2GTNA

Mutated map kinase p38 (mus musculus) in complex with inhbitor pg-951717
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The development of novel C-2, C-8, and N-9 trisubstituted purines as inhibitors of TNF-alpha production.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 105
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gtnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gtnA01
4IAIA 3QBNA 4QYFA 4UWBA 3ORIA 4G3DA 4HCTA 4PF4A 4QTEA 2R3PA 5HBJA 3CS9A 2C5YA 1HCKA 2OH4A 3BGQA 4U79A 5LJJA 5IQIA 5KKRC 4D4YA 4A9RA 2OZAB 4WSYA 5TT7A 4BCNA 4KNBA 4F09A 1ZMVA 4B99A 5ANDA 2O63A 1Y91A 3JPVA 5AM6A 3SG9A 2QOHA 3PA5A 1PXMA 4FK6A 2O0UA 3H0YA 3ORNA 5BVWA 2WMXA 1LPUA 3GBZA 3BQCA 3R73A 3LZBA 4X3FA 5AX3A 3CD3A 3ZC6A 3GCSA 4CNHA 2FSTX 1GOLA 2R0UA 5BVFA 4P7EA 5HIDA 4H39A 4MAOA 3W2RA 4JQEA 4JJRA 5FBNC 3RHXA 4D1XA 4RX5A 4Q9ZA 3LOKA 5LMKA 3OG7A 3O7LD 2C5XA 4PMSA 3QX2A 4KIOA 5J1WA 5LQFA 3FI4A 3QLFA 5IUGA 1B6CB 4EK6A 1NA7A 4GJ2A 4KBKA 5IKWA 4O82A 5CEMA 3FLYA 3AC4A 1TQPA 3NYOA 3ZBFA 3QQGA 3RVGA 3HAMA 1YXVA 3IDBA 3O8TA 3P7CA 4I4EA 3OC1A 4JBPA 5DG5A 1H01A 1A06A 1WBNA 4RQVA 4DH3A 4BKZA 1OZ1A 3C0IA 3SD0A 4PPBA 2BDFA 2OKRA 3CXWA 3GU8A 5KMLA 5AIKA 5M53A 3DXQA 2PVHA 2XNMA 3UE4A 1PXPA 2ZB1A 3E88A 3FKNA 3Q3BA 4O91A 4RC2A 4TRLA 1CTPE 4CQGA 3HRFA 1P2AA 1YW2A 3MSSA 4FZAB 3MGYA 4N4SA 1APME 3PPKA 5BYZA 4BCIA 2OFVA 3HZTA 3NMUF 3MPAA 3RM7A 1WFCA 3A7HA 3R01A 4DG0E 3FI8A 3F7WA 3KK8A 4QTBA 2O64A 4PL4A 3LFNA 3POZA 4JQ8A 5CEQA 2QOLA 3VBYA 2CSNA 4QYGA 4ZK5A 5EKNA 2VTLA 2CNVA 4CG8A 4NTTA 5DOSA 5EOBA 2BILB 3EZVA 1FBNA 3K2LA 3SQQA 4AW2A 3EZRA 5DMZA 5C4KA 2PY3A 3O17A 3ZM4A 2YIYA 3KVWA 4BZDA 4Y46A 2PPQA 3NCGA 3PIZA 4FR4A 3EL8A 