2GTNA

Mutated map kinase p38 (mus musculus) in complex with inhbitor pg-951717
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The development of novel C-2, C-8, and N-9 trisubstituted purines as inhibitors of TNF-alpha production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 105
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gtnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gtnA01
2XK8A 2WMWA 3H3CA 1SYKA 2OF4A 2YM4A 1P4OA 5E8UA 4BGHA 2B9JA 3KK8A 5AMNA 3EWHA 5KUPA 4O84A 3VO3A 4FEXA 3DZQA 1W8CA 4MX9A 2X39A 3TZMA 4JIKA 5IDNA 3RM6A 1VEBA 3IW4A 3VJOA 4FUXA 3R04A 2YAKA 3Q9WA 3PTGA 2B9FA 4WHZA 5IQAA 2R3RA 2X7FA 5IMXA 3F6XA 2W06A 3FI2A 4YTCA 4EQMA 3HECA 3RTPA 2PPQA 1K3AA 3UZRA 1NW1A 2ITXA 4LV5A 5I9XA 4HPUE 4WNPA 3EH9A 4EZ7A 2VUWA 5JFVA 3LLAA 4P5ZA 3KXMA 5HTIA 3BHTA 5EW3A 3FI8A 5IQCA 4EK6A 5FUTA 5EDRA 4CGAA 4OBPA 4EOPA 3PPKA 3R28A 3VN9A 3QTQA 4ANBA 4CMTA 4I20A 5M09A 3L1SA 3IW8A 2RG5A 4UEUA 3AGLA 3OFMA 3VUDA 4G16A 2GQGA 3QGYA 4FTCA 4A07A 2A0CX 3QRTA 5J8IA 2XZSA 4YLKA 2W7XA 4AOTA 2BAKA 4BBEA 4EZ3A 4JG7A 4ZSAA 2F9GA 3A2CA 4RWKA 4W4VA 3ZO2A 5IQIA 3K3IA 1WBWA 3LXPA 3H4JA 5IQHA 3GCVA 4QMOA 4OTQA 4OT6A 1W98A 5AP4A 1GIIA 3KA0A 4IB1A 4R8QA 5I0BA 4O1OA 5FWKK 2XP2A 2R3KA 1RE8A 1WVWA 5DLSA 4ZTNA 1Q99A 4EOSA 3ZXZA 4G3FA 3ORXA 3LFNA 4TN6A 3AQVA 3RPOA 4DFNA 3V6SA 4QD6A 2JEDA 1Q8WA 1YI6A 3KN6A 4D2WA 4DN5A 2E9OA 2YLFA 1T46A 4KINA 2W1FA 2CLXA 3R7IA 2BIKB 4I6BA 1G3NA 5DHJA 4C3RA 2BROA 4DFUA 2YIRA 4E1ZA 3DLSA 1ZLTA 5D9HA 5JRSA 4TY1A 3VIDA 5CF8A 3W2PA 4BCQA 2O3PA 2BHHA 4DEIA 3I7CA 2ZDTA 4QNAA 3ZC6A 2YDKA 4NWMA 4ZMFA 5GINE 4IX3A 3OZ6A 4JBVA 2ITYA 1S9JA 2VO7A 4F1OA 2X9EA 3R1SA 5CNNA 2XEZA 3EYGA 3ODYX 2GNGA 1H1RA 2UZOA 2YDJA 3NX8A 5HD4A 4DEDA 4AAAA 3KB7A 2WU6A 4I5MA 4X2GA 4J7BA 4JJRA 2PVRA 2VGPA 3D7TB 2QKRA 2ZVAA 3PZHA 5LVOA 2X8EA 2G15A 3F5UA 3ZCLA 3G9NA 2R7BA 1YRPA 2YN8A 4FSNA 2JFLA 4DG0E 4YJUA 5L8LA 3PY0A 2ETRA 4FIFA 4R7IA 2QI8A 3LFAA 4OTDA 4V05A 5AP6A 2JAMA 3UBDA 3SOCA 3R8UA 4MBJA 2XKCA 3COIA 4MXYA 4U43A 4Z55A 3SG8A 1REJA 2PUUA 1WBVA 2XYUA 2OJ9A 1H00A 4Q9ZA 1BL7A 4PDSA 3VQUA 1H4LA 4PDYA 2H34A 4Y5HA 4H3QA 4ACMA 2OH4A 4IZ7A 4F9AA 4MXZA 2YZAA 1MQBA 4MAOA 2YACA 4IB0A 4BI1A 2W4JA 3H9RA 5E92A 2J9MA 4FG8A 3EL7A 2OIDA 3V5JA 3LQ3A 1XH4A 2VWXA 3NDMA 3FZ1A 3GXLA 3BBWA 2BR1A 3OCBA 1OI9A 3DAEA 5EK7A 4DINA 3FY0A 4FBXA 4WG3A 2EUFB 4Z9LA 2BIYA 5AAEA 3FEGA 4FTMA 5KHWA 3A61A 1E1XA 3TNIA 5K5NA 3ZRMA 4EK5A 3PLSA 1PMNA 5FGKA 3EQDA 3U8WA 4UX9A 1YHWA 2VWUA 4IXPA 3CD3A 4XV2A 2WTWA 2C0TA 3LCDA 2UVYA 3DNDA 5AUTA 3G0FA 1ZOGA 4BBMA 5FBOA 4F0GA 3F3ZA 2VTPA 1ZWSA 3QUPA 4FGBA 1J91A 4U8ZA 2W1CA 4AW1A 4F1TA 3JR1A 5AR8A 3FMHA 4DTAA 2C0IA 4BHZA 3LCKA 4NH1A 3FLQA 5BPYA 1L8TA 3L9MA 3F61A 4PMTA 1XH7A 2CGXA 4YJVA 3EMGA 2LGCA 2VGOA 4E6AA 3UO6A 4BDCA 2W96B 2ZM1A 2C4GA 4E26A 3C0GA 3P0MA 5AFVA 1W0XC 1OIRA 2JIUA 3DBQA 4CTBA 2V0DA 4M13A 4ZY4A 5D10A 5KMMA 2QO2A 1IR3A 2QC6A 3AC2A 3FI4A 3PE2A 4R6VA 4H05A 3ORNA 2VWVA 3V5PA 3COHA 3PPJA 4I4FA 2C6OA 4GUEA 2PZRA 4D9TA 4AN2A 5CZHA 2PHKA 4EWQA 1BMKA 3WIKA 5CEKA 1ZAOA 4FVRA 4FKIA 4UMUA 3PFQA 1U5RA 4P90A 2QNJA 3A4OX 4PDPA 3QC9A 4ZJJA 4O86A 3MY5A 3ET7A 4GMYA 4IVAA 4U3YA 5F1ZA 3S1HA 3E92A 3Q32A 4LOPA 4FKGA 4NM0A 1VYZA 3QD4A 5AR4A 3II5A 4C8BA 3GCQA 4IW0A 3ORLA 5HIBA 2PY3A 1WVXA 3MY0A 4X3FB 2ZM3A 4OR5A 3GFEA 4QTEA 3NRMA 4C0TA 5K9IA 3HMMA 1YHVA 2OFUA 3H30A 4MF0A 1YWVA 4M8TA 4JBQA 3WF6A 3O0GA 3F7ZA 3LZBA 4FTLA 4U45A 4R1YA 2XYNA 3ZLXA 3BLQA 4HOKA 4FKOA 2WTKC 4FODA 5E8XA 5KE0A 5L6WL 4E93A 3OEFX 4YTFA 4RC2A 1L3RE 2YAAA 5IISA 4X2KA 2XRUA 4S34A 1Y57A 2DYLA 4R5SA 3R7UA 1R0PA 4QQTA 2CSNA 4S33A 3VBVA 3NW5A 3Q53A 3KXNA 4CV8A 1Q3WA 2QO9A 2ZOQA 5EFQA 4DFYA 1OIUA 1Y8YA 2QD9A 4FTIA 4JLCA 5LMBA 3QCYA 3OVVA 4CNHA 2QLQA 3MFSA 1Q8YA 5FG8A 1J7LA 1PKDA 4YPDA 4W4XA 4KABA 5IKWA 3HRBA 2GS7A 4FK6A 3K2LA 1H26A 2C68A 5A4QA 3JS2A 2I1MA 3QA0A 4BBFA 1R3CA 2QU5A 5KO1A 2OI4X 3NLBA 3KCKA 5D11A 2GQSA 5HIEA 3MTFA 5ANEA 5HU9A 2J51A 2JD5A 4BCJA 5KBRA 4FIGA 5IH4A 2BILB 4TPTA 2OFVA 5AIKA 3S2PA 3HX4A 4O2PA 5E90A 3UC4A 4BWKA 4PPCA 4FZAB 4RLLA 4MK0A 5IA0A 4GFMA 3E8CA 4N6YA 4S32A 3VS5A 5EM8A 4EH8A 4FI1A 3HV4A 3ATTA 4IC7A 3MESA 3QZHA 4M69A 3TIZA 3ORMA 3EQBA 3NUAA 3SDJA 2X8IA 3Q2JA 2I0YA 5ETCA 3D2KA 3W8LA 5I9ZA 4MNEB 5IUHA 2VTAA 2XMYA 3GQLA 4EOMA 1WAKA 2RF9A 2OXYA 4O81A 3OCSA 5CYIA 4K9YA 2QR8A 5M4FA 1IRKA 4AGWA 1FGIA 3TI1A 2CNVA 3AMBA 4FKRA 4BCFA 3S95A 4HZRA 2W5HA 2IG7A 4ZS0A 2ETMA 4ZK5A 4FG7A 5A4LA 4JR3A 5FM3A 4OTWA 3QRUA 4FMQA 4QP2A 3EJ1A 3O8TA 4JX3A 4YMJA 2BDWA 3MIAA 4BL1A 4O7RA 3OXZA 2GMXA 3ULZA 4BCGA 4MTAA 3P1AA 4D2SA 3DTCA 2V5QA 3FSFA 3U4UA 1QCFA 1ZY4A 2PMIA 3BYUA 3HKOA 3Q9YA 2YIWA 3WF9A 2HELA 3BV2A 4RWLA 4CYJA 4UMRA 2VWBA 2OKRA 3IK3A 2GHLA 3ORTA 4EKKA 3PDTA 4PMPA 2XNEA 1DI9A 3LCSA 5DWRA 2WMSA 2B9HA 2WHBA 5ICPA 4CQEA 5FTOA 4QYGA 4RFMA 1O9UA 3PJCA 4EHVA 2VTLA 5J1WA 4IZYA 5KKRC 4IVDA 4HCVA 4QMXA 3PVWA 4EH3A 1OBDA 5CS6A 5LVPA 3KVXA 4TYHA 1HCLA 4C33A 3O17A 2IZSA 1JPAA 3U51A 4TW9A 4NIFB 3P4KA 1SVGA 3KRJA 3VJNA 4CRLA 4NL0A 3DK6A 3NUPA 2OBJA 2J5FA 3FPMA 4RWIA 1YOMA 