1H8FA

Glycogen synthase kinase 3 beta.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
352
structure length
352
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Kinase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Crystal Structure of Glycogen Synthase Kinase 3Beta . Structural Basis for Phosphate-Primed Substrate Specificity and Autoinhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1h8fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1h8fA01
2QI8A 2C1AA 4FZAB 3ZSIA 3A61A 1UVRA 3WF9A 4C35A 1IAHA 1XH8A 4CD0A 4TL0A 1UA2A 2QOLA 3BYSA 3FBVA 4HOKA 3T8OA 1ZY4A 3EN7A 3Q9ZA 2X7FA 4PPCA 1GZOA 4FBXA 2OJ9A 4YU2A 4O21A 1R3CA 2UZWE 3ZC6A 2EUFB 4GEOA 2CKPA 4JLCA 4X2NA 5DE2A 5KKRB 2J0MB 3DK6A 4EH8A 4UX9A 3OWLA 4BBFA 4M0YA 4DINA 5IEXA 2ITZA 4GIHA 3ZUUA 2VTRA 4K8AA 2Q0NA 4ZTQA 3LHJA 3QHWA 5HO6A 2FSOX 4UEUA 4M68A 2B4SB 2BAKA 4KBAA 2XIRA 5IMEA 5CNOA 2OU7A 2PMOX 3V51A 5E91A 5KZIA 2H6DA 2JDRA 3I5NA 4K2RA 3A7FA 2X7OA 5CSWA 3PA3A 4C7TA 3F5UA 2C68A 2XM9A 4BFMA 4YMJA 2Y6MA 3I5ZA 4W9XA 2VTLA 2I40A 3OC1A 4IB3A 4YTIA 3RHKA 5HNGA 2O8YA 5BVFA 4D0XA 2XK8A 3GCVA 1OIUA 3LKMA 1O9UA 1RDQE 4RIXA 3NMUF 4G5JA 4E5WA 4IB0A 3RK5A 5HVYA 4XV2A 2Y4IC 3DOGA 4GU9A 3S3IA 2W96B 2CSNA 1KE9A 1K9AA 4PWNA 4YJTA 3WF6A 3VNTA 2XJ2A 4B99A 3FY2A 3OT8A 5IQGA 5EW8A 5DPVA 2B9IA 2BZIB 3HP2A 4V0GA 5TF9A 3FMMA 3JY0A 3HMMA 4MX9A 4ANLA 4QPSA 3DZQA 1CMKE 4H39A 4O91A 2P55A 3OEFX 4G3GA 4YJNA 4BDBA 1S9JA 3CY3A 4OGRA 4FIEA 1UNHA 1NVQA 2WHBA 4I0TA 4TWNA 4UB7A 3A4OX 2Y6OA 3MESA 4TT7A 3ZFYA 5I5ZA 1JAMA 1PJKA 2X6DA 5LCJA 1UKHA 5CSVA 2PK9A 2GNIA 2UW5A 2WMRA 4OT5A 2PPQA 2OLCA 5EDPA 4R3PA 5HVJA 4E4XA 2R2PA 3BE2A 2WNTA 3P4KA 4KRCA 2P33A 3DV3A 4RZWA 1Y8YA 5JFXA 2OI4X 4ZP5A 1YI4A 2PUPA 3K3JA 5J79A 4J71A 3GOPA 3CSVA 5EOLA 4QMWA 1FBNA 1FMOE 3ZFXA 2ETKA 5CZIA 4G3FA 4MXCA 2J5FA 1DAWA 3HAVA 4ONAA 5H3QA 3ATSA 4IDTA 4QRCA 3OW4A 3I6WA 1BKXA 3UIUA 2XNEA 3RM6A 3PWDA 1Q97A 2BIKB 2HK5A 2KULA 4XBUA 2VRXA 4OUCA 1UU9A 1OPKA 2UZTA 3C4WA 3V3VA 4O7LA 4LL0A 2UW9A 3V6SA 4FT9A 3D7ZA 2XMYA 4FF8A 2GNJA 5B2KA 3FMHA 3IQ7A 2R3FA 4K1BA 2QOIA 3RWQA 4PL4A 4MEDA 4G3CA 4IWQA 4ITIA 3R9OA 1BLXA 2I0EA 4ZTHA 4O7VA 3W16A 2J51A 3QD4A 3PE2A 4GK2A 4XG7A 1VEBA 3ACJA 4J1RA 5CYIA 4CSVA 3ZRMA 5KZ0A 2LAVA 3I7CA 5DNRA 4PV0A 4N0SA 5F4NA 4BIBA 4CRLA 1ZOEA 3SHEA 4Q9SA 2FVDA 4FV2A 3H3CA 2HWPA 1G8SA 4KIQA 3AC2A 3Q5IA 4KB8A 4Q5HA 2PMNX 4FKQA 1FMKA 4WG5A 4PPAA 4EHVA 4FL2A 4NZWB 5AP7A 3FL4A 1W7HA 1H0WA 2IW8A 2J0KA 5KUPA 2VTHA 3ATTA 4JAIA 3KKVA 4BDIA 3B2WA 3PJ2A 2UV2A 3HECA 3ZFMA 4A9UA 4IVAA 5I9ZA 4I6QA 5EK7A 2VV9A 1OMWA 5M57A 2XJ1A 5DGZA 3RMFA 2IVSA 3OHTA 3UMWA 3UTOA 1JPAA 3HP5A 4XG6A 4EZ3A 1W84A 1JSVA 2IW9A 3FYJX 3CP9A 3HL7A 5E1EA 3RPRA 5AP3A 3TL8A 2CKEA 3FZRA 3PIYA 4UWYA 3D2IA 4FG8A 4I5PA 1WBWA 4FSZA 5IA4A 5F95A 4BHNA 2RF9A 4FEVA 4C4EA 3D5UA 1UU3A 4UXLA 5EOBA 3AGMA 3EMGA 4KKEA 4FYNA 4MD9E 5IA3A 3EN6A 2WB8A 4CRSA 4EEVA 3QD0A 2ZM1A 3S4QA 4PTGA 4DFXE 3CKXA 4NWMA 3EQIA 2ITYA 2G2IA 4O0VA 4CTBA 2PSQA 3HMOA 1MQBA 3G2FA 3EFJA 5I9UA 4JXFA 3QCXA 3LXLA 2FSTX 3FDNA 3KK8A 4FT5A 4CFUA 4D4RA 2GQSA 2FH9A 4LRMA 4MH7A 2YM6A 4ACGA 3NNUA 5D9HA 4DFBA 2X39A 3UG1A 4FUXA 4PRJA 4V05A 5FM3A 4JT3A 3W55A 4MXAA 5DWRA 4TYHA 4F7SA 4QP4A 4L3PA 1PXIA 3KFAA 2PVNA 3IG7A 4F7NA 5CF6A 3UC4A 1MQ4A 5EHLA 3SOAA 3H9OA 5L2IA 4ACMA 4BWKA 2WD1A 1UNLA 4IZ5A 3ZS5A 4Q2AA 4BDEA 1OBDA 2VO7A 2HZIA 5AADA 2FSLX 1XH5A 3U9NA 4M8TA 1KUTA 2V0DA 3PRFA 4DEBA 5GJFA 5EM6A 3LM0A 3PRIA 3QD3A 4TNDA 3F2AA 4RX9A 3NWWA 3VS4A 2C4GA 4O7ZA 5E8WA 5B7VA 5CSPA 5IEVA 5CU6A 2H9VA 3R8MA 2JFLA 2W4JA 4FICA 4IAFA 4JG7A 5HCXA 3PUPA 1JLUE 2B0QA 4RT7A 4ZIMA 3T9TA 2H34A 5M09A 3E87A 4EH4A 1FGIA 1TQIA 5HU9A 5EQYA 3AD6A 3PTGA 5CS6A 4ZTSA 5B2LA 4MQ2A 5CT7A 4I0SA 2B53A 5D7VA 1OL2A 5AWMA 1ZRZA 2W1CA 5FGKA 4CFWA 5K3YA 5AA9A 2A19B 2ZV7A 4FVPA 3KRJA 4YJRA 4RJ6A 1Q8ZA 4FKUA 4U3YA 3UZTA 2OBJA 3GQIA 3V8SA 2VN9A 4EUTA 5JGAA 4DCAA 1U54A 5DN3A 4BDKA 4F0IA 2C6MA 4MXOA 2VWWA 4KIOA 2Z7RA 4RJ5A 2V5QA 4Y73A 5F94A 4HPUE 1PXPA 3NUYA 2ZM3A 3JR1A 1ZZ2A 3WZEA 4B4LA 3PVWA 4WNPA 2PE1A 3KXGA 2B55A 2PYWA 2Y4PA 3C50A 3U87A 3Q2JA 3VS0A 4QQ5A 5IH6A 4G9CA 4DEAA 1IA9A 1VJYA 4FEQA 4YSMA 3V5WA 1P14A 3LVPA 5ANOA 2UZBA 3MVJA 4AA4A 5K5XA 3KRXA 3FMKA 3KB7A 4C58A 5CEPA 3TIYA 2JKMA 4JIKA 1PHKA 4QD6A 4RJ3A 3P23A 4TWCA 4A06A 2C3IB 5K5NA 4DTBA 4CKJA 2B52A 3LMIA 5HNIX 1P2AA 3OCTA 4W4XA 3RNIA 2XKCA 5HORA 5L8LA 3TIZA 4HYSA 4LFIA 2C5OA 1Q5KA 2A0CX 2IN6A 4KNBA 4ZTLA 3WYXA 3F5PA 5TE0A 1REKA 4IAKA 4AGCA 4OTPA 4EHGA 5AR2A 3B2TA 3OOGA 4IX6A 1CM8A 4E5AX 5HTBA 3DA6A 4U97A 4AA5A 1YXTA 1YVJA 2ETMA 4MKCA 4RVKA 3HMIA 5D7AA 4GUBA 5A46A 2A1AB 3ZONA 4BIEA 4IACA 4UZDA 4DG3E 3RHXA 3HAMA 3R6XA 4DYMA 4UMQA 2YIQA 5D12A 3POOA 4ZSGA 5HE1A 2E9NA 4C4IA 4YLLA 4GVJA 2XNOA 2Y0AA 5CT0A 1E9HA 4OW8A 3V01A 5I9YA 5CX9A 5I9VA 2W5HA 1Q3DA 2X2LA 3Q4TA 4IWPA 1VR2A 3EYHA 5GZ8A 1JKKA 1IAJA 2ERZE 2ZDTA 3RALA 3COMA 4I92A 5J5TA 2WMVA 4O1PA 3ORPA 3U4UA 4QP2A 3U8WA 3DK7A 3NSZA 4EK8A 5J9LA 4W4YA 1H26A 3TTIA 3C5UA 4YZ9A 3MGYA 5AUXA 4E3CA 3Q6WA 3IPHA 4W4WA 4KUJA 2UW6A 4U43A 1Q61A 3EKKA 1ZMVA 