5AP2A 4GIHA 2YDKA 1MQBA 3ZRMA 3EN7A 4AN3A 1H1PA 1G3NA 4WG3A 3AC3A 3M1SA 4FG7A 4FKOA 4KIKA 4YBKA 4UZHA 5D7AA 4FV0A 5E8TA 3NUXA 4F99A 1FGKA 4BIDA 2A27A 4XG6A 4FTOA 4MXXA 2I1MA 2HCKA 4FUXA 1QL6A 3S2PA 2WGJA 2V62A 3KL8A 3R30A 4RJ5A 5IEXA 4BIEA 2JKMA 4QMPA 4XEYA 3KA0A 4AT5A 3ZO3A 5T3QA 3ZDUA 2CKPA 4F4PA 1VR2A 4G3GA 3GT8A 4CYIA 1YXTA 4TYHB 3UOLA 4HVDA 4O0RA 4U7ZA 2YWPA 4M0ZA 1B38A 2R3IA 3MA6A 3R00A 4JT3A 1R78A 1V1KA 2JFMA 4L43A 4CMTA 4IDVA 4IAYA 3EJ1A 4C37A 2PSQA 2CCIA 5CF6A 1H4LA 4CGAA 4I23A 1UA2A 3BYUA 3FLWA 4FNZA 4IWOA 5DWRA 5C9CA 3R83A 4XV3A 3UVPA 5DRDA 4EQCA 4ANBA 1W7HA 5KE0A 2ZM4A 3FMEA 3HEGA 3EFKA 1YHWA 4J99A 2Y6MA 5EHOA 4PTGA 4GFGA 1RJBA 3NAXA 3OY3A 4I24A 2YJRA 4JNWA 4QTCA 4RIYA 3E3PA 4WHZA 2VNYA 2VWUA 3L8SA 3WARA 3FZ1A 4CT2A 4XOZA 3I79A 3TZMA 4E6CA 5LVPA 4RIOA 2CCHA 3GUBA 3FUPA 3ORXA 3NIEA 5EHLA 3WE4A 2ITNA 2YLFA 3GC8A 4DFXE 4F1OA 1T46A 2VWIA 5E92A 4B6LA 2GS2A 5LXMA 3MB7A 3E3BX 2BRMA 3G9LX 3MDYA 1R39A 4RWIA 4BL1A 4PP7A 4O7YA 3DLSA 2XJ0A 3LXNA 2C6MA 4ONAA 3OEZA 3L8PA 4FTJA 4G1WA 4D2VA 2QVSE 2ZMCA 4ZLYA 3LLTA 3IGGA 2HENA 4C3RA 2OJIA 1ZY4A 4KKEA 5ITAA 1DS5A 1U54A 3COKA 5B0XA 5DYJA 3PRIA 2C3JA 2F4JA 4RWLA 4F9AA 2Z60A 3KCFA 2J51A 4X2KA 2WTKB 1YOLA 3NW5A 3PZHA 3RPRA 4HVHA 4CFFA 4GSBA 5IG1A 3CE3A 4YR8A 3UQGA 4ANLA 4GU9A 2W9ZB 4IIRA 1OKZA 4FK3A 3BKBA 4FV9A 4KBAA 5I3OA 1G8AA 4LOPA 1XH5A 4CG9A 5DNRA 5L2WA 4G2FA 3IW6A 4K9YA 3VW8A 4BN1A 4C35A 5IQDA 3F9NA 3KULB 2X2LA 2IVVA 3Q96A 4FG9A 2W4JA 4IQ6A 4ITIA 3Q2MA 3CD8A 5CNOA 2J90A 4D55A 4QMTA 3QD4A 4ZEGA 4YTIA 4GYIA 4UMRA 1UNLA 4A4OA 2X7GA 3CJFA 3Q60A 4IZ7A 1FOTA 4BCHA 5IA4A 4GVAA 2C5NA 4F0IA 3V3VA 3ZO1A 4MNFA 2YZLA 2JAVA 4USDA 4GH2A 5CVFA 3MW1A 4H1MA 4UB7A 3GGFA 5K0KA 