4Y8DA 2IW8A 3RPSA 4BDBA 4BYJA 3OEFX 1A48A 2CKOA 2CKPA 4CQEA 4KWPA 3HRFA 2WQBA 4TY1A 1OVEA 1ZMUA 5F4NA 3TCPA 2VWVA 4YJUA 4ASZA 2RF9A 4C7TA 1H1PA 3PFYA 1V0OA 5JGBA 5LMKA 5HE1A 3DCVA 3EFLA 5J87A 2ACXA 2X4ZA 4FTKA 4YC8A 4ACHA 4CZYB 4E5WA 3TZMA 3DS6A 3NPCA 4S33A 2HYYA 2Z2WA 3FUPA 2CPKE 4FG9A 2OF4A 4QP2A 4R1YA 4H3BA 3ZDIA 4MD8E 4WNKA 3QLFA 3TXOA 1YVJA 2C0IA 4ERWA 3CLYA 3PPZA 4BZOA 3MH2A 4BR3A 3M1SA 4X3JA 2ETKA 3CTJA 4CZTA 2Y0AA 3OVVA 4L44A 2G2HA 4DFBA 4WNMA 3NUUA 3TZ7A 5E8SA 4QMOA 3ZO4A 4ZS4A 4L7FA 3A7HA 2V22A 3VVHA 4DEGA 1DI9A 1WMKA 4O1OA 2YCQA 2Q0BA 4FKIA 5CI6A 4V04A 1ZYCA 2IW9A 4BCMA 4UMQA 4BI1A 5LOHA 4O7NA 5GIPE 3MPMA 4IWDA 4DE4A 2BZHB 5AV4A 3T3UA 3DJ5A 5EQEA 5AFVA 1R78A 1V1KA 4FYOA 2GU8A 4PTCA 5IQFA 3ETAA 4ZY4A 2H9VA 2VO3A 3NVKI 3Q9XA 4KKEA 5M55A 4QQCA 4DDIA 3PSBA 1PHKA 1YI4A 1Z57A 1OIQA 3SXSA 5BQ0A 5CSXA 1PYEA 2W9ZB 3AC5A 3QZFA 5TF9A 1I09A 2R3OA 3LFDA 4G31A 2J0LA 4WG3A 4BL1A 3UOHA 4CKJA 4JR3A 2F9GA 5IA2A 4A06A 5IA5A 1GZNA 2YCRA 3ATSA 3NVMB 4C8BA 4CVAA 1ZWSA 3FHIA 2Y7JA 4FC0A 4C58A 4O2ZA 3GB2A 4AXCA 2FSLX 4DEEA 5J9LA 2ZM1A 4O0UA 3FMJA 2HZNA 4FEXA 4AZEA 4X21A 4PTEA 2CDZA 2X4FA 3HUCA 4YZCA 2PMIA 1W2DA 4FKVA 5KMNA 5DEWA 3QX4A 2VTMA 3P5KA 3VUTA 5A4EA 1G8SA 3HECA 2C6EA 3KQ7A 5BMMA 5HIBA 3ZUVA 2IPXA 3SV0A 3EFKA 2WZJA 1Z9XA 3HAMA 4FL2A 4D1SA 3IKAA 2AC3A 5AUWA 3KRJA 3UNJA 2Y4IC 3MA6A 5H2UA 4TWPA 1E1VA 3GGFA 4FNZA 4WG5A 3CD8A 3UYTA 4O0XA 1NT2A 3ORKA 4F7LA 5EKNA 3DQWA 4AOTA 3D94A 3JY0A 3I7CA 3OF0A 3PJ3A 4U81A 3HV7A 5CQUA 4MQ1A 5JSMA 2JC6A 3TMOA 2XK9A 3OTUA 3CKXA 4O0YA 3EMGA 4YSMA 3Q4TA 4L43A 4ZSGA 1OPKA 2R5TA 3GQIA 4F9AA 1OB3A 4CFFA 4ZJJA 4CCBA 4AFJA 4ZK5A 4X0MA 3RCJA 4JBOA 4YU2A 1WBVA 2B55A 3F66A 4EOQA 3PUFC 4IQ6A 5EM8A 1MRVA 4W4VA 1PMVA 3BGQA 2ITYA 2QOIA 1J7LA 4QMZA 3VHKA 1AQ1A 4JL9A 5HTIA 3PLAE 2R3JA 3C0IA 2OWBA 4WNPA 5M06A 2WQNA 3UODA 3C5UA 3Q32A 1XJDA 4Q9SA 3KN6A 5EYKA 3MFTA 3DT1A 5LWNA 3PDTA 3IW7A 4FBXA 5AP2A 4FODA 2OXYA 2V62A 4YBJA 2GNFA 2UW3A 2XK4A 2R3MA 3VS1A 4TWCA 5CXZA 2HXLA 4QNYA 3FI3A 3O51A 4UZDA 2OBJA 2YIWA 3NAYA 4BN1A 4I6LA 4GEOA 4EQUA 3L9LA 4HGLA 4AF3A 3EN6A 5HO8A 2W4JA 3RP9A 3ZH8A 3PSCA 4WO5A 3CJFA 4FIEA 2OJIA 2IZRA 3BEGA 4BRXA 2VTSA 2C5OA 3Q6WA 4OTQA 2W06A 3MWUA 2YABA 4IFGA 4PDPA 5HNGA 3VBWA 4G3GA 4XV9A 4MXCA 4NT4A 4UXQA 2WTKC 3OXTA 5ACKA 4YO4A 4C35A 4EK3A 4YTIA 2QOKA 2C3LA 2NP8A 2BRGA 3ANRA 5AWMA 4F70A 1SNUA 2X0QA 1ND4A 5LQFA 5CALA 