2RL5A

Crystal structure of the vegfr2 kinase domain in complex with a 2,3-dihydro-1,4-benzoxazine inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
294
Chain Sequence
EHAERLPYDASKWEFPRDRLKLGKPLGRGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title Novel 2,3-dihydro-1,4-benzoxazines as potent and orally bioavailable inhibitors of tumor-driven angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 294
sequence length 311
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rl5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rl5A01
4QPAA 4DTBA 3DBEA 4I0SA 4E4NA 3F61A 2F9GA 3VS6A 3D5XA 4IAZA 2C5OA 4II5A 4JBOA 3QQHA 2UZEA 3M1SA 5CALA 4DFYA 3QXPA 4EL9A 3C5IA 3GXLA 3UYTA 1ZYDA 3FDNA 4Y85A 1WBNA 2BAKA 5K9IA 1WBWA 1IA8A 4USDA 4GJ3A 4AOIA 3E8EA 3ORPA 2IW9A 5IQDA 2WQBA 1WVWA 2XK4A 2QURA 3HECA 3F69A 4QO9A 4ANMA 5M4UA 3PLAE 1YHVA 4IB1A 2CN5A 4ZJVA 2RGPA 2GNJA 3EHAA 4DEHA 2BVAA 4QPSA 5H2UA 2E9UA 1OL6A 3MTLA 4NW5A 4NTTA 5A9UA 1FBNA 4I92A 4QP4A 2B55A 4NCTA 1A06A 1XH4A 3QTSA 5CAUA 3V8TA 5KMOA 3TDVA 3ZRKA 3CQEA 5HCYA 4IZAA 5BVNA 3AMBA 5DFPA 1ERKA 1P2AA 2XIKA 4QMSA 4Y46A 3UMWA 3ETAA 4CMTA 5CU3A 2OBJA 5M08A 3MFUA 3BYMA 5A3XA 4LM5A 5JMSA 4I6QA 3H3CA 4U45A 4CKIA 4IM2A 2BRGA 2PMOX 1A9UA 1OKVA 1XQZA 4ZTSA 4XG4A 3L1SA 3LFEA 4L01A 3LQ5A 2CPKE 2O2UA 3NW5A 5AR4A 2I1MA 4GT5A 4C02A 4EUUA 5EYKA 3RI1A 4D2SA 1QPDA 5F95A 5C03A 4F9WA 2W4JA 2PUUA 1NT2A 3LCSA 3F3TA 3H0YA 4S31A 5DMZA 5M07A 2EWAA 4CEGA 4IZYA 1Q3WA 5JQ5A 4G34A 4AQCA 4GH2A 5BX0A 2RSVA 3F7WA 2R7IA 1F0QA 4IJPA 5A14A 5EKNA 4G3CA 2XM8A 2X4ZA 3K2LA 4FUYA 4YPSA 5GNKA 5B2KA 5HLNA 3HA6A 3BQRA 3OWPA 3GQIA 3OXIA 4W8DA 5DEWA 2R3LA 5K0KA 3MYGA 4YLJA 2ZB0A 3P08A 1WBTA 3T9IA 1H27A 2Y6MA 3R73A 5BVKA 2YIYA 3R2YA 5AP4A 4TL0A 4KIKB 3EFWA 4S32A 4WKQA 4CV8A 3OUKA 3CQWA 5FWKK 5IH5A 2HZ0A 5DI1A 3KXXA 4U8ZA 5E8SA 2C5VA 3Q04A 3G0FA 2BRNA 4KWPA 4AZVA 3DY7A 2G2HA 3DZQA 4CCBA 5CAQA 4F1MA 2I7QA 2YCRA 2YITA 3QD2B 3KREA 4TXCA 4FNWA 3R71A 4YC6A 2HW7A 4M12A 4AUAA 3QUPA 5AV1A 5EG3A 5KHXA 4GYIA 3QL8A 4RZWA 3QRKA 2VGPA 2PUPA 4LQMA 3FLWA 3WF8A 4CRSA 5AEPA 4PNIA 3CR0A 5JFWA 5EI2A 1M7NA 3EQFA 4RJ7A 1V0PA 3BZ3A 2CGWA 4QMXA 5FD2A 4YJSA 3PJ3A 2YEXA 3EMGA 3MFRA 4UMTA 4F6SA 3DXPA 3IS5A 4D0WA 2KULA 3O17A 4ORKA 4X2GA 1JWHA 3CPCA 4KRDA 4FG9A 4CRLA 5HQ0A 3WE8A 4YU2A 5AAEA 1NA7A 1P4FA 4MQ1A 4HYSA 5J9ZA 4ZJIA 4TTHB 1JSVA 3P1AA 3PG3A 5DOSA 1NW1A 3QCXA 3FY2A 2JDVA 4Z3VA 2XKEA 2FO0A 4D9UA 1YWRA 3A4PA 2QLQA 3EQBA 2IN6A 4MVFA 3TCPA 1J1CA 3O7LD 3Q9WA 1J7IA 3DAEA 4I21A 2CCIA 1JQHA 3PA3A 4MXAA 1KOBA 5KZ0A 1XH9A 3RK5A 3G51A 1PXLA 4WUAA 4P90A 3UIMA 3WI6A 5C8KA 5CI7A 2HZIA 4IJ9A 4CYIA 2C47A 1AD5A 1YRPA 4HPUE 3FSKA 3ZYAA 1WBVA 5AUYA 4XS2A 2A1AB 2YABA 3ZUUA 5K5NA 1OIYA 4DEAA 4ITHA 5HO8A 2XKDA 2QO9A 4UV0A 2E9OA 2WQOA 4OR5A 4BIEA 1R3CA 3F3VA 4G9CA 4L3LA 4MX9A 1OBDA 1MUOA 3CGFA 1ZMUA 2J4ZA 4FV6A 4O2PA 5A4CA 3OUNB 1ZZ2A 4DEGA 2BZKB 4NKSA 4UZHA 5IA4A 2HWPA 4DGOA 3BI6A 4EZ5A 4WSYA 4MXXA 2WTCA 4UYAA 5CEQA 3JS2A 5DR9A 2UW7A 4FV9A 4AGCA 4C2VA 2PVRA 2J0MB 3FQEA 4CFXA 1FPUA 5HE2A 3R2BA 1K2PA 3O8TA 5JQ8A 2XNBA 2VX3A 2G2FA 1NVSA 3N51A 4YZ9A 3EFKA 1F3MC 2X39A 3QTXA 3UC4A 2XEZA 3POZA 4J8MA 3OEZA 3FBVA 1O9UA 4LRMA 3QQJA 2VWYA 2PUNA 5ICPA 4ZLYA 3DKOA 3GOKA 1UVRA 2VO7A 4YZMA 4MBIA 5C27A 4TYHA 3D94A 3A7IA 4AAAA 3P79A 3PDTA 1M52A 2BALA 5AUTA 3I6WA 4AP7A 5A4LA 5HGIA 4DH1A 2RG6A 3D15A 3R7YA 2OO8X 3AD5A 3MH1A 1ZY4A 3QWKA 2PULA 1GNGA 4U40A 2NRUA 3QZHA 4HZSA 3KGAA 4NM3A 3P7BA 4F08A 4F65A 5M4FA 4QQCA 1PMUA 5HBHA 3MW1A 4X7QA 4XRJA 4J8NA 4FBXA 2B54A 2C30A 5CU6A 4WD5A 4B6LA 2QG7A 3E64A 4OAVB 5AV4A 1YDRE 3AG9A 3BV2A 2FB8A 3NYOA 3ZXZA 3C0HA 3VUGA 1JPAA 2J0JA 4YTFA 4S2ZA 3T9TA 4RX5A 3LFQA 2BPMA 2NO3A 3UQFA 4RC3A 4JVGA 3MPAA 5IPJA 4X2JA 5AP3A 3FI3A 1IASA 4F7SA 4KIOA 3FEGA 2NPQA 3PJ2A 4RQVA 3WF9A 5EM8A 5E8VA 2FUMA 5TE0A 2XK7A 4RJ6A 4A7CA 4FIFA 1DAYA 3VBWA 3MS9A 4JI9A 5AP6A 4QTCA 2WHBA 4C3RA 5HVJA 2VX0A 3QZFA 3ULIA 2J9MA 3LAUA 5EOBA 3BYSA 3FLNC 5GZ9A 3GNIB 4M0YA 2WTKC 2DWBA 1H1QA 4PWNA 3V51A 3QX4A 3DJ7A 3CTJA 4CMUA 3GC7A 3ORIA 2LGCA 4UXLA 3TIZA 2YERA 3D7ZA 4M7IA 4X3JA 3R8UA 3UG2A 4CVAA 2PU8A 4NL0A 2C6EA 3R8VA 3CKWA 3NSZA 4EQMA 5LCJA 4C38A 3R1SA 3SA0A 4FV8A 5EDPA 2A27A 3PE1A 5AAFA 5KMMA 2P2HA 4M69B 4ERWA 1X8BA 1JAMA 2Z7QA 3F6XA 3WYXA 2CDZA 4FT9A 2QOOA 3SKCA 4ACMA 5CU0A 4E4LA 5A54A 5IA3A 4JBVA 4RPVA 2DS1A 2P33A 5TF9A 3C51A 4J71A 3ZUVA 4IVCA 3NW7A 4EOLA 1U5QA 1GOLA 4RA5A 3UQCA 2O65A 2CGVA 3LHJA 2BAJA 1SMHA 2JKOA 3QTZA 5EDRA 3HUBA 1ZYLA 2FVDA 4RA4A 4ANSA 4CQGA 3GFWA 1OB3A 1REKA 3QYWA 4ZSAA 2XNPA 3HRCA 3LFNA 3BHYA 3SOAA 5TOZA 4C34A 4MF0A 4YSMA 3SRVA 4UWCA 3CE3A 3FPMA 4HNIA 4WNKA 5CNOA 2R3PA 3JR1A 2V62A 3VS4A 2UW3A 4AOTA 4H1MA 5JGDA 4AZFA 3NZ0A 2BILB 2ZDUA 2P3GX 3QTIA 1MQ4A 5FXQA 4QNAA 4EJ7A 3LMIA 4F6WA 2C6DA 2UZWE 4RWLA 3WZUA 3ZM4A 2PZRA 5ETCA 2UW5A 1XO2B 2VAGA 5DPVA 3NUNA 3VIDA 3D2IA 3VUKA 4O7SA 4FTKA 4D2VA 5DH3A 2HYYA 3TUCA 3E3PA 3QGWA 4N0SA 4PP9A 2XIRA 5C4KA 4EWQA 3MVMA 2J90A 3BPRA 3LFCA 5CSPA 4ITJA 4DBXA 4LRJA 2GNFA 5LVNA 1M17A 3KVWA 3FXZA 4ZLZA 1G3NA 1M14A 3UP7A 3HLLA 5J79A 2GNGA 2WB8A 