3QZGA 3UMXA 3NIEA 2CCHA 4AA5A 4RVLA 2W1GA 4BKZA 5JQ5A 4DC2A 4PUZA 4XRJA 4CFWA 5HG9A 4W4YA 5IMEA 5IQBA 4YJNA 5BVEA 4RX7A 4PP7A 5BYZA 4V01A 2QG5A 1H0WA 4RBLA 5H9BA 4OT5A 4GJ3A 1H08A 3TM0A 5BUIA 3R8VA 4YTHA 3ZM4A 4JBPA 4CFNA 3NUUA 4D5KA 2WOTA 3ZS5A 4J99A 2W9ZB 4HGTA 4FTTA 5IEVA 3FHRA 2J50A 4NKAA 5L8KA 2JC6A 4BRXA 2ITUA 2WMUA 4IACA 1U46A 2UZDA 2R3QA 3NUYA 3QTRA 3GU5A 3GU7A 4B7TA 3RPYA 4ZJVA 4BDGA 1GZOA 4MEDA 3FSKA 4G31A 4IWQA 3FAAA 5HO8A 1GIHA 3KVWA 3QTXA 2J90A 3HP5A 3U9CA 3U6IA 4AGDA 2FB8A 3U55A 4PWNA 3PVUA 3TN8A 4BZDA 3DKOA 2QLUA 2GPHA 5CU4A 3BYOA 5A46A 4WIHA 3L9LA 1ERKA 4UWCA 5EQPA 3FYJX 4V0GB 3FZRA 2PL0A 4FSQA 5AR7A 1YI4A 4DGNA 4IX5A 1ZXEA 3TEIA 4J52A 3VUMA 3NNXA 3QXPA 2XM9A 5EI8A 1IAJA 3PJ2A 3I7BA 5BYYA 2JBPA 5EKNA 4PV0A 2B9IA 4I92A 2C0OA 3VNTA 5BMSA 4YSMA 3QD3A 4O27B 1PKGA 3D5VA 4FKQA 1XH6A 4QP9A 4OTIA 1M7NA 3WZDA 5H3QA 4L45A 2YDIA 4I6HA 4R7HA 2BKKA 1JAMA 3QX4A 3HUBA 5CTPA 4CSVA 4FTAA 4O7WA 3QF9A 4QYFA 3MPMA 5ANDA 3TT0A 5CI7A 5AM7A 3VRZA 1UWJA 2PE0A 4RC4A 3L8XA 2I0HA 4P5QA 5LQFA 3AXWA 4RVKA 5DR9A 2YWPA 5F95A 3TNQB 2O5KA 4BDBA 3DU8A 5CY3A 2VX3A 3ENMA 4P4CA 4G6NA 3IKAA 4WD5A 5CALA 5CANA 1T45A 3EFKA 4EWHA 4O7ZA 4U42A 3P7AA 1LP4A 4EOKA 5CASA 4ZSJA 2C6EA 2G1TA 4AGUA 3NCGA 4DT9A 3LVPA 2VTJA 4YO6A 3UP2A 4BVUA 3IGOA 5AV3A 3VBQA 1OL2A 4EZ5A 4O7TA 1JNKA 4G3EA 3MTLA 2HWOA 3QCXA 4O7YA 2WTKB 3VS4A 1NA7A 2IJMA 5CAQA 5HLNA 3BGQA 3DK3A 3PA4A 3QD2B 5KMIA 3LFBA 5CI6A 4YZMA 3TKHA 3LFQA 3POOA 3BI6A 4FV1A 1X8BA 4BIBA 4U3ZA 4I6FA 3Q4CA 4E4NA 3AD4A 3QLGA 2PTKA 1XBAA 3F7WA 5HLPA 2C3IB 4F0FA 5AA8A 3UG1A 3UVRA 3HV3A 2WMQA 5E7RA 4QP8A 1H07A 4GK4A 4D0XA 4NM7A 2J7TA 4CZTA 4XG9A 4ENYA 5CEIA 1O6LA 4PF4A 3V8TA 4C37A 4C57A 1B6CB 1Y91A 2BTRA 3NZ0A 4QMYA 5FRIA 3RNIA 5HNIX 3R1YA 4ITIA 1KE9A 2J0IA 4GU6A 4BHNA 5DT0A 4YNOA 2J0LA 3VUHA 3DB8A 4WO5A 2GTMA 4JDKA 3VUGA 4ENXA 2CNUA 5JH6A 3FXWA 1BKXA 3DZOA 3FLSA 3HMOA 3RMFA 3UC3A 4AZFA 2PMOX 1WMKA 2YCSA 3Q3BA 4E4XA 4G5JA 3BWFA 1JSTA 3L9PA 3DS6A 3ZUVA 4NM3A 4QYEA 3WARA 3ZDUA 1YKRA 1V0BA 2BVAA 2YA9A 3OBGA 3QTZA 3F9NA 4IVCA 4X3JA 3R9DA 4QP4A 4AZSA 4D2PA 3FMEA 5EM6A 3AMAA 3TWJA 2W17A 2OW3A 3F3VA 4WRSA 2F49A 1BUHA 1XH5A 2P2HA 4NEUA 2JDVA 4C38A 4I41A 4F64A 3MFUA 5ANOA 4JL9A 2GNLA 4FV2A 1NVQA 4ITHA 4Y85A 2GNJA 2JKOA 4FICA 4I21A 1M17A 4AZVA 4BR3A 4KKEA 4QYHA 5LOHA 4KSPA 4L46A 4RX8A 5AA9A 2X9FA 3DDPA 3QQGA 4NZWB 5FXSA 2WOUA 3F3TA 3O96A 4DH7A 5ANJA 1KE5A 4W9XA 4RIWA 4BTMA 4WUAA 1SNUA 2GFCA 3KFAA 1KE6A 4S31A 2ERZE 2PZ5A 4GW8A 1BL6A 3DFAA 5HD7A 3T9IA 4QMQA 4XH6A 2YWVA 2X4ZA 3PJ8A 4HZSA 3VC4A 1Y8GA 3ZO1A 4BKJA 2C6IA 2C1AA 5JSMA 2R3GA 4CG8A 3JUHA 1RQQA 2BDJA 3QKMA 4HGEA 4YO4A 4RJ7A 3IGGA 1UWHA 3UGCA 4ZLZA 2WMRA 2XK4A 5C1QB 5KKRB 2OSCA 3QHWA 2PVLA 4AU8A 4QQCA 4YZ9A 1STCE 4G1WA 5I5ZA 2YHVA 2BZJA 3EHAA 1R39A 5CXZA 1FVTA 4XP3A 4AW2A 3GT8A 4D28A 5HCZA 4U80A 1VYWA 2GNIA 3IS5A 4DCAA 2CPKE 4ZSGA 4BICA 3KXHA 2V55A 2RFSA 4LFIA 5CX9A 3UE4A 3TXOA 4IB3A 4AT4A 4C36A 4F9WA 5HX6A 2CJMA 3R2YA 5KHXA 5KMOA 2UZLA 3KK9A 2ITOA 3U87A 3RKBA 4MBLA 1PMUA 3HGKA 1ATPE 3BQRA 4EBWA 3UIMA 2Y4IC 2OH0E 3FL4A 2BZHB 4Y5QA 5DR6A 2XKDA 4C4EA 4QMNA 5AEPA 4UB7A 3R8MA 4LOOA 4ZSLA 4ANLA 2V62A 5CWZA 3R8ZA 3D15A 3OOMA 5FDPA 1GZNA 3PVBA 4JI9A 4YHFA 3M1SA 3PJ1A 4Y83A 2X7GA 3Q60A 2UW8A 1YOLA 2IZTA 3LJ2A 4A9SA 3R1NA 1OM1A 3D2IA 3FYKX 4C4IA 3MPAA 3FDNA 3RGFA 5JZNA 4B9DA 5GZAA 4IQ6A 4ANNA 2W5BA 4YLLA 2PVJA 4JBOA 4F65A 4D4YA 5DOSA 4XV3A 3V5LA 4D4SA 5KZ0A 4DLJA 1OPLA 5DPVA 3VRYA 4FZ6A 1GZ8A 3VBYA 3ZDIA 3SXSA 3QLFA 4EYJA 5IH5A 3FZTA 3ZMMA 4I0TA 4JDIA 3UIXA 5AP2A 4BDKA 4C34A 1OMWA 3OEZA 5CSPA 2R3OA 3AC4A 2H9VA 4EH2A 4U79A 2O65A 3QQJA 3R63A 5K5XA 3F2RA 3ACKA 1PMEA 3FMNA 5FP5A 3LFSA 3DKGA 2B4SB 4UZDA 5E4HA 5FQDC 2WKMA 2E2BA 3JVSA 4Z16A 2WQNA 2Z7SA 3NCZA 4GFOA 2F2UA 1PXJA 2BMCA 5HNBA 3AT3A 3B8QA 5AV1A 4G6LA 3UPXA 4FSZA 3C4FA 4XP0A 5CAUA 3QRIA 4L3LA 3MIYA 4IE9A 3CE3A 3LOKA 3LFCA 3DK7A 3O2MA 3F2AA 3ZUUA 4XV9A 2YM6A 4K11A 4YP8A 3M42A 4G3GA 4LV8A 4AN3A 2PUNA 2J0KA 3KXXA 3TTIA 4CD0A 2X7OA 3HA6A 3P9JA 2JBOA 4YGAA 1PW2A 3GENA 4FNYA 4JRNA 4M3QA 4ANSA 2XIRA 3RNYA 5DYJA 1OVEA 1KV2A 2IVTA 2YFXA 3KKVA 3LFDA 5IEYA 3P79A 4O1PA 4FSWA 2QOCA 4CLIA 2VTOA 5HCXA 3PP0A 2OZOA 4IADA 3EZRA 3WBLA 2REIA 1OUKA 5L2SA 3JY9A 5M4CA 3R2BA 4WBOA 3SKCA 3EIDA 2P0CA 2ITVA 2AUHA 3A7HA 4RIXA 4QQJA 1R1WA 4FT0A 4GSBA 2I40A 3SW7A 2WIPA 3UPZA 4FV5A 3QL8A 1QPEA 5JFSA 4RLKA 4XBRA 5DVRA 4FZDB 2JKQA 3PUPA 1BLXA 2CGUA 5ETAA 2Y6OA 3TNHA 4FT7A 4MXXA 4BFMA 3D5WA 4AOIA 2GSFA 2C6MA 4XG7A 5DFPA 4AZTA 1IA9A 5EYDA 1ZYJA 4GCJA 5J9YA 4NYEA 4IVBA 4CTCA 2CDZA 1H28A 3OCTA 3HAVA 3OROA 4G9RA 2QOBA 3CQEA 4PMSA 4Y46A 3R7YA 4F6WA 1Q8ZA 4QMUA 3EKKA 4DCEA 1Y6BA 3DLZA 4NUSA 5GNKA 5J9LA 3DGKA 3C4EA 3RWQA 3ZSGA 4X2FA 3LM5A 2YZLA 1WCCA 5M06A 4DTBA 3OTUA 5HHWA 2G2IA 5GJDA 4ACCA 3GC0A 3DBDA 3AG9A 5KNJA 2C6DA 1PY5A 5ANIA 3SG9A 3V5QA 4UYAA 4M14A 3I79A 2OLCA 2VTHA 4BZNA 3ZH8A 4ZLYA 2VN9A 5IZFA 2WTCA 5CU2A 3OCGA 2E9VA 2VWYA 3W1FA 3W2OA 2DQ7X 5A4EA 3PRFA 5H8EA 5F9EA 3ALOA 1W84A 4WBBB 4YZDA 3MY1A 2HOGA 2ACXA 3SXFA 2DUVA 2XJ2A 4N4SA 4QMTA 5FDXA 5EQYA 