4GS6A 4E6QA 4EONA 3W2OA 4AAAA 3FZ1A 3W2CA 4YTCA 3F3WA 4NM0A 3DY7A 3PA5A 3KCKA 3QA0A 4BYJA 3DXQA 3DTWA 4DEDA 3ET7A 4O22A 3SD0A 4HYIA 4V01A 3DNEA 2W9ZB 3UZRA 4FKGA 2REIA 3SV0A 3MH3A 1L3RE 3QX2A 4KAOA 1NW1A 4ZLOA 4UWCA 5ETCA 4XG4A 3BGZA 4O82A 3QGYA 2IVUA 2CNUA 4G6OA 3ANQA 3UQFA 1R1WA 4E93A 4B8MA 4NCTC 2YDKA 4FGRA 1G3NA 5LQFA 4KIKB 3KVWA 4QPAA 4F9BA 4FTAA 2WMXA 4K11A 3AMBA 3ANRA 2PL0A 2Z60A 4BRXA 2X0GA 3EQGA 4C2VA 3R7VA 4AZEA 4I1ZA 4GJ2A 5CNNA 4U40A 3A7IA 3QKKA 4XLVA 2Y4IB 3QWKA 4XOYA 3IECA 2P4IA 2WQOA 2ITXA 3FKLA 3MV5A 3PP0A 5FD2A 2YIYA 5CEIA 3O51A 5FP5A 4PF4A 4F08A 2J0IA 1IRKA 4A4LA 3QKMA 2JIUA 4YR8A 3CKWA 1YI3A 4EOSA 3CJFA 1GOLA 4EH9A 3QQUA 3R2BA 4PUZA 2CPKE 3LFBA 3L8PA 4CQEA 1E1XA 3SRVA 4HZRA 4MTAA 5A54A 4XRLA 3QA8A 3W2QA 3DJ6A 2YM3A 2W1GA 2FUMA 1YOJA 1Q3WA 2XNNA 2Y7JA 4IANA 5L8KA 3GU8A 4OTIA 2HIWA 2GPHA 3E8EA 4A07A 5C4KA 1B6CB 3MVHA 4XX9A 3LFNA 2QU5A 2YISA 4AA0A 3WF5A 3MTLA 4FKIA 5HESA 3HRBA 2VX3A 3LXKA 2OJFE 5AUWA 5E92A 4F1OA 1KE5A 3BHUA 3GCQA 4APPA 2R4BA 3AQVA 3BV3A 2HXQA 3LE6A 5D11A 4L6QA 5E7RA 3T3VA 4M69A 2ZV8A 2J50A 3I4BA 3BU6A 4FSYA 3LFSA 4FV6A 1KE6A 2C0IA 2QU6A 3GU7A 3QTUA 1IASA 3QXPA 4WSQA 4X7QA 1PY5A 1DI9A 4RVTA 2DQ7X 1KWPA 3KF4A 4L43A 5E8SA 4E6DA 3GENA 3PXYA 3PZHA 5AP6A 2XJ0A 3P7AA 5HD7A 4ANQA 3NPCA 2F57A 5LOHA 4FZ6A 4Y95A 4RA4A 3K3IA 4DA5A 1UU7A 4CLIA 2G15A 1JOWB 3VS3A 4FV1A 5AP5A 2QKWB 3N9XA 4XS2A 4CZUA 4PL5A 4JDIA 4D1ZA 2QO7A 5J7HA 2C6DA 3LW0A 4B6LA 5IZFA 4MBJA 2WELA 3FLSA 4QMMA 4IAYA 4XLIA 3VJNA 3ZO3A 4K9YA 4KIPA 4LMUA 3QTRA 4RIYB 3KRWA 3WF8A 1DAYA 2OK1A 2C0TA 3JVSA 4G34A 4XCUA 4BWXA 3LQ3A 3ROYA 4ZJVA 4XG8A 2QG7A 4YC6A 4PTCA 3K5UA 5EYMA 3NUAA 5KHWA 1J7LA 3QQKA 4D4SA 2QQ7A 5ANDA 4YBJA 5AM7A 2YEXA 5LVLA 3ORLA 3EL7A 3W18A 3LFFA 2WXVA 4YZCA 4D5HA 1W82A 4GG5A 4NJDA 5DYJA 5AAGA 4OT6A 4EH2A 1OL7A 4YJOA 3MH0A 1M2PA 4FZ7A 1STCE 2Z2WA 3SAYA 4DH8A 1Y57A 5G1XA 4CZTA 4U44A 4UZHA 1ZAOA 5JRSA 3S00A 2PUNA 4BKZA 3VWAA 3HX4A 3LCDA 4RVMA 1V0BA 3UODA 2FGIA 4EI4A 3ZXTA 4D5KA 5LMBA 4RQKA 2WIPA 3EL8A 3ERKA 3W8QA 3TUDA 4EK6A 1FGKA 4FIJA 3LCTA 4QMPA 4EUUA 2RG5A 2CKOA 2F7EE 3EN9A 1H1RA 1YRPA 2BKKA 5EI2A 2W5BA 4V04A 3OWPA 3E3PA 2XCKA 4O38A 2GU8A 4ZY5A 2FYSA 4RZVA 4EOOA 2HZ0A 3R21A 4AQCA 3CPCA 4CKIA 3KK9A 1NT2A 2OWBA 2WO6A 1Q8YA 4Y5HA 5TT7A 3ZLSA 2OH4A 1RE8A 2R3RA 1I09A 4WD5A 4L45A 4E4NA 2W1ZA 4FI1A 2W99B 2NPQA 4IBMA 4AT4A 5J7BA 4F99A 3V5QA 3P0MA 2J0JA 1OKWA 4F6UA 3UNZA 4FL3A 1LEZA 3WZUA 3JXWA 2WOTA 4R78A 1OM1A 1WBVA 4PDSA 4RRVA 1KV2A 4F9CA 5CSXA 4MYGA 3MA3A 1WFCA 2UW7A 3QUEA 3AXWA 3OP5A 4LI5A 2ITNA 2X6EA 2G9XA 4GIIA 3MW1A 3GGFA 4G2FA 4J95A 2XEYA 5HO8A 5FRIA 3FEGA 2R3NA 3IGGA 1Y8GA 5AX3A 2E9VA 4M66A 4UY9A 2VWZA 4X0MA 1BI7A 3HNGA 5HE3A 1PXLA 4FNYA 4ITJA 3UBDA 3UDBA 3FZOA 5K0XA 3VBXA 1H07A 4XV1A 2JBOA 5FDXA 4RBLA 3UP7A 4RFYA 5T3QA 4FNWA 3MPAA 5CSHA 3NYNA 4PNKA 3TUBA 4CG9A 3QCQA 4N6ZA 4KBCA 4YTHA 2GQGA 4TYEA 5HTCA 2XNMA 4AZVA 1JWHA 3QD2B 3HA8A 2VZ6A 3DK3A 2VD5A 3AD5A 4DG2E 3O71A 3A8XA 3K2LA 1OKVA 4NH1A 4USDA 4WKQA 4OAUC 3G33A 3C4XA 3UNJA 3V8TA 4G3DA 3N4VA 4QP9A 3OOMA 1QPJA 4RG0A 4IMYA 4O81A 3Q5ZA 3RVGA 2W4OA 4CT2A 1JSUA 2A27A 5M08A 3LOKA 3PIZA 3GP0A 4F1TA 3DLSA 2BTSA 3QQLA 3UOJA 5BMMA 4E1ZA 2EVAA 5A4QA 1IA8A 4O0UA 3F3VA 5M51A 4D2VA 4GMYA 2YM4A 3MFRA 3EQRA 3U6HA 2VNWA 1HCKA 2I0YA 3GNIB 3D94A 2JEDA 3HDNA 3R22A 3R7YA 3TN8A 5EH0A 3DJ7A 4DTAA 3VBTA 3IW7A 5EM7A 4CG8A 2BROA 3D83A 5FDPA 3E5AA 4AW2A 4EOPA 4ITHA 3BBTB 4FTRA 1IR3A 3PXQA 4NCTA 4NIFB 4CXAA 4ZS4A 5IQHA 5CXHA 1WCCA 4M14A 4ZZNA 1G8AA 4JBOA 4BBMA 4IFGA 1WBNA 3VHEA 3E88A 1FVRA 4JAJA 1H27A 2QOCA 2XM8A 4XBRA 4CCBA 4YO4A 3OROA 2VGOA 5AFVA 2PUUA 4FMQA 4I22A 4A9TA 3D2KA 3OTUA 2PVHA 4GFGA 3RJCA 4S30A 2X1NA 3SXFA 3G0FA 4IAIA 4M3QA 4X3FC 3HEGA 3JVRA 3QQFA 4IEBA 5DEWA 2YA9A 4BDHA 2VTTA 3R7GA 5EHYA 1PYEA 2HZNA 5EG3A 2WEVA 3Q52A 2NO3A 2UUEA 2EXCX 2QKRA 4RX7A 2UVYA 4EH5A 2UZDA 5DEYA 2YWPA 3FI2A 5AR3A 4BWPA 4PY1A 5LXMA 1KOBA 1ZYJA 2P2HA 1YQJA 2PE2A 2YJRA 4Z7HA 3KULB 3FC2A 3P7BA 2O5KA 1YWVA 3LFCA 4LUEA 5F1ZA 5M56A 4EHZA 4XMOA 5BYLA 1H1QA 4PX6A 2CCHA 2IVTA 2QOFA 3HRFA 5EYCA 3R1YA 2XBJA 3R7EA 1W8CA 3DZOA 3R8VA 4EK3A 5CAOA 4BICA 2UW4A 4ANBA 2XUUA 4DFUA 3RPSA 3VW6A 1U5QA 3RINA 4QNAA 2IG7A 2C6IA 2OZAA 4FT0A 4WO5A 3CXWA 2E9PA 3VBYA 1ND4A 5BUEA 4O83A 4RFMA 1OECA 2WTVA 4FKTA 1I44A 4I5HA 5TKDA 1OPLA 3LJ2A 4HJOA 2YCFA 2WQMA 4N4SA 4DGMA 4FA2A 4BYIA 4O2PA 3CS9A 2R0UA 2C6TA 2PY3A 1GAGA 3DFAA 4G5PA 4GKIA 3QFVA 1QPEA 2H96A 3TT0A 4MQ1A 4HZSA 5CU3A 2WMUA 3FQHA 1LP4A 5CU4A 4ZSAA 4O2ZA 4L52A 3S95A 5DR6A 3DQXA 5JFSA 4O96A 4C2WA 4IE9A 5KMMA 3BRBA 4FUYA 4TPTA 2W1IA 2WU6A 4JRNA 2CGVA 3UYTA 5HLWA 5JFVA 1PRYA 2OKRA 4TZRA 2VO6A 1NVRA 3LCSA 3QL8A 4BI2A 3Q53A 4BR3A 2YCQA 3CC6A 3OEZA 4L9IA 3DXNA 3F6XA 4BZDA 3UP2A 4ENYA 3ODYX 2QCSA 3GC8A 3FHRA 3MFUA 4QP1A 4H1MA 4QMZA 1ZLTA 4EOQA 4FTMA 4D55A 4GL9A 2GSFA 3QXOA 4G3EA 4R1YA 5DRBA 5C03A 3UVPA 3WYYA 4ERWA 4CFNA 5CTPA 2EB3A 4JR3A 3LJ1A 3MJ1A 5M44A 3KC3A 5HX6A 1Y6BA 2XKDA 2X4ZA 2UW0A 3HUCA 3I0OA 3EQDA 3CR0A 5C26A 3IOPA 4GVAA 1PXMA 4ACDA 4EHEA 3EN5A 2QD9A 3E8NA 3RAIA 3QTZA 1Q62A 