4OTRA 4WBBB 4FICA 5AIRA 4EH8A 4DT9A 1Q4LA 2ETRA 3D5WA 3M42A 3V8WA 1FINA 3Q2JA 3R83A 4FSNA 1KE9A 3ZOSA 3GC0A 3L8SA 4LUDA 5I4NA 3QA8A 4IDTA 3II5A 4QYGA 5JFSA 4UXQA 4ACDA 1T45A 2FYSA 4Z55A 2DQ7X 3QWJA 1BX6A 3KXNA 2XRUA 4FR4A 4AGDA 3EFJA 2BRHA 3GC8A 4BZNA 1S9JA 3COKA 4JG8A 2ERKA 3V5WA 4BKYA 4DLIA 4YC8A 4E6DA 3U6IA 2B9IA 5L8KA 3KCFA 4K2RA 1H00A 4BTKA 2JBPA 3AT4A 3F66A 3Q5IA 5J95A 4KIPA 5M51A 3TUDA 3DKCA 4O86A 3QTWA 4KBAA 2ITWA 4BZDA 4MBJA 3P23A 3CY2A 4IM3A 3MDYA 4O2ZA 4FTNA 3PWDA 2WOTA 3RHKA 4I22A 2H96A 3V04A 5HU3A 4UYNA 3UC3A 3NEWA 4C57A 1JVPP 1Q24A 5ETFA 3D7TB 4NK9A 3BIZA 3CQUA 5L2SA 3F2NA 1QL6A 5EQYA 5IQIA 3EQIA 3DDQA 4XOYA 3PA4A 4EOQA 2ZV9A 4XLVA 4OAUC 1HCKA 1TQIA 3A61A 3CCNA 1H26A 4L6QA 3ZEWA 3JVRA 5IEXA 2WZJA 5DLSA 5GHVA 1ZLTA 3BU6A 4UWBA 4JIKA 4O7WA 1PXOA 4IBMA 4QMPA 3A8WA 4V05A 3NUSA 1FMOE 4KKHA 1K3AA 3BWFA 2C68A 3VBTA 3CD3A 3VAPA 4IW0A 3RWPA 4MH7A 2BHEA 3ID6C 1ATPE 3MY1A 4FL2A 2UW6A 3BELA 3NUAA 5BNJA 4RJ4A 2ITZA 3DA6A 2PVMA 3BHUA 2A0CX 3AC2A 1B6CB 3K5VA 4FSTA 2XP2A 4CMOA 4RX9A 3R0TA 4W9XA 4U0IA 4W4WA 1J91A 1R78A 4RVMA 2VTOA 3QQGA 3IONA 1OBGA 5HO6A 3VS7A 5K4IA 4FIHA 2IZRA 1OKZA 5IUHA 2B4SB 5CANA 2W06A 2JAMA 4F7JA 5HU9A 2E9PA 3BGQA 2JC6A 2A2AA 4RJ5A 2CKPA 4FK6A 5CU2A 4CTCA 2B1PA 4QP8A 5CZHA 4IH8A 4O0XA 4B8LA 3N9XA 3FLZA 1KSWA 2FSOX 3U4WA 2PHKA 3EN6A 2EUFB 3NUPA 2BZIB 2P55A 2R5TA 2Z8CA 5KZIA 3QCQA 4OTHA 4BBFA 1OGUA 3FMEA 4CFWA 5IA1A 1B39A 5CSWA 4I0RA 5CTPA 5HVYA 3RAKA 1RW8A 2Y9QA 3LCDA 4GVJA 5TR6A 3T3UA 3PP0A 2R9SA 3TACA 3HEGA 4CNHA 5AV0A 4DT8A 1XH8A 4I3ZA 2Y7JA 2WD1A 5LMAA 5EM6A 4EBVA 5HNIX 4KKGA 5IZFA 1TVOA 5CI6A 2JD5A 2PK9A 2HXQA 4YHTA 5B0XA 2GTNA 3DDPA 5HE1A 4JR3A 2QOIA 2PE0A 2XF0A 3CGOA 4E6QA 2QOQA 4I5CA 5CU4A 3IDCA 1YW2A 3UPXA 4GFGA 5AFVA 3R8LA 5D11A 1H0WA 4ACCA 3BE9A 4L67A 2J5FA 3PFQA 2JBOA 5KMJA 4D1ZA 3P7CA 4FEUA 4UZDA 4MHAA 4BCNA 3WIGA 5F20A 4M15A 3OXZA 5IQBA 4ASZA 2FSLX 3DLSA 3KK8A 5EYMA 2ZOQA 4G3EA 1Q8ZA 4GKIA 1MP8A 2RFSA 3UYSA 4FZ7A 1J7UA 4GYGA 5E7RA 5TKDA 4RSSA 5IQGA 4O6EA 1PMNA 4CCUA 2OFVA 4JX3A 5JGBA 3O51A 1U46A 3Q3BA 2XJ2A 3AC8A 3E8NA 4IC7A 4XHKB 3RNIA 4CD0A 4YNOA 2EXMA 5E90A 3F2AA 2XS0A 2AC5A 4TNDA 2O3PA 2GCDA 1B38A 2YDJA 3HDMA 5LWMA 3OWLA 5FEQA 4FKPA 4ID7A 5IQHA 4K77A 4WT6A 3COIA 2PMIA 4C4IA 3R1QA 5J5SA 1YKRA 3IO7A 3L9NA 5BYZA 4O1PA 4KD1A 4OLIA 2YM8A 5ETAA 1OUYA 5M09A 4ACHA 5HCZA 4C59A 2JKMA 4HCTA 3HA8A 3OROA 2WELA 3NUYA 3A62A 1FQ1B 2WTIA 5JKGA 3QD3A 4RVKA 3OT8A 3PP1A 4QD6A 4E1ZA 4E5BA 4HOKA 2OW3A 2R3JA 2W5AA 2XK8A 4J95A 3AT2A 4ZTHA 4LV8A 5BUJA 4C61A 1PMEA 2YCQA 4O83A 4E7WA 2WTJA 2ZJWA 3TV7A 3EKKA 4J98A 4CFVA 4XRLA 1HCLA 2G01A 1YHWA 3BKBA 4C3FA 1KWPA 4QMUA 4V0GB 4GU6A 3JPVA 3S95A 3R30A 3MV5A 3NLBA 4IAIA 5HI2A 2WOUA 4N70A 3SLSA 2AC3A 5HG7A 4J97A 3ZRMA 2Z60A 4PY1A 3NNXA 4UALA 4BGHA 4O7ZA 1M2RA 5T3QA 3FZPA 3Q96A 3AMYA 2GPHA 2VTNA 4XG8A 5KHWA 3S00A 4Y95A 2W4KA 3ZC6A 3K54A 3UMXA 3PPJA 3I6UA 3TEIA 3R8ZA 5AX3A 4WRSA 2GTMA 4P7EA 4E20A 3E3BX 1OITA 2GHGA 2BKKA 1YWNA 4HVSA 2YIQA 2UZBA 3I1AA 4IEBA 5DG5A 3CJGA 5HE0A 2OXYA 2XRWA 2XCHA 3SXSA 5L2IA 1L8TA 5GZ8A 3NYXA 2WTKB 4GK3A 2VTRA 4LOPA 3BBTB 4ZTQA 4BCMA 3DTCA 3KXHA 2XKFA 2YIWA 4R7BA 2PVYA 3UOJA 4ZMEA 4DHFA 3KF7A 4O91A 2HAKA 3MI9A 4FT0A 4ONAA 3E92A 2YLEA 4BFMA 4KIQA 5GZAA 2RFEA 2UZVA 3RAHA 1YDTE 3NCGA 3ORXA 5CZIA 3D14A 2WEIA 4CKRA 5K5XA 5KMIA 2WTDA 4AN3A 3FXXA 3A4OX 5IQCA 3NNVA 1MRYA 4A06A 3LOKA 4JOAA 1MRUA 2XMYA 4L3JA 5L2TA 2XJ1A 4YR8A 3DZOA 3TIYA 5E4HA 2F57A 5FDPA 5J1WA 2W7XA 3G9LX 4J99A 4FGRA 2WMTA 4KINA 3ACJA 1OL7A 3C7QA 2YWPA 2BRMA 2Z7RA 3BGZA 1GZNA 3COMA 4IAFA 5AP7A 3RM6A 3P78A 3TKHA 2VO6A 2GSFA 3VF8A 1DI9A 1JLUE 3KRLA 3FZRA 5KCVA 4IM0A 1CKJA 3I0QA 3W10A 2HIWA 4FVRA 3DT1A 4RIYA 5AR8A 5CASA 4XP2A 5CAPA 2EB2A 2C3IB 4CZTA 4RIXA 1UU8A 3HP2A 3C4EA 2CSNA 3R9HA 5BYYA 3D5VA 3H9FA 3NWWA 3PZEA 4Y8DA 4E4MA 4B7TA 5D41A 2YCFA 3RPSA 5A4EA 4GFOA 5CEKA 3E7VA 4QQ5A 3UO5A 5BQ0A 3VRYA 4K1BA 4KUJA 3OEFX 4YSJA 2IVTA 1OZ1A 3I5NA 3QBNA 3R00A 4IAKA 3R7VA 3SG9A 2AYPA 4O81A 4BCJA 3DK3A 2FGIA 4XV2A 1H8FA 1ZMWA 5GIOE 4NCTC 4EORA 4G9RA 2WXVA 4BDKA 3Q60A 4FX3A 4YPDA 4KS8A 2RIOA 5B2MA 4GFMA 4PDSA 4M3QA 3VBXA 5ANEA 2BTSA 2IZTA 4PMPA 3PE2A 3QF9A 2CKEA 2OJGA 4DEDA 2YZLA 2OJIA 2XNOA 4MK0A 2CJMA 3GT8A 5J7HA 3EN7A 2ZMCA 4XV9A 3QQFA 4ZMFA 4DFNA 1J3HA 1H07A 4JBPA 2X4FA 5HICA 3VS1A 4XOZA 4WG3A 5BVOA 4D2WA 5AR3A 3R01A 2DUVA 2OJFE 3ORKA 3TZ9A 3ORLA 4ZAUA 3A60A 4I93A 3GEQA 1BMKA 3QCYA 4YJPA 5FTOA 3UIUA 2NP8A 5E8TA 3PZHA 4L43A 1BLXA 3ZSGA 4IADA 4GMYA 3W8LA 5M4CA 5AP2A 3W16A 5J8IA 4M8TA 3VUIA 3R63A 2VN9A 3TV4A 3FJQE 4AE9A 4QTEA 4USFA 2WMWA 2OH4A 1W7HA 4FZ6A 3I81A 2YM5A 3QTQA 3MVLA 2XK9A 3MJ2A 4G6LA 2VO0A 4JDJA 3UG1A 3F88A 2ONLA 4Z16A 1Q41A 3WIKA 3UNKA 3WBLA 3LXNA 5I0BA 4DN5A 3QRTA 4UMRA 4YJRA 2ESMA 3FMDA 4L9IA 2GNHA 3BLQA 4FYNA 3IW6A 1KE5A 4O38A 2C6OA 1JKLA 4QMWA 4AT3A 1IA9A 4EK4A 3NYVA 3PVGA 4PL3A 5BMMA 3BEAA 1PF8A 3TNIA 3RBWA 2PUIA 4Z7GA 3NGAA 2WMVA 2JDRA 2Y4PA 3E7OA 2VWUA 5C01A 3TN8A 2XZSA 1UU3A 4OTDA 2QR8A 4C7TA 1YVJA 4AX8A 3B8QA 4AFEA 4GUBA 3KEXA 4Q9ZA 4JRNA 3FMLA 4OBOA 2X2KA 4PDYA 4AN9A 4MCVA 4EOMA 2IZSA 3LM0A 