3L8VA 4A7CA 4B6LA 5BVDA 2X0GA 3EN7A 3I6WA 1YI3A 3ZOSA 2PVKA 3U4WA 3HV6A 1JQHA 2VU3A 3Q4TA 3EQIA 5CXHA 2QKWB 3RK9A 5HORA 4DF3A 1M2PA 4AT3A 4MF1A 5IQFA 4I24A 3NNUA 4FKVA 4Y73A 4CEGA 3TDWA 1JBPE 3PXKA 4H39A 5AX9A 4J98A 2H6DA 5IH6A 3MVMA 4ZAUA 2F7EE 5TR6A 3D83A 4GRBA 4OUCA 5C4LA 2HXLA 4L7FA 4HYIA 3MA3A 4L43A 4D4VA 2QOFA 5M08A 3UVQA 4RFZA 3FKOA 1QPJA 4NCTA 2Y8OA 3PIXA 4JOAA 4NFNA 2BFYA 2IN6A 2X2KA 3EB0A 3ZO4A 3ORPA 3ORIA 1V1KA 2C6LA 3FLWA 3UP7A 4D2RA 3TUDA 3DNEA 3FMMA 4K2RA 4KA3A 1Z5MA 3RZFA 2XCKA 3SOAA 2XH5A 3W33A 1JKSA 3NNVA 3DV3A 4UY9A 5IA1A 3KXGA 4APCA 3EFWA 1TVOA 4MQ1A 5TOZA 4JAIA 4YJTA 1YXSA 3A7JA 2VRXA 3POZA 3VS1A 2XKFA 5I9VA 2PE1A 2XNOA 2F7ZE 2XEYA 4KRDA 2PK9A 1XQZA 2WQEA 5AUUA 4YJQA 4CMUA 4J8NA 4CVAA 4J95A 3NUSA 2HYYA 5F4NA 2Q83A 1TQMA 3HMIA 4L42A 4UYNA 5CQUA 5E91A 3ZO3A 1I09A 2C3KA 4MBIA 3BKBA 2J0JA 5IEXA 2UV2A 3ZU7A 2P2IA 2Y4IB 4DAWA 3RPVA 4BDHA 3FZSA 4F9YA 4GT5A 4QPMA 3V3VA 1XWSA 3G90X 4TKSA 3JXWA 3BHVA 5LXMA 4BCKA 3HLLA 2B55A 2QOQA 2R3LA 4X0MA 4HVIA 2WMXA 4P2KA 4RT7A 3UYSA 3EL8A 3HL7A 3L8PA 3R30A 2BAJA 4KIQA 4R3RA 4L6QA 4TYJA 5J7BA 2OJIA 3CJGA 2JGZA 3F2NA 3PWDA 2B0QA 3D5UA 1Q5KA 4E6QA 1M2RA 3VHEA 1FMKA 3KN5A 3F69A 4BDDA 3LJ0A 2W4OA 3HDNA 5CU3A 5AR5A 3NYNA 1PF8A 5J79A 5J5SA 3EQGA 3PY3A 3LIJA 4AXAA 1UNLA 2HZIA 3E8EA 5CU0A 4QMVA 1V0PA 2DWBA 3QGWA 2JKMA 1B38A 3MS9A 4IFGA 3RZBA 4BCPA 5IA2A 1J7IA 1XBCA 3GCSA 4L9IA 3ZSIA 1ZZLA 2QOIA 2G2HA 3V5WA 4FL3A 3TV4A 3DT1A 2VO0A 5KX8A 3QCQA 5TT7A 1UU9A 2QR7A 2V7OA 2UW7A 5I3OA 4WSQA 4MD8E 4RIYA 4C2WA 4GG7A 4CV9A 4JX7A 4USEA 2X8DA 4GS6A 1S9IA 3BHUA 2FSLX 3Q04A 4FIHA 3GI3A 4EH7A 1MQ4A 1PMVA 2PSQA 2EXEA 4O7SA 2UUEA 2UZNA 3ETAA 3RK5A 2BALA 2FO0A 3CY2A 4R5YA 3ZFYA 3SA0A 4OAVB 3IONA 4WUNA 4KIKB 2I0EA 3PSDA 4OBOA 3R71A 3QQKA 2ZM4A 4BY9E 3VULA 2PUPA 3D0EA 1CKIA 4RJ5A 2WMTA 4XMOA 2BRBA 5LCJA 4FNZA 4YSJA 3VS7A 4FV6A 3MVJA 5CSXA 5LMKA 3OP5A 3FLYA 1AQ1A 2O2UA 3E63A 3I5NA 3MI9A 2IZUA 3E5AA 2X1NA 1E9HA 4OGRA 4TYEA 3V51A 3U6HA 1OB3A 3R1QA 1WBOA 4FTKA 2FYSA 1Q62A 2OIBA 2XK3A 4BC6A 4E5AX 1Q4LA 3E7VA 5ETIA 2WB8A 3IW6A 2XVDA 2ZYBA 5FXQA 5HBJA 5AAGA 2W9FB 3Q5IA 4TZRA 3E62A 3GVUA 3ZUTA 2OJFE 4X6QC 3AC8A 2YLEA 3BU5A 1W83A 2XKEA 3TJCA 3E7OA 4Z3VA 4EC9A 4L3PA 4HYUA 5AX3A 2ERKA 3NW7A 4CCBA 4C58A 4MYGA 4DH1A 4EUUA 3EFLA 3MV5A 4KKHA 5AP7A 2R9SA 3S3IA 3MW1A 3ANRA 1K9AA 4YZCA 4F7LA 4TRLA 3A8WA 2JKKA 4FEQA 5C26A 3PXFA 4Q5HA 3KQ7A 3C4ZA 1OKVA 4GYGA 3PA3A 5L2WA 3QZFA 2PZYA 2WIHA 2YISA 5FXRA 2FUMA 3NUXA 3AC3A 5FLFA 1H25A 3LW0A 1TQIA 2Z7QA 1SNXA 4F4PA 5T68A 5ITAA 2QVSE 4FIIA 5FM2A 2XK7A 4Q9SA 2CKEA 2ITPA 3SGCA 3QC4A 5EM5A 4ASZA 1PXOA 3DB6A 4QPSA 4EQCA 1XO2B 4EOLA 5HG7A 3FC1X 2B53A 4HYHA 2EVAA 4IFCA 1KE8A 1WBPA 2HZ4A 4FZ7A 3ZBXA 1O6YA 1OECA 2HCKA 3CC6A 2VTQA 4L3JA 5EHOA 3PZEA 3RPRA 4K1BA 1NY3A 3ZEWA 5EW9A 3BHYA 3PSCA 3SV0A 2YJSA 2XA4A 2YIQA 3D5XA 4F1MA 4AFEA 4GU9A 1P4FA 3DBCA 5BVFA 3JVRA 1PYXA 2BRHA 2WAJA 3NSZA 3EN4A 5K3YA 4DEGA 4F7NA 3NYVA 3C1XA 4ZS4A 4CT1A 4ZTQA 4I5PA 1Y6AA 3F5GA 4RA4A 2EU9A 4BZOA 3BCEA 2Y0AA 3P86A 4GFGA 4I5CA 5AV0A 4NSTA 4A4LA 4AF3A 4H36A 4U0IA 2VZ6A 3F5XA 3IECA 4DEAA 4KS7A 4OTRA 4FV7A 5CF5A 4G17A 4RX9A 2Z02A 3G0EA 2HY0A 3N4TA 4I0SA 1FVRA 3AT4A 3A60A 4QYYA 3TTJA 3RAHA 5HZNA 2ITNA 4XV1A 3EKNA 3WIGA 2R5TA 3QZIA 5HTBA 2CKOA 5AIRA 3IDBA 1SM2A 3GCPA 4IAFA 4Z7HA 4AG8A 2ZJWA 3ULIA 4FYNA 3UNKA 4LM5A 5AR2A 3FHIA 4BWXA 3E8NA 4HW7A 3BYVA 4BGQA 2PVFA 2OU7A 4ZY5A 5JK3A 4TNBA 4O0YA 3OS3A 4ALVA 4I22A 4K8AA 3O51A 2JDOA 3EN6A 4NK9A 4RJ3A 4JNWA 2W5AA 1A48A 3HV7A 3QYZA 4JQEA 4QMPA 3LLTA 1UKIA 5EM7A 5EYKA 3SD0A 1MRVA 2OXXA 2X6DA 4QP3A 3UVPA 4B4LA 4E3CA 5HVKA 1FBNA 5HE2A 3COMA 3O8UA 2ITZA 4FKSA 3QKKA 5E8ZA 4ANOA 3CTQA 1J7UA 3C4CA 3R7EA 3BRBA 4E6DA 2HZ0A 2Y6MA 3RVGA 3ZHPC 4A9YA 4APPA 4D1XA 2BFXA 5AWMA 2I0VA 3PP1A 3PLAE 1WBTA 3NIZA 3ZSHA 4FZFB 4AWIA 4AUAA 3O7LD 5CEQA 1OZ1A 4I5HA 5AV4A 4NJ3A 1DAWA 4ERKA 4W8DA 3GU6A 3ROYA 5GZ8A 4I94A 4QMZA 3CXWA 3B8RA 3C0HA 4DH8A 4WG5A 4PL5A 4XG4A 3DQXA 3V04A 5DA3A 3WZEA 1UU8A 3VBWA 4YHJA 3OOGA 3FJQE 3FLZA 4MXCA 5FEQA 3LFFA 2CN5A 3WE4A 4AN9A 4B0GA 4KBKA 4XLVA 3RI1A 4FKWA 4ZTLA 3I0OA 5T6KA 3HMPA 1MRUA 1SZMA 3OT3A 4FV0A 3V01A 1UKHA 3ANQA 3W2CA 2FVDA 3GCUA 4Y72A 2WMAA 3IW5A 4IJPA 4OLIA 4TTHB 4J97A 5CT7A 4MNEA 4M0ZA 3ZFXA 3QKLA 3D7ZA 3NYOA 2WMVA 3LQ5A 1YVJA 4O0RA 2A19B 4IH8A 5J5TA 4JG6A 3FQHA 1QMZA 3BWJA 3KULA 2E9PA 1G5SA 4YBKA 2QQ7A 4AP7A 4O21A 3KREA 5H2UA 1H27A 3UOJA 3OXTA 1F0QA 1PXNA 2I7QA 3GC9A 4AZEA 1GZKA 3D4QA 2IO6A 2WNTA 3DQWA 4XJ0A 5KBQA 5GJGA 4HNIA 5E8SA 4YJRA 2YM5A 5FEDA 4NJDA 3CP9A 2OGVA 3QXOA 4L8MA 3C4XA 2XM8A 4XEYA 5E8TA 5CSHA 4XRLA 2WFYA 2YCFA 4HGLA 4ARKA 3KMUA 1MP8A 5E8WA 5EG3A 4CKJA 2VWIA 4WA9A 5A4CA 2WTJA 2YCRA 3BGPA 5E8YA 2IW9A 4AFJA 2JITA 3IDCA 4XOYA 1QL6A 4C4JA 4MNFA 5EYMA 2FGIA 4XNEA 5M55A 1P5EA 2HW6A 3R6XA 3PXYA 5HVYA 3RCDA 4ACHA 3FMJA 1PXLA 4N70A 3ROCA 3QD0A 4ZXTA 4C2VA 4ANMA 4H58A 4DLIA 5JEBA 4YJPA 1OPKA 2QHMA 3E3BX 3QBNA 4NCTC 2HXQA 2UVZA 3SVVA 4LMUA 4ZJIA 2XJ0A 3QTIA 4EYMA 4F6UA 4LUEA 4QT1A 5BVOA 3PPZA 2JLDA 4ZY6A 2EXCX 4H1MA 1QPCA 1IASA 2OWBA 3G6GA 4IZAA 