4U97A 4BFMA 3ETAA 1AD5A 3H0ZA 3T3VA 3I5NA 2NRUA 4FSTA 4O86A 4MXAA 4R5YA 4R8QA 4FKVA 2J6MA 4I93A 5CF5A 1PMVA 1WVYA 5CF8A 2XNBA 3K3IA 3AC1A 4B9DA 4CFVA 3DOGA 3FLSA 3QCXA 3F7ZA 3SOAA 3EB0A 4ZLOA 5F1ZA 5LWMA 2V22A 5M4IA 2X8DA 5LVOA 1XQZA 4AA4A 5IQCA 2VTRA 1Q97A 4XP3A 2Q83A 3HA6A 4AN2A 4CRLA 2DS1A 2C4GA 3CPBA 5EM6A 4ACMA 5E8WA 5EQPA 2VWBA 4KABA 4X2GA 3FXZA 3VBXA 3GQIA 2QOBA 4RFMA 4QYHA 3MYGA 3BLQA 2BRHA 5G1XA 4DG2E 3LIJA 2YM6A 5CAQA 4IB5A 3MV5A 1IRKA 5ICPA 3AT2A 3V5TA 4FIGA 5E91A 3R7YA 2YDJA 5BVKA 4OTQA 1XO2B 4XCUA 5CWZA 2PE1A 4FIJA 4I0TA 5HD7A 4DYMA 2PUIA 3T3UA 2DQ7X 5M07A 4FTTA 4EI4A 4LQMA 3ZLWA 4ZTMA 3S95A 3JVSA 4IXPA 3MH1A 4K6ZA 2WD1A 3SXSA 1QPJA 3ERKA 2CN5A 3A99A 3OUNB 4HGEA 3EN5A 4DN5A 4ZY6A 3PE1A 4YC3A 4ALUA 4FV3A 3JR1A 3FL5A 2C0OA 1H0WA 2RL5A 4YZNA 3GU5A 2H6DA 4M7IA 5AP1A 4BI0A 3DTWA 1GIHA 2R5TA 3NNVA 4R3CA 4FKJA 4FT7A 4IX3A 3U8WA 1FMOE 3UMXA 4YU2A 3KGAA 3BV2A 2A19B 2JITA 1S9JA 4FSNA 4BCQA 3O0GA 4YUQA 4ZMEA 4BICA 1OUKA 4IMYA 4F9CA 3KF4A 4RX9A 1REJA 3BU5A 3NS9A 5FXRA 2VX3A 5AR2A 3V5JA 4KA3A 4BWXA 5E4HA 3HUCA 3AD4A 3B8RA 3OWKA 4BI1A 4BTJA 3FSFA 4LYNA 3EHAA 4JRNA 5K5NA 3L8XA 3NNUA 5CU0A 4O84A 2WNTA 3LXPA 1KSWA 3IG7A 4NFMA 4BGHA 4C36A 4G17A 5AP7A 3UG2A 3VQUA 4AA5A 2YM3A 5IUHA 3QALE 5DI1A 1ZYLA 4QP6A 4FIEA 2HOGA 4HCVA 4G16A 3SW4A 2ERKA 2WTJA 3QRTA 1KV2A 4GCJA 4ORKA 2YM8A 3IQ7A 3GU6A 4DCAA 5H2UA 2ZV8A 3DS6A 4GK2A 3Q4UA 2G2HA 2XKDA 4CV8A 2GTNA 4M68A 4FOCA 4UALA 2XIZA 1W84A 4FOBA 2Y7JA 2GSFA 3I7BA 4HPTE 4YLKA 1UNGA 2HZ0A 5J7BA 4HGSA 3GENA 3R02A 5I9UA 4FEWA 2YAAA 4L01A 4Q5HA 4NJ3A 1VJYA 4PL5A 4WKQA 4HVSA 4RIXA 3TNWA 4IAZA 5IQGA 2RG6A 4MD8E 2XKEA 3OZ6A 2VWYA 2ZB0A 4NIFA 4W4VA 3UC4A 1ZARA 2JDSA 1GZKA 4R6VA 2O8YA 