4ZEGA 2GFSA 2VTSA 2HOGA 4LL0A 4O0SA 3PG1A 5D12A 5DVRA 5EYCA 3UE4A 2J5EA 5EYDA 2XNNA 4L45A 4TWOA 4D55A 1RJBA 2VWZA 3RZFA 3U9NA 4OGRA 3R8PA 1YWVA 4IB5A 1XBBA 4D5HA 5FUTA 2PMLX 4I6HA 3QRJA 4U7ZA 1DS5A 2BTRA 3G6HA 4KKEA 4E4XA 4ENYA 4IB3A 3F5UA 2UVYA 3TJDA 4TYJA 2JFLA 3ZONA 3TM0A 4GIIA 4O0YA 3PJ8A 1UNGA 2WPAA 4IX3A 4X3FA 4JRVA 4CLJA 4DE4A 3KU2A 5CF5A 3O7LB 4WHZA 4RIWA 1UKHA 3DCVA 3OCBA 2PZPA 2XIZA 1YOMA 2CNQA 4HW7A 4EOIA 3F82A 4M66A 4NM0A 5HX6A 3WF6A 2OIBA 2JITA 4YO4A 4U79A 1QPCA 3W33A 1PYXA 3UVRA 1URCA 1BUHA 4DEEA 5JSMA 3Q9XA 4ZLOA 2WU7A 2G9XA 4L44A 4WUNA 1ZOEA 2SRCA 4FV2A 3RTPA 4RBLA 5CSHA 3WF5A 1U54A 1UU7A 2BMCA 3LKMA 5KNJA 5HEZA 1ZYCA 2C6IA 3LFAA 3NYNA 4IQ6A 4XBRA 4F9BA 2JIIA 4MXCA 3AC1A 3RZBA 1E9HA 5CF6A 3F9NA 5FM2A 2EU9A 3BU3A 4QTAA 4Z9LA 1H25A 2XNMA 2YWVA 4JAJA 3RM7A 4M13A 2HXLA 5KE0A 4LMNA 3FSFA 3Q32A 4FUXA 4MYGA 3I7CA 4G5JA 3A7GA 1MRVA 3A99A 2V0DA 4IX5A 3ZZEA 3HV6A 5CVFA 4QYFA 4L53A 4MNEA 3ERKA 4FSQA 4R7IA 1MQBA 4U81A 3E8CA 3HKOA 4FT7A 1JSTA 1K9AA 3GU5A 1Z5MA 4LOQA 5L6OA 4BB4A 1PHKA 2I0VA 4YURA 4PX6A 4FA2A 2HZNA 3HMOA 1GZOA 3ODYX 3A2CA 4EC9A 2KTYA 4NZWB 4FIEA 3R1YA 4PDOA 4WG5A 4EBWA 4S30A 4WBOA 2YISA 3RP9A 4MD7E 3R9DA 4CGAA 4D4VA 5M57A 2QQ7A 3C4FA 5C26A 1PXPA 2R0IA 5K4JA 5L6WL 3DBDA 3BX5A 3W1FA 1DAWA 3R28A 4OBPA 2GHMA 3PRIA 1LEZA 4GKHA 4FIJA 4LV5A 3LMGA 1KE8A 4FMQA 2C0OA 4TY1A 3DQXA 1IAHA 3N4UA 4FKTA 4BBMA 5BUEA 5JK3A 3HL7A 2RF9A 4A9SA 3UQGA 4L52A 4O7TA 3CP9A 4HVHA 5B7VA 4FEVA 4WSQA 2I0EA 5AUZA 3NPCA 2BFYA 2WMUA 2XH5A 4NIFB 2AUHA 3RPRA 3SXFA 2X1NA 3Q9ZA 3Q6UA 1YXUA 4B0GA 2X6EA 3Q9YA 2X8IA 3ZXTA 1ZOHA 5L6PA 2GQRA 1QCFA 3D5UA 4EH4A 4KSPA 4I23A 4M67A 4Y72A 3ULZA 3NRMA 1H1WA 4O0WA 5H9BA 3MH0A 4PL5A 1YOJA 3GP0A 3EL7A 3OWKA 5LVLA 5AA8A 3KL8A 1Q8WA 3IQ7A 4Q9SA 3CC6A 4OTPA 3V8SA 2ACXA 4D4SA 2ZAZA 4FKQA 4YZCA 4YC3A 3P0MA 2BDFA 2OGVA 4JNWA 4FNXA 3PXYA 4FEQA 3WILA 3HRFA 3DXNA 3MY0A 3OW3A 3H9OA 4QP9A 4GRBA 2HELA 4QMQA 4M84A 1GY3A 1IEPA 2X0GA 2C3KA 3NIEA 2F2CB 4NW6A 2Z2WA 4OT5A 1UV5A 3NMUF 4Y5QA 2JDSA 3MESA 3LXLA 5BVDA 2HENA 3IPHA 4ERKA 1YQJA 1KV1A 3FXWA 3PVUA 4AZTA 4KBKA 4BTFA 4MD9E 3LQ8A 4QMZA 3BRBA 4Y5HA 2PZYA 2X9EA 4B9DA 4ZP5A 4RIOA 3LXPA 5KMNA 1O6YA 4FTLA 2BR1A 1IG1A 4JG6A 1Q3DA 1AGWA 3WZEA 1XBCA 3VBQA 2OZAA 5AADA 2VTPA 3G33A 3CD8A 4KB8A 3SDJA 1OMWA 3AGLA 4PPCA 3NW6A 1YXVA 2XCKA 4FKSA 4H3QA 4QP1A 3JUHA 1VZOA 3NVKI 4UMQA 4YJVA 3WE4A 5IF1A 3CLYA 3FYJX 5C9CA 4PPAA 3NNUA 2ZM1A 4FOBA 5AIKA 5HBEA 4A4LA 5KBRA 4O7NA 2OIQA 5HIBA 2PVLA 4O0TA 3SD0A 3W18A 4BDBA 4TRLA 4LGHA 5M4IA 2PVNA 4APCA 3O23A 1YOLA 5IKWA 1LUFA 2J2IB 3TL8A 2IVUA 2E2BA 3KA0A 4M68A 4G5PA 4UBAA 4FNYA 3U87A 1UA2A 4BYJA 4LMUA 2UZTA 5ANKA 5JGAA 3UZTA 1WVYA 4O21A 4AZSA 3CY3A 3JYAA 5DRBA 3ZLXA 1XH6A 2WEVA 2Y8OA 3DB8A 5AUVA 3QHWA 4XG6A 5EM7A 5I3OA 5F9EA 3OFMA 4DFZE 3ZRLA 3RJCA 3GU8A 1PW2A 4F9CA 2W4OA 3SQQA 2JLDA 3AT3A 2X8EA 4PV0A 4HGEA 5CT7A 5C8MA 5C4LA 5D7AA 2ZYBA 3OY3A 5AP5A 1PMVA 3WF7A 5IMXA 5M06A 5A6NA 3VUMA 2QOFA 5L2WA 2YIRA 4K6ZA 3O2MA 1PKDA 4H05A 1VYWA 4AT4A 1FOTA 2XIXA 3OWJA 3LPBA 3PTGA 3UZRA 4IX6A 2F7EE 3QZGA 3EQGA 3QTUA 2ZDTA 2VWXA 4IIRA 4HYIA 5J5TA 4O96A 3ZCLA 1U59A 4YJNA 2WU6A 4ZXTA 4EZ7A 3QAME 2WQMA 2W1GA 1OL2A 1U4DA 3B2TA 1SNXA 1YI3A 3QX2A 2IG7A 4BR3A 3EOCA 3ZMMA 4RQKA 4D5KA 4BTJA 4E8AA 4X2FA 1WMKA 4AXAA 4F0IA 3T8OA 2HCKA 4FT3A 4XNEA 1WBPA 4FGBA 2W1HA 3VNTA 4JXFA 2GS2A 1R39A 4J53A 1SM2A 3ENHA 3V5QA 2VTHA 2VTTA 4IWQA 4N6ZA 3U4UA 4BCGA 4BKZA 2WMXA 5CYIA 3OCTA 3FZOA 3ZM9A 2PSQA 4GG7A 4R1YA 4C36A 2Q83A 3OG7A 4NKAA 3OP5A 3QUEA 4H1JA 4A4OA 4IWOA 3HV7A 5EHLA 2X7GA 3WOWA 3AD4A 4GV1A 2UW8A 3FQSA 4XMOA 4YZDA 2OF4A 5F94A 4PP7A 4O7VA 4CXAA 2JIVA 4AACA 1GZKA 3R6XA 4O0UA 4V04A 4C0TA 3ODZX 1UKIA 3RCDA 5CAOA 2X7FA 3FE3A 4NH1A 3DTWA 4ANOA 4KNBA 5AAGA 2BHHA 1JSUA 2YM4A 4YP8A 4O7LA 1JBPE 3FC1X 3VUHA 2W1FA 3BQCA 4ALVA 2JIUA 3DK7A 4CFNA 1J1BA 3EIDA 4U5JA 4ZIMA 4CTBA 4G6OA 4AN2A 3VHEA 3GU4A 4G3DA 4O6LA 3EQDA 3MVJA 1Z57A 2XK6A 4ARKA 2PZIA 4FTTA 2GS6A 3EYHA 4P5ZA 3IGOA 4UEUA 4FSYA 5EW3A 3KULA 4QNYA 4TKSA 5FQDC 4L7SA 2Z7LA 3FQHA 1NY3A 1OIQA 4BRXA 4QYEA 4TWCA 4ANBA 4YO6A 4DLJA 3DU8A 5EK7A 2LAVA 4QMMA 5CEMA 4EKKA 1WAKA 3PPKA 5D7VA 2WGJA 3EWHA 3TZMA 3E5AA 4PMTA 3U51A 4JR7A 1ZOGA 1YXTA 4QRCA 5FBNC 3NCZA 3C0IA 4EYMA 3ZZWA 5CF8A 4IX4A 4PTGA 3R7IA 2ITNA 3DXQA 2V22A 1SYKA 3EQHA 3RPYA 2QR7A 4MF1A 4FG7A 2RFDA 2PTKA 3O8PA 2OWBA 3HV4A 4PRJA 3VHKA 4JJRA 3W2CA 5IU2A 4Q5EA 2I0HA 4F0FA 2ZV8A 5BMSA 3O96A 2R2PA 4HPTE 3PXZA 2R3MA 4CT2A 1LEWA 4XP0A 3MIYA 2FSTX 3Q2MA 2J0KA 1GAGA 3F3UA 3PXQA 3IW7A 5B2LA 3FLSA 2YHVA 3HMPA 4LG4A 5D10A 5ETIA 2WMAA 4QTBA 5AUUA 2F2UA 3OD6X 1PRYA 1IAJA 3VBVA 3WARA 2B0QA 4EQUA 4BHZA 1ZXEA 3DKFA 4BKJA 4NT4A 3FLQA 2XK3A 4S34A 3ET7A 2I6LA 3IGGA 3OT3A 2W99B 3KRXA 3O0GA 4FKJA 2HW6A 4IAAA 2XYUA 3V01A 3V5TA 3ZBFA 2BIYA 3QRUA 2HK5A 1Q99A 2GQGA 3ZTXA 4S33A 4UWYA 4FKOA 2F49A 4R8QA 5H8EA 3ZDUA 4BCQA 4TYIA 3PXRA 3OZ6A 4YJTA 4EQCA 3R9OA 2PY3A 1GZ8A 3FLYA 4AW2A 4R78A 3IOPA 4D2RA 4DG0E 4BDIA 1OM1A 4YJQA 4ANQA 1PKGA 2PVKA 4RJ8A 4TYGA 1SVHA 5HTIA 1P4OA 4HCUA 2G1TA 3VW8A 4C62A 1JOWB 3C13A 3HZTA 4MXOA 4IWDA 4DTAA 1L3RE 