4TWPA 4XLIA 4M0YA 4LYNA 5BVNA 4FIEA 3QALE 3P7CA 5C9CA 5AP3A 1J3HA 4PDOA 3OC1A 4DEHA 3CLYA 1ZYSA 4ERWA 3DXQA 4QP6A 4U97A 3OTVA 4R78A 3R21A 4M67A 3UOKA 3Q4ZA 4BIEA 4FTRA 3WOWA 4TWNA 4O7NA 4PPBA 3K54A 4GT3A 2QOKA 5ANGA 5A14A 2OZAA 5AADA 2ZV2A 5BUEA 2AC3A 5BVWA 4IWOA 1FPUA 3TUBA 3VS2A 2J5EA 5HX8A 3UQCA 2X2LA 4DGMA 3C4WA 5M4UA 1ZMUA 3E3PA 3CS9A 5DG5A 3C51A 2YM3A 4JRVA 2ZMDA 4H3BA 1JOWB 4E8AA 3R8LA 2ONLA 5M51A 4YPSA 5AJQA 5HBHA 4QPAA 2GQRA 3HYHA 4ZP5A 3QRKA 1H1SA 4ANQA 3G5DA 3KMMA 4F70A 3QHRA 1U54A 4O6EA 3FY2A 3QQHA 1PYEA 4U44A 2PWLA 4G5PA 3L9NA 4KIOA 4V0GA 1H8FA 4YZBA 3FUPA 3ENHA 3MH0A 3OWKA 4LOQA 3DBEA 1G8AA 2QHNA 1NVSA 1NXKA 1HCKA 3Q6WA 2GFSA 2Z7LA 4CFXA 5CEMA 5LCKA 5C8MA 1UNGA 2X81A 3R02A 3I60A 4FKTA 4U81A 3W55A 3WILA 2WU7A 2UW5A 2XBJA 1OUYA 3VBTA 5E9EA 3QQFA 3MH3A 4F63A 5JGDA 3R0TA 1P2AA 4DGGA 3SRVA 3KL8A 5AR3A 4L7SA 4QTBA 2G9XA 4G2FA 2YIYA 3R8PA 3UIUA 2BAQA 3CPCA 3TKIA 3S00A 2XNGA 4CFVA 5JZJA 2YM8A 3MYGA 3UNZA 2FH9A 3LQ8A 4XS2A 3B2WA 5HLWA 2UZVA 5ACBC 4BB4A 4CRSA 2XNPA 3BYSA 3RBWA 5IUGA 3NVKI 4AX8A 3PXRA 4GYIA 2RGPA 2ZMCA 1IEPA 3BZ3A 2P3GX 3KU2A 2EB2A 2CHLA 3R83A 3C5UA 4ZZOA 3KGAA 5D7VA 4DGLC 3U6JA 4KBCA 3PWYA 4DBXA 3PXZA 5AV2A 2IVSA 1XH8A 1XR1A 3IOKA 4DBNA 3LPBA 3I6UA 2YIXA 3BLRA 2C3LA 5GIOE 5HI2A 4HJOA 4GL9A 3P23A 3E87A 3N51A 5ACKA 4Z7GA 2OK1A 2GU8A 2BDFA 4IDVA 3UYTA 4N57A 4J53A 4FL1A 4L68A 4DHFA 1G8SA 4DH3A 3BEAA 4MKCA 5C4KA 2B52A 4IC8A 4IM2A 3CJFA 4PNKA 4YC8A 4E7WA 3RHXA 2XNMA 4KRCA 4TWCA 4D2VA 5LMKC 1W7HA 4FIJA 1PHKA 3R9NA 3WZKA 4F08A 4LG4A 4QQ5A 2R0UA 1QPDA 3U54A 1REKA 4EI4A 1JKTA 3GGFA 3CSVA 5E1SA 4M7IA 1KOAA 3OY1A 4RIXB 4HGSA 4HVDA 4EJ7A 2VNWA 3KEXA 3VW6A 4U5JA 3BEGA 3TZ8A 2UW0A 3UZPA 2F4JA 4LGHA 1Z9XA 2GS2A 2Z7RA 1UNHA 1CKPA 4JDJA 4S30A 4YJOA 4A9TA 3ERKA 5EDQA 1ZOEA 3K5VA 1R0EA 4FTJA 4B8LA 4I6QA 2J2IB 3PA5A 3G2FA 5D12A 5FP6A 3VAPA 1M2QA 1KUTA 2VTTA 4TNDA 3DAKA 4RQKA 4ZSEA 4WOVA 1A9UA 3SQQA 2BTSA 2UW9A 3MB7A 3QTSA 4FKJA 1DS5A 4FTNA 2HZNA 4LUDA 2XB7A 3H9FA 5BQ0A 1ZRZA 4FT3A 4IIRA 1LPUA 1YXVA 4JXFA 4F99A 5IA3A 1GOLA 3AC5A 5HEZA 2XNNA 4MWHA 4U40A 3AT2A 3PXQA 3FZOA 5CSWA 3DAJA 3FI3A 1JKLA 3RALA 5KMKA 4DG3E 3W32A 1KV1A 3FQEA 4LRJA 1JVPP 3LXNA 4C35A 4IWDA 2NNWB 5DR2A 2PVHA 3EN9A 3W16A 4RSSA 5L8JA 2C1BA 4FG9A 2PYWA 3H9OA 4MD9E 2C3JA 5AM6A 4ZOGA 4M68A 1Z57A 2OJGA 3C13A 4C3FA 1CM8A 2WD1A 3TZ9A 1A06A 3CR0A 5DEWA 2OG8A 4E6CA 4GH2A 3ZFMA 4EHEA 1APME 3BYMA 3DY7A 4RMZA 4ASXA 4ZTHA 3E93A 1URWA 4MWIA 2C5YA 3C50A 5JFWA 3P08A 1HOWA 3H0ZA 3GNIB 3LCOA 5CLPA 4I93A 3T3UA 2RFDA 3VWAA 4GJ2A 5D1JA 1FINA 4NTTA 3IOPA 3F3WA 4WNOA 1OIQA 3EQFA 3F88A 4F9BA 4UXQA 2V22A 2OXDA 3OXIA 3VUTA 2I6LA 3I5ZA 3GEQA 3PG3A 4IBMA 4JQ7A 3MSSA 4YR8A 5B2MA 3AGMA 3OG7A 2WZJA 5LARA 4B99A 4BF2A 2WEVA 2QURA 3OHTA 4EOJA 3OMVA 1ZARA 3GUBA 1JSUA 2YM7A 4BTKA 1FMOE 3TUCA 4QMSA 2C5NA 4FNWA 5C27A 3TCPA 2WPAA 4DGOA 3D9VA 2C69A 2E9UA 3Q9ZA 4I23A 5CT0A 4D2TA 2QG7A 4N0SA 4BWPA 2OF2A 3PYYA 3I4BA 4RVMA 5CF6A 5LJJA 3ZTXA 4ZZNA 4FSYA 1JSVA 3QX2A 3BU6A 1AGWA 2JDSA 4FK3A 2C5OA 4L44A 2RIOA 4OW8A 3V5TA 4EOOA 2PU8A 3JY0A 4KWPA 3LMGA 5H8GA 1FVVA 4NTSA 3LJ1A 4YLJA 5TO8A 2BRGA 4DEBA 5AP5A 1OKWA 3F5PA 3BX5A 4HCUA 3ZZEA 2RL5A 2R3NA 4GKIA 3TL8A 1TKIA 3ELJA 4RRVA 2C6KA 2KULA 5AUWA 4CFMA 2WTDA 3TNWA 4IM0A 1WFCA 3GB2A 4O22A 5DIAA 1V0OA 4FKPA 2XJ1A 3GU8A 3T9TA 4DFBA 3OW4A 3ZXTA 5A54A 4F0IA 5EOLA 1FQ1B 4AS0A 3C5IA 1LEZA 3LKMA 3WF7A 3MPTA 2X2MA 2XF0A 4UN0C 1E1VA 3QAME 4D1SA 1ZMWA 3R7GA 1F5QA 4HVHA 1UVRA 2R2PA 1JWHA 4PQNA 5HG8A 2CKPA 3N4UA 3H0YA 3QTWA 5M07A 3SAYA 1K2PA 4FC0A 5CNOA 4ASDA 4O0WA 1MUOA 3KY2A 3TG1A 5JMSA 4NT4A 4V04A 4YUQA 1CKJA 5AUZA 5FTQA 3LMHA 1Q24A 3NR9A 5LWNA 2W1ZA 4J96A 4BCIA 4A4XA 3BHHA 3OUNB 4RJ6A 2WTIA 3CIKA 3KC3A 3F66A 3PE1A 4N6ZA 2VTMA 3CGOA 3KRXA 3PJ3A 1Q3DA 5CU6A 2C47A 4I4EA 4LI5A 1OL7A 3GC8A 5D7AA 5EI6A 5JGAA 4TYIA 4GKHA 4WT6A 4C3PA 4ZLOA 4CZYB 5B2KA 3IDPA 2UW3A 1Q41A 4BDEA 5BVKA 2QCSA 1FGKA 3ZEPA 2VO6A 4AW0A 3R9OA 3WZJA 4HNFA 4IMYA 3NNWA 1UU7A 4GT4A 4O0VA 3G51A 3PSBA 2IZRA 3UODA 4C4HA 2AYPA 3WYYA 3KRRA 2PE2A 3VQHA 2R64A 3EOCA 4FV3A 4G6OA 5JFXA 2FSMX 4FT9A 2C5VA 2VTRA 2B54A 2JDRA 4WNMA 3AC1A 4FSMA 5GIPE 5CVFA 4L01A 4FSUA 1P14A 4IAYA 4O91A 4RIYB 4CFFA 5ANKA 2HWPA 3R00A 2FSTX 4C61A 4XG3A 4CZUA 5A6OA 2CNQA 1J1CA 2BKZA 4MHAA 4C4FA 3QCSA 4WG4A 5J87A 1OIYA 4CT2A 2PVYA 4FR4A 3I1AA 2A2AA 1GAGA 3TJDA 4AOJA 3DBFA 3ZRLA 2HW7A 1YHSA 5TE0A 2BZKB 5HIDA 2X4FA 3FMLA 1EH4A 1XHAA 4GV1A 2F7XE 5I9WA 4J1RA 4FTOA 1YW2A 1NT2A 3O71A 3Q2MA 4FOBA 4M84A 4AT5A 4BDFA 4ZIMA 2H8HA 3IW7A 2JAVA 2W0JA 2YITA 2EB3A 3FC2A 2WEIA 1VZOA 4NW5A 2HY81 2IPXA 2VTIA 2VWZA 1SMHA 2UZWE 2R3HA 3QQLA 1GY3A 1PXIA 3DA6A 4IEBA 3N4VA 2YERA 1OKZA 1KSWA 3BV3A 4UWYA 5IA4A 3OUKA 2B1PA 3QFVA 1YDSE 2XCHA 5IPJA 3TACA 2W05A 2FSOX 4OAUC 1YDRE 5CENA 4CMOA 5KMLA 1PXMA 5K4IA 4K0YA 3SC1A 4RZWA 3RAKA 4C7TA 3ID6C 4TYGA 4R3CA 4D4RA 4E5BA 3ZLWA 2GCDA 4XG2A 2Q0BA 4USDA 4FT5A 3MFRA 2ONLC 3M2WA 5CQWA 1H0VA 4M69B 3JPVA 4IAAA 2Z60A 4JIAA 3FBVA 3COKA 3RM7A 3LHJA 4UWBA 4PTCA 1FOTA 1YXUA 5G6VA 4IX6A 3BU3A 3G9LX 3DXPA 5C03A 4EK4A 3A62A 