4P2KA 1BUHA 4KS8A 2CNQA 2UVYA 4WO5A 2C6EA 5I0BA 4GJ3A 3GU7A 3R28A 4JIKA 3RWQA 2ITVA 4TYEA 3C4WA 4FTQA 3I5ZA 3BWJA 3K5UA 2QO2A 3BHVA 5H9BA 2WMWA 2Z7SA 3TJCA 4FZDB 4YPSA 2O65A 3KCKA 5EH0A 4MBIA 3QGWA 3EQPA 1O9UA 4L9IA 3PLSA 3JY9A 3QUEA 2RFNA 3KFAA 4P90A 1W82A 3PUPA 5GINE 3PE2A 1H08A 4JG7A 4KSQA 5AWMA 2XS0A 2W5BA 4U3YA 3S3IA 3UMWA 4EH7A 4EHEA 5GJGA 5ANOA 3D7TB 4QNYA 4BTFA 3D2IA 4EWQA 4BCOA 3P1AA 2IZSA 1GZOA 3C4EA 2CDZA 1JLUE 3B2WA 3OCBA 4QP4A 1M2RA 4KD1A 4DH7A 4J7BA 5CEIA 3BHUA 2I7QA 2W5AA 3NAYA 4QRCA 3N4TA 1E9HA 1YDTE 1ZYSA 2OJGA 3VUKA 4FE2A 4LM5A 5FTGA 4NH1A 2YACA 2CLXA 3LJ1A 4RJ3A 3QZIA 3D14A 2ZDTA 3EOCA 3BEAA 3NLBA 4IVBA 5I9WA 2W0JA 2VTHA 1IR3A 1YWNA 4I5HA 4WRGA 3G5DA 1ZAOA 4ZTQA 3DTCA 3ULZA 5CI7A 5B7VA 4O38A 2EWAA 1F3MC 3PRFA 3R7IA 2XUUA 2CGUA 1AGWA 3EYGA 2F49A 3PJ1A 4BDCA 5JKGA 2BTSA 3I0OA 3R1SA 2C6KA 3BI6A 4RZVA 5I9XA 4BBMA 2YAKA 3ZRLA 4YJSA 1DM2A 3MS9A 4AF3A 4YNEA 5CAUA 3NRMA 5CNNA 3F2RA 3RAWA 4Y73A 1SMHA 4FKRA 5JRSA 4RA4A 3FEGA 2WELA 4R7IA 4OLIA 5AJQA 3FZPA 4D9UA 4FA2A 5I3RA 3OD6X 5KCVA 4FODA 2YIXA 3RBWA 2XBJA 5CY3A 4QP2A 3V01A 3UTOA 5K4JA 2XK4A 4WBOA 5JFXA 3E8NA 2PL0A 5HHWA 4GMYA 2YM5A 5GZ8A 3POOA 4KINA 4K2RA 4RGJA 3TIYA 5D11A 4DH8A 1XBCA 3F5XA 5CXZA 1TVOA 2FVDA 5JH6A 4FKQA 1I09A 1M7NA 3FQEA 2G2IA 4QMNA 4IC7A 3FC2A 4H3PA 1RDQE 3IPHA 3U54A 2GTMA 5KNJA 5EYDA 5KZ0A 3HECA 4LFIA 3PZEA 4ACGA 4Y95A 1CKPA 5TF9A 2XK3A 4J97A 5EM5A 2UW0A 3F69A 5DR6A 5CF4A 1CKJA 2WMAA 3OUKA 2ONLC 3OCGA 1DAYA 1CDKA 3KKVA 2YCQA 3EIDA 4XG3A 4O27B 3ACJA 3V8SA 1Q61A 2BALA 3KN6A 4F7NA 4ITJA 2Y0AA 4WA9A 2VTJA 4CKIA 5DT0A 4OT5A 3LPBA 2XNGA 4O96A 3KEXA 3OXZA 3LQ3A 2BZJA 5KO1A 3PSCA 3IS5A 4E7WA 1PJKA 3BBWA 5AV1A 3DZOA 3GFWA 3C7QA 4OTHA 