5BVWA 5AP0A 4LRKA 4AU8A 4RRVA 4G3FA 3KRWA 3DAKA 5LMBA 5AUWA 4BN1A 3KY2A 2YIXA 3HAMA 5HTBA 5HX8A 3H30A 2X8DA 4ZS4A 5I9WA 4FK3A 4KS7A 5KKRC 4HGSA 2XBJA 3OBJA 3ORTA 5M44A 3NS9A 3L8XA 4LGDA 4TYHB 4TT7A 4C8BA 5CEPA 4AT5A 3R9NA 2OSCA 1P14A 4BI1A 3KN6A 2CCHA 3QHRA 4HNFA 4XCUA 3UTOA 2E9VA 1XJDA 2R3OA 2H9VA 1M2QA 3LCOA 3UNJA 4KIKA 3WYYA 5J1VA 2C6MA 4BCFA 4AOJA 4ZJJA 4X6RA 2B9HA 3PYYA 1F5QA 4BZOA 4G31A 5IH6A 4FIGA 3MN3A 5CQUA 5AR2A 1OPKA 2VTAA 3R02A 5F1ZA 3F3WA 4FV7A 5AP1A 4YTCA 4RWKA 3I60A 3O8UA 2QU5A 3E8DA 3EJ1A 4LYNA 2QNJA 3SXRA 4O7YA 4FSZA 2GQSA 1FVVA 2B52A 3DV3A 3G2FA 3MTFA 4D9TA 3GGFA 2VU3A 5I9UA 5FXSA 4L42A 3QQKA 3GQLA 1YHSA 1FVRA 5ANIA 3KRJA 5HHWA 4BHNA 3QZIA 4O27B 2VTMA 2IW8A 3VW6A 4NJDA 4ZSEA 1M7QA 3VUDA 4AF3A 3QUDA 5L8LA 5DT4A 3A7JA 1SZMA 4IZ7A 5EQEA 4HCVA 1G8AA 4CG9A 4J96A 4MWIA 2G2IA 3KK9A 5K3YA 2VWBA 3JY0A 4F70A 2OXDA 4K11A 5E8XA 1H1RA 4ZZOA 4H3PA 4YUQA 4FVPA 2PE2A 3BYUA 3HMNA 4MD8E 1OI9A 3HV3A 1R0EA 4EK6A 2EXEA 2DYLA 2NNWB 2PVFA 5IH4A 4YZNA 2QVSE 2XNEA 2GMXA 4JX7A 3SV0A 3LZBA 1Q62A 2RG5A 4O0RA 1H08A 2UW0A 1NVRA 2C5NA 4EHVA 4U9AA 3PSBA 5KO1A 4QMOA 2VTIA 1KE6A 4FOCA 4KAOA 4AWIA 5HIEA 5JZJA 2QG5A 2WMQA 4MXZA 2JAVA 3AGMA 4BDDA 5M55A 4FV5A 4A9YA 5HBJA 2V55A 3ZFXA 2XNGA 4QTDA 5AM7A 1ZYJA 2R0UA 4JQEA 2W0JA 2RL5A 5CY3A 3OS3A 3D9VA 3ENMA 4DGNA 4RMZA 2ZMDA 4I5PA 3N4TA 1VJYA 2ITQA 3JVSA 3DGKA 4XH6A 2CKOA 2PVHA 4BCPA 4RLKA 4RT7A 3SRVB 4JLCA 5BVEA 3S2PA 3VS3A 2GNIA 4A9UA 4EH3A 2B53A 2QD9A 3OVVA 3NUUA 4N6YA 3SW7A 3OTVA 3ZLWA 4DF3A 1Q5KA 2PWLA 4BWXA 4ZZMA 3IW5A 3K5UA 4FZAB 5KMLA 3LFBA 5HCXA 4BI2A 4BTMA 4AA4A 4F7LA 5CT0A 3CEKA 4C37A 5A4QA 3QKKA 4U41A 3QLGA 4IHPA 5LVMA 5D1JA 4QP2A 4XYFA 5E8ZA 2W1IA 4D4RA 3MFTA 1LR4A 3AMAA 2QO7A 3DBQA 2IO6A 5BYLA 3GVUA 5DA3A 4DFLA 1JKSA 5EI6A 2YM3A 4JQ7A 2XEYA 5E8YA 4A9RA 3DFAA 3S3IA 3CJFA 4TPTA 4WIHA 1H4LA 4GS6A 4ZSJA 5JZNA 1YI4A 4O0VA 5F4NA 2J0LA 3R7OA 1VR2A 4I6BA 4R5YA 4BDJA 2UZUE 4I4EA 1CDKA 3HDNA 1DM2A 3WZKA 4EOJA 2W9FB 5M53A 3EYGA 3GCPA 3LJ0A 1RQQA 3UGCA 4BDCA 2R4BA 3PIZA 5E8WA 3I4BA 3KXMA 3ZDIA 2QI8A 4FEXA 5LVPA 3ITZA 5CQWA 4D2TA 1O6KA 3IKAA 3VVHA 3TT0A 3BYOA 3CS9A 3GU7A 3TV6A 3S4QA 2BKZA 1ZMVA 3FZ1A 2OLCA 4FT5A 1V0BA 3ALOA 4F9YA 2O63A 3FKNA 3OC1A 4JDKA 3EQPA 3U6HA 5FP5A 4FTIA 4G16A 2JGZA 5CXHA 2XBAA 4FNZA 4UY9A 1Y91A 4LL5A 3QQUA 3ZHPC 3KQ7A 3H0ZA 5FTQA 2ONLC 3ZFYA 2R3QA 2ZVAA 3MB6A 4OUCA 4BWKA 4YMJA 5IMEA 3ANQA 4DBNA 2VV9A 3KMMA 3CSVA 1CMKE 2XM9A 1W82A 3FL5A 3PWYA 4FIIA 5E8UA 3A8XA 3ZC5A 4DCAA 5E91A 1WFCA 3BLHA 2UV2A 3C4ZA 5G6VA 5I3RA 2YJRA 4ASXA 2R3RA 5DRDA 3KXGA 4I94A 2FSMX 5EHOA 3V5LA 3HV5A 2WAJA 2WMRA 5IQEA 4IFGA 3H10A 3VJOA 2C6TA 2BROA 3RALA 4IZ5A 4OTGA 4ALWA 2GS7A 4CSVA 1KUTA 4PTCA 4C3PA 5EQPA 5LMKA 3MY5A 4M69A 4AW5A 4E6AA 4R6VA 3PJCA 3FY0A 3GCSA 2X81A 4EJNA 4BIBA 4B99A 4C35A 2IPXA 3NNWA 4I5MA 3UO6A 5LOHA 5CNNA 4XLIA 3BWJA 3EZVA 3A7FA 4USEA 2HZ4A 4FV4A 3MSSA 4XG9A 3Q53A 1OL5A 4E5WA 4AZWA 1PJKA 2C0IA 4ZY5A 2FA2A 3LFDA 3W2QA 5LXMA 1XR1A 2X7OA 2IJMA 4P2KA 5I9XA 3AOXA 1GIJA 3KCKA 1FGIA 3E88A 3TNHA 3VC4A 4G2FA 3W2RA 4L68A 5DT0A 3R04A 3FAAA 1O6LA 2W05A 4UB7A 5HOAA 3K3IA 5DT3A 3UZPA 3SOCA 3ZU7A 5JRQA 3ZBXA 4FTQA 4FG8A 4K18A 3ATTA 1YXSA 1V1KA 2J7TA 2CLXA 1R1WA 3OXTA 4H3BA 4AFJA 4Z7HA 4JBQA 3ZSIA 4F6UA 4K8AA 4GT3A 4GJ2A 3TI1A 4CYJA 1H1PA 2JDOA 2EVAA 2WNTA 3P86A 3ZH8A 1UNHA 3JY9A 4XEYA 4X3FC 2WMSA 3AC3A 4U42A 4CQEA 2ZM4A 5IQFA 2GU8A 3P7AA 1APME 4EOSA 4PPBA 4NM7A 1H24A 3CXWA 3VULA 2BFXA 3AQVA 4B4LA 4FI1A 3HVCA 4YBKA 4F0GA 3U6JA 3QGYA 4XUFA 4A9TA 2VZ6A 4WA9A 4ZSGA 3ZLYA 4UMPA 4UX9A 4JT3A 4YHFA 3SVVA 3EH9A 4J1RA 2OJ9A 3Q4TA 4X2KA 4IFCA 3HMIA 3TZ8A 4IDVA 5EDQA 4BVUA 1WCCA 3DBFA 3F7ZA 1OPLA 3C4XA 2C3LA 3FHRA 4XG3A 3UOLA 4DEIA 3GU6A 3N4VA 3KKVA 3IG7A 5IDNA 4F7NA 5I5ZA 3SHEA 3SG8A 3NX8A 5DYJA 4IE9A 1I44A 1CTPE 5EM5A 2ERZE 3W2SA 1OPJA 2W1CA 3C50A 3TKUA 2NRYA 4F9AA 3GUBA 3FPQA 4IMYA 2WMBA 4C4GA 3EQRA 4D1XA 5FXRA 3TNWA 3P9JA 2J51A 1BKXA 3EL8A 4X6QC 5LQFA 4TYEA 1WVXA 2J6MA 3DQWA 3Q4CA 5FG8A 3SAYA 3TXOA 2R3FA 4NEUA 3TZ7A 1Y6AA 4QOXA 5IA2A 3HX4A 1Y6BA 5HIDA 4QMVA 4RX8A 2PE1A 3W55A 3ATSA 5AUXA 4UMUA 4PUZA 4DA5A 3IOKA 4YTIA 2UW4A 4GU9A 4WG4A 4PL4A 4FKRA 5DIAA 3W8QA 4D28A 1A48A 1SNUA 3OCGA 4A4XA 3R22A 1TKIA 4HYUA 3MH2A 3D7TA 2UZNA 2HWOA 4GCJA 2OK1A 4NFNA 4XG7A 3RK7A 3KRRA 3UVPA 5CEIA 3Q6WA 4KABA 4FL3A 4DG3E 1TQMA 3OTUA 5KKRB 4RGJA 4RZVA 5FRIA 2PZ5A 4O22A 5H8BA 3FYKX 5K0XA 2QLUA 4DFBA 4DC2A 5GJDA 3K3JA 3O71A 2Y4IC 3QALE 4RLLA 3TTJA 4QQTA 3FHIA 4I6FA 3V5PA 2PYWA 2V7OA 4XV3A 3RINA 1LP4A 4ALUA 1OIUA 3BLRA 4PNKA 5BVFA 1W83A 2Y6OA 4WNPA 2G15A 2H8HA 4WO5A 2BUJA 4B8MA 3EN4A 2YDKA 4RVLA 4C4HA 2QC6A 3NDMA 3FZSA 4WRGA 1FGKA 4ZOGA 3VF9A 4V01A 4ZY4A 4C2WA 3IDPA 4GSBA 4YZBA 4YLKA 5FEDA 2JDTA 3VN9A 3MPMA 4FTJA 5T6KA 3UPZA 5GIPE 4FKVA 5AR5A 4FKWA 1PXJA 2CGUA 4RJ3A 1W0XC 2QONA 2BRBA 4I24A 4ANNA 2QHMA 4GG5A 3ACKA 3BBWA 2VTLA 1STCE 4IANA 2ZV7A 3ANRA 4FSWA 4AW1A 1PY5A 3C4WA 4A07A 1DI8A 2C5XA 5LWNA 3QYZA 5DGZA 4KSQA 5DN3A 4CZYB 5T68A 2CHLA 4EH2A 5JN2A 4IACA 2OIDA 3ZO3A 3C5UA 3CBLA 3UBDA 2YFXA 4BL1A 4NWMA 4DYMA 4EK3A 3LQ3A 3SGCA 1KE7A 1NXKA 2IW6A 