4DDGA 3HMOA 4I4FA 4IB5A 1RW8A 3EJ1A 3QC9A 2W17A 5KMLA 2QG7A 1OUYA 2E2BA 4DFLA 3SHEA 2V7OA 3OWJA 3PPKA 1STCE 3ZYAA 4BICA 2OO8X 4BKZA 1UKHA 3WF6A 5I9ZA 4JOAA 4C3FA 1K9AA 2O0UA 5G6VA 4J71A 3ROCA 2IZSA 4DHIB 2BUJA 4FTRA 4FMQA 3S3IA 4CD0A 5T68A 3PJCA 5HVKA 4O4FA 1FGIA 4PDOA 3W32A 5FTGA 2EXCX 2NPQA 5EFQA 2JFMA 4E6DA 5LMBA 3ULZA 1H07A 3BELA 5CVHA 4GS6A 5CZHA 3AMYA 3ZUTA 2QOFA 1GY3A 2OJJA 3A7IA 3FQSA 4XV2A 3IW8A 4QP9A 4FTOA 4ANQA 3D5XA 1W2CA 2J9MA 5IUIA 5BVDA 3JR1A 2BRMA 5DNRA 5AP3A 1H01A 4NFMA 3ZS5A 5AR7A 4AWIA 4E6AA 5JH6A 5LWMA 4LG4A 5EI6A 4E1ZA 1G3NA 4BGHA 1H1SA 4UB7A 3S2PA 4MCVA 2J90A 3F3VA 3LQ8A 1F3MC 3PY1A 4FL1A 5CU6A 4ZTRA 3SC1A 2GQRA 5EDQA 1FGKA 3GENA 4LOOA 3LPBA 1SMHA 3R02A 2XRWA 2ITPA 2W7XA 4P4CA 4FTCA 4DEHA 2REIA 3PA4A 4TW9A 3KA0A 4IHPA 4E8AA 2WTDA 3ZO1A 4FTIA 4BBMA 3NX8A 3DGKA 3OCTA 4X6RA 2ZV7A 3IOPA 3VUHA 3W55A 5LMKC 4QDEA 5DHJA 4EKLA 2YM6A 3FBVA 3VIDA 4F4PA 2PUUA 5CTPA 3VBXA 4ZAUA 5CEKA 5L8LA 4AXEA 2UZDA 4R1VA 2O63A 2R3FA 5DEYA 5K4JA 2FSTX 4U40A 1ZMWA 2ZB1A 1VR2A 4E4LA 4OAUC 3TZ8A 4HOKA 1BI7A 4G6LA 4EH9A 5IA4A 3OWKA 3IS5A 4EOSA 3HYHA 4P5QA 3RI1A 3KXZA 3VC4A 3KREA 1PMNA 4L42A 4I92A 4ITHA 3HVCA 1H00A 5C8MA 3DBFA 4GKIA 3HZTA 3BCEA 4X6QC 2UUEA 3U55A 3E8EA 2XCHA 3BHYA 4WBBB 3EWHA 3R22A 2F49A 3RKBA 1JVPP 1LP4A 3N4UA 1PMUA 4QTCA 4QNAA 1JNKA 2QCSA 2FSOX 2UZWE 3W8LA 3RK7A 2A19B 4ANSA 4CT2A 5JFWA 3LQ3A 4DEDA 5CF4A 5AX3A 4DH5A 2WNTA 1QPJA 3ZZWA 4FV3A 2W05A 4D4VA 2AEGA 4M7IA 2YWVA 1Q3WA 3DZOA 4J8NA 3A7FA 2HK5A 5C8KA 4C59A 4IXPA 5IA0A 1ST0A 2VTIA 3S00A 3W33A 3PJ2A 5LCJA 4USDA 4WA9A 1OKZA 2OG8A 3O17A 4FNXA 4XHKB 5L4QA 5A14A 4DGMA 2I0YA 4BCNA 4EH6A 1MP8A 2A98A 3BGPA 1KE9A 3O50A 3NNXA 5IQBA 3NUYA 5CENA 4EH8A 5KO1A 4IVCA 5CLPA 2IW6A 3BE2A 3KC3A 4HPUE 4EWHA 3BLAA 4ZMEA 4I5CA 3UOKA 4RIYA 4RLKA 4YSJA 4I4EA 3QL8A 3DDPA 4G2FA 4IACA 4CFMA 2XEZA 2XK3A 4FZFB 3NS9A 1F0QA 3AT2A 4U8ZA 1XWSA 4BDIA 4D2RA 5CEOA 5GNKA 1WZYA 1J1BA 4PX6A 4FSUA 5BYZA 3MY0A 1O9UA 4BWKA 2UW4A 4EOOA 1UWJA 4KD1A 1AGWA 2I0EA 3MYGA 4I1ZA 2VTTA 3CSVA 2YM8A 1SVHA 3QUEA 3COIA 4JDKA 4C38A 4H05A 5A4CA 3FZ1A 4G3FA 1TVOA 4O22A 4OBQA 4QD6A 2ZV8A 2DYLA 2QLUA 5D1JA 3OCBA 5CT7A 4DTBA 4YJSA 3FSKA 2HW6A 4BDCA 2ZAZA 2QOCA 4GU9A 4FX3A 5ANIA 2LAVA 3LM5A 5HOAA 5E8YA 5A3XA 3FY2A 5D10A 3ANQA 2R2PA 3QRJA 1XKKA 2PZ5A 4GK2A 5DR6A 3VJNA 5I3RA 2WPAA 4EOKA 3OT3A 1XHAA 3QTUA 4GUEA 4DFNA 3H9FA 4RX9A 4CNHA 1OMWA 2XNBA 3L9NA