4QPSA 5F95A 5HI2A 4S30A 2HZ4A 1YQJA 2C6IA 2W17A 3EFLA 2P2HA 2PVNA 2V0DA 3MB6A 4FKGA 4J8NA 2GS6A 4BCJA 4ANQA 4AW1A 3VUTA 2UZNA 5DT4A 5IISA 2ETRA 4EH3A 2ERZE 3AGMA 5I9ZA 3NX8A 4EOKA 5HCYA 5L2QA 2PVLA 2R3QA 5LCJA 3LFCA 2Z7QA 3QYZA 3UIXA 4C0TA 3ZH8A 3JS2A 4BBFA 4NYEA 5IA5A 1AQ1A 4OW8A 5HLWA 4HCUA 3RAKA 2GNGA 4FKLA 4CMOA 4HOKA 2QKWB 3G6HA 4J8MA 4L45A 4FSYA 4U5JA 3V8WA 1PXOA 4GRBA 4ZP5A 5HX8A 1G8SA 4MH7A 3Q9YA 4CFUA 2VWZA 3E93A 4X3FB 3KC3A 4QOXA 2QU5A 4PDSA 5LWNA 4L3PA 4I92A 4ZOGA 3UOJA 3DNEA 2BAKA 3SXRA 4O7NA 4K0YA 3P7BA 4JG6A 2VTQA 5LVNA 2IW6A 1PKDA 4IAKA 5I9YA 2ZOQA 5CYIA 2HWOA 4ENYA 3ZDIA 4AU8A 1QPCA 4CV9A 4TWOA 3WZEA 3BLHA 4DINA 3AXWA 3OXIA 5HORA 3R9RA 3R0TA 2JKOA 4XV1A 5EI2A 2WIPA 4JS8A 3GU4A 4IWDA 3RNYA 5HIEA 3LM0A 5AUZA 4G34A 5C8KA 3KMWA 4BY9E 4YHFA 1ZMUA 1MRUA 1H8FA 5A4CA 4NW6A 2I40A 4O7SA 2EU9A 3ZS5A 4FC0A 2YDIA 3FL4A 4USFA 2QCSA 4AOIA 4X3JA 4Q9SA 4XS2A 4UBAA 2YHVA 4O0UA 1W8CA 2ITYA 3ZSIA 4QPAA 5AUTA 3H10A 4QMUA 4L44A 1GAGA 3H9FA 3VBQA 1YHVA 2W05A 3P5KA 1PY5A 4BWKA 4AZFA 3U4WA 3W2SA 4H58A 4DEHA 3BHHA 4QTAA 3G6GA 2R3FA 4FBXA 3GI3A 1JKKA 4MF0A 4XP2A 3SC1A 5F9EA 4E6QA 1M7QA 3HGKA 5B2KA 3P4KA 1WBSA 4LV8A 4GEOA 5K0XA 3QD0A 3MTFA 1ZLTA 2QURA 2JIIA 4O6LA 4R3PA 5EW8A 1PMEA 1CMKE 2PZIA 3FMNA 1YXUA 3R1YA 4ENXA 2B9HA 4V0GB 3QRUA 3E64A 3DAKA 4DH1A 1WVWA 2BMCA 4F63A 4RJ7A 5E8VA 3C13A 2C47A 4M97A 3L1SA 4IADA 2PVMA 5AA9A 1QCFA 3EKKA 3OTVA 5HESA 2VTNA 3FPQA 2NRYA 3MFTA 4E4MA 3HL7A 1KV1A 1Q62A 2W4OA 4BDGA 4CVAA 1OIUA 3LJ2A 4UMUA 5CAOA 5GNKA 3U6IA 2FSMX 2XM8A 3ORTA 4G3FA 3UPXA 2PVFA 2XK8A 3A2CA 3MH0A 4E5BA 4NJDA 4QMZA 4MKCA 4DLJA 4F1MA 2ITOA 3HVCA 4NU1A 5TE0A 4F7JA 5DEYA 3OFMA 5HKMA 5M09A 4XV2A 4O1OA 3FY0A 5IUIA 3K54A 