1VR2A 2QODA 3CCNA 2WXVA 3LFEA 3Q52A 2VV9A 3CKXA 3DFCB 2IW6A 3KRWA 2A1AB 5HO6A 3VVHA 4E5WA 2OICA 3G15A 4CFUA 2OJJA 4U41A 5M4IA 4CKIA 3G6HA 2HIWA 3CTHA 5HNGA 3O8PA 3A7GA 4MH7A 3M11A 4WNKA 5L2TA 5I3RA 3OWPA 4AGCA 1CSNA 4I3ZA 5KMNA 1IG1A 2XNBA 2UZUE 2XS0A 2ETKA 5HE1A 5K0XA 5J7HA 3UIBA 3W2RA 1U5QA 3E88A 2UZTA 3NW6A 3KRLA 4JQ8A 2PZPA 3FE3A 3D7TA 1XKKA 4HCTA 3GQIA 3PG1A 4RVTA 4BCMA 4GVJA 4O0SA 4O7VA 3DOGA 3FKLA 4KS8A 2XRWA 2IVUA 1Q8UA 4DEEA 3WF8A 5K0KA 4DA5A 3CD8A 3MGYA 4OBQA 4UMPA 4PRJA 2H96A 4X7QA 3WE8A 5L6OA 2CKQA 4S2ZA 3R9RA 1YXTA 1LEWA 3HRCA 4R7BA 1M7QA 4L52A 3QYWA 2VX1A 4TYHB 4RG0A 4QTAA 5CVHA 4AACA 4EEVA 5M56A 4QMMA 4DH5A 4M15A 4OTHA 4FEUA 4QMLA 4XG6A 5AAFA 1BX6A 2RFNA 4A06A 3DJ7A 2DS1A 4OTPA 3AOXA 4EH5A 5LVLA 2R3JA 2R0IA 4R3PA 4D0WA 4TL0A 2Y7JA 3SXRA 2WQOA 4W8EA 4PL4A 1KE7A 1OPJA 3V8WA 3NYXA 5B7VA 3D94A 3E64A 4AQCA 3NUNA 5DE2A 3MDYA 2PZIA 4QTCA 4UALA 5HG5A 3FLNC 2O8YA 3HV5A 4RJ8A 2CCIA 4IDTA 5AUXA 4FV9A 3RCJA 3C0IA 3OD6X 2OIQA 1OKYA 4L00A 4NFMA 4NM5A 5DEYA 5EOBA 4EH4A 4FA2A 3F82A 3GOPA 5HESA 4AA0A 3VW8A 3A4PA 4O0XA 2GNHA 2O64A 3IO7A 2C30A 3BIZA 2XIYA 3Q4UA 5EH0A 3PIYA 5LMAA 3RWPA 1M14A 4PTGA 1F3MC 4O2ZA 4RA5A 3VS6A 4AZWA 2ESMA 4X21A 4EL9A 4BN1A 4XOZA 3RPSA 2W1EA 4EH9A 5DNRA 4K33A 1GNGA 2R3MA 1OL5A 3K5UA 4LL0A 3AMYA 4FSRA 3RAWA 5BNJA 3ATSA 2BRNA 4LRKA 4C4GA 4BDIA 4XYFA 2JIVA 1PRYA 3DKFA 3DTWA 2RG6A 2ZB0A 2UZEA 4I0RA 2YABA 3Q6UA 5HBEA 3UO4A 4D55A 1PJKA 4F7JA 4FV8A 2W1HA 1OL6A 5IG1A 1ZYLA 5ETFA 3UOHA 4YU2A 4DT8A 3LXKA 3FMKA 4W4WA 2ZV8A 1LUFA 4G3DA 4IM3A 4BGGA 1YWNA 4PNIA 2CLQA 4FGRA 4EBVA 4O0TA 1H1QA 2A4LA 5CEOA 3EFJA 4TXCA 4MVFA 4IAZA 4FSTA 2Z2WA 4ALUA 1RJBA 1XH9A 3KULB 3REPA 4ZTSA 5DMZA 4FEWA 4ORKA 4FTUA 5HOAA 3DPKA 3OBJA 3HMNA 1SVEA 3R22A 4NW6A 2VX0A 4EKLA 1B39A 5BX0A 2WELA 3ZYAA 5EDPA 2BPMA 3FXXA 4USFA 4X3FA 5D41A 3FXZA 3GOKA 4K77A 4O0UA 3RJCA 2GHGA 5A6NA 4HVGA 1XBBA 5HE3A 3AD5A 4EHZA 3UOLA 2WTVA 4XCUA 4IJ9A 3Q9XA 2JIIA 3DJ6A 3ZBFA 2P4IA 3R01A 5M57A 4KIKA 5HGIA 3WI6A 4EOIA 4XBUA 3GU4A 4EUTA 5C8KA 5IUIA 2C5XA 4YJSA 1KWPA 2NRUA 4XP2A 2VNYA 3T8OA 4CYIA 5CF4A 4PY1A 1WZYA 3NVMB 3NAXA 4PP9A 5DI1A 4ZEGA 5EHLA 2LAVA 1JLUE 1CTPE 5HU3A 4ZTMA 4KBAA 4CG9A 5CAPA 3CKWA 3MVLA 4ZMEA 4BTJA 5AP1A 1RDQE 3O50A 1DI8A 4RX5A 1GJOA 3OWLA 3IPHA 4WSYA 5A9UA 2WMBA 2HAKA 3ZM9A 4A9UA 3BQCA 4DFLA 2R3FA 1U59A 3ZLSA 5DT3A 3Q5ZA 2NRYA 2UVXA 4FKLA 5L2QA 2QOHA 2GDOA 2ZAZA 4YHTA 1YOJA 3KF4A 3OY3A 3ZLYA 3VF8A 4ASEA 2BUJA 3WF5A 4BI2A 3HAMA 4Y8DA 5CEPA 2CMWA 3R7OA 3GBZA 3FWQA 2R3IA 2JDTA 5TF9A 3TDVA 2W99B 4XX9A 5I9YA 4J8MA 2OZAB 3DDQA 2B7AA 2R3PA 3HA8A 4QRCA 4FKUA 4IZ5A 5AUYA 4FYOA 4IAIA 3FV8A 3NGAA 2XUUA 3DJ5A 4MCVA 3RK7A 4AE9A 4JR7A 4KD1A 2ZV9A 2HENA 2CGWA 1PXKA 2PMNX 3TV7A 4IAKA 2W1DA 4GIIA 4L53A 1I44A 4BCHA 2P33A 2C6TA 4O6LA 5HE0A 5JT2A 3QTUA 2PVNA 2WGJA 3ORKA 4LMNA 2GHMA 4WRGA 3HRFA 4YTIA 2QONA 3CEKA 5CAOA 4GG5A 4YNEA 3UMWA 4FOCA 3MN3A 1U54B 4E20A 3CY3A 4D9UA 1AD5A 1NVRA 2YCQA 4F6SA 2NPQA 3PY1A 4H1JA 4DYMA 3BLHA 4U9AA 4B8MA 4F09A 4G3CA 3NWWA 4NKSA 5E1EA 1WBNA 5L4QA 4ALWA 3QWJA 2WO6A 1H1PA 2GNFA 3KXZA 4R1VA 3PVGA 2XK9A 5HVJA 4IWPA 4QMWA 4D58A 4MQ2A 4BCOA 3CBLA 3U9NA 3MJ2A 2RKUA 1J1BA 4O82A 3A7FA 3AD6A 4RC3A 1BI8A 4RFYA 3BE2A 3SRVB 3VHKA 2PUIA 3R73A 4H3PA 5J9ZA 1OL1A 1WBSA 3L8SA 3O7LB 4JDHA 5IF1A 5LVNA 4PL3A 3C9WA 5EKOA 4LGGA 4LQMA 4RIWB 1H01A 3B2TA 3MJ1A 4EQUA 2R7IA 2J6MA 2QU6A 3CPBA 3MWUA 5DBXA 3LXLA 2J4ZA 5FD2A 4CQGA 2PULA 3ZZWA 4LRMA 4JS8A 4KSQA 4UV0A 4JAJA 3UJGA 3ALNA 3FKNA 5CZIA 3P7BA 3QWKA 4HPTE 3BPRA 3BGZA 4GIHA 4NIFA 4F9CA 3EQPA 1M52A 2R4BA 2OO8X 3HVCA 2ZB1A 4FUYA 1IAHA 1H24A 1GIJA 3MA6A 3IQ7A 4RPVA 3ODZX 2JFMA 4IB5A 3CQWA 4GEOA 1R78A 1YXXA 3PIZA 5T3QA 5IQDA 5I9UA 4FEVA 4O96A 1DAYA 4L67A 4FVQA 3HP2A 5GHVA 4HVSA 3FMDA 3T3VA 2VD5A 1H1WA 5KCVA 2GS6A 4MXOA 3K3JA 4KKGA 3I81A 4IX4A 5DRBA 4EORA 2O63A 3RINA 2Y4PA 4LL5A 4QP1A 3SHEA 3TNPC 4FL2A 4BYJA 3QUEA 4TWOA 2V7AA 4K18A 5F20A 3MH2A 5C01A 4QP7A 4G9CA 3FZPA 5LVMA 3HEGA 2VTSA 4X6RA 5FBNC 4II5A 2ITQA 1WVYA 5B0XA 4UMTA 4YURA 3FL5A 5C8NA 3JYAA 4I1ZA 3VS0A 1Q8TA 1BI7A 4DG2E 3A99A 4KB8A 4K6ZA 3ITZA 2XIKA 1OGUA 4PTEA 3G33A 4C02A 4A4OA 4JG8A 4FNXA 3W10A 4E4LA 4BI0A 3SX9A 3ZRKA 3QRJA 3LCTA 2YEXA 2UZBA 5J95A 4OTGA 3QA8A 4AA4A 3S0OA 4ZTRA 4YC6A 4UZHA 5BMMA 4EHGA 3KF7A 2XIZA 3E8DA 4FTQA 5M53A 5A4TA 1CDKA 5GJFA 5LWMA 3SW4A 2UW4A 3TZ7A 5AP0A 4BDAA 3LAUA 5FTGA 5IQGA 4P7EA 4M12A 4TT7A 1OBGA 5HKMA 5JQ8A 3HDMA 4IHPA 4ITJA 1SVHA 3GFWA 2O0UA 4QO9A 5A3XA 3UDBA 5L3AA 1PXPA 3BELA 3WYXA 3EQRA 3CGFA 4MD7E 2ITWA 3OT8A 4ONAA 2IW8A 3SLSA 5AUVA 1W82A 2NP8A 2BCJA 3A7IA 4EC8A 4CXAA 3Q96A 1U4DA 5M44A 2VO3A 1KOBA 3ZC5A 5HO7A 2EWAA 5I4NA 3IG7A 4RQVA 4AE6A 5E8VA 4XG8A 2Z8CA 2IWIA 3D14A 3TIYA 1YDTE 2EXMA 1CMKE 5G1XA 3LE6A 3QU0A 3MBLA 5EW8A 5J1VA 3HZTA 3MVHA 3VBXA 5HCYA 3UTOA 4QTDA 2Y9QA 2RFEA 2UW6A 1YQJA 2XK6A 2ITTA 5IQEA 3NEWA 4GK2A 2KTYA 4FVPA 4E4MA 3NS9A 3UZTA 3A8XA 5CSVA 4DTKA 2Q0NA 4U6RA 1MRYA 1ZZ2A 3RHKA 2P55A 3GC7A 3V8SA 3EQCA 5BUJA 2FA2A 3TKUA 3C7QA 4Q5EA 4U7ZA 3RP9A 5EYCA 3UG2A 3NAYA 4FF8A 4NU1A 5DH3A 4IANA 3QQUA 5FEEA 