4TYGA 2OJGA 2JDSA 3LLTA 4L53A 4HCUA 2X4FA 2ITPA 4RA5A 2B54A 2C69A 1OL5A 4CMTA 2NRUA 3BQCA 5D10A 2QR7A 3DKOA 3MI9A 2WTWA 3E7VA 4FZFB 4U7ZA 4XEYA 3FI4A 3QTXA 4YLKA 3SXSA 3VUDA 3SW4A 3MY1A 3L8SA 3QZFA 4FVQA 4E8AA 3QYZA 3TUCA 4FTKA 4QTAA 5JQ8A 2W4KA 1GIJA 2OIQA 2XBAA 5AM6A 2O65A 3NLBA 4PDOA 3FSFA 4IIRA 1OIRA 4N57A 2UW8A 3MH2A 4CT1A 4I4FA 4YNEA 5C4LA 4FSRA 3OS3A 3RNYA 2Z8CA 3A4PA 1M17A 3GC0A 2HELA 5FLFA 3PWYA 3SVVA 2WTIA 4EBWA 2QHMA 2F9GA 3QALE 2ITOA 1OGUA 5FXSA 5H9BA 3R9RA 5IEYA 4C8BA 2QG5A 3L9MA 3FJQE 5JZJA 3FI8A 4ZMEA 4BCGA 2GNLA 5AAEA 5CASA 5AMNA 2P2IA 4GCJA 3E62A 2WKMA 3BLRA 3DDPA 5IQBA 4QNYA 4RIXB 2PVJA 1CKPA 1SVGA 1VZOA 4FSUA 3W2SA 4S33A 3B8QA 3D15A 3QCSA 3BYVA 4OTQA 4EOJA 2OXYA 1P4OA 2F7ZE 2IZTA 4FKRA 4V0GB 3G6HA 3NYVA 5EI6A 3R02A 3BYOA 3KXNA 1H1PA 3GB2A 5C8NA 3ZUTA 4O7RA 4UWBA 2XRUA 4BC6A 2PVFA 4QMXA 5I9XA 5L6PA 4DH7A 4I4EA 4B8LA 3DS6A 3O50A 4MAOA 5KMNA 3L8VA 3EHAA 2CCIA 2BDJA 4J8MA 4CV8A 4O86A 4D0WA 4E20A 2C5NA 2BRGA 3R8ZA 4BZNA 3M11A 3RPOA 5IQDA 3CQEA 4C0TA 5JGDA 3O8UA 4FSNA 5CANA 2GQRA 2GHLA 3EQHA 3KXZA 4O0SA 4EH3A 5CU0A 3UO5A 2XF0A 3Q32A 4C57A 4GRBA 3DBDA 3QQHA 5FEDA 3O8PA 4ID7A 5A9UA 2GHGA 2OGVA 3MIAA 1WBTA 2WQEA 2NP8A 1K3AA 2V7AA 3JY9A 4FV3A 1XHAA 4IVBA 4C33A 4FSMA 1AGWA 3V04A 2QC6A 3ODZX 3RPYA 4IAZA 3BGQA 4ARKA 3DKFA 4G17A 4IM0A 4Y72A 4MBIA 2BDFA 2YERA 5DI1A 4CTCA 2H8HA 2FA2A 3DBCA 1PXJA 2RIOA 4HCTA 4KSQA 3FMLA 2V62A 3A60A 3PVGA 4HGLA 5IPJA 5M4CA 2IJMA 1YXXA 2C47A 5HI2A 4KBKA 1WVWA 3DBQA 5CENA 5HCZA 4EL9A 1R39A 1XBCA 4F4PA 4QTBA 2JKKA 2O63A 4IX5A 5EW9A 1ZYLA 3TDVA 2F7XE 2E9OA 4ZY4A 5CEMA 3I0QA 1XH9A 3FMJA 5EDRA 4JQ7A 4D2TA 2PE0A 3ORXA 4J96A 2G2HA 2UVZA 2Z7QA 4X3FA 5AUZA 4BDFA 3W33A 4AW5A 3EQCA 4L00A 5F9EA 2OW3A 2IPXA 3PXRA 2C5VA 4M12A 3TNWA 3ZUVA 3PZEA 1M2QA 4DGNA 3DCVA 4DH3A 1J1BA 3VS6A 4XH6A 2OICA 3OFMA 3P9JA 4RJ7A 2UZNA 3MH1A 3LM5A 4EKLA 4FEXA 3O96A 3QAME 1OPJA 2WQBA 3BYUA 4I24A 4YZMA 3U55A 4DE4A 5K4IA 3EJ1A 2PMIA 1M14A 5C9CA 5A3XA 1PMEA 3BIZA 2BILB 2UZOA 3FL5A 4RIWA 5AJQA 1LEWA 3ORTA 3Q2MA 3LCOA 3MN3A 5DT0A 5ICPA 4AACA 5IQFA 3I1AA 4F7JA 4AGWA 2R64A 4CFXA 2RFNA 5BVNA 1JKLA 4AT3A 3TWJA 4X2GA 3ZO1A 3N4UA 3LFAA 4LG4A 1KE7A 3OMVA 3JPVA 4WNKA 1UWHA 4NT4A 2PZRA 3ZSGA 3L9PA 1W0XC 4F6SA 5J8IA 3R7OA 4EOMA 5LVPA 3UMXA 5CF4A 4JOAA 3D0EA 3F66A 4O1OA 4O0XA 2PULA 3DJ5A 3R0TA 5BVWA 4P7EA 4AN3A 1T46A 2BIYA 5LARA 3LFDA 4ZZOA 1IEPA 3O0GA 3COIA 4YJPA 2R5TA 3SC1A 4FX3A 3NUUA 3QZGA 3TNPC 2OFVA 2W1HA 5BYYA 1GZKA 3HV3A 2A4LA 2DUVA 3HMPA 1OIQA 2OJJA 4TYHB 2GTMA 1OKZA 3BELA 3E8DA 4F9YA 4FKLA 2DWBA 5E9EA 3M42A 4S34A 3ELJA 3EQFA 4I6HA 3ZXZA 4F9AA 5DH3A 2XZSA 4QMLA 3WBLA 4IM3A 3P86A 4AE9A 1SVHA 4ASDA 5KMJA 4YZNA 3GQLA 3VBQA 3UPZA 3POZA 4O6LA 4RJ4A 3T9IA 2J6MA 1SYKA 4E73A 4ZSEA 5EM8A 3VUTA 3P7CA 5KMIA 5M4UA 3TJDA 4N6YA 4PPBA 4DGLC 4JG6A 5JFWA 2R3GA 3IO7A 1SNXA 2YACA 3CQUA 3E8CA 4FK6A 4FL1A 3QBNA 5IA1A 2I0HA 4K18A 2Y8OA 4DN5A 1M52A 4F0GA 3AC8A 4O0RA 4MCVA 4LGHA 2Z7SA 3KN6A 3AGLA 3N51A 2J7TA 3NUXA 5H2UA 5FWKK 1PXOA 3GOKA 4FG7A 2X8EA 3BEGA 4ZTRA 1U5RA 5E8ZA 2QOOA 1XH7A 3AT4A 3FKNA 3PSBA 3NNWA 5C27A 4I20A 4YHTA 5FXRA 5FBOA 4G6LA 2QOKA 4L01A 1U54B 3R28A 2C5YA 2OF2A 2R3JA 4WHZA 2JBPA 2O0UA 3EZVA 5DOSA 3DKGA 4MNEA 5J9ZA 1ZOHA 3JUHA 2EXEA 3FSKA 4M15A 4O7YA 2IZUA 4DT9A 2VTNA 4ZXTA 2F2UA 5HGIA 1V0OA 3UIMA 2CJMA 4S32A 5AR7A 3Q60A 1YWRA 4QQCA 4MHAA 4AFJA 2ZAZA 2VWUA 4NM5A 4EBVA 4NM7A 3MIYA 4I6BA 1JKTA 3L9NA 4LRJA 1AQ1A 4BDAA 2BRMA 3AC3A 3UO6A 1HOWA 4CCUA 3PJ8A 4J97A 3UZPA 1P4FA 2QURA 2JLDA 3H4JA 4G31A 3R2YA 4E4LA 4XHKB 2W17A 3D9VA 5K0KA 5GHVA 3VF8A 4ACHA 4KS8A 2JITA 1UNGA 2PTKA 3P5KA 3FLYA 3G0EA 4FG9A 4RQVA 4TNBA 3NUPA 4QT1A 5AUYA 5I3OA 2XK9A 5EHOA 3IW8A 4RJ8A 4DGGA 1GZNA 2ERKA 4RWIA 4QYGA 1CTPE 4R7HA 2JDOA 5HG9A 3O23A 3AC5A 4JDHA 3GT8A 3U51A 1O6YA 1CKJA 2B1PA 2OH0E 4HNIA 1M7NA 3R71A 3OXZA 3H9RA 3MY0A 4M13A 2YHVA 2G1TA 3ZO2A 4QP6A 5IKWA 1H1WA 5IU2A 2R3OA 3GU5A 3AC1A 3OTVA 3OUNB 2ZDUA 4S31A 4CVAA 1UU8A 3RZBA 5AP4A 3OXIA 2OXXA 4G16A 1ZARA 3D7TA 5AV2A 1SM2A 4YNOA 1RQQA 3A99A 4Q5EA 5C8MA 2PWLA 2QLQA 3UO4A 4L42A 4U81A 5ANJA 3A7HA 4GT3A 5K9IA 3F88A 3H0ZA 2QNJA 4BBEA 4C4GA 2RG6A 4F7LA 4IWDA 3TJCA 2CN5A 2WTKC 3QGWA 5CAVA 2OJIA 4KINA 2Q0BA 3OG7A 4HNFA 3KMWA 4ZJJA 3VUKA 1YDSE 4YJQA 5IDPA 4FTCA 2C6KA 3ACKA 3BHYA 4FZDB 4JNWA 3CGFA 4C02A 5JSMA 3HA6A 1BX6A 4QQTA 4FTIA 4CGAA 4BL1A 5DIAA 3E3BX 4I23A 3RP9A 4AZTA 4I6FA 3M2WA 5I4NA 1FQ1B 2C3JA 2ITVA 4CYIA 4PP7A 3GFEA 5KMLA 3PPJA 4YHFA 3QTIA 5I9WA 3SGCA 2V22A 2XKFA 4EK4A 3A7JA 4MK0A 4U6RA 4D2WA 3FMEA 4AX8A 4C61A 2X7GA 2X8DA 2VTOA 2XIKA 3DFCB 3VUMA 3ZO4A 5AX9A 2VTJA 4FC0A 4LV8A 4G6NA 3MYGA 2WMTA 5HTIA 4OTDA 3ZLWA 2CDZA 3DB8A 4H3BA 2VWYA 4IC7A 4ZSLA 5HLPA 3IK3A 5ANEA 1A06A 5ACBC 2C30A 2WQNA 3L1SA 2VWXA 4GFMA 4PMPA 4DEHA 2W06A 3MJ2A 4J98A 3W8LA 3QTQA 4Y5QA 5ITAA 1PMUA 3I81A 2BMCA 2C6OA 3IS5A 4TTHB 5HG7A 2YM8A 5DVRA 3TCPA 3NIZA 4YGAA 4ANSA 4B0GA 4TYIA 3VUGA 4C3PA 3BX5A 3EOCA 3SRVB 2ITQA 4BDJA 1GIIA 3QC9A 3OBGA 4TWPA 5BQ0A 4ORKA 3QCYA 3DKCA 4DFZE 5BVOA 4NUSA 3HV6A 5CLPA 3ZH8A 5HIEA 2J0LA 3MPTA 3R9HA 2QOHA 3TEIA 4RC4A 