4O81A 2W7XA 5JFSA 4GG5A 2OJ9A 4QP1A 4FKUA 4RRVA 5JK3A 3UPZA 3DK6A 3L9NA 4S34A 3QRJA 4D2WA 2JDOA 4O2PA 2O2UA 3QLGA 4I22A 4XBRA 2J2IB 1U5RA 3TJDA 1WMKA 3PP1A 4MNEA 2PUUA 4CQEA 2GNHA 2WMUA 2B0QA 3UNZA 1SNUA 3FI3A 2Z2WA 3EN4A 3IOPA 4Y72A 5HG8A 3UOHA 1YI4A 5GJFA 5K3YA 2NNWB 3HLLA 1Q5KA 2B9IA 3QKMA 1ZZ2A 5M4FA 4HGTA 5ETCA 1UU9A 4WIHA 1VYWA 4BC6A 2Z8CA 5LARA 4BRXA 5B2MA 3QHWA 3WIKA 5JGAA 3NWWA 5CSWA 4AT3A 3I6WA 3HRCA 1Q3WA 4U45A 2OGVA 4QTDA 3W18A 4LRKA 5BPYA 3CJGA 4JAIA 4NUSA 4AZWA 3FKOA 2YZAA 2F7XE 3DBQA 4F64A 2OJFE 3DNDA 4GFMA 4RIYB 2CKEA 3T8OA 1OPLA 4JR7A 5EDPA 5KMOA 3FMHA 3D5VA 2UW3A 4EEVA 4YO6A 5M51A 3MVLA 4II5A 3IGOA 2QOIA 3MY0A 3ZTXA 4EOLA 4DEAA 3TKUA 5J1VA 3FDNA 4Z16A 4R3RA 3LJ0A 5CI6A 5A6OA 2JDRA 5HCXA 4R7HA 5CU4A 5DN3A 1XJDA 4RVKA 1JKSA 3DXNA 5FRIA 1RE8A 2F2CB 4PUZA 5BUEA 1M14A 4AZVA 5A14A 2ETKA 5HBHA 3DBFA 2E9VA 4G5JA 5L6WL 3NUNA 4N6ZA 1Q8ZA 2W1GA 2XNPA 3F2AA 5F94A 5DHJA 1Q8UA 2RFDA 4EHGA 2G1TA 5ETFA 2Q0BA 1SVEA 4ANSA 2XIKA 5T6KA 3FMLA 5EM7A 4C2VA 5ACKA 2Z02A 2Y4IB 3Q4CA 5L2TA 2B55A 3FC1X 5BUJA 3GCVA 5BVOA 5FXQA 2YM7A 3BHTA 2OSCA 4DFLA 4EORA 3MFSA 5EFQA 4YJOA 5FEDA 3DBDA 3HAVA 3R7GA 1O6YA 5D12A 2OIQA 2Z7RA 1Q24A 4BDEA 3BGPA 2VO7A 2GNFA 4YLLA 4RVMA 3PY3A 5TKDA 3GEQA 3PJCA 4EOQA 4E20A 3ORZA 5I9VA 2QOFA 2R0IA 4M12A 4QP7A 5H3QA 4D9TA 4F6SA 2Y4PA 2XNEA 4M84A 4DFUA 5CXHA 4PWNA 3KMMA 2CJMA 4U44A 4DE4A 5D7VA 3K3JA 1KE9A 5HIBA 4F70A 5EYKA 4OBOA 2W1DA 4RG0A 4C57A 2XA4A 3I81A 5AP5A 3HX4A 4W4YA 5A4LA 4A9SA 3QTQA 2JBPA 2XMYA 4I0RA 3FMKA 5FBOA 4XUFA 4XG9A 4DGMA 2I0EA 2F7ZE 3IDPA 3W8LA 5A4EA 3IOKA 4YGAA 3UYTA 1NVQA 5JN2A 4I5CA 4W8DA 2UW9A 1OIRA 3TNIA 3LQ8A 3FQSA 4P5ZA 1DI8A 4AX8A 3U55A 3CC6A 4FMQA 1PXJA 3DQWA 3LFDA 