4R1VA 2VO3A 4TWNA 5DE2A 3G5DA 3NUXA 3DNEA 5CVGA 4N57A 3OW4A 4FKLA 1BI7A 1U5RA 2F4JA 2XJ0A 3R7UA 2WIPA 2IVVA 3KC3A 4U80A 4LOOA 5HTCA 3HRBA 4FKUA 3EN5A 2X2MA 4QYYA 4R5SA 4TNBA 4DGGA 5I9VA 2GDOA 4C4FA 1ZAOA 4FKGA 2BDWA 2R3NA 4E93A 1E1VA 5HE3A 4O84A 1SVEA 4OT6A 3LW0A 2W5BA 5D9HA 4L7FA 4MWHA 3QRIA 5CF4A 1WBOA 3G0EA 5L4QA 2JKKA 3GI3A 3B8RA 4EH9A 5A6OA 2CKQA 5IDPA 4JDHA 5JRSA 4BC6A 1YXXA 4GIHA 5AV3A 4PDPA 2A19B 3WZJA 3KMWA 3QKMA 2VWWA 4ENXA 4FL1A 1J7LA 3MWUA 2W96B 4MXYA 3UJGA 4TW9A 1RDQE 2YCSA 2J0IA 3LIJA 1PXNA 2O5KA 3PJ1A 4JS8A 3Q52A 5EI8A 3T3VA 4DEBA 4BICA 5DEYA 3RK9A 3ZO4A 4D58A 2HY0A 3NAYA 1HOWA 3RWQA 4I4FA 4W4VA 5EH0A 3KVXA 4PMMA 5HG8A 5GINE 3AC5A 2CMWA 1W8CA 5DR2A 3V6RA 4RIYB 2X6DA 1XBAA 4NM5A 4G3GA 4P4CA 3TNPC 5HLWA 3L8VA 4LUEA 1XWSA 3PY3A 3EB0A 4RIXB 4EONA 3VQHA 4GK2A 1CM8A 4WNMA 5FEEA 3IECA 4CT1A 2VTJA 3U55A 2QHNA 3FV8A 5GJGA 4EUTA 2YDIA 3B2WA 4DGMA 5C8NA 4U3ZA 4BYIA 3OF0A 2XIYA 3V6SA 2W1EA 3DPKA 5LARA 4ZTMA 3KN5A 3UOHA 3THBA 4BDFA 5EHYA 1QPEA 5EKOA 4G1WA 4X0MA 3MJ1A 4FV3A 5EFQA 1SVGA 5DHJA 3M11A 3U9CA 3LMHA 1OKWA 3QU0A 3UNZA 2UUEA 2Y0AA 3PLSA 3QC4A 2UW9A 4APPA 2WKMA 1PXIA 3LFSA 3Q5ZA 4JIAA 4PQNA 3PY0A 4EZ3A 5ITAA 3HAVA 3RAWA 4W4XA 2WTWA 5CX9A 3ZUTA 5IEYA 1PXMA 3H9RA 4M14A 2OFUA 4FTMA 3GENA 4C4EA 5DNRA 2W1ZA 3DKGA 1OKYA 1Q8UA 2C4GA 4ASDA 3PUPA 5JH6A 4NSTA 4EOKA 3C9WA 3D0EA 2BDJA 4D2PA 4EI4A 4JDIA 3ZSHA 4FSUA 4V0GA 5KX8A 4NFMA 1UU9A 2O0UA 1GIIA 2VTQA 4RX7A 1UWHA 2B9JA 3QLFA 2YZAA 3FL4A 4QMYA 4TN6A 4R3CA 4J52A 3FI4A 1QPJA 2OH0E 4MBLA 5CAVA 2XVDA 5LJJA 2FH9A 4BY9E 4JL9A 2ITVA 4QYHA 2C1BA 4EEVA 3NIZA 4YGAA 3RPVA 3W2PA 1E1XA 3REPA 3CIKA 4DFXE 4EWHA 4ZTLA 5HG5A 3Q4ZA 4FSMA 4FTRA 4FZFB 3DFCB 3HNGA 1ZRZA 5AWMA 5L2QA 2I0YA 4EOPA 3F5GA 3TUBA 2W5HA 4I20A 2R7BA 4BWPA 5CS6A 3FKLA 4XV1A 4FF8A 1BL7A 3D83A 1H28A 5HD4A 2C0TA 2YLFA 2YACA 1H0VA 2F7ZE 3DLZA 4Q5HA 5DBXA 5HORA 5ACBC 1YDSE 2P0CA 3CPBA 1CKPA 4L46A 3W32A 4O1OA 3P4KA 4AW0A 3E93A 3GFEA 2Q0BA 2UZDA 2YM6A 3LJ1A 3MVHA 3ZFMA 5HD7A 4BCOA 4GK4A 4BCKA 5IQAA 3RVGA 3MA3A 3UVQA 1IRKA 4AA0A 3UIXA 1M2PA 2BZHB 3BHTA 5ANDA 4RWIA 1XH5A 3GCVA 4PTEA 1OIRA 3R1NA 2ZV2A 5AMNA 2A4LA 4YLLA 5CSXA 2ITXA 2OU7A 3POOA 1XKKA 4FV1A 3R9RA 4BBEA 2YAAA 3RGFA 4DFUA 2C3JA 3LFFA 3KB7A 3ORZA 1RE8A 3M2WA 1AQ1A 3LCTA 4J7BA 4L3PA 5CWZA 1JKKA 3L9MA 2OICA 2YJSA 3TDWA 1VEBA 3PSCA 4FYOA 4PMSA 4FODA 2BIKB 5AJQA 3ROCA 3MH3A 3PA5A 5HNBA 3VO3A 4DITA 5J9LA 2OJJA 2OKRA 3FMKA 3L8PA 4NUSA 4R3PA 4ZY6A 3VWAA 4HVIA 4UN0C 2WTVA 3E62A 4D4YA 1ND4A 4F4PA 2OF2A 2Q0NA 2QOBA 5BPYA 3I5ZA 2C69A 2IVSA 4GUEA 4PF4A 1NVQA 5IEVA 1IR3A 2VNWA 5AX9A 3LLAA 4I0TA 4DINA 2XA4A 1REJA 3L9LA 4CKJA 5IA0A 3ALNA 3AXWA 2YM7A 3E87A 2X2LA 4FVQA 2UVXA 4CLIA 4HYHA 2QOLA 2VX1A 4IWPA 4G6NA 1XH7A 2R3IA 4MQ2A 4QQJA 4YBJA 4X3FB 1UWJA 2BCJA 4Y83A 5DWRA 3KXZA 3G15A 4DAWA 3D2KA 4XBUA 3UO4A 4ZZNA 4RIWB 4BDHA 5AV2A 4U43A 1OL1A 2RFNA 4MEDA 5HLPA 3SW4A 4FTUA 4N4SA 3RNYA 4BDGA 4RC4A 3F5XA 3DNDA 4ZK5A 2GHLA 3FI8A 2B7AA 3BE2A 3MBLA 1ZWSA 4AZEA 3Q4UA 2ITUA 4IVDA 2ETMA 4U3YA 2QOCA 2JKQA 3LXKA 3C1XA 5E1SA 3I0OA 1U54B 4U44A 4CFMA 2GNLA 2OG8A 2XYNA 3C4CA 4AG8A 4DGLC 2H34A 2R3KA 2ITYA 3LM5A 1JNKA 4EK8A 2WQEA 3F5PA 4OTFA 4RWJA 4ZTRA 3PRFA 3AD6A 5GJFA 5CSVA 2IZUA 1WBSA 1H01A 2EXCX 3EKNA 4F09A 5ANGA 5IA5A 4CFFA 4DH5A 3HMMA 4XJ0A 1Q8YA 4MAOA 5IUIA 2CGXA 4HGTA 4FSRA 3I7BA 4I5HA 2VD5A 4RFZA 4BIDA 4EH6A 5E9EA 5L8JA 4CG8A 1OUKA 1S9IA 2P2IA 4MNEB 3GOPA 2E9NA 2PL0A 3EZRA 4QMLA 3RMFA 2CNUA 3NVMB 3FWQA 2WIHA 3PIXA 2ITOA 3EN9A 4EYJA 5IUGA 2P4IA 1Z9XA 2CLQA 3AC4A 1GIHA 3EQCA 3OY1A 5DR6A 4BI0A 5J7BA 5FLFA 3G9NA 4YHJA 4R77A 2C1AA 3QA0A 4ITIA 3ROYA 5G1XA 4DG2E 5FTGA 4FTAA 5HESA 3PVWA 1URWA 5LVOA 4H58A 4QP3A 4XG2A 3ZO1A 2VGOA 1OECA 2BZJA 2IWIA 4DCEA 3OBGA 3BU5A 3R8MA 4WOVA 1Q97A 2JEDA 4R7HA 5FDXA 4BGQA 3FMJA 5HKMA 4NU1A 4OTIA 1PXKA 2QCSA 1XHAA 4K0YA 4E26A 4FKIA 4YJOA 4CFUA 1H1SA 4E6CA 2H6DA 4IC8A 3LJ2A 2Y4IB 4NTSA 4FTOA 3TWJA 1R0PA 2QOHA 3CTQA 3U8WA 3W2OA 5KMKA 3QD0A 3QD4A 5A4TA 4EK5A 3RCJA 3EFLA 2F7XE 3DJ5A 4G17A 1BYGA 3MGYA 4HVDA 3FI2A 4U97A 1CSNA 3MA6A 4E3CA 4OBQA 2V5QA 1I09A 2WFYA 4Q2AA 3RAIA 5CENA 4LI5A 4HZRA 4YTHA 2Z02A 5JFXA 4X21A 5TT7A 3SX9A 4KBCA 3TTIA 4C4JA 4DH7A 4EHEA 4BF2A 3S1HA 3SC1A 3BHVA 5LCKA 3DB6A 2VNYA 3HGKA 1YI6A 4IXPA 4DH3A 4XX9A 3O50A 5ANJA 5BUIA 3FMNA 3NR9A 2QODA 4HVGA 1Y8YA 5TO8A 5AM6A 2ZM3A 4D0XA 3OCSA 5ACKA 3VS2A 4RC2A 3LVPA 2I40A 4GEOA 2RKUA 4L8MA 1Q61A 3DK6A 3G6GA 3HP5A 5I9ZA 4ANLA 3QFVA 4BGGA 4X2NA 3JXWA 2CN8A 1W98A 1T46A 2QKWB 2VUWA 3PSDA 4ZSLA 3FZTA 1BI8A 4QT1A 1KV2A 5HNGA 5I9YA 3UODA 2OZOA 3TNQB 2J50A 4FEWA 1EH4A 2QOKA 4RVTA 4ZS0A 1CKIA 4ASEA 2OZAB 3GBZA 3R7EA 1ZZLA 4IVBA 3FUPA 3E63A 3MPTA 1QMZA 4E73A 1PYEA 3PXFA 3H4JA 3DOGA 4O7RA 5FM3A 3DAJA 3TG1A 3VBYA 4KRCA 4DH8A 4CV9A 3MB7A 2UVZA 3V5JA 3IDBA 3D4QA 4K33A 3QTRA 5IISA 5CEOA 4O82A 4OTQA 2QO2A 4CZUA 4IAYA 4DTKA 4QP6A 4EHZA 4I1ZA 3KMUA 4KA3A 5EW9A 3VRZA 2QU6A 4Y73A 2VRXA 5JT2A 1ZYSA 4MNFA 3BCEA 4AS0A 3DS6A 2YAKA 3FKOA 4IVAA 2UZLA 4C33A 3CKXA 1G5SA 1ZY5A 4OTWA 2CNVA 5AA9A 4FTCA 3S0OA 3BV3A 5H8GA 3TKIA 4EKLA 3BGPA 2PPQA 2O8YA 2XKCA 3HYHA 4W4YA 