3UOLA 2YCSA 3VN9A 5IUGA 4FTUA 3QQJA 4ASZA 3ZMMA 4HGTA 3P78A 4DGOA 5GIOE 4ZAUA 2VWVA 4GFOA 4DFNA 3I7BA 4BDGA 4RIOA 3PA4A 2YZLA 2C3KA 3TNHA 2XP2A 3ZLXA 4EQMA 1J1CA 5L3AA 3PLSA 5EYDA 4X21A 3ORNA 4U5JA 5BPYA 2JKQA 5J5SA 2EU9A 4JR7A 4AZSA 4FSQA 1KSWA 2A2AA 2ETRA 1Y91A 2WMSA 3MWUA 3JYAA 4M69B 2YDIA 4U80A 3ZM9A 2IO6A 2JAVA 1BL7A 3PIXA 3FLZA 2ITWA 4H3PA 3UQCA 1UWJA 3GC9A 5HCYA 3RAHA 4NFNA 4XOZA 4ZJIA 2PUIA 3MVMA 4BKJA 1V1KA 2VTSA 3FZTA 3ZBXA 2OO8X 5JEBA 3T3UA 1EH4A 1XH4A 5LVOA 4BN1A 1S9IA 4U3ZA 3L9LA 4FSWA 2EXMA 2QHNA 4KWPA 4IC8A 1JSTA 4MXXA 1YHVA 2ZM4A 5JN2A 1NVSA 4AT5A 4ALVA 5CXZA 3FZSA 4O0WA 5BVEA 2OXDA 5JT2A 4R3RA 2QOQA 4L8MA 4S2ZA 1YXVA 2F2CB 4OBOA 2JC6A 3EQBA 3G9LX 1DI8A 5CVGA 4BCIA 3V6RA 3EZRA 2W5AA 5M53A 2VTIA 4FYOA 4OBQA 3VVHA 3GVUA 2J9MA 4D2PA 2GFCA 3TI1A 4HW7A 3TACA 4NKSA 3Q04A 3EIDA 4QMQA 3FPMA 3C0HA 1WBOA 3NZ0A 4Q9ZA 1R78A 1YDRE 5CY3A 3TV4A 3IDCA 3PXFA 5E8TA 3DLZA 3O2MA 4FV5A 4IAAA 4XG3A 5D41A 4BY9E 4X3JA 3FHIA 4EQCA 1WZYA 4DTKA 2RSVA 4W8DA 3TTJA 2P3GX 3ZCLA 4AP7A 5A4CA 4ANOA 3Q9YA 1XBBA 2CLQA 2SRCA 3P08A 1KE8A 2ZB0A 3FLNC 4RSSA 5BYZA 4FV7A 2Z02A 2R3IA 5HE0A 2I1MA 4QP7A 4HVIA 3HYHA 2O64A 2ZMCA 4GW8A 4AOJA 3SKCA 4IH8A 5HU3A 3A62A 3EFWA 3SW7A 4IM2A 4C34A 4R77A 3QTSA 3EKNA 3GCSA 2R7BA 4DAWA 1FPUA 3KRLA 4QYHA 3Q9WA 4NIFA 3KU2A 3OD6X 5GJDA 4TN6A 1Q4LA 2CHLA 1MRVA 3BGPA 2XYUA 2HCKA 3DB6A 4L7SA 3UOKA 4F64A 2W9FB 1PKDA 3GUBA 4FV9A 1Q24A 1YHSA 3SX9A 3RAKA 2PVRA 3VBVA 4E5BA 4GK3A 4FTTA 3PG3A 4GT4A 2WAJA 4TRLA 3W1FA 1PF8A 3NRMA 3N4TA 4QYFA 2ITUA 4FEUA 4FIIA 4OR5A 3E93A 1FOTA 5KE0A 4BCPA 2EWAA 4CKRA 3EFLA 5KHXA 4AGUA 2R3PA 3D4QA 2UZLA 4GYGA 4R5YA 1UV5A 4WG4A 3ORKA 4L46A 3O8TA 4J8NA 4FR4A 4C38A 5IDNA 4O0TA 5DRDA 1H4LA 3VHKA 4E6AA 3IW6A 2X9FA 3QZHA 1CKIA 3NW5A 5GINE 4F0FA 4DHFA 4EKKA 1YW2A 1XQZA 4C37A 5FG8A 2XVDA 4WNMA 5EDQA 3ZSHA 4D4YA 1J7IA 3Q9XA 5AV0A 4C3RA 2BCJA 5JK3A 2CMWA 2YDJA 2R7IA 2HENA 4PMMA 2YWVA 3QLFA 3COKA 4ZY6A 5CI6A 4D58A 3ORIA 3DTCA 4QO9A 3H10A 1K2PA 1JBPE 3DU8A 4AG8A 4CFFA 1A48A 2OSCA 2R3HA 3FXWA 1XR1A 4U9AA 4BI1A 4BCFA 2GNHA 4KRDA 2C3LA 3KF7A 4AE6A 2YM5A 5DT4A 3VC4A 4CNHA 3IOKA 4QMUA 5DLSA 4XP0A 3QKLA 3ALNA 4I5MA 5CI7A 4JBQA 4YZBA 4J52A 2JFMA 2X8IA 4FIFA 1U46A 3LMGA 3GFWA 3NYXA 4AZFA 2VTMA 3FV8A 5FTGA 2VX1A 4M7IA 4D4VA 4RX8A 4UMPA 4JQ8A 1U4DA 2R9SA 5GNKA 5M4IA 3KREA 4KABA 3ALOA 3NW6A 2VAGA 4GYIA 5AV1A 2PZIA 4XP2A 5EQPA 5HBJA 4DFLA 5L2SA 3UNKA 3OVVA 2I0VA 3R63A 4GH2A 3UC3A 5KMOA 3TKIA 3ENHA 4WUNA 3W32A 3TM0A 2VUWA 4P5QA 4EYJA 4DITA 4B9DA 5LMKC 3B8RA 4JI9A 5DA3A 5L2QA 4D2SA 3KL8A 3HKOA 1KV1A 5EKNA 3VRZA 5LVMA 3PJ1A 2GNFA 1J7UA 4WIHA 4IWOA 5HHWA 4FNXA 1H25A 3AT2A 4MD7E 4BGQA 4C4HA 1R0EA 4NW5A 1PXKA 3MSSA 3ZYAA 1G5SA 4BTFA 3F3UA 4WG3A 3BCEA 4QPMA 4A9YA 5L2WA 1WMKA 2UW3A 2PVKA 5CAQA 4AOTA 2WMQA 2BUJA 3A7GA 2YJSA 4KKHA 2YLEA 4NTSA 3BHVA 4W9WA 4BHZA 4OTHA 4P2KA 3IGOA 4H1JA 2GS2A 3JS2A 3FUPA 5JGBA 4YUQA 4APCA 3BZ3A 3PPZA 4FKWA 4LRKA 3R7IA 1MRUA 3VJOA 4IDVA 4OTFA 2PVMA 4LGDA 2R3KA 4R1VA 3OCGA 4D9TA 5A4LA 2RFEA 1UKIA 2OFUA 4XNEA 5ETIA 4WT6A 1OI9A 1H24A 5E4HA 1JQHA 3C0GA 3RK7A 2WMAA 4CEGA 5AR5A 4EJ7A 4FSTA 4MBLA 2YIRA 2JIVA 2C6EA 2P0CA 3FY0A 4ENXA 4GKHA 4DEGA 5AEPA 1YXUA 3CIKA 3HVCA 4WSYA 5HO7A 2IZSA 3KQ7A 5E8VA 2BRBA 3HDMA 4NM3A 4UBAA 4IXPA 3WZDA 4O7SA 3NS9A 3P1AA 4IX4A 3TXOA 4BIDA 4D1SA 3CE3A 2WTKB 1MRYA 5AP2A 5H8EA 3ZLYA 4AS0A 3KMUA 3OUKA 5DBXA 4F63A 5A14A 1RW8A 1PYXA 2HW7A 2QONA 4PL3A 4EK5A 5B2MA 5IQAA 3OBJA 5AR8A 4U0IA 5KNJA 3LPBA 5IUIA 3F3TA 4WOVA 3AMAA 3KY2A 3ZBFA 3DGKA 4JQEA 5A6OA 3ETAA 4MWHA 5BX0A 4LYNA 4YLJA 4OTRA 2OZAB 3E64A 3W2RA 4UN0C 4AUAA 4YJUA 4F65A 3W10A 5LVNA 3BQRA 3HZTA 2UZEA 2WOUA 3NVMB 4BDCA 3CJGA 3G51A 4ZTMA 4YC3A 3DXPA 4B7TA 3L8XA 4FGBA 3DPKA 3KXMA 4YC8A 4LQMA 3NNXA 4A9RA 1GZ8A 4ZEGA 3QF9A 2ONLC 1B39A 2YAAA 4J53A 4XG2A 4IZ7A 2XEZA 4RLKA 3MFSA 3V8WA 4ASXA 2J5EA 3FKOA 3QRJA 1XKKA 2BALA 3LFEA 3TZ7A 2XIXA 2ESMA 2W1EA 3U4WA 1PW2A 3R30A 3UG2A 1BUHA 4H05A 3LAUA 3G9NA 4FKVA 5CVHA 4ANMA 3BE9A 4MD8E 2JDTA 5AR4A 3TNIA 3GI3A 2WTDA 5TR6A 2VU3A 3NR9A 1FINA 1R0PA 3BU5A 3F5XA 4O0YA 3C7QA 3DQWA 3D5XA 3BI6A 2X2MA 4M84A 1CDKA 5HBHA 3R9NA 3REPA 4RX5A 5L4QA 3CGOA 4P4CA 3VO3A 3SA0A 2YIXA 4O27B 2GNGA 4X6RA 4HPTE 2GS7A 4YHJA 3UVQA 4R5SA 4KS7A 4XRJA 1H08A 4KKGA 2R3LA 4EORA 4DLJA 5AUUA 5DHJA 3CCNA 3G15A 4BCOA 4YZDA 1LUFA 2JD5A 2XK4A 4BVUA 2YIWA 3BHTA 1URCA 1JVPP 2QR8A 3G90X 4LOQA 4MNFA 2JGZA 5FEQA 1TKIA 2DYLA 4HYHA 3V5LA 1H00A 2IW6A 3E92A 4FIHA 5CAUA 1TQMA 3QC4A 2BAQA 4FIGA 3VUIA 2XRWA 2VWBA 2QOBA 4JJRA 4XYFA 1ZYSA 4ZS0A 3ZZEA 2GTNA 4Y8DA 5IG1A 2W7XA 5K4JA 3U54A 4CFVA 3II5A 3QRKA 5D1JA 4FV8A 2XA4A 3SXRA 3QRUA 2PZ5A 5BNJA 1OIYA 5DR2A 3ZDUA 4CQGA 5M07A 5IA2A 3OCBA 2CNVA 3ZRKA 4EH7A 4U8ZA 3GC7A 4BCNA 4C36A 3FE3A 4PP9A 2JDVA 4EC8A 3C4ZA 4M97A 3OY1A 3R8UA 5EYKA 2QODA 3VUHA 1ZMUA 4UXQA 4Y46A 4HYUA 3DT1A 2BTRA 2RL5A 4AW0A 4AXAA 4DLIA 2BKZA 2B7AA 4IB5A 5CF8A 3BEAA 2XNGA 3CTQA 1IG1A 3CY2A 4I94A 4MXZA 3AG9A 4ZLZA 1Q99A 3DDQA 5CQWA 3RBWA 4WBBB 4TWOA 3BKBA 1JKSA 1GIHA 4E7WA 1B38A 3NUSA 4I21A 2FSMX 3C13A 5L2TA 5JZNA 2G2FA 2X81A 2BFXA 