3F2NA 4IFCA 4IBMA 3U9CA 5IEYA 3OROA 4J53A 4TZRA 2VX0A 1K9AA 3DDPA 4MF1A 4GKIA 3PSDA 4AZSA 4CEGA 4KRCA 4EOJA 2PK9A 4FTNA 3KXHA 1UNHA 4UEUA 3REPA 4BGQA 4CZUA 3PVGA 5KMMA 4YJQA 4E3CA 3ZRKA 3NUAA 2ACXA 4CYJA 2R3OA 3KU2A 5FP5A 4EKLA 5KMNA 3DCVA 3OXTA 2YJSA 1J7UA 3VN9A 3UO5A 3NNXA 2RSVA 5FTOA 5LVMA 3BELA 4YHJA 2R3HA 1GIJA 4TNDA 2NO3A 4N70A 2QI8A 5E7RA 3ATTA 3EQDA 3OEFX 4FT9A 4R1YA 4A9YA 2OZAA 4EONA 5AFVA 4F9WA 4F08A 2CPKE 4IAAA 3TZ7A 4CSVA 1LR4A 3FZTA 4E6DA 2BZHB 2ONLA 2WMBA 4U3ZA 5AV3A 3KXXA 5AUYA 3DB6A 4LOQA 3W2OA 5BNJA 2C6DA 2W1CA 4L68A 3SGCA 4YLJA 4L00A 1CM8A 1PHKA 1KWPA 2YCRA 4H36A 3F82A 2PUPA 1X8BA 1W98A 2OXXA 2REIA 2JFLA 3EH9A 4HYUA 4ID7A 5DT3A 2I6LA 4DTAA 3TZ9A 3Q9WA 3WILA 3JUHA 3PY0A 1P5EA 4I1ZA 4JX7A 2LAVA 5IDPA 1PMUA 1KE5A 4N57A 2UZTA 3RP9A 2OLCA 1PW2A 4RQKA 3UGCA 2HW7A 2P0CA 4OAUC 4FSZA 3UODA 1QMZA 4I0SA 3MJ2A 4D28A 3C5UA 3IONA 5JMSA 1FVTA 2WAJA 3DJ5A 2QU6A 2OU7A 1R0PA 5HBEA 3R7UA 1XKKA 4ZTSA 2LGCA 2PE2A 2XRUA 4D5HA 2QOQA 4IDTA 5C4LA 3O2MA 4MTAA 3ZOSA 4BDHA 4ERKA 3OW3A 5LOHA 1V0OA 3R1QA 3MFUA 3ZZEA 1U5QA 2GCDA 2O3PA 1BLXA 1WZYA 3GCUA 3W2QA 2VO0A 4ALWA 2A1AB 2F57A 2OZOA 4U6RA 1OL6A 5E90A 1ZYCA 2ZM1A 2R3RA 3UP2A 4IZ5A 4ZTRA 5CALA 3D4QA 4YC6A 3FYKX 2OO8X 4C8BA 2AC3A 3FPMA 1ZZLA 3HYHA 3DY7A 1OL2A 3ATSA 3ZXTA 3GOPA 4FKIA 4RJ8A 5I5ZA 4EUTA 3DKFA 5BQ0A 5IH4A 3QCQA 4F65A 1J91A 4DGGA 4JBQA 2JDTA 3QKLA 3K5VA 5KKRB 3HP5A 3ID6C 2FH9A 3FLZA 5LCKA 4BHNA 2JD5A 2OW3A 2IZTA 4CZTA 3O7LB 2HAKA 2W99B 2NPQA 3DKOA 4HYHA 3Q5ZA 4PX6A 3OOMA 4M15A 5HU9A 1PXIA 2PTKA 4ERWA 3EFWA 3G0EA 4AFEA 4U40A 4E5WA 3CBLA 3FJQE 3NW7A 4GT4A 5KBRA 3BIZA 4Y8DA 5T68A 3GB2A 4C33A 2WOTA 3DFCB 4GV1A 4EWHA 4I21A 4P5QA 3ELJA 4F7LA 5IU2A 3OCSA 3RPOA 