3V3VA 1Y8GA 4M0ZA 5HZNA 2C6KA 3PY1A 3FC2A 3WZDA 5A46A 2REIA 2WQNA 3NAXA 3OOMA 2C5YA 4YNEA 2X9FA 3TJCA 4QMTA 3PPZA 5EW8A 2R3GA 3I79A 5H3QA 5L3AA 3PVBA 5HO7A 1G8SA 2UZOA 5J9YA 2JFMA 2XB7A 4AE6A 4F63A 1Y57A 1ZARA 5J87A 4FE2A 2ZB1A 3VS0A 3G90X 3ORNA 4I41A 4TWPA 5JFVA 1W84A 4WNOA 2Z7SA 1FMKA 3R7GA 5KUPA 2W17A 4F64A 4BDAA 1BL6A 3UOKA 4OW8A 4C58A 3LLTA 2PVJA 4YJUA 2C6LA 3DJ6A 4GL9A 3UP2A 4NJ3A 3OMVA 3RKBA 1UNLA 3QC9A 4MKCA 4XP3A 2XUUA 3PXKA 5E1EA 3QKLA 5HVKA 2HY81 5IG1A 4QP7A 2R3HA 4LFIA 3BYVA 3F3ZA 3LCKA 4NIFA 3P5KA 2GFCA 1WZYA 4IB0A 4AA5A 4HJOA 2BAQA 2ITPA 1LPUA 2W1DA 3ELJA 4NYEA 4H36A 3FMHA 4RFMA 3GCUA 3GCQA 4ZTNA 3VS5A 3MFSA 4D1SA 4L00A 1OVEA 4F99A 4GT4A 3MIAA 3GC9A 5KBQA 2PMNX 4W9WA 3UIBA 5EOLA 3DBCA 3ZLSA 4F1TA 1KOAA 3HUCA 4W8EA 3VQUA 1Q8TA 3RHXA 3BHHA 3A7HA 2B9FA 3ZS5A 5M56A 4HGLA 3ZO2A 4JG7A 2WO6A 4M97A 2O64A 4H39A 5FP6A 3QXOA 3R21A 2YA9A 3VJNA 3U54A 2V7AA 5C1QB 4U6RA 3C0GA 4MTAA 3IK3A 1V0OA 2YN8A 3FMMA 3OOGA 4JQ8A 5ANOA 5AR7A 4ACGA 3IW4A 4E5AX 5JEBA 5LMKC 4AGUA 2ITTA 1FVTA 3UDBA 1VYZA 4FC0A 3COHA 3OHTA 4R3RA 4RFYA 4BCHA 2OI4X 5CXZA 4FZDB 4GW8A 4BCIA 4F1OA 3F2RA 4QMNA 3QCSA 3L9PA 3CTHA 5E92A 2VWVA 2OXXA 3IW8A 4BDEA 3ORMA 3VUTA 2R64A 1TQPA 3LE6A 3ZEPA 4JAIA 3KULB 4EH7A 4EHGA 3QQLA 3PIYA 3KF4A 4QPMA 4TZRA 3KFAA 4FV0A 3GB2A 1P5EA 2VWIA 2W9ZB 4EC8A 4GVAA 4P5QA 5FGKA 2EB3A 5CLPA 5HG9A 5FBOA 4RG0A 4LGGA 1GJOA 4EOOA 1JKTA 2ETKA 4EH5A 2QKRA 4K9YA 5CVHA 3BEGA 4AGWA 3RPOA
chains in the Genus database with same CATH superfamily
4QPAA 4DTBA 3DBEA 4I0SA 4E4NA 3F61A 2F9GA 3VS6A 3KIOC 3D5XA 4IAZA 2C5OA 4II5A 4JBOA 3QQHA 2UZEA 3M1SA 5CALA 4DFYA 3QXPA 4EL9A 3C5IA 3GXLA 3UYTA 1ZYDA 3FDNA 4Y85A 1WBNA 2BAKA 5K9IA 1WBWA 1IA8A 4USDA 4GJ3A 4AOIA 3E8EA 3ORPA 2IW9A 5IQDA 2WQBA 1WVWA 2XK4A 2QURA 3HECA 3F69A 4QO9A 4ANMA 5M4UA 3PLAE 1YHVA 4IB1A 2CN5A 4ZJVA 2RGPA 2GNJA 3EHAA 4DEHA 2BVAA 4QPSA 5H2UA 2E9UA 1OL6A 3MTLA 4NW5A 4NTTA 5A9UA 1FBNA 4I92A 4QP4A 2B55A 4DHZA 4NCTA 1A06A 1XH4A 3QTSA 5CAUA 3V8TA 5KMOA 3TDVA 3ZRKA 3CQEA 5HCYA 4IZAA 5BVNA 3AMBA 5DFPA 1ERKA 1P2AA 2XIKA 4QMSA 4Y46A 3UMWA 3ETAA 4CMTA 5CU3A 2OBJA 5M08A 3MFUA 3BYMA 5A3XA 4LM5A 5JMSA 4I6QA 3H3CA 4U45A 4CKIA 4IM2A 2BRGA 2PMOX 1A9UA 1OKVA 1XQZA 4ZTSA 4XG4A 3L1SA 3LFEA 4L01A 3LQ5A 2CPKE 2O2UA 3NW5A 5AR4A 2I1MA 4GT5A 4C02A 4EUUA 5EYKA 3RI1A 4D2SA 1QPDA 5F95A 5C03A 4F9WA 2W4JA 2PUUA 1NT2A 3LCSA 3F3TA 3H0YA 4S31A 5DMZA 5M07A 2EWAA 4CEGA 4IZYA 1Q3WA 5JQ5A 4G34A 4AQCA 4GH2A 5BX0A 2RSVA 3F7WA 2R7IA 1F0QA 4IJPA 5A14A 5EKNA 4G3CA 2XM8A 2X4ZA 3K2LA 4FUYA 4YPSA 5GNKA 5B2KA 5HLNA 3HA6A 3BQRA 3OWPA 3GQIA 3OXIA 4W8DA 5DEWA 2R3LA 5K0KA 3MYGA 4YLJA 2ZB0A 3P08A 1WBTA 3T9IA 1H27A 2Y6MA 3R73A 5BVKA 2YIYA 3R2YA 5AP4A 4TL0A 4KIKB 3EFWA 4S32A 4WKQA 4CV8A 3OUKA 3CQWA 5FWKK 5IH5A 2HZ0A 5DI1A 3KXXA 4U8ZA 5E8SA 2C5VA 3Q04A 3G0FA 2BRNA 4KWPA 4AZVA 3DY7A 2G2HA 3DZQA 4CCBA 5CAQA 4F1MA 2I7QA 2YCRA 2YITA 3QD2B 3KREA 4TXCA 4FNWA 3R71A 4YC6A 2HW7A 4M12A 4AUAA 3QUPA 5AV1A 5EG3A 5KHXA 4GYIA 3QL8A 4RZWA 3QRKA 2VGPA 2PUPA 4LQMA 3FLWA 3WF8A 4CRSA 5AEPA 4PNIA 3CR0A 5JFWA 5EI2A 1M7NA 3EQFA 4RJ7A 1V0PA 3BZ3A 2CGWA 4QMXA 5FD2A 4YJSA 3PJ3A 2YEXA 3EMGA 3MFRA 4UMTA 4F6SA 3DXPA 3IS5A 4D0WA 3TYKA 2KULA 3O17A 4ORKA 4X2GA 1JWHA 3CPCA 4KRDA 4FG9A 4CRLA 5HQ0A 3WE8A 4YU2A 5AAEA 1NA7A 1P4FA 4MQ1A 4HYSA 5J9ZA 4ZJIA 3NFFB 4TTHB 1JSVA 3P1AA 3PG3A 5DOSA 1NW1A 3QCXA 3FY2A 2JDVA 4Z3VA 2XKEA 2FO0A 4D9UA 1YWRA 3A4PA 2QLQA 3EQBA 4LDTA 2IN6A 4MVFA 3TCPA 1J1CA 3O7LD 3Q9WA 1J7IA 3DAEA 4I21A 2CCIA 1JQHA 3PA3A 4MXAA 1KOBA 5KZ0A 1XH9A 3RK5A 3G51A 1PXLA 4WUAA 4P90A 3UIMA 3WI6A 5C8KA 5CI7A 2HZIA 4IJ9A 4CYIA 2C47A 1AD5A 1YRPA 4HPUE 3FSKA 3ZYAA 1WBVA 5AUYA 4XS2A 2A1AB 2YABA 3ZUUA 5K5NA 1OIYA 4DEAA 4ITHA 5HO8A 2XKDA 2QO9A 4UV0A 2E9OA 2WQOA 4OR5A 4BIEA 1R3CA 3F3VA 4G9CA 4L3LA 4MX9A 1OBDA 1MUOA 3CGFA 1ZMUA 2J4ZA 4FV6A 4O2PA 5A4CA 3OUNB 1ZZ2A 4DEGA 2BZKB 4NKSA 4UZHA 5IA4A 3NFGB 2HWPA 4DGOA 3BI6A 4EZ5A 4WSYA 4MXXA 2WTCA 4UYAA 5CEQA 3JS2A 5DR9A 2UW7A 4FV9A 4AGCA 4C2VA 2PVRA 2J0MB 3FQEA 4CFXA 1FPUA 5HE2A 3R2BA 1K2PA 3O8TA 5JQ8A 2XNBA 2VX3A 2G2FA 1NVSA 3N51A 4YZ9A 3EFKA 1F3MC 2X39A 3QTXA 3UC4A 2XEZA 3POZA 4J8MA 3OEZA 3FBVA 1O9UA 4LRMA 3QQJA 2VWYA 2PUNA 4FRFA 5ICPA 4ZLYA 3DKOA 3GOKA 1UVRA 2VO7A 3UDTA 4YZMA 4MBIA 5C27A 4TYHA 3D94A 3A7IA 4AAAA 3P79A 3PDTA 1M52A 2BALA 5AUTA 3I6WA 4AP7A 5A4LA 5HGIA 4DH1A 2RG6A 3D15A 3R7YA 2OO8X 3AD5A 3MH1A 1ZY4A 3QWKA 2PULA 1GNGA 4U40A 2NRUA 3QZHA 4HZSA 3KGAA 4NM3A 3P7BA 4F08A 4F65A 5M4FA 4QQCA 1PMUA 5HBHA 3MW1A 4X7QA 4XRJA 4J8NA 4FBXA 2B54A 2C30A 5CU6A 4WD5A 4B6LA 2QG7A 3E64A 4OAVB 5AV4A 1YDRE 3AG9A 3BV2A 2FB8A 3NYOA 3ZXZA 3C0HA 3VUGA 1JPAA 2J0JA 4YTFA 4S2ZA 3T9TA 4RX5A 3LFQA 2BPMA 2NO3A 3UQFA 4RC3A 4JVGA 3MPAA 5IPJA 4X2JA 5AP3A 3FI3A 1IASA 4F7SA 4KIOA 3FEGA 2NPQA 3PJ2A 4RQVA 3WF9A 5EM8A 5E8VA 2FUMA 5TE0A 2XK7A 4RJ6A 4A7CA 4FIFA 1DAYA 3VBWA 3MS9A 4JI9A 5AP6A 4QTCA 2WHBA 4C3RA 5HVJA 2VX0A 3QZFA 3ULIA 2J9MA 3LAUA 5EOBA 3BYSA 3FLNC 5GZ9A 3GNIB 4M0YA 2WTKC 2DWBA 1H1QA 4PWNA 3V51A 3QX4A 3DJ7A 3CTJA 4CMUA 3GC7A 3ORIA 2LGCA 4UXLA 3TIZA 2YERA 3D7ZA 4M7IA 4X3JA 