5IDPA 5BYLA 3NMUF 4O7LA 3W2QA 4ACGA 4D5HA 4BTFA 3S4QA 2XIXA 5DGZA 5KZIA 4WKQA 3CQUA 3FPQA 4CKRA 3KCFA 3MB6A 2ZDUA 2W4KA 4X2JA 3PRIA 3ACJA 4GUBA 2QOOA 4KIPA 3VS3A 5KMJA 5DRDA 1ZYCA 3HNGA 2WQBA 2VAGA 4RZVA 4DFZE 4FE2A 4E73A 2WQMA 4FX3A 5EHYA 5JRQA 3EYHA 5DN3A 3DCVA 4EH6A 1ZYDA 4YC3A 3W18A 5K4JA 2PVMA 1Q97A 5B2LA 1ZOHA 3DKCA 3EZVA 3GP0A 5H8BA 5HTCA 4O38A 5L2IA 3UQFA 3R9HA 4YBJA 4JVGA 1UA2A 4M97A 5JN2A 2RSVA 4ACDA 2AC5A 4Y95A 1O6KA 4UBAA 2CN8A 1XJDA 4EJNA 2PMLX 4D1ZA 2XBAA 4EOQA 5DT4A 1DM2A 5F94A 3KMWA 1JKKA 3CTJA 1TQPA 3W2SA 4PX6A 2NO3A 3MH1A 3I0QA 4CCUA 4DFXE 4EONA 4YZNA 2BHEA 3THBA 3WZUA 5EQEA 3OWJA 1UV5A 3VF9A 2F2CB 1ZY5A 2E9NA 4QOXA 4XUFA 2VWWA 2G2FA 4ZZMA 1BYGA 3RAIA 4O83A 2BZIB 4M66A 4CLJA 3ZONA 3HUCA 1VJYA 3UNJA 3NPCA 5JKGA 5EI2A 3V6RA 3OF0A 3VUKA 4BYIA 5JGBA 1RW8A 3R7VA 4DITA 3LMIA 3FQSA 4BIDA 1LR4A 4HYSA 4QNYA 4FV4A 2VTNA 4A9RA 4JT3A 1ND4A 4GVAA 2YJRA 4BKYA 2QOLA 4UXLA 3H10A 5L6PA 4XHKB 2SRCA 1IA8A 1URCA 2IVVA 3F3UA 3OW3A 4G34A 4PPAA 5TKDA 3ORZA 4C59A 4RWJA 4W9WA 4X2NA 2F57A 4EK3A 4KNBA 4EK8A 5HQ0A 3O23A 3UO5A 2GTNA 2J0MB 3N9XA 4OTFA 4MXAA 3P78A 4LGDA 5CVGA 3W8QA 4AW5A 4RJ4A 1OITA 3TV6A 2ZV7A 1ZMVA 4KAOA 4BDJA 4GK3A 5GZ9A 5HICA 5IA5A 1YWRA 1Q61A 4PMMA 4RGJA 4Q2AA 4KUJA 2CGVA 2W1IA 2A27A 3QUDA 3EQHA 1UU3A 3VUIA 4BCNA 3BE9A 5CAVA 2QO7A 3DXNA 2HK5A 4X3FC 4J71A 3MFTA 4DE4A 4ID7A 3BBTB 3P5KA 3UQGA 2X6EA 3LM0A 2BRMA 4R77A 3EN5A 4RIOA 4UMQA 4F7SA 2G01A 5IU2A 4C62A
chains in the Genus database with same CATH superfamily
2XK8A 2WMWA 3H3CA 1SYKA 2OF4A 2YM4A 1P4OA 5E8UA 4BGHA 2B9JA 3KK8A 5AMNA 3EWHA 5KUPA 4O84A 3VO3A 4FEXA 3DZQA 1W8CA 4MX9A 2X39A 3TZMA 4JIKA 5IDNA 3RM6A 1VEBA 3IW4A 3VJOA 4FUXA 3R04A 2YAKA 3Q9WA 3PTGA 2B9FA 4WHZA 5IQAA 2R3RA 2X7FA 5IMXA 3F6XA 2W06A 3FI2A 4YTCA 4EQMA 3HECA 3RTPA 2PPQA 1K3AA 3UZRA 1NW1A 2ITXA 4LV5A 5I9XA 4HPUE 4WNPA 3EH9A 4EZ7A 2VUWA 5JFVA 3LLAA 4P5ZA 3KXMA 5HTIA 3BHTA 5EW3A 3FI8A 5IQCA 4EK6A 5FUTA 5EDRA 4CGAA 4OBPA 4EOPA 3PPKA 3R28A 3VN9A 3QTQA 4ANBA 4CMTA 4I20A 5M09A 3L1SA 3IW8A 2RG5A 4UEUA 3AGLA 3OFMA 1W2FA 3VUDA 4G16A 2GQGA 3ML1A 3QGYA 4FTCA 4A07A 2A0CX 3QRTA 5J8IA 2XZSA 4YLKA 2W7XA 4AOTA 2BAKA 4BBEA 4EZ3A 4JG7A 4ZSAA 2F9GA 3A2CA 4RWKA 4W4VA 3ZO2A 5IQIA 3K3IA 1WBWA 3LXPA 3H4JA 5IQHA 3GCVA 4QMOA 4OTQA 4OT6A 1W98A 5AP4A 1GIIA 3KA0A 4IB1A 4R8QA 5I0BA 4O1OA 5FWKK 2XP2A 1XMMA 2R3KA 1RE8A 1WVWA 5DLSA 4ZTNA 1Q99A 4EOSA 3ZXZA 4G3FA 3ORXA 3LFNA 4TN6A 3AQVA 3RPOA 4DFNA 3V6SA 4QD6A 2JEDA 1Q8WA 1YI6A 3KN6A 4D2WA 4DN5A 2E9OA 2YLFA 1T46A 4KINA 2W1FA 2CLXA 3R7IA 2BIKB 4I6BA 1G3NA 5DHJA 4C3RA 2BROA 4DFUA 2YIRA 4E1ZA 3DLSA 1ZLTA 5D9HA 5JRSA 4TY1A 3VIDA 5CF8A 3W2PA 4BCQA 2O3PA 2BHHA 4DEIA 3I7CA 2ZDTA 4QNAA 3ZC6A 2YDKA 4NWMA 4ZMFA 5GINE 4IX3A 3OZ6A 4JBVA 2ITYA 1S9JA 2VO7A 4F1OA 2X9EA 3R1SA 5CNNA 2XEZA 3EYGA 3ODYX 2GNGA 1H1RA 2UZOA 2YDJA 3NX8A 5HD4A 4DEDA 4AAAA 3KB7A 2WU6A 4I5MA 4X2GA 4J7BA 4JJRA 2PVRA 2VGPA 3D7TB 2QKRA 2ZVAA 3PZHA 5LVOA 2X8EA 2G15A 3F5UA 3ZCLA 3G9NA 2R7BA 1YRPA 2YN8A 4FSNA 2JFLA 4DG0E 4YJUA 5L8LA 3PY0A 2ETRA 4FIFA 4R7IA 2QI8A 3LFAA 4OTDA 4V05A 5AP6A 2JAMA 3UBDA 3SOCA 3R8UA 4MBJA 2XKCA 3COIA 4MXYA 4O4DA 4U43A 4Z55A 3SG8A 1G8JA 1REJA 2PUUA 1WBVA 2XYUA 2OJ9A 1H00A 4Q9ZA 1BL7A 4PDSA 3VQUA 1H4LA 1W2DA 4PDYA 2H34A 4Y5HA 4H3QA 4ACMA 2OH4A 4IZ7A 4F9AA 4MXZA 2YZAA 1MQBA 4MAOA 2YACA 4IB0A 3AKKA 4BI1A 2W4JA 3H9RA 5E92A 2J9MA 4FG8A 3EL7A 2OIDA 4O4CA 3V5JA 3LQ3A 1XH4A 2VWXA 3NDMA 3FZ1A 3GXLA 3BBWA 2BR1A 4QDVA 3OCBA 1OI9A 3DAEA 5EK7A 4DINA 3FY0A 4FBXA 4WG3A 2EUFB 4Z9LA 2BIYA 5AAEA 3FEGA 4FTMA 5KHWA 3A61A 1E1XA 3TNIA 5K5NA 3ZRMA 4EK5A 3PLSA 1PMNA 5FGKA 3EQDA 3U8WA 4UX9A 1YHWA 2VWUA 4IXPA 3CD3A 4XV2A 2WTWA 2C0TA 3LCDA 2UVYA 3DNDA 5AUTA 3G0FA 1ZOGA 4BBMA 5FBOA 4F0GA 3F3ZA 2VTPA 1ZWSA 3QUPA 4FGBA 1J91A 4U8ZA 2W1CA 4AW1A 4F1TA 3JR1A 5AR8A 3FMHA 4DTAA 2C0IA 4BHZA 3LCKA 4NH1A 3FLQA 5BPYA 1L8TA 3L9MA 3F61A 4PMTA 1XH7A 2CGXA 4YJVA 3EMGA 2LGCA 2VGOA 4E6AA 3UO6A 4BDCA 2W96B 2ZM1A 2C4GA 4E26A 3C0GA 3P0MA 5AFVA 1W0XC 1OIRA 2JIUA 3DBQA 4CTBA 2V0DA 4M13A 4ZY4A 5D10A 5KMMA 2QO2A 1IR3A 2QC6A 3AC2A 3FI4A 3PE2A 4R6VA 4H05A 3ORNA 2VWVA 3V5PA 3COHA 3PPJA 4I4FA 2C6OA 4GUEA 1G8KA 2PZRA 4D9TA 4AN2A 5CZHA 2PHKA 4EWQA 1BMKA 3WIKA 5CEKA 1ZAOA 4FVRA 4FKIA 4UMUA 3PFQA 1U5RA 4P90A 2QNJA 3A4OX 4PDPA 3QC9A 4ZJJA 4O86A 3MY5A 3ET7A 4GMYA 4IVAA 4U3YA 5F1ZA 3S1HA 3E92A 3Q32A 4LOPA 4FKGA 4NM0A 1VYZA 3QD4A 5AR4A 3II5A 4C8BA 3GCQA 4IW0A 3ORLA 5HIBA 2PY3A 1WVXA 3MY0A 4X3FB 2ZM3A 4OR5A 3GFEA 4QTEA 3NRMA 4C0TA 5K9IA 3HMMA 1YHVA 2OFUA 3H30A 4MF0A 1YWVA 4M8TA 4JBQA 3WF6A 3O0GA 3F7ZA 3LZBA 4FTLA 4U45A 4R1YA 2XYNA 3ZLXA 3BLQA 4HOKA 4FKOA 2WTKC 4FODA 5E8XA 5KE0A 5L6WL 4E93A 3OEFX 4YTFA 4RC2A 1L3RE 2YAAA 5IISA 4LV7A 4X2KA 2XRUA 4S34A 1Y57A 2DYLA 4R5SA 3R7UA 1R0PA 4QQTA 2CSNA 4S33A 3VBVA 3NW5A 3Q53A 3KXNA 4CV8A 1Q3WA 2QO9A 2ZOQA 5EFQA 4DFYA 1OIUA 1Y8YA 2QD9A 4FTIA 4JLCA 5LMBA 3QCYA 3OVVA 4CNHA 2QLQA 3NFGB 3MFSA 3P5JC 1Q8YA 5FG8A 1J7LA 1PKDA 4YPDA 4W4XA 4KABA 5IKWA 3HRBA 2GS7A 4FK6A 3K2LA 1H26A 2C68A 5A4QA 3JS2A 2I1MA 3QA0A 4BBFA 1R3CA 2QU5A 