3F69A 3Q4UA 1PXNA 2BZKB 4M67A 3VRYA 4BGGA 2QLUA 1QCFA 2J2IB 2YITA 3QUDA 4RWLA 3VW8A 4CYJA 5IA5A 3ORZA 3EFKA 3F9NA 3ZTXA 3PJCA 1O6KA 3OWJA 4HGSA 3HV5A 1OUKA 5IH4A 4BF2A 3I60A 2UVXA 5ANIA 3TZ8A 4Y85A 2F4JA 5AV4A 2C0OA 4LV5A 2ZJWA 3QUPA 2GS6A 2HYYA 4AW1A 3TDWA 4G1WA 3SG9A 1QMZA 3LZBA 1OKYA 3V5TA 1TQPA 3I6UA 5E1SA 2WZJA 1Q8TA 3BBWA 2WTCA 5I0BA 4OAVB 1SVEA 5IMXA 4FV4A 1H28A 3GXLA 3PVUA 4RVLA 3CD3A 1U59A 2J4ZA 5LMAA 5GIPE 1APME 4K0YA 1BMKA 1KOAA 3VF9A 4ZMFA 3NCZA 2CNQA 2W05A 4FOCA 3QU0A 3PSCA 5GJGA 5E8YA 5IISA 3R83A 5H8BA 2OIBA 4DH1A 2WFYA 5CF5A 4AFEA 4PQNA 4AU8A 3GU6A 3RCJA 4QMVA 3OY3A 5L8JA 4D1XA 3CTJA 3IKAA 3EYGA 1Z5MA 1WBSA 4NJ3A 2VGPA 1WVYA 3KVXA 3NGAA 4IQ6A 4WUAA 5HICA 5JQ5A 4ASEA 1XO2B 4QMSA 1HCLA 3Q4ZA 5BVDA 4DF3A 3RK9A 4A7CA 4FVRA 4WRSA 4EOIA 3FC1X 5LMKA 4NEUA 2PMLX 4PMSA 4YP8A 2RFSA 2VO3A 2YZAA 3OW3A 1CSNA 2R0IA 4QMTA 4YPDA 3F82A 1P5EA 2YN8A 3NIEA 2RFDA 3MB7A 3R7UA 4IADA 3BWFA 3DNDA 3MTFA 3MY5A 5L6WL 1NXKA 4GU6A 5EM5A 3KXXA 4ERKA 3EB0A 3R00A 3AMYA 3QWJA 1PMVA 4FTQA 4AN2A 4CFMA 5C8KA 5IH5A 3HGKA 4LGGA 1BI8A 5J87A 2BPMA 4X2JA 3MB6A 2E2BA 3UPXA 4CMUA 2WEIA 2ZB1A 3NW7A 3ROCA 5FQDC 5CEQA 3BWJA 1GNGA 4WNOA 4D2RA 4OTGA 4L3JA 3NAYA 2JAMA 1F5QA 2ITTA 2PZPA 4PDPA 3ULZA 3ZHPC 3ZOSA 4UMRA 1DM2A 1VYWA 4EH6A 2UZVA 4E26A 3UJGA 4X3FB 3ID6C 4YO6A 3UIXA 5I3RA 4O7WA 1OUYA 4DEIA 1QL6A 5LWNA 3GBZA 3UYSA 2OG8A 3OZ6A 3MBLA 3C0IA 4YURA 2WTJA 5EQEA 4OBPA 4LUDA 1W98A 2R3QA 2KTYA 3HV7A 4AZWA 4BI0A 4YTFA 4ZOGA 4RC3A 4MXYA 1BYGA 2NRYA 3R04A 4IVDA 4ZSJA 4L3LA 2XCHA 2ZV9A 3MFTA 4U79A 4W4VA 1PKGA 2W1FA 2JKOA 2W1DA 5FEEA 3DBFA 1LPUA 4RIWB 4YPSA 3RKBA 5IQIA 3R9DA 5LWMA 1ZYDA 2VTAA 4LOOA 2ZMDA 3ULIA 4DC2A 2CGWA 2O3PA 4H3QA 5HOAA 4R7IA 3RAWA 5J9YA 3O17A 3ZEPA 3MS9A 4N70A 1YI6A 1YKRA 4UMTA 4UMUA 5KCVA 2YCRA 4ZTNA 4QTDA 4WRGA 3KN5A 4KIKA 4E6CA 3QQGA 4QYYA 3TZMA 3FQSA 4Z9LA 2QO2A 3VULA 4EYMA 5JRQA 1ZY5A 4FKJA 1RJBA 5ANGA 4AN9A 1E1VA 1ZMWA 4K33A 3QYWA 4DBXA 3A2CA 2HZ4A 4MF1A 2Q83A 3CD8A 1WAKA 3U9CA 3F61A 2AC5A 5TO8A 5AP1A 2X2KA 3PFQA 1H8FA 5BMSA 2ONLA 2GDOA 3RGFA 1OL6A 2PZYA 2CN8A 3C51A 3G5DA 4FNZA 1WVXA 3KRRA 5EW3A 5BVKA 3VS5A 4HVDA 3BLQA 2NNWB 5HNBA 5M55A 2HOGA 4H36A 3LMHA 3PXKA 2V7OA 3AD4A 4U45A 4A9SA 1JNKA 2XH5A 2EB2A 4BCHA 1REJA 3Q3BA 4GUEA 5AUTA 2YABA 4BCMA 5KMKA 1J91A 5AP0A 4YBKA 4PTEA 3RCDA 4BCQA 3GEQA 5CEKA 4C3FA 5LCKA 4A4XA 5HIBA 3OCSA 3QX4A 4D28A 2HY81 3BLHA 2ACXA 3NCGA 3GCUA 3UVRA 3WI6A 5KO1A 1ZWSA 4Z55A 4D9UA 4EWHA 3LLAA 4KD1A 1FVVA 4UYNA 3NNVA 1YXSA 2WIHA 5HG5A 5HD4A 2XYNA 2PVYA 2Z7LA 2LGCA 3IW5A 4IVCA 4XG9A 1F0QA 2BRNA 2QO9A 3S1HA 2XK7A 3O7LB 5FTOA 4JBPA 3PJ3A 5TOZA 2O2UA 5A6NA 1M7QA 5E8XA 2C1BA 3WIGA 4QMNA 3CPBA 3ZZWA 5CALA 5CQUA 5IF1A 3FI3A 3BV2A 4EWQA 4XV3A 2B9JA 5ETFA 3SQQA 3PYYA 4AF3A 4RWKA 3WE8A 2HW6A 5KKRC 1OZ1A 3R1NA 1QPCA 4FK3A 4NSTA 4C4JA 4U42A 5HE2A 4C4FA 5HLNA 1XH6A 2B9FA 3MVLA 3G6GA 3GCPA 2PU8A 5GZAA 4IW0A 1SNUA 2FO0A 1MP8A 1FVTA 1OVEA 3UIBA 5DR9A 4MNEB 1GJOA 3H0YA 3OF0A 5G6VA 4LL5A 3F2NA 4PNIA 5H8GA 3W2PA 5FP6A 3F5GA 3Q4CA 3D5VA 3C4CA 4QMYA 5EFQA 4DBNA 3WOWA 5JKGA 5AIKA 4HGEA 5LJJA 1M2RA 1ZOGA 4DCEA 3C5IA 2W0JA 4JIAA 3CTHA 3Q96A 4RIYA 3WF7A 3E7OA 3TZ9A 5ANKA 1MUOA 2E9UA 3F7ZA 1NY3A 3F7WA 4J99A 5E90A 3S0OA 3SG8A 3I79A 3QRTA 5ETAA 4TKSA 3NAXA 3H30A 3FMNA 4F70A 4CLJA 1Q8WA 2YLFA 2R3MA 4O84A 4HVSA 3A8WA 2F49A 1ATPE 3BU3A 4DEEA 4P90A 3ZU7A 4O7TA 1ZYCA 2YAKA 4USEA 3ENMA 3LXNA 4IB1A 2VTQA 3PXZA 1SMHA 4XV9A 4UALA 5DG5A 1V0PA 3VQHA 4FE2A 4I0RA 2XIZA 3FXXA 4QQJA 5DT3A 5FBNC 3SLSA 3R1SA 4X6QC 3LFQA 2HY0A 2WU7A 1O6LA 3TV6A 4H58A 2DS1A 4TW9A 3TNQB 5M4FA 4JX7A 1BL6A 4QTCA 4LMNA 3V5PA 4I5CA 5FUTA 1SZMA 4M0ZA 5FM2A 3PE1A 4EJNA 2C5XA 2WMWA 4LM5A 4AWIA 2PHKA 2XIYA 4WA9A 5AIRA 4GG7A 5HIDA 3FXZA 2HWOA 3BPRA 4FKOA 4ACCA 5HEZA 3THBA 1YOLA 3D7TB 3HUBA 3DAJA 4GJ3A 2WGJA 5ACKA 3BYMA 3UQGA 4AGDA 4XUFA 5CVFA 3OWKA 5C01A 3ZDIA 4ALUA 4BB4A 4EZ5A 3AC4A 4R8QA 4RPVA 5C1QB 5L6OA 3PLAE 4P5ZA 4XP3A 4RGJA 5F20A 3CQWA 4I93A 5CU2A 3PY1A 4FKSA 4RLLA 2OIDA 3HV4A 2VX0A 3K5VA 4ZK5A 5BUIA 1VYZA 3TV7A 4TYJA 1Q8UA 4EOKA 5M06A 1AD5A 1QPDA 4RC2A 3VS7A 2JIIA 3PP1A 1Z9XA 3AOXA 2CLXA 2CGUA 3WARA 4EOLA 4IZAA 4FV0A 4BZOA 3TKUA 5EI8A 2GFSA 4PDYA 3Q6UA 4CZYB 3EQPA 3R8PA 2ZOQA 2BFYA 4F1MA 2X9EA 1OBGA 3OXTA 4NKAA 5J95A 3WILA 3F2RA 4L7FA 4MF0A 4BCKA 5A4TA 2ZVAA 2XKEA 1ZZLA 3RPVA 3DAEA 4NU1A 2BR1A 1X8BA 3E63A 4FOBA 4DG0E 3R73A 5JMSA 5CWZA 3R8LA 4RWJA 4U41A 5KBRA 5HQ0A 4TXCA 2AYPA 3ORMA 2BHHA 4EC9A 3ZRLA 3PY0A 4FTLA 3O7LD 2BAJA 3U6JA 1YDTE 1GY3A 3COHA 1XWSA 3FAAA 4OLIA 3WIKA 3U6IA 3IDPA 3QTWA 4ANNA 5HZNA 4QP8A 2CKQA 4JBVA 4RMZA 2ZV2A 5HKMA 4J7BA 2BZJA 5A4EA 3KGAA 1ERKA 4KSPA 3C1XA 3D5WA 3ZM4A 2WPAA 3FLQA 5J1VA 4FTOA 4DT8A 4R7BA 4LOPA 3C4EA 4DFYA 4JG8A 3KXHA 4I41A 2G01A 3FZPA 2WMBA 4II5A 4YJSA 3NUNA 1H0VA 3QZIA 3NYOA 4HCVA 3KCFA 4PMTA 4BGHA 4FEWA 1Y6AA 4Z16A 4IJPA 3VAPA 3CLYA 2FB8A 2XK6A 4IJ9A 5T68A 2RKUA 1URWA 3K54A 3LXPA 2UZUE 3LJ0A 2AC3A 3RI1A 4Z3VA 5FTQA 5IA0A 1OITA 1XBAA 3PY3A 4X2KA 5DFPA 3FPQA 2VNYA 2IWIA 3FLWA 3LQ5A 4NYEA 2BDWA 4DH5A 4EQUA 4K6ZA 4GSBA 4TY1A 3WZJA 2QVSE 