3R8UA 3UG2A 4CVAA 2PU8A 4NL0A 2C6EA 3R8VA 3CKWA 3NSZA 4EQMA 5LCJA 4C38A 3R1SA 3SA0A 4FV8A 5EDPA 2A27A 3PE1A 5AAFA 5KMMA 2P2HA 4M69B 4ERWA 1X8BA 1JAMA 2Z7QA 3F6XA 3WYXA 2CDZA 4FT9A 2QOOA 3SKCA 4ACMA 5CU0A 4E4LA 5A54A 5IA3A 4JBVA 4RPVA 2DS1A 2P33A 5TF9A 3C51A 3W0OA 4J71A 3ZUVA 4IVCA 3NW7A 4EOLA 1U5QA 1GOLA 4RA5A 3UQCA 2O65A 2CGVA 3LHJA 2BAJA 1SMHA 2JKOA 3QTZA 5EDRA 3HUBA 1ZYLA 2FVDA 4RA4A 4ANSA 4CQGA 3GFWA 1OB3A 1REKA 3QYWA 4ZSAA 2XNPA 3HRCA 3LFNA 3BHYA 3SOAA 5TOZA 4C34A 4MF0A 4YSMA 3SRVA 4UWCA 3CE3A 3FPMA 4HNIA 4WNKA 5CNOA 2R3PA 3JR1A 2V62A 3VS4A 2UW3A 4AOTA 4H1MA 5JGDA 4AZFA 3NZ0A 2BILB 2ZDUA 2P3GX 3QTIA 1MQ4A 5FXQA 4QNAA 4EJ7A 3LMIA 4F6WA 2C6DA 2UZWE 4RWLA 3WZUA 3ZM4A 2PZRA 5ETCA 2UW5A 1XO2B 2VAGA 5DPVA 3NUNA 3VIDA 3D2IA 3VUKA 4O7SA 4FTKA 4D2VA 5DH3A 2HYYA 3TUCA 3E3PA 3QGWA 4N0SA 4PP9A 2XIRA 5C4KA 4EWQA 3MVMA 2J90A 3BPRA 3LFCA 5CSPA 4ITJA 4DBXA 4LRJA 2GNFA 5LVNA 1M17A 3KVWA 3FXZA 4ZLZA 1G3NA 1M14A 3UP7A 3HLLA 5J79A 2GNGA 2WB8A 4OTRA 4WBBB 4FICA 5AIRA 4EH8A 4DT9A 1Q4LA 2ETRA 3D5WA 3M42A 3V8WA 1FINA 3Q2JA 3R83A 4FSNA 1KE9A 3ZOSA 3GC0A 3L8SA 4LUDA 1G8KA 5I4NA 3QA8A 4IDTA 3II5A 4QYGA 5JFSA 4UXQA 4ACDA 1T45A 2FYSA 4Z55A 2DQ7X 3QWJA 1BX6A 3KXNA 2XRUA 4FR4A 4AGDA 3EFJA 2BRHA 3GC8A 4BZNA 1S9JA 3COKA 4JG8A 2ERKA 3V5WA 4BKYA 4DLIA 4YC8A 4E6DA 3U6IA 2B9IA 5L8KA 3KCFA 4K2RA 1H00A 4BTKA 3BL7A 2JBPA 3AT4A 3F66A 3Q5IA 5J95A 4KIPA 5M51A 3TUDA 3DKCA 4O86A 3QTWA 4KBAA 4O4BB 2ITWA 4BZDA 4MBJA 3P23A 3CY2A 4IM3A 3MDYA 4O2ZA 4FTNA 3PWDA 2WOTA 3RHKA 4I22A 2H96A 3V04A 5HU3A 4UYNA 3UC3A 3NEWA 4C57A 1JVPP 1Q24A 5ETFA 3D7TB 4NK9A 3BIZA 3CQUA 5L2SA 3F2NA 1QL6A 5EQYA 5IQIA 3EQIA 3DDQA 4XOYA 3PA4A 4EOQA 2ZV9A 4XLVA 4OAUC 1HCKA 1TQIA 3A61A 3CCNA 1H26A 4L6QA 3ZEWA 3JVRA 5IEXA 5E9EA 2WZJA 5DLSA 5GHVA 1ZLTA 3BU6A 4UWBA 4JIKA 4O7WA 1PXOA 4IBMA 4QMPA 3A8WA 4V05A 3NUSA 1FMOE 3UDZA 4KKHA 4AXDA 1K3AA 3BWFA 2C68A 3VBTA 3CD3A 3VAPA 4IW0A 3RWPA 4MH7A 2BHEA 3ID6C 1ATPE 3MY1A 4FL2A 2UW6A 3BELA 3NUAA 5BNJA 4RJ4A 2ITZA 3DA6A 2PVMA 3BHUA 2A0CX 3AC2A 1B6CB 3K5VA 4FSTA 4AXFA 2XP2A 4CMOA 3W0PA 4RX9A 3R0TA 4W9XA 4U0IA 4W4WA 1J91A 1R78A 4RVMA 2VTOA 3QQGA 3IONA 1OBGA 5HO6A 3VS7A 5K4IA 4FIHA 2IZRA 1OKZA 5IUHA 2B4SB 5CANA 2W06A 2JAMA 4F7JA 5HU9A 2E9PA 3BGQA 2JC6A 2A2AA 4RJ5A 2CKPA 4FK6A 5CU2A 4CTCA 2B1PA 4QP8A 5CZHA 4IH8A 4O0XA 4B8LA 3N9XA 3FLZA 1KSWA 2FSOX 3U4WA 2PHKA 3EN6A 2EUFB 3NUPA 2BZIB 2P55A 2R5TA 2Z8CA 5KZIA 3QCQA 4OTHA 4BBFA 1OGUA 3FMEA 4CFWA 5IA1A 1B39A 2IF8A 2X0OA 5CSWA 4I0RA 5CTPA 5HVYA 3RAKA 1RW8A 2Y9QA 3LCDA 4GVJA 5TR6A 3T3UA 3PP0A 2R9SA 3TACA 3HEGA 4CNHA 5AV0A 4DT8A 1XH8A 4I3ZA 2Y7JA 2WD1A 5LMAA 5EM6A 4EBVA 5HNIX 4KKGA 5IZFA 1TVOA 5CI6A 2JD5A 2PK9A 2HXQA 4YHTA 5B0XA 2GTNA 3DDPA 5HE1A 4JR3A 2QOIA 2PE0A 2XF0A 3CGOA 4E6QA 2QOQA 4I5CA 5CU4A 3IDCA 1YW2A 3UPXA 4GFGA 5AFVA 3R8LA 5D11A 1H0WA 4ACCA 4DHJA 3BE9A 4L67A 2J5FA 3PFQA 2JBOA 5KMJA 4D1ZA 3P7CA 4FEUA 4UZDA 4MHAA 4BCNA 3WIGA 5F20A 4M15A 3OXZA 5IQBA 4ASZA 2FSLX 3DLSA 3KK8A 5EYMA 2ZOQA 4G3EA 1Q8ZA 4GKIA 1MP8A 2RFSA 3UYSA 4FZ7A 1J7UA 4GYGA 5E7RA 5TKDA 4RSSA 5IQGA 4O6EA 1PMNA 4CCUA 2OFVA 4JX3A 5JGBA 3O51A 1U46A 3Q3BA 2XJ2A 3AC8A 3E8NA 4IC7A 4XHKB 3RNIA 4CD0A 4YNOA 2EXMA 5E90A 3F2AA 2XS0A 2AC5A 4TNDA 2O3PA 2GCDA 1B38A 2YDJA 3HDMA 5LWMA 3OWLA 5FEQA 4FKPA 4ID7A 5IQHA 4K77A 4WT6A 3COIA 2PMIA 4C4IA 3R1QA 5J5SA 1YKRA 4DDIA 3IO7A 3L9NA 5BYZA 4O1PA 4KD1A 4OLIA 2YM8A 5ETAA 1OUYA 5M09A 4ACHA 5HCZA 4C59A 2JKMA 4HCTA 3HA8A 3OROA 2WELA 3NUYA 3A62A 1FQ1B 2WTIA 5JKGA 3QD3A 4RVKA 3OT8A 3PP1A 4QD6A 4E1ZA 4E5BA 4HOKA 2OW3A 2R3JA 2W5AA 2XK8A 4J95A 3AT2A 4ZTHA 4LV8A 5BUJA 4C61A 1PMEA 2YCQA 4O83A 4E7WA 2WTJA 2ZJWA 3TV7A 3EKKA 4J98A 4CFVA 4XRLA 1HCLA 2G01A 1YHWA 3BKBA 4C3FA 1KWPA 4QMUA 4V0GB 4GU6A 3JPVA 3S95A 3R30A 3MV5A 3NLBA 4IAIA 5HI2A 2WOUA 4N70A 3SLSA 2AC3A 5HG7A 4J97A 3ZRMA 2Z60A 4PY1A 3NNXA 4UALA 4BGHA 4O7ZA 1M2RA 5T3QA 3FZPA 3Q96A 3AMYA 2GPHA 2VTNA 4XG8A 5KHWA 3S00A 4Y95A 2W4KA 3ZC6A 3K54A 3UMXA 3PPJA 3I6UA 3TEIA 3R8ZA 5AX3A 4WRSA 2GTMA 4P7EA 4E20A 3E3BX 1OITA 2GHGA 2BKKA 1YWNA 4HVSA 2YIQA 2UZBA 3I1AA 4IEBA 5DG5A 3CJGA 5HE0A 2OXYA 2XRWA 2XCHA 3SXSA 5L2IA 1L8TA 2AEGA 5GZ8A 3NYXA 2WTKB 4GK3A 2VTRA 4LOPA 3BBTB 4ZTQA 4BCMA 3DTCA 3KXHA 2XKFA 2YIWA 4R7BA 2PVYA 3UOJA 4ZMEA 4DHFA 3KF7A 4O91A 2HAKA 3MI9A 4FT0A 4ONAA 3E92A 2YLEA 4BFMA 4KIQA 5GZAA 2RFEA 2UZVA 3RAHA 1YDTE 3NCGA 3ORXA 5CZIA 3D14A 2WEIA 4CKRA 5K5XA 5KMIA 2WTDA 4AN3A 3FXXA 3A4OX 5IQCA 3NNVA 1MRYA 4A06A 3LOKA 4JOAA 1MRUA 2XMYA 4L3JA 5L2TA 2XJ1A 4YR8A 3DZOA 3TIYA 5E4HA 2F57A 5FDPA 5J1WA 2W7XA 3G9LX 4J99A 4FGRA 2WMTA 4KINA 3BLAA 3ACJA 1OL7A 3C7QA 2YWPA 2BRMA 2Z7RA 3BGZA 1GZNA 3COMA 4IAFA 5AP7A 3RM6A 3P78A 3AKKA 3TKHA 2VO6A 2GSFA 3VF8A 1DI9A 1JLUE 3KRLA 3FZRA 5KCVA 4IM0A 1CKJA 3I0QA 3W10A 2HIWA 4FVRA 3DT1A 4RIYA 5AR8A 5CASA 4XP2A 5CAPA 1W2CA 2EB2A 2C3IB 4CZTA 4RIXA 1UU8A 3HP2A 3C4EA 2CSNA 3R9HA 5BYYA 1OGYA 3D5VA 3H9FA 3NWWA 3PZEA 4Y8DA 4E4MA 4B7TA 5D41A 2YCFA 3RPSA 5A4EA 4GFOA 5CEKA 3E7VA 4QQ5A 3UO5A 5BQ0A 3VRYA 4K1BA 4KUJA 3OEFX 4YSJA 2IVTA 1OZ1A 3I5NA 3QBNA 3R00A 4IAKA 3R7VA 3SG9A 2AYPA 4O81A 