3W0MA 5KO1A 2OI4X 3NLBA 3KCKA 5D11A 2GQSA 5HIEA 2XARA 3MTFA 5ANEA 5HU9A 2J51A 2JD5A 4BCJA 5KBRA 4FIGA 5IH4A 2BILB 4TPTA 2OFVA 5AIKA 3S2PA 3HX4A 4O2PA 5E90A 3UC4A 4BWKA 4PPCA 4FZAB 4DDGA 4RLLA 4MK0A 5IA0A 4GFMA 3E8CA 4N6YA 4S32A 3VS5A 5EM8A 4EH8A 4FI1A 3HV4A 3ATTA 4IC7A 3MESA 3QZHA 4M69A 3TIZA 3ORMA 3EQBA 3NUAA 3SDJA 2X8IA 3Q2JA 2I0YA 5ETCA 3D2KA 3W8LA 5I9ZA 3O5AA 4QDEA 4MNEB 5IUHA 2VTAA 4FRFA 2XMYA 3GQLA 4EOMA 1WAKA 2RF9A 2OXYA 4O81A 3OCSA 5CYIA 4K9YA 2QR8A 5M4FA 1IRKA 4AGWA 1FGIA 3TI1A 2CNVA 3AMBA 4FKRA 4BCFA 3S95A 4HZRA 2W5HA 2IG7A 4ZS0A 2ETMA 4ZK5A 4FG7A 5A4LA 4JR3A 5FM3A 4OTWA 2ZFYA 3QRUA 4FMQA 4QP2A 3EJ1A 3O8TA 4JX3A 4YMJA 2BDWA 3MIAA 4BL1A 4O7RA 3OXZA 2GMXA 3ULZA 4BCGA 4MTAA 3P1AA 4D2SA 3DTCA 2V5QA 3FSFA 3U4UA 1QCFA 1ZY4A 2PMIA 3BYUA 3HKOA 3Q9YA 2YIWA 3WF9A 2HELA 3BV2A 4RWLA 4CYJA 4UMRA 2VWBA 2OKRA 3IK3A 2GHLA 3ORTA 4EKKA 3PDTA 4PMPA 2XNEA 1DI9A 3LCSA 5DWRA 2WMSA 2B9HA 2WHBA 5ICPA 4CQEA 5FTOA 4QYGA 4RFMA 1O9UA 3PJCA 4EHVA 2VTLA 5J1WA 4IZYA 5KKRC 4IVDA 4HCVA 4QMXA 3PVWA 4EH3A 1OBDA 5CS6A 1TZDA 3KVXA 5LVPA 4TYHA 1HCLA 4C33A 3O17A 2IZSA 1JPAA 3U51A 4TW9A 4NIFB 3P4KA 1SVGA 3KRJA 3VJNA 4CRLA 4NL0A 3DK6A 3NUPA 2OBJA 2J5FA 3FPMA 4RWIA 1YOMA 3QZGA 3UMXA 3NIEA 2CCHA 4AA5A 4RVLA 2W1GA 4BKZA 5JQ5A 4DC2A 4PUZA 4XRJA 4CFWA 5HG9A 4W4YA 5IMEA 5IQBA 4YJNA 5BVEA 4RX7A 4PP7A 5BYZA 4V01A 2QG5A 1H0WA 4RBLA 5H9BA 4OT5A 4GJ3A 1H08A 3TM0A 5BUIA 3R8VA 4YTHA 3ZM4A 4JBPA 4CFNA 3NUUA 4D5KA 2WOTA 3ZS5A 4J99A 2W9ZB 4HGTA 4FTTA 5IEVA 3FHRA 2J50A 4NKAA 5L8KA 2JC6A 4BRXA 2ITUA 2WMUA 4IACA 1U46A 2UZDA 2R3QA 3NUYA 3QTRA 3GU5A 3GU7A 4B7TA 3RPYA 4ZJVA 4BDGA 1GZOA 4MEDA 3FSKA 4G31A 4IWQA 3FAAA 5HO8A 1GIHA 3KVWA 3QTXA 2J90A 3HP5A 3U9CA 3U6IA 4AGDA 2FB8A 3U55A 4PWNA 3PVUA 3TN8A 4BZDA 3DKOA 2QLUA 2GPHA 5CU4A 3BYOA 5A46A 4WIHA 3L9LA 1ERKA 4UWCA 5EQPA 3FYJX 4V0GB 3FZRA 2PL0A 4FSQA 5AR7A 1YI4A 4DGNA 4IX5A 1ZXEA 3TEIA 4J52A 3VUMA 3NNXA 3QXPA 2XM9A 5EI8A 1IAJA 3PJ2A 3I7BA 5BYYA 2JBPA 5EKNA 4DHZA 4PV0A 2B9IA 4I92A 2C0OA 3VNTA 5BMSA 4YSMA 3QD3A 4BJJB 4O27B 1PKGA 3D5VA 4FKQA 1XH6A 4QP9A 4OTIA 1M7NA 3WZDA 5H3QA 4L45A 2YDIA 4I6HA 4R7HA 2BKKA 1JAMA 3QX4A 3HUBA 5CTPA 4CSVA 4FTAA 4O7WA 3QF9A 4QYFA 3MPMA 5ANDA 3TT0A 5CI7A 5AM7A 3VRZA 1UWJA 2PE0A 4RC4A 3L8XA 2I0HA 4P5QA 5LQFA 3AXWA 4RVKA 5DR9A 2YWPA 5F95A 3TNQB 2O5KA 4BDBA 3DU8A 5CY3A 2VX3A 3ENMA 4P4CA 4G6NA 3IKAA 4WD5A 5CALA 5CANA 1T45A 3EFKA 4EWHA 4O7ZA 4U42A 3P7AA 1LP4A 4EOKA 5CASA 4ZSJA 2C6EA 2G1TA 4AGUA 3NCGA 4DT9A 3LVPA 2VTJA 4YO6A 3UP2A 4BVUA 3IGOA 5AV3A 3VBQA 1OL2A 4EZ5A 4O7TA 4DDIA 1JNKA 4G3EA 3MTLA 2HWOA 3QCXA 4O7YA 2WTKB 3VS4A 1NA7A 2IJMA 5CAQA 5HLNA 3BGQA 3DK3A 3PA4A 3QD2B 5KMIA 3LFBA 5CI6A 4YZMA 3TKHA 3LFQA 3POOA 3BI6A 4FV1A 1X8BA 4BIBA 4U3ZA 4I6FA 3Q4CA 4E4NA 3AD4A 3QLGA 2PTKA 1XBAA 3F7WA 5HLPA 2C3IB 4F0FA 5AA8A 3UG1A 3UVRA 3HV3A 2WMQA 5E7RA 4QP8A 1H07A 4GK4A 4D0XA 4NM7A 2J7TA 4CZTA 4XG9A 4ENYA 5CEIA 1O6LA 4PF4A 3W0SA 3V8TA 4C37A 4C57A 1B6CB 1Y91A 2BTRA 3NZ0A 4QMYA 5FRIA 3RNIA 5HNIX 3R1YA 4ITIA 1KE9A 2J0IA 4GU6A 4BHNA 4O4BB 5DT0A 4YNOA 2J0LA 3VUHA 3DB8A 4WO5A 2GTMA 4JDKA 3VUGA 4ENXA 2CNUA 5JH6A 3FXWA 1BKXA 3DZOA 3FLSA 3HMOA 3RMFA 3UC3A 4AZFA 2PMOX 1WMKA 2YCSA 3Q3BA 4E4XA 4G5JA 3BWFA 1JSTA 3L9PA 3DS6A 3ZUVA 4NM3A 4QYEA 3WARA 3ZDUA 1YKRA 1V0BA 2BVAA 2YA9A 3OBGA 3QTZA 3F9NA 4IVCA 4X3JA 3R9DA 4QP4A 4AZSA 4D2PA 3FMEA 5EM6A 3AMAA 3TWJA 2W17A 2OW3A 3F3VA 4WRSA 2F49A 1BUHA 1XH5A 2P2HA 4NEUA 2JDVA 4C38A 4I41A 4F64A 3MFUA 5ANOA 4JL9A 2GNLA 4FV2A 1NVQA 4ITHA 4Y85A 2GNJA 2JKOA 4FICA 4I21A 1M17A 4AZVA 4BR3A 4KKEA 4QYHA 3BL9A 5LOHA 4KSPA 4L46A 4RX8A 5AA9A 2X9FA 3DDPA 3QQGA 4NZWB 5FXSA 2WOUA 3F3TA 3O96A 4DH7A 5ANJA 1KE5A 4W9XA 4RIWA 4BTMA 4WUAA 1SNUA 2GFCA 3KFAA 1KE6A 4S31A 2ERZE 2PZ5A 4GW8A 1BL6A 3DFAA 5HD7A 3T9IA 4QMQA 4XH6A 2YWVA 2X4ZA 3PJ8A 4HZSA 3VC4A 4I6LA 1Y8GA 3ZO1A 4BKJA 2C6IA 2C1AA 5JSMA 2R3GA 4CG8A 3JUHA 1RQQA 2BDJA 3QKMA 4HGEA 4YO4A 4RJ7A 3IGGA 1UWHA 3UGCA 4ZLZA 2WMRA 2XK4A 5C1QB 5KKRB 2OSCA 3QHWA 2PVLA 4AU8A 4QQCA 4YZ9A 2NYAA 1STCE 4G1WA 5I5ZA 2YHVA 2BZJA 3EHAA 1R39A 5CXZA 1FVTA 4XP3A 4AW2A 3GT8A 4D28A 5HCZA 4U80A 1VYWA 2GNIA 3IS5A 4DCAA 4JMQA 2CPKE 4ZSGA 4BICA 3KXHA 2V55A 2RFSA 4LFIA 5CX9A 3UE4A 2XANA 3TXOA 4IB3A 4AT4A 4C36A 4F9WA 5HX6A 2CJMA 3R2YA 5KHXA 5KMOA 2UZLA 3KK9A 2ITOA 4O4EA 3RKBA 4MBLA 1PMUA 3HGKA 1ATPE 3BQRA 3U87A 4EBWA 3UIMA 2Y4IC 2OH0E 3FL4A 2BZHB 4Y5QA 5DR6A 2XKDA 4C4EA 4QMNA 5AEPA 4UB7A 3R8MA 4LOOA 4ZSLA 4ANLA 2V62A 5CWZA 3R8ZA 3D15A 3OOMA 5FDPA 1GZNA 3PVBA 4JI9A 4YHFA 3M1SA 3PJ1A 4Y83A 2X7GA 3Q60A 2UW8A 1YOLA 2IZTA 3LJ2A 4A9SA 3R1NA 1OM1A 3D2IA 3FYKX 4C4IA 3MPAA 3FDNA 3RGFA 5JZNA 4B9DA 5GZAA 4IQ6A 4ANNA 2W5BA 4YLLA 3TMOA 2PVJA 4JBOA 4F65A 4D4YA 5DOSA 4XV3A 3V5LA 4D4SA 5KZ0A 4DLJA 1OPLA 5DPVA 3VRYA 4AAYA 4FZ6A 1GZ8A 3VBYA 3ZDIA 3SXSA 3QLFA 4EYJA 5IH5A 3FZTA 3ZMMA 4I0TA 4JDIA 3UIXA 5AP2A 4BDKA 4C34A 1OMWA 3OEZA 5CSPA 1OGYA 2R3OA 3AC4A 2H9VA 4EH2A 4U79A 2O65A 4DHIB 3QQJA 3R63A 5K5XA 3F2RA 3ACKA 3TYKA 1PMEA 3FMNA 5FP5A 3LFSA 3DKGA 2B4SB 4UZDA 5E4HA 5FQDC 2WKMA 2E2BA 3JVSA 4Z16A 2WQNA 