4L44A 4GK4A 5EKOA 2BRHA 4FTNA 1Z57A 2HXLA 4XJ0A 4Z7GA 4FODA 3P79A 5DMZA 1YWNA 2CGXA 3H9FA 3EWHA 4NW6A 1LR4A 1ZXEA 3PSDA 3BHHA 1OL1A 4IZYA 4MVFA 3NVKI 4C62A 2J90A 4R3CA 4F6WA 5HX8A 2OF4A 5IUHA 5T6KA 3PPKA 4IX3A 4ALWA 4HVGA 3FWQA 5AUVA 2OZOA 3LIJA 3R1QA 5B0XA 5IQEA 2XB7A 4O6EA 2BVAA 4GV1A 4JDJA 4R6VA 3RWPA 3WE4A 4KA3A 4QTEA 1H1SA 2ZYBA 2I6LA 4YSJA 4C59A 2VO0A 3OT3A 4AOIA 3FQEA 4NK9A 2VTPA 4JL9A 4NL0A 1F3MC 3QHRA 3SOCA 3D14A 3KULA 1YOMA 3EN4A 2IVVA 5HVKA 3LCKA 3PG1A 2XS0A 4FKPA 3VBWA 5J1WA 4NTTA 5FXQA 1PMNA 1DS5A 3DAKA 4JX3A 3FMDA 3TKHA 4G9RA 5BUJA 4E4MA 4BKYA 1W83A 3M1SA 3KA0A 5JH6A 1Q41A 3QLGA 4F9WA 3RM7A 4GT5A 5E8UA 5HBEA 2HAKA 5AAFA 5AV3A 3PVBA 4IFCA 4JRVA 3IDBA 4BTJA 5KBQA 3UOHA 4HVHA 2GHMA 4UV0A 5CZHA 4BTMA 2AUHA 3R01A 5KX8A 4MWIA 3C9WA 1YHWA 5CEOA 2BZHB 2GMXA 4RFZA 1T45A 2XK3A 3GU4A 3MA6A 3HMNA 1A9UA 4EZ7A 2C6LA 3AT3A 4ZLYA 4JVGA 3NDMA 4X2FA 4FT3A 4FT7A 2V55A 1J3HA 3VQUA 4O7NA 3NEWA 3CBLA 3EH9A 4L67A 4QYEA 4W8EA 3UGCA 3CEKA 3WZKA 4BTKA 3S2PA 5CAPA 2GCDA 4JDKA 3HRCA 3MPMA 3RTPA 5GZ9A 3TG1A 3PDTA 2IZRA 4IHPA 4YJVA 1OB3A 4CMOA 3F3ZA 1XJDA 4USFA 2PVLA 4F09A 4A4OA 4NFMA 2RGPA 2XNBA 5IQCA 2XNPA 1WBPA 3SDJA 3V5JA 2Y9QA 4BDDA 3C4FA 3RZFA 4CV9A 4JS8A 3IONA 4Y83A 2BHEA 3QRIA 2B9HA 3HLLA 3KMMA 4L68A 3VS1A 3IW4A 3DBEA 2YM7A 4I3ZA 3ZEWA 3FYKX 4OTWA 3ZC5A 5AA8A 1TVOA 1H01A 4K77A 4QMOA 5HG8A 4QP3A 4WBOA 4UYAA 3KEXA 3LQ8A 3ITZA 2I7QA 3UE4A 4BCJA 2YFXA 3VIDA 1NA7A 4FTJA 1L8TA 3VS2A 4ZZMA 2VWIA 3MDYA 3NX8A 4QOXA
chains in the Genus database with same CATH superfamily
2QI8A 2C1AA 4FZAB 3ZSIA 3A61A 1UVRA 3WF9A 4C35A 1IAHA 1XH8A 4CD0A 4TL0A 1UA2A 2QOLA 3BYSA 3FBVA 4HOKA 3T8OA 3W0MA 1ZY4A 3EN7A 3Q9ZA 2X7FA 4PPCA 1GZOA 4FBXA 2OJ9A 4YU2A 4O21A 1R3CA 2UZWE 3ZC6A 2EUFB 4GEOA 2CKPA 4JLCA 4X2NA 5DE2A 5KKRB 2J0MB 3DK6A 4EH8A 4UX9A 3OWLA 4BBFA 4M0YA 4DINA 5IEXA 2ITZA 4GIHA 3ZUUA 2VTRA 4K8AA 2Q0NA 4ZTQA 3LHJA 3QHWA 5HO6A 2FSOX 4UEUA 4M68A 2B4SB 2BAKA 4KBAA 2XIRA 5IMEA 5CNOA 2OU7A 2PMOX 3V51A 5E91A 5KZIA 2H6DA 2JDRA 3I5NA 4K2RA 3A7FA 2X7OA 5CSWA 3PA3A 4C7TA 3F5UA 4I6LA 2C68A 2XM9A 4BFMA 4YMJA 2Y6MA 3I5ZA 4W9XA 2VTLA 2I40A 3OC1A 4IB3A 4YTIA 3RHKA 5HNGA 2O8YA 5BVFA 4D0XA 2XK8A 3GCVA 1OIUA 3LKMA 1O9UA 1RDQE 4RIXA 3NMUF 4G5JA 4E5WA 4IB0A 3RK5A 5HVYA 4XV2A 2Y4IC 3DOGA 4GU9A 3S3IA 2W96B 2CSNA 2NYAA 1KE9A 1K9AA 4PWNA 4YJTA 3WF6A 3VNTA 2XJ2A 4B99A 3FY2A 3OT8A 5IQGA 5EW8A 5DPVA 2B9IA 2BZIB 3HP2A 4V0GA 5TF9A 3FMMA 3JY0A 3HMMA 4MX9A 4ANLA 4QPSA 3DZQA 1CMKE 4H39A 4O91A 2P55A 3OEFX 4G3GA 4YJNA 4BDBA 1S9JA 3CY3A 4OGRA 4FIEA 1UNHA 1NVQA 2WHBA 4I0TA 4TWNA 4UB7A 3A4OX 2Y6OA 3MESA 4TT7A 3ZFYA 5I5ZA 1JAMA 1PJKA 2X6DA 5LCJA 1UKHA 5CSVA 2PK9A 2GNIA 2UW5A 2WMRA 4OT5A 2PPQA 2OLCA 5EDPA 4R3PA 5HVJA 4E4XA 2R2PA 3BE2A 2WNTA 3P4KA 4KRCA 2P33A 3DV3A 4RZWA 1Y8YA 5JFXA 2OI4X 4ZP5A 1YI4A 2PUPA 3K3JA 5J79A 4J71A 3GOPA 3CSVA 5EOLA 4QMWA 1FBNA 1FMOE 3ZFXA 2ETKA 5CZIA 4G3FA 4MXCA 2J5FA 1DAWA 3HAVA 4ONAA 5H3QA 3ATSA 4IDTA 4QRCA 3OW4A 3I6WA 1BKXA 1XMLA 3UIUA 2XNEA 3RM6A 3PWDA 1Q97A 2BIKB 2HK5A 2KULA 4XBUA 2VRXA 4OUCA 1UU9A 1OPKA 2UZTA 3C4WA 3V3VA 4O7LA 4LL0A 3W0QA 2UW9A 3V6SA 4FT9A 3D7ZA 2XMYA 4FF8A 2GNJA 5B2KA 3FMHA 3IQ7A 2R3FA 4K1BA 2QOIA 3RWQA 4PL4A 4MEDA 4G3CA 4IWQA 4ITIA 3R9OA 1BLXA 2I0EA 4ZTHA 4O7VA 3W16A 2J51A 3QD4A 3PE2A 4GK2A 4XG7A 1VEBA 3ACJA 4J1RA 5CYIA 4CSVA 3ZRMA 5KZ0A 2LAVA 3I7CA 5DNRA 4PV0A 4N0SA 5F4NA 4BIBA 4CRLA 1ZOEA 3SHEA 4Q9SA 2FVDA 4FV2A 3H3CA 2HWPA 1G8SA 4KIQA 3AC2A 3Q5IA 4KB8A 4Q5HA 2PMNX 4FKQA 1FMKA 4WG5A 4PPAA 4EHVA 4FL2A 4NZWB 5AP7A 3FL4A 1W7HA 1H0WA 2IW8A 2J0KA 5KUPA 2VTHA 3ATTA 4JAIA 3KKVA 4BDIA 3B2WA 3PJ2A 2UV2A 3HECA 3ZFMA 4A9UA 4IVAA 5I9ZA 4I6QA 5EK7A 2VV9A 1OMWA 5M57A 2XJ1A 5DGZA 3RMFA 2IVSA 3OHTA 3UMWA 3UTOA 1JPAA 3HP5A 4XG6A 4EZ3A 1W84A 1JSVA 2IW9A 3FYJX 3CP9A 3HL7A 5E1EA 3RPRA 5AP3A 3TL8A 2CKEA 3FZRA 3PIYA 4UWYA 3D2IA 4FG8A 4I5PA 1WBWA 4FSZA 5IA4A 5F95A 4BHNA 2RF9A 4FEVA 4C4EA 3D5UA 1UU3A 4UXLA 5EOBA 3AGMA 3EMGA 4KKEA 4FYNA 4MD9E 5IA3A 3EN6A 2WB8A 4CRSA 4EEVA 3QD0A 2ZM1A 3S4QA 4PTGA 4DFXE 3CKXA 4NWMA 3EQIA 2ITYA 2G2IA 4O0VA 4CTBA 2PSQA 3HMOA 1MQBA 3G2FA 3EFJA 5I9UA 4BJJA 4JXFA 3QCXA 3LXLA 2FSTX 3FDNA 3KK8A 4FT5A 4CFUA 4D4RA 2GQSA 2FH9A 4LRMA 4MH7A 2YM6A 4ACGA 3NNUA 5D9HA 4DFBA 2X39A 3UG1A 4FUXA 4PRJA 4V05A 5FM3A 4JT3A 3W55A 4MXAA 5DWRA 4TYHA 4F7SA 4QP4A 4L3PA 2X0OA 1PXIA 3KFAA 2PVNA 3IG7A 4F7NA 5CF6A 3UC4A 1MQ4A 5EHLA 3SOAA 3H9OA 5L2IA 4ACMA 4BWKA 2WD1A 1UNLA 4IZ5A 3ZS5A 4Q2AA 4BDEA 1OBDA 2VO7A 2HZIA 5AADA 2FSLX 1XH5A 3U9NA 4M8TA 1KUTA 2V0DA 3PRFA 4DEBA 5GJFA 5EM6A 3LM0A 3PRIA 3QD3A 4TNDA 3F2AA 4RX9A 3NWWA 3VS4A 2C4GA 4O7ZA 5E8WA 5B7VA 5CSPA 5IEVA 5CU6A 2H9VA 3R8MA 2JFLA 2W4JA 4FICA 4IAFA 4JG7A 5HCXA 3PUPA 1JLUE 2B0QA 4RT7A 4ZIMA 3T9TA 2H34A 5M09A 3E87A 4EH4A 1FGIA 1TQIA 5HU9A 5EQYA 3AD6A 3PTGA 5CS6A 4ZTSA 5B2LA 4MQ2A 5CT7A 4I0SA 2B53A 5D7VA 1OL2A 5AWMA 1ZRZA 2W1CA 5FGKA 4CFWA 5K3YA 5AA9A 2A19B 2ZV7A 4FVPA 3KRJA 4YJRA 4RJ6A 1Q8ZA 4FKUA 4U3YA 3UZTA 2OBJA 3GQIA 3V8SA 2VN9A 4EUTA 5JGAA 4DCAA 1U54A 5DN3A 4BDKA 4F0IA 3NFFB 2C6MA 4MXOA 2VWWA 4KIOA 2Z7RA 