4BCJA 3DK3A 2FGIA 4XV2A 1H8FA 1ZMWA 5GIOE 4NCTC 4EORA 4G9RA 1XMMA 2WXVA 4MUQA 4BDKA 3Q60A 4FX3A 4YPDA 4KS8A 2RIOA 5B2MA 4GFMA 4PDSA 4M3QA 3VBXA 5ANEA 2BTSA 2IZTA 4PMPA 3PE2A 3QF9A 2CKEA 2OJGA 4DEDA 2YZLA 2OJIA 2XNOA 4MK0A 2CJMA 2A98A 3GT8A 5J7HA 3EN7A 2ZMCA 4XV9A 3QQFA 4ZMFA 4DFNA 1J3HA 1H07A 4JBPA 2X4FA 5HICA 3VS1A 4XOZA 4WG3A 5BVOA 4D2WA 5AR3A 3R01A 2DUVA 2OJFE 3ORKA 3TZ9A 3ORLA 4ZAUA 3A60A 4I93A 3GEQA 1BMKA 3QCYA 4YJPA 5FTOA 3UIUA 2NP8A 5E8TA 3PZHA 4L43A 1BLXA 3ZSGA 4IADA 4GMYA 3W8LA 5M4CA 5AP2A 3W16A 5J8IA 4M8TA 3VUIA 3R63A 2VN9A 3TV4A 3FJQE 4AE9A 4QTEA 4USFA 4QDVA 2WMWA 2OH4A 1W7HA 4FZ6A 3I81A 2YM5A 3QTQA 3MVLA 2XK9A 3MJ2A 4G6LA 2VO0A 4JDJA 3UG1A 3F88A 2ONLA 4Z16A 1Q41A 3WIKA 3UNKA 3WBLA 3LXNA 5I0BA 4DN5A 3QRTA 4UMRA 4YJRA 2ESMA 3FMDA 4L9IA 2GNHA 3BLQA 4FYNA 3IW6A 1KE5A 4O38A 2C6OA 1JKLA 4QMWA 4AT3A 1IA9A 4EK4A 3NYVA 3PVGA 4PL3A 5BMMA 3BEAA 1PF8A 3TNIA 3RBWA 2PUIA 4Z7GA 3NGAA 2WMVA 2JDRA 2Y4PA 3E7OA 2VWUA 5C01A 3TN8A 2XZSA 1UU3A 4OTDA 2QR8A 4C7TA 2IEWA 1YVJA 4AX8A 3B8QA 4AFEA 4GUBA 3KEXA 4Q9ZA 4JRNA 3FMLA 4OBOA 4QDEA 2X2KA 4PDYA 4AN9A 4MCVA 4EOMA 2IZSA 3LM0A 4ZEGA 2GFSA 2VTSA 2HOGA 4LL0A 4O0SA 3PG1A 5D12A 5DVRA 5EYCA 3UE4A 2J5EA 5EYDA 2XNNA 4L45A 4TWOA 4D55A 1RJBA 2VWZA 3RZFA 3U9NA 4OGRA 3R8PA 1YWVA 4IB5A 1XBBA 4D5HA 5FUTA 2PMLX 4I6HA 3QRJA 4U7ZA 1DS5A 2BTRA 3G6HA 4KKEA 4E4XA 4ENYA 4IB3A 3F5UA 2UVYA 3TJDA 4TYJA 2JFLA 3ZONA 3TM0A 4GIIA 4O0YA 3PJ8A 1UNGA 2WPAA 4IX3A 4X3FA 4JRVA 4CLJA 4DE4A 3KU2A 5CF5A 3O7LB 4WHZA 4RIWA 1UKHA 3DCVA 3OCBA 2PZPA 2XIZA 1YOMA 2CNQA 4HW7A 4EOIA 3F82A 4M66A 4NM0A 5HX6A 3WF6A 2OIBA 2JITA 4O4DA 4YO4A 4U79A 1QPCA 3W33A 1PYXA 3UVRA 1URCA 2XALA 1BUHA 4DEEA 5JSMA 3Q9XA 4ZLOA 2WU7A 2G9XA 4L44A 4WUNA 1ZOEA 2SRCA 4FV2A 3RTPA 4RBLA 5CSHA 3WF5A 1U54A 1UU7A 2BMCA 3LKMA 5KNJA 5HEZA 1ZYCA 2C6IA 3LFAA 3NYNA 4IQ6A 4XBRA 4F9BA 2JIIA 4MXCA 3AC1A 3RZBA 1E9HA 5CF6A 3F9NA 5FM2A 2EU9A 3BU3A 4QTAA 4Z9LA 1H25A 2XNMA 2YWVA 4JAJA 3RM7A 4M13A 2HXLA 5KE0A 4LMNA 3FSFA 3Q32A 4FUXA 4MYGA 3I7CA 4G5JA 3A7GA 1MRVA 3A99A 2V0DA 4IX5A 3ZZEA 3HV6A 5CVFA 4QYFA 4L53A 4MNEA 3ERKA 4FSQA 4R7IA 1MQBA 4U81A 3E8CA 3HKOA 4FT7A 1JSTA 1K9AA 3GU5A 1Z5MA 4LOQA 5L6OA 4BB4A 1PHKA 2I0VA 4YURA 4PX6A 4FA2A 2HZNA 3HMOA 1GZOA 3ODYX 3A2CA 4EC9A 2KTYA 4NZWB 4FIEA 3R1YA 4PDOA 4WG5A 4EBWA 4S30A 4WBOA 2YISA 3RP9A 4MD7E 3R9DA 4CGAA 4D4VA 5M57A 2QQ7A 3C4FA 5C26A 1PXPA 2R0IA 5K4JA 5L6WL 3DBDA 3BX5A 3W1FA 1DAWA 3R28A 4OBPA 3TMOA 2GHMA 3PRIA 1LEZA 4GKHA 4FIJA 4LV5A 3LMGA 1KE8A 4FMQA 2C0OA 4TY1A 3DQXA 1IAHA 3N4UA 4FKTA 4BBMA 5BUEA 5JK3A 3HL7A 2RF9A 4A9SA 3UQGA 4L52A 4O7TA 3CP9A 4HVHA 5B7VA 4FEVA 4WSQA 2I0EA 5AUZA 3NPCA 2BFYA 2WMUA 2XH5A 4NIFB 2AUHA 3RPRA 3SXFA 2X1NA 3Q9ZA 3Q6UA 1YXUA 4B0GA 2X6EA 3Q9YA 2X8IA 3ZXTA 1ZOHA 5L6PA 2GQRA 1QCFA 3D5UA 4EH4A 4KSPA 4I23A 4M67A 4Y72A 3ULZA 3NRMA 1H1WA 4O0WA 5H9BA 3MH0A 4PL5A 1YOJA 3GP0A 3EL7A 3OWKA 5LVLA 5AA8A 3KL8A 1Q8WA 3IQ7A 4Q9SA 3CC6A 4OTPA 3V8SA 2ACXA 4D4SA 2ZAZA 4FKQA 4YZCA 4YC3A 3P0MA 2BDFA 2OGVA 4JNWA 4FNXA 3PXYA 4FEQA 3WILA 3HRFA 3DXNA 3MY0A 3OW3A 3H9OA 4QP9A 4GRBA 2HELA 4QMQA 4M84A 1GY3A 1IEPA 2X0GA 2C3KA 3NIEA 2F2CB 4NW6A 2Z2WA 4OT5A 1UV5A 3NMUF 4Y5QA 2JDSA 3MESA 3LXLA 5BVDA 2HENA 3IPHA 4ERKA 1YQJA 1KV1A 3FXWA 3PVUA 4AZTA 4KBKA 4BTFA 4MD9E 3LQ8A 4QMZA 3BRBA 4Y5HA 2PZYA 2X9EA 4B9DA 4ZP5A 4RIOA 3LXPA 5KMNA 1O6YA 4FTLA 2BR1A 3W0RA 1IG1A 4JG6A 1Q3DA 1AGWA 3WZEA 3PUFC 1XBCA 3VBQA 2OZAA 5AADA 2VTPA 3G33A 3CD8A 4KB8A 3SDJA 1OMWA 3AGLA 4PPCA 3NW6A 1YXVA 2XCKA 4FKSA 4H3QA 4QP1A 3JUHA 1VZOA 3NVKI 4UMQA 4YJVA 3WE4A 5IF1A 3CLYA 3FYJX 5C9CA 3P5JC 4PPAA 3NNUA 2ZM1A 4FOBA 5AIKA 5HBEA 4A4LA 5KBRA 4O7NA 2OIQA 5HIBA 2PVLA 4O0TA 3SD0A 3W18A 4BDBA 4TRLA 4LGHA 5M4IA 2PVNA 3AKLA 4APCA 3O23A 1YOLA 5IKWA 1LUFA 2J2IB 3TL8A 2IVUA 2E2BA 3KA0A 4M68A 4G5PA 4UBAA 4FNYA 3U87A 1UA2A 4BYJA 4LMUA 2UZTA 5ANKA 5JGAA 3UZTA 1WVYA 4O21A 4AZSA 3CY3A 3JYAA 5DRBA 3ZLXA 1XH6A 2WEVA 2Y8OA 3DB8A 5AUVA 3QHWA 4XG6A 5EM7A 5I3OA 5F9EA 3OFMA 4DFZE 3ZRLA 3RJCA 3GU8A 1PW2A 4F9CA 2W4OA 3SQQA 2JLDA 3AT3A 2X8EA 4PV0A 4HGEA 5CT7A 5C8MA 5C4LA 5D7AA 2ZYBA 3OY3A 5AP5A 1PMVA 3WF7A 5IMXA 5M06A 5A6NA 3VUMA 2QOFA 5L2WA 2YIRA 4K6ZA 3O2MA 1PKDA 4H05A 1VYWA 4AT4A 1FOTA 2XIXA 3OWJA 3LPBA 3PTGA 3UZRA 4IX6A 2F7EE 3QZGA 3EQGA 3QTUA 2ZDTA 2VWXA 4IIRA 4HYIA 5J5TA 4O96A 3ZCLA 1U59A 4YJNA 2WU6A 4ZXTA 4EZ7A 3QAME 2WQMA 2W1GA 1OL2A 1U4DA 3B2TA 1SNXA 1YI3A 3QX2A 2IG7A 4BR3A 3EOCA 3ZMMA 4RQKA 4D5KA 4BTJA 4E8AA 4X2FA 1WMKA 4AXAA 4F0IA 3T8OA 2HCKA 4FT3A 4XNEA 1WBPA 4FGBA 2W1HA 3VNTA 4JXFA 2GS2A 1R39A 4J53A 1SM2A 3ENHA 3V5QA 2VTHA 2VTTA 4IWQA 4N6ZA 3U4UA 4BCGA 4BKZA 2WMXA 5CYIA 3OCTA 3FZOA 3ZM9A 2PSQA 4GG7A 4R1YA 4C36A 2Q83A 3OG7A 4NKAA 3OP5A 3QUEA 4H1JA 4A4OA 4IWOA 3HV7A 5EHLA 2X7GA 3WOWA 3AD4A 4GV1A 2UW8A 3FQSA 4XMOA 4YZDA 2OF4A 5F94A 4PP7A 4O7VA 4CXAA 2JIVA 4AACA 1GZKA 3R6XA 4O0UA 4V04A 4C0TA 3ODZX 1UKIA 3RCDA 5CAOA 2X7FA 3FE3A 4NH1A 3DTWA 4ANOA 4KNBA 5AAGA 2BHHA 1JSUA 2YM4A 4YP8A 4O7LA 1JBPE 3FC1X 3VUHA 2W1FA 3BQCA 4ALVA 2JIUA 3DK7A 4CFNA 1J1BA 3EIDA 4U5JA 4ZIMA 4CTBA 4G6OA 4AN2A 3VHEA 3GU4A 4G3DA 4O6LA