2Z7SA 3NCZA 4GFOA 2F2UA 1PXJA 2BMCA 5HNBA 3AT3A 3B8QA 5AV1A 4G6LA 3UPXA 4FSZA 3C4FA 4XP0A 5CAUA 3QRIA 4L3LA 3MIYA 4IE9A 3CE3A 3LOKA 3LFCA 3DK7A 3O2MA 3F2AA 3ZUUA 4XV9A 2YM6A 4K11A 4YP8A 3M42A 4G3GA 4LV8A 4AN3A 2PUNA 2J0KA 3KXXA 3TTIA 4CD0A 2X7OA 3HA6A 3P9JA 2JBOA 4YGAA 1PW2A 3GENA 4FNYA 4JRNA 4M3QA 4ANSA 2XIRA 3RNYA 5DYJA 1OVEA 1KV2A 2IVTA 2YFXA 3KKVA 3LFDA 5IEYA 3P79A 4O1PA 4FSWA 2QOCA 4CLIA 2VTOA 5HCXA 3PP0A 2OZOA 4IADA 3EZRA 3WBLA 2REIA 1OUKA 5L2SA 3JY9A 5M4CA 3R2BA 4WBOA 3SKCA 3EIDA 2P0CA 2ITVA 2AUHA 3A7HA 4RIXA 4QQJA 1R1WA 4FT0A 4GSBA 2I40A 3SW7A 2WIPA 3UPZA 4FV5A 3QL8A 1QPEA 5JFSA 4RLKA 4XBRA 5DVRA 4AXDA 4FZDB 2JKQA 3PUPA 1BLXA 2CGUA 5ETAA 2Y6OA 3TNHA 4FT7A 4MXXA 4BFMA 3D5WA 4AOIA 2GSFA 2C6MA 4XG7A 5DFPA 4AZTA 1IA9A 5EYDA 1ZYJA 4GCJA 5J9YA 4NYEA 4IVBA 4CTCA 2CDZA 1H28A 3OCTA 3HAVA 3OROA 4G9RA 2QOBA 3CQEA 4PMSA 4Y46A 3R7YA 4F6WA 1Q8ZA 4QMUA 3EKKA 4DCEA 1Y6BA 3DLZA 4NUSA 5GNKA 5J9LA 3DGKA 3C4EA 3RWQA 3ZSGA 4X2FA 3LM5A 2YZLA 1WCCA 5M06A 4DTBA 3OTUA 5HHWA 2G2IA 5GJDA 4ACCA 3GC0A 3DBDA 3AG9A 5KNJA 3UDTA 2C6DA 1PY5A 5ANIA 3SG9A 3V5QA 4UYAA 4M14A 3I79A 2X0QA 2OLCA 2VTHA 4BZNA 3ZH8A 4ZLYA 2VN9A 5IZFA 2WTCA 5CU2A 3OCGA 2E9VA 2VWYA 3W1FA 3W2OA 2DQ7X 5A4EA 3PRFA 5H8EA 5F9EA 3ALOA 1W84A 4WBBB 4YZDA 3MY1A 2HOGA 2A98A 2ACXA 3SXFA 2DUVA 2XJ2A 4N4SA 4QMTA 5FDXA 5EQYA 3L8VA 4A7CA 4B6LA 5BVDA 2X0GA 3EN7A 3I6WA 1YI3A 3ZOSA 2PVKA 3U4WA 4LDTA 3HV6A 1JQHA 2VU3A 3Q4TA 3EQIA 5CXHA 2QKWB 3RK9A 5HORA 4DF3A 1M2PA 4AT3A 4MF1A 5IQFA 4I24A 3NNUA 4FKVA 4Y73A 4CEGA 3TDWA 1JBPE 3PXKA 4H39A 5AX9A 4J98A 2H6DA 5IH6A 3MVMA 4ZAUA 2F7EE 5TR6A 3D83A 4GRBA 4OUCA 5C4LA 2HXLA 4L7FA 4HYIA 3MA3A 4L43A 4D4VA 2QOFA 5M08A 3UVQA 4RFZA 3FKOA 1QPJA 4NCTA 2Y8OA 3PIXA 4JOAA 4NFNA 2BFYA 2IN6A 2X2KA 3EB0A 3ZO4A 3ORPA 3ORIA 1V1KA 2C6LA 3FLWA 3UP7A 4D2RA 3TUDA 3DNEA 3FMMA 4K2RA 4KA3A 1Z5MA 3RZFA 2XCKA 3SOAA 2XH5A 3W33A 1JKSA 3NNVA 3DV3A 4UY9A 5IA1A 3KXGA 4APCA 3EFWA 1TVOA 4MQ1A 5TOZA 4JAIA 4YJTA 1YXSA 3A7JA 2VRXA 3POZA 3VS1A 2XKFA 5I9VA 2PE1A 2XNOA 2F7ZE 2XEYA 4KRDA 2PK9A 5BV3A 1XQZA 2WQEA 5AUUA 4YJQA 4CMUA 4J8NA 4CVAA 4J95A 3NUSA 2HYYA 5F4NA 2Q83A 1TQMA 3HMIA 4L42A 4UYNA 5CQUA 5E91A 3ZO3A 1I09A 2C3KA 4MBIA 3BKBA 2J0JA 5IEXA 2UV2A 3ZU7A 2P2IA 2Y4IB 4DAWA 3RPVA 4BDHA 3FZSA 4F9YA 4GT5A 4QPMA 3V3VA 1XWSA 3G90X 4TKSA 3JXWA 3BHVA 5LXMA 4BCKA 3HLLA 2B55A 2QOQA 2R3LA 4X0MA 4HVIA 2WMXA 4P2KA 4RT7A 3UYSA 3EL8A 3HL7A 3L8PA 3R30A 2BAJA 4KIQA 4R3RA 4L6QA 4TYJA 5J7BA 2OJIA 3CJGA 2JGZA 3F2NA 3PWDA 2B0QA 3D5UA 1Q5KA 4E6QA 1M2RA 3VHEA 1FMKA 3KN5A 3F69A 4BDDA 3LJ0A 2W4OA 3HDNA 5CU3A 5AR5A 3NYNA 1PF8A 5J79A 5J5SA 3EQGA 3PY3A 3LIJA 4AXAA 1UNLA 2HZIA 3E8EA 5CU0A 4QMVA 1V0PA 2DWBA 3QGWA 2JKMA 1B38A 3MS9A 4IFGA 3RZBA 4BCPA 5IA2A 1J7IA 1XBCA 3GCSA 4L9IA 3ZSIA 1ZZLA 2QOIA 2G2HA 3V5WA 4FL3A 3TV4A 3DT1A 2VO0A 5KX8A 3QCQA 5TT7A 1UU9A 2QR7A 2V7OA 2UW7A 5I3OA 4WSQA 4MD8E 4RIYA 4C2WA 4GG7A 4CV9A 4JX7A 4USEA 2X8DA 4GS6A 1S9IA 3BHUA 2FSLX 3Q04A 4FIHA 3GI3A 4EH7A 1MQ4A 1PMVA 2PSQA 2EXEA 4O7SA 2UUEA 2UZNA 3ETAA 3RK5A 2BALA 2FO0A 3CY2A 4R5YA 3ZFYA 3SA0A 4OAVB 3IONA 4WUNA 4KIKB 2I0EA 3PSDA 4OBOA 3R71A 3QQKA 2ZM4A 4BY9E 3VULA 2PUPA 3D0EA 1CKIA 4RJ5A 2WMTA 4XMOA 2BRBA 5LCJA 4FNZA 4YSJA 3VS7A 4FV6A 3MVJA 5CSXA 5LMKA 3OP5A 3FLYA 1AQ1A 2O2UA 3E63A 3I5NA 3MI9A 2IZUA 3E5AA 2X1NA 1E9HA 4OGRA 4TYEA 3V51A 3U6HA 1OB3A 3R1QA 1WBOA 4FTKA 2FYSA 1Q62A 2OIBA 2XK3A 4BC6A 4E5AX 1Q4LA 3E7VA 5ETIA 2WB8A 3IW6A 2XVDA 2ZYBA 5FXQA 5HBJA 5AAGA 2W9FB 3Q5IA 4TZRA 3E62A 3GVUA 3ZUTA 2OJFE 4X6QC 3AC8A 2YLEA 3BU5A 1W83A 2XKEA 3TJCA 3E7OA 4Z3VA 4EC9A 4L3PA 4HYUA 5AX3A 2ERKA 3NW7A 4CCBA 4C58A 4MYGA 4DH1A 4EUUA 3EFLA 3MV5A 4KKHA 5AP7A 2R9SA 3S3IA 3MW1A 3ANRA 1K9AA 4YZCA 4F7LA 4TRLA 3A8WA 2JKKA 4FEQA 5C26A 3PXFA 4Q5HA 3KQ7A 3C4ZA 1OKVA 4GYGA 3PA3A 5L2WA 3QZFA 2YISA 2PZYA 1W2CA 2WIHA 2FUMA 5FXRA 3NUXA 3AC3A 5FLFA 1H25A 3LW0A 1TQIA 2Z7QA 1SNXA 4F4PA 5T68A 5ITAA 3AKJA 2QVSE 4FIIA 5FM2A 2XK7A 4Q9SA 2CKEA 2ITPA 3SGCA 3QC4A 5EM5A 4ASZA 1PXOA 3DB6A 4QPSA 4EQCA 1XO2B 4O4FA 4EOLA 5HG7A 3FC1X 2B53A 4HYHA 2EVAA 4IFCA 1KE8A 1WBPA 2HZ4A 4FZ7A 3ZBXA 3BL7A 1O6YA 4FJVA 1OECA 2HCKA 3CC6A 2VTQA 4L3JA 5EHOA 3PZEA 3RPRA 4K1BA 1NY3A 3ZEWA 5EW9A 3BHYA 3PSCA 3SV0A 2YJSA 2XA4A 2YIQA 3D5XA 4F1MA 4AFEA 4GU9A 1P4FA 3DBCA 5BVFA 3JVRA 1PYXA 2BRHA 2WAJA 3NSZA 3EN4A 5K3YA 4DEGA 4F7NA 3NYVA 3C1XA 4ZS4A 4CT1A 4ZTQA 4I5PA 1Y6AA 3F5GA 4RA4A 2EU9A 4BZOA 3BCEA 2Y0AA 3P86A 4GFGA 4I5CA 5AV0A 4NSTA 4A4LA 4AF3A 4H36A 4U0IA 2VZ6A 3F5XA 3IECA 4DEAA 4KS7A 4OTRA 4FV7A 5CF5A 4G17A 4RX9A 2Z02A 3G0EA 2HY0A 3N4TA 4I0SA 1FVRA 3AT4A 3A60A 4QYYA 3TTJA 3RAHA 5HZNA 2ITNA 4XV1A 3EKNA 3WIGA 2R5TA 3QZIA 5HTBA 2CKOA 5AIRA 3IDBA 1SM2A 3GCPA 4IAFA 4Z7HA 4AG8A 2ZJWA 3ULIA 4FYNA 3UNKA 4LM5A 5AR2A 3FHIA 4BWXA 3E8NA 4HW7A 3BYVA 4BGQA 2PVFA 2OU7A 4ZY5A 5JK3A 4TNBA 4O0YA 3OS3A 4ALVA 4I22A 4K8AA 3O51A 2JDOA 3EN6A 4NK9A 4RJ3A 4JNWA 2W5AA 1A48A 3HV7A 3QYZA 4JQEA 4QMPA 3LLTA 1UKIA 5EM7A 5EYKA 3SD0A 3W0PA 1MRVA 2OXXA 2X6DA 4QP3A 3UVPA 4B4LA 4E3CA 5HVKA 1FBNA 5HE2A 3COMA 3O8UA 2ITZA 4FKSA 3QKKA 5E8ZA