4RJ5A 2V5QA 4Y73A 5F94A 4HPUE 1PXPA 3NUYA 2ZM3A 3JR1A 1ZZ2A 3WZEA 4B4LA 3W0PA 3PVWA 4WNPA 2PE1A 3KXGA 2B55A 2PYWA 2Y4PA 3C50A 3U87A 3Q2JA 3VS0A 4QQ5A 5IH6A 4G9CA 4DEAA 1IA9A 1VJYA 4FEQA 4YSMA 3V5WA 1P14A 3LVPA 5ANOA 2UZBA 3MVJA 4AA4A 5K5XA 3KRXA 3FMKA 3KB7A 4C58A 5CEPA 3TIYA 2JKMA 4JIKA 1PHKA 4QD6A 4RJ3A 3P23A 4TWCA 4A06A 2C3IB 5K5NA 3KIOC 4CKJA 2B52A 3LMIA 5HNIX 1P2AA 3OCTA 4W4XA 3RNIA 2XKCA 5HORA 5L8LA 3TIZA 4HYSA 4LFIA 2C5OA 1Q5KA 2A0CX 2IN6A 4KNBA 4ZTLA 3WYXA 4AXFA 3F5PA 5TE0A 1REKA 4IAKA 4AGCA 4OTPA 4EHGA 5AR2A 3B2TA 3OOGA 4IX6A 1CM8A 4E5AX 5HTBA 3DA6A 4U97A 4AA5A 1YXTA 2XARA 1YVJA 2ETMA 4MKCA 4RVKA 3HMIA 5D7AA 4GUBA 5A46A 2A1AB 3ZONA 4BIEA 4IACA 4UZDA 4DG3E 3RHXA 3HAMA 3R6XA 4DYMA 4UMQA 2YIQA 5D12A 3POOA 1TFFA 4ZSGA 5HE1A 2E9NA 4C4IA 4YLLA 4GVJA 2XNOA 2Y0AA 5CT0A 1E9HA 4OW8A 3V01A 5I9YA 5CX9A 5I9VA 2W5HA 1Q3DA 2X2LA 3Q4TA 4IWPA 1VR2A 3EYHA 5GZ8A 1JKKA 1IAJA 5L2TA 2ERZE 2ZDTA 3RALA 3COMA 4I92A 5J5TA 2WMVA 4O1PA 3ORPA 3U4UA 4QP2A 3U8WA 3DK7A 3NSZA 4EK8A 5J9LA 4W4YA 4LDTA 1H26A 3TTIA 3C5UA 4YZ9A 3MGYA 5AUXA 4E3CA 3Q6WA 3IPHA 4O4CA 4W4WA 4KUJA 2UW6A 4U43A 1Q61A 3EKKA 1ZMVA 4GS6A 4E6QA 4EONA 3W2OA 4AAAA 3FZ1A 3W2CA 4YTCA 3F3WA 4NM0A 3DY7A 3PA5A 3KCKA 3QA0A 4BYJA 3DXQA 3DTWA 4DEDA 3ET7A 4O22A 3SD0A 4HYIA 4V01A 3DNEA 2W9ZB 3UZRA 4FKGA 2REIA 3SV0A 3MH3A 1L3RE 3QX2A 4KAOA 1NW1A 4ZLOA 4UWCA 5ETCA 4XG4A 3BGZA 4O82A 3QGYA 2IVUA 2CNUA 4G6OA 3ANQA 3UQFA 1R1WA 4E93A 4B8MA 4NCTC 2YDKA 4FGRA 1G3NA 5LQFA 4KIKB 3KVWA 1G8JA 4QPAA 4F9BA 4FTAA 2WMXA 4K11A 3AMBA 3ANRA 2PL0A 2Z60A 4BRXA 2X0GA 3EQGA 4C2VA 3R7VA 4AZEA 4I1ZA 4GJ2A 5CNNA 4U40A 3A7IA 3QKKA 4XLVA 2Y4IB 3QWKA 4XOYA 3IECA 2P4IA 2WQOA 2ITXA 3FKLA 3MV5A 3PP0A 5FD2A 2YIYA 5CEIA 3O51A 5FP5A 4PF4A 4F08A 2J0IA 1IRKA 4A4LA 3QKMA 2JIUA 4YR8A 3CKWA 1G8KA 1YI3A 4EOSA 3CJFA 2XAMA 1GOLA 4EH9A 3QQUA 3R2BA 4PUZA 2CPKE 3LFBA 3L8PA 4CQEA 1E1XA 3SRVA 4HZRA 4MTAA 5A54A 4XRLA 3W0OA 3QA8A 3W2QA 3DJ6A 2YM3A 2W1GA 2FUMA 1YOJA 1Q3WA 2XNNA 2Y7JA 4IANA 5L8KA 3GU8A 4OTIA 2HIWA 2GPHA 3E8EA 4A07A 5C4KA 1B6CB 3MVHA 4XX9A 3LFNA 2QU5A 2YISA 4AA0A 3WF5A 3MTLA 4FKIA 5HESA 3HRBA 2VX3A 3LXKA 2OJFE 5AUWA 5E92A 4F1OA 1KE5A 3BHUA 3GCQA 4APPA 2R4BA 3AQVA 3BV3A 2HXQA 3LE6A 5D11A 4L6QA 3AKKA 5E7RA 3T3VA 4M69A 2ZV8A 2J50A 4O4DA 3I4BA 3BU6A 4FSYA 3LFSA 4FV6A 1KE6A 2C0IA 2QU6A 3GU7A 3QTUA 1IASA 3QXPA 4WSQA 4X7QA 1PY5A 1DI9A 4RVTA 2DQ7X 1KWPA 3KF4A 4L43A 5E8SA 4E6DA 3UDZA 3GENA 3PXYA 3PZHA 5AP6A 2XJ0A 3P7AA 5HD7A 4ANQA 3NPCA 2F57A 5LOHA 4FZ6A 4Y95A 4RA4A 3K3IA 4DA5A 1UU7A 4CLIA 2G15A 1JOWB 3VS3A 4FV1A 5AP5A 2QKWB 3N9XA 4XS2A 4CZUA 4PL5A 4JDIA 4D1ZA 2QO7A 5J7HA 2C6DA 3LW0A 4B6LA 5IZFA 4MBJA 2WELA 3FLSA 4QMMA 4IAYA 4XLIA 3VJNA 3ZO3A 4K9YA 4KIPA 4LMUA 3QTRA 4RIYB 3KRWA 3WF8A 1DAYA 2OK1A 2C0TA 3JVSA 4G34A 4XCUA 4BWXA 3LQ3A 3ROYA 4ZJVA 4XG8A 2QG7A 4YC6A 4PTCA 3K5UA 5EYMA 3NUAA 5KHWA 1J7LA 3QQKA 4D4SA 2QQ7A 5ANDA 4YBJA 5AM7A 2YEXA 5LVLA 3ORLA 3EL7A 3W18A 3LFFA 2WXVA 4YZCA 4D5HA 1W82A 4GG5A 4NJDA 5DYJA 5AAGA 4OT6A 4EH2A 1OL7A 4YJOA 3MH0A 1M2PA 4FZ7A 2ZFYA 1STCE 2Z2WA 3SAYA 4DH8A 1Y57A 5G1XA 4CZTA 4U44A 4UZHA 1ZAOA 5JRSA 3S00A 2PUNA 4BKZA 3VWAA 3HX4A 3LCDA 4RVMA 1V0BA 3UODA 2FGIA 4LV7A 4EI4A 3ZXTA 4D5KA 5LMBA 4RQKA 2WIPA 3EL8A 3ERKA 3W8QA 3TUDA 4EK6A 1FGKA 4FIJA 3LCTA 4QMPA 4EUUA 2RG5A 2CKOA 2F7EE 3EN9A 1H1RA 1YRPA 2BKKA 5EI2A 2W5BA 4V04A 3OWPA 3E3PA 2XCKA 4O38A 2GU8A 4ZY5A 2FYSA 4RZVA 4EOOA 2HZ0A 3R21A 4AQCA 3CPCA 4CKIA 3KK9A 1NT2A 2OWBA 2WO6A 1Q8YA 4Y5HA 5TT7A 3ZLSA 2OH4A 1RE8A 2R3RA 1I09A 4WD5A 4L45A 4E4NA 2W1ZA 4FI1A 2W99B 2NPQA 4IBMA 4AT4A 5J7BA 4F99A 3V5QA 3P0MA 2J0JA 1OKWA 4F6UA 3UNZA 4FL3A 1LEZA 3WZUA 3JXWA 2WOTA 4R78A 1OM1A 1WBVA 4PDSA 4RRVA 1KV2A 4F9CA 5CSXA 4MYGA 3MA3A 1WFCA 2UW7A 3QUEA 4AXCA 3AXWA 3OP5A 4LI5A 2ITNA 2X6EA 2G9XA 4GIIA 3MW1A 3GGFA 4G2FA 4J95A 2XEYA 5HO8A 5FRIA 3FEGA 2R3NA 3IGGA 1Y8GA 5AX3A 2E9VA 4M66A 4UY9A 2VWZA 4X0MA 1BI7A 3HNGA 5HE3A 1PXLA 4FNYA 4ITJA 3UBDA 3UDBA 3FZOA 5K0XA 3VBXA 1H07A 4XV1A 2JBOA 5FDXA 4RBLA 3UP7A 4RFYA 5T3QA 4FNWA 3MPAA 5CSHA 3NYNA 4PNKA 3TUBA 4CG9A 3QCQA 4N6ZA 4KBCA 4YTHA 2GQGA 4TYEA 5HTCA 2XNMA 4AZVA 1JWHA 3QD2B 3HA8A 2VZ6A 3DK3A 2VD5A 3AD5A 4DG2E 3O71A 3A8XA 3K2LA 1OKVA 4NH1A 4USDA 4WKQA 4OAUC 3G33A 3C4XA 3UNJA 3V8TA 4G3DA 3N4VA 4QP9A 3OOMA 1QPJA 4RG0A 4IMYA 4O81A 3Q5ZA 3RVGA 2W4OA 4CT2A 1JSUA 2A27A 5M08A 3LOKA 3PIZA 3GP0A 4F1TA 3DLSA 2BTSA 3QQLA 3UOJA 5BMMA 4E1ZA 2EVAA 5A4QA 1IA8A 4O0UA 3F3VA 5M51A 4D2VA 4GMYA 2YM4A 3MFRA 3EQRA 3U6HA 2VNWA 1HCKA 2I0YA 3GNIB 3D94A 2JEDA 3HDNA 3R22A 3R7YA 3TN8A 5EH0A 4QDVA 3DJ7A 4DTAA 3VBTA 3IW7A 5EM7A 4CG8A 2BROA 3D83A 5FDPA 3E5AA 4AW2A 4EOPA 4ITHA 1W2FA 3BBTB 1IR3A 3PXQA 4FTRA 4NCTA 4NIFB 4CXAA 4ZS4A 5IQHA 5CXHA 1TZDA 1WCCA 4M14A 4ZZNA 1G8AA 4JBOA 4BBMA 4IFGA 1WBNA 3VHEA 3E88A 1FVRA 2AEGA 4JAJA 1H27A 2QOCA 2XM8A 4XBRA 4CCBA 4YO4A 3OROA 2VGOA 5AFVA 2PUUA 4FMQA 4FEWA 4I22A 4A9TA 3D2KA 3OTUA 2PVHA 4GFGA 3RJCA 4S30A 2X1NA 3SXFA 3G0FA 4IAIA 4M3QA 4X3FC 3HEGA 3JVRA 3QQFA 4IEBA 5DEWA 2YA9A 4BDHA 4QDEA 2VTTA 3R7GA 5EHYA 1PYEA 2HZNA 5EG3A 2WEVA 3Q52A 2NO3A 2UUEA 2EXCX 2QKRA 4RX7A 2UVYA 4EH5A 2UZDA 5DEYA 2YWPA 3FI2A 5AR3A 4BWPA 4PY1A 5LXMA 1KOBA 1ZYJA 2P2HA 1YQJA 2PE2A 2YJRA 4Z7HA 3KULB 3FC2A 3P7BA 2O5KA 1YWVA 3LFCA 4LUEA 5F1ZA 5M56A 4EHZA 4XMOA 5BYLA 1H1QA 4PX6A 2CCHA 2IVTA 2QOFA 3HRFA 5EYCA 3R1YA 2XBJA 3R7EA 1W8CA 3DZOA 3R8VA 4EK3A 5CAOA 4BICA 2UW4A 4ANBA 2XUUA 4DFUA 3RPSA 3VW6A 1U5QA 3RINA 4QNAA 2IG7A 2C6IA 2XAOA 2OZAA 4FT0A 4WO5A 3CXWA 2E9PA 3VBYA 1ND4A 5BUEA 4O83A 4RFMA 1OECA 2WTVA 4FKTA 1I44A 4I5HA 5TKDA 1OPLA 3LJ2A 4HJOA 2YCFA 2WQMA 4N4SA 4DGMA 4FA2A 4BYIA 4O2PA 3CS9A 2R0UA 2C6TA 2PY3A 1GAGA 3DFAA 4G5PA 4GKIA 3QFVA 1QPEA 2H96A 3TT0A 4MQ1A 4HZSA 5CU3A 2WMUA 3FQHA 1LP4A 5CU4A 4ZSAA 4O2ZA 4L52A 3BL9A 3S95A 5DR6A 3DQXA 5JFSA 4O96A 4C2WA 4IE9A 5KMMA 3BRBA 4FUYA 4TPTA 2W1IA 2WU6A 4JRNA 2CGVA 3UYTA 5HLWA 5JFVA 1PRYA 2OKRA 4TZRA 2VO6A 1NVRA 3LCSA 3QL8A 4BI2A 3Q53A 3UDTA 4BR3A 2YCQA 3CC6A 3OEZA 4L9IA 3DXNA 3F6XA 4BZDA 3UP2A 4ENYA 3ODYX 2QCSA 3GC8A 3FHRA 3MFUA 4QP1A 4H1MA 4QMZA 1ZLTA 4EOQA 4FTMA 4D55A 4GL9A 2GSFA 3QXOA 4G3EA 4R1YA 5DRBA 5C03A 3UVPA 3WYYA 4ERWA 4CFNA 5CTPA 2EB3A 4JR3A 3LJ1A 3MJ1A 5M44A 3KC3A 5HX6A 1Y6BA 2XKDA 2X4ZA 2UW0A 3HUCA 3I0OA 3EQDA 3CR0A 5C26A 3IOPA 4GVAA 1PXMA 4ACDA 4EHEA 3EN5A 2QD9A 3E8NA 3RAIA 3QTZA 1Q62A 4TYGA 2OJGA 2JDSA 3LLTA 4L53A 4HCUA 2X4FA 2ITPA 4RA5A 2B54A 2C69A 1OL5A 4CMTA 2NRUA 3BQCA 5D10A 2QR7A 3DKOA 3MI9A 2WTWA 3E7VA 4FZFB 4U7ZA 4XEYA 3FI4A 3QTXA 4YLKA 3SXSA 3VUDA 3SW4A 3MY1A 3L8SA 3QZFA 4FVQA 4E8AA 3QYZA 3TUCA 4FTKA 4QTAA 5JQ8A 2W4KA 1GIJA 2OIQA 2XBAA 5AM6A 2O65A 3NLBA 4PDOA 3FSFA 4IIRA 1OIRA 4N57A 2UW8A 3MH2A 4CT1A 4I4FA 4YNEA 5C4LA 4FSRA 3OS3A 3RNYA 2Z8CA 3A4PA 1M17A 3GC0A 2HELA 5FLFA 3PWYA 3SVVA 2WTIA 4EBWA 2QHMA 2F9GA 3QALE 2ITOA 1OGUA 5FXSA 5H9BA 3R9RA 5IEYA 4C8BA 2QG5A 3L9MA 3FJQE 5JZJA 3FI8A 4ZMEA 4BCGA 2GNLA 5AAEA 5CASA 5AMNA 2P2IA 4GCJA 3E62A 2WKMA 3BLRA 3DDPA 5IQBA 4QNYA 4RIXB 2PVJA 1CKPA 1SVGA 1VZOA 4FSUA 3W2SA 4S33A 3B8QA 3D15A 3QCSA 3BYVA 4OTQA 4EOJA 2OXYA 1P4OA 2F7ZE 2IZTA 4FKRA 1VLRA 4V0GB 3G6HA 3NYVA 5EI6A 3R02A 3BYOA 3KXNA 1H1PA 3GB2A 5C8NA 3ZUTA 4O7RA 4UWBA 2XRUA 4BC6A 2PVFA 4QMXA 5I9XA 5L6PA 4DH7A 4I4EA 4B8LA 3DS6A 3O50A 4MAOA 5KMNA 3L8VA 3EHAA 2CCIA 2BDJA 4J8MA 4CV8A 4O86A 4D0WA 4E20A 2C5NA 2BRGA 3R8ZA 4BZNA 3M11A 3RPOA 5BV3A 5IQDA 3CQEA 4C0TA 5JGDA 3O8UA 3VONA 4FSNA 5CANA 2GQRA 2GHLA 3EQHA 3KXZA 4O0SA 4EH3A 5CU0A 3UO5A 2XF0A 3Q32A 4C57A 4GRBA 3DBDA 3QQHA 5FEDA 3O8PA 4ID7A 5A9UA 2GHGA 2OGVA 3MIAA 1WBTA 2WQEA 2NP8A 1K3AA 2V7AA 3JY9A 4FV3A 1XHAA 4IVBA 4C33A 4FSMA 1AGWA 3V04A 2QC6A 3ODZX 3RPYA 4IAZA 3BGQA 4ARKA 3DKFA 4G17A 4IM0A 4Y72A 4MBIA 2BDFA 2YERA 5DI1A 4CTCA 2H8HA 2FA2A 3DBCA 1PXJA 2RIOA 4HCTA 4KSQA 3FMLA 2V62A 3A60A 3PVGA 4HGLA 5IPJA 5M4CA 2IJMA 1YXXA 2C47A 5HI2A 4KBKA 1WVWA 3DBQA 5CENA 5HCZA 4EL9A 1R39A 1XBCA 4F4PA 4QTBA 2JKKA 2O63A 4IX5A 5EW9A 1ZYLA 3TDVA 2F7XE 2E9OA 4ZY4A 5CEMA 3I0QA 1XH9A 3FMJA 5EDRA 4JQ7A 4D2TA 2PE0A 3ORXA 4J96A 2G2HA 2UVZA 2Z7QA 4X3FA 5AUZA 4BDFA 3W33A 4AW5A 3EQCA 4L00A 5F9EA 2OW3A 2IPXA 3PXRA 2C5VA 4M12A 3TNWA 3ZUVA 3PZEA 1M2QA 4DGNA 3DCVA 4DH3A 1J1BA 3VS6A 4XH6A 2OICA 3OFMA 3P9JA 4RJ7A 2UZNA 3MH1A 3LM5A 4EKLA 4FEXA 3O96A 3QAME 1OPJA 2WQBA 3BYUA 4I24A 4YZMA 3U55A 4DE4A 5K4IA 3EJ1A 2PMIA 1M14A 5C9CA 5A3XA 1PMEA 3BIZA 2BILB 2UZOA 3FL5A 4RIWA 5AJQA 1LEWA 3ORTA 3Q2MA 3LCOA 3MN3A 5DT0A 5ICPA 4AACA 5IQFA 3I1AA 4F7JA 4AGWA 2R64A 4CFXA 2RFNA 5BVNA 1JKLA 4AT3A 3TWJA 4X2GA 3ZO1A 3N4UA 3LFAA 4LG4A 1KE7A 3ML1A 3OMVA 3JPVA 4WNKA 1UWHA 4NT4A 2PZRA 3ZSGA 3L9PA 1W0XC 4F6SA 5J8IA 3R7OA 4EOMA 5LVPA 3UMXA 5CF4A 4JOAA 3D0EA 3F66A 4O1OA 4O0XA 2PULA 3DJ5A 3R0TA 5BVWA 4P7EA 4AN3A 1T46A 2BIYA 5LARA 3LFDA 4ZZOA 1IEPA 4JMQA 3O0GA 3COIA 4YJPA 2R5TA 3SC1A 4FX3A 3NUUA 3QZGA 3TNPC 2OFVA 2W1HA 5BYYA 1GZKA 3HV3A 2A4LA 2DUVA 3HMPA 1OIQA 2OJJA 4TYHB 2GTMA 1OKZA 1W2DA 3BELA 3E8DA 4F9YA 4FKLA 2DWBA 5E9EA 3M42A 4S34A 3ELJA 3EQFA 4I6HA 3ZXZA 4F9AA 5DH3A 2XZSA 4QMLA 3WBLA 4IM3A 3P86A 4AE9A 1SVHA 4ASDA 5KMJA 4YZNA 3GQLA 3VBQA 3UPZA 3POZA 4O6LA 4RJ4A 3T9IA 2J6MA 1SYKA 4E73A 4ZSEA 5EM8A 3VUTA 3P7CA 5KMIA 5M4UA 3TJDA 4N6YA 4PPBA 4DGLC 4JG6A 5JFWA 2R3GA 3IO7A 1SNXA 2YACA 3CQUA 3E8CA 4FK6A 4FL1A 3QBNA 5IA1A 3NFGB 2I0HA 4K18A 2Y8OA 4DN5A 1M52A 4F0GA 3AC8A 4O0RA 4MCVA 4LGHA 2Z7SA 3KN6A 3AGLA 3N51A 2J7TA 3NUXA 5H2UA 5FWKK 1PXOA 3GOKA 4FG7A 2X8EA 3BEGA 4ZTRA 1U5RA 5E8ZA 2QOOA 1XH7A 3AT4A 3FKNA 3PSBA 3NNWA 5C27A 4I20A 4YHTA 5FXRA 5FBOA 4G6LA 2QOKA 4L01A 1U54B 3R28A 2C5YA 2OF2A 2R3JA 4WHZA 2JBPA 2O0UA 3EZVA 5DOSA 3DKGA 4MNEA 5J9ZA 1ZOHA 3JUHA 2EXEA 3FSKA 4M15A 4O7YA 2IZUA 4DT9A 2VTNA 4ZXTA 2F2UA 5HGIA 1V0OA 3UIMA 2CJMA 4S32A 5AR7A 3Q60A 1YWRA 4QQCA 4MHAA 4AFJA 4O4FA 2ZAZA 2VWUA 4NM5A 4EBVA 4NM7A 3MIYA 4I6BA 1JKTA 3L9NA 4LRJA 1AQ1A 4BDAA 2BRMA 3AC3A 3UO6A 1HOWA 4CCUA 3PJ8A 4J97A 3UZPA 1P4FA 2QURA 2JLDA 3H4JA 4G31A 3R2YA 4E4LA 4XHKB 4DHZA 2W17A 3D9VA 5K0KA 5GHVA 3VF8A 4ACHA 4KS8A 2JITA 1UNGA 2PTKA 3P5KA 3FLYA 3G0EA 4FG9A 4RQVA 4TNBA 3NUPA 4QT1A 5AUYA 5I3OA 2XK9A 5EHOA 3IW8A 4RJ8A 4DGGA 1GZNA 2ERKA 4RWIA 4QYGA 1CTPE 2AQXA 4R7HA