4FUYA 1Q41A 4ZJVA 3SRVB 4U8ZA 4YJNA 4FSUA 4C62A 2PZRA 2RFSA 4C58A 4G6OA 5GIOE 2JIVA 4IHPA 4AA0A 2XRWA 3DA6A 4QQCA 4ASDA 3SLSA 4RA5A 5AV0A 3UIMA 4E4LA 4WNMA 5JEBA 3EL7A 2PMOX 3SHEA 3G15A 3PY1A 4R78A 5CVGA 3AD5A 5AP6A 3HV7A 4JOAA 1IG1A 2UZOA 4ZS0A 5HE3A 4ACHA 5AP4A 3U51A 4MD9E 3ZO2A 3ZUVA 5IMEA 1DI9A 5CAVA 4J96A 4ALVA 1H0VA 5C8MA 3O8PA 2OICA 3MESA 4JBOA 4RSSA 4D1ZA 3A62A 3E8DA 5LMBA 4TXCA 4BDFA 1L3RE 3DU8A 4EH8A 2E9OA 3R21A 4O22A 5AV2A 4EH9A 1WAKA 2CKQA 2R7BA 2ITZA 3PIYA 1MP8A 3KREA 5GHVA 3TUCA 4QO9A 1BI7A 1TQMA 4LMUA 4PV0A 3ENHA 3W2CA 1ERKA 2WTWA 4KS7A 5AUVA 3ZSGA 3AQVA 4J98A 5IQAA 2WOUA 3ZLXA 1BX6A 4QQ5A 5ANEA 3DBEA 3Q4ZA 4A07A 5CT7A 1UU3A 5CSPA 3Q2JA 1J1BA 2R3GA 3LW0A 3UZTA 4FKPA 3MVJA 2XBAA 3BLRA 3ZZWA 3NNWA 3QWJA 1UKIA 3S4QA 4BDAA 4U9AA 4AW0A 2CNUA 5GIPE 2X2KA 1IA8A 3PJ3A 3ZSHA 3R7OA 4JI9A 3VS3A 2GQGA 3QHRA 2WMRA 4LG4A 3M2WA 4A9TA 4WNPA 4PNIA 3ROCA 4JBVA 4WSQA 3FBVA 2HY0A 1XBBA 3PG3A 4JR3A 1OIQA 4G6LA 4D1SA 2Z7LA 3OMVA 2B9FA 1PYEA 4EOOA 1XH6A 2UW8A 1OM1A 2HWPA 1YOMA 3MVHA 2X4FA 4RVLA 5FDXA 2XIRA 3D5UA 4XP0A 2B53A 2JDVA 4KKHA 3DZQA 3O23A 4NFNA 2UZVA 4QYYA 2IVTA 4AW5A 3AC5A 4ZZNA 1PXKA 3TL8A 4FTKA 3TV6A 4LL0A 2G9XA 2QR8A 2R4BA 3FZRA 3PLAE 2GNLA 5M4CA 3D7TA 1FGIA 3V04A 1OECA 2BRGA 3TNQB 2QONA 4XMOA 2OI4X 3TNHA 5BVEA 4O0VA 4MK0A 5AM7A 3UZPA 3HV4A 4MQ2A 5AAFA 3MPMA 4QNAA 4LV5A 3RPSA 3UIUA 3ZXZA 4EBWA 2PVRA 5C1QB 5HTBA 3QQUA 4X2NA 3EQCA 3F88A 3HUBA 3A7FA 5IQBA 3CP9A 1VEBA 4TYHA 4O6EA 4IX5A 4YZ9A 2Y6OA 2WPAA 3A61A 5M55A 2AYPA 2W1ZA 4K77A 5BUIA 4LRMA 2E9NA 4O2ZA 4EUUA 3TNPC 5HD4A 3R2YA 4GW8A 3C1XA 4EOMA 2VGPA 2XEYA 1JSUA 3ZEWA 2ZYBA 3FE3A 5EKOA 4JLCA 1F0QA 1P14A 3TV4A 2CMWA 2JGZA 3M11A 4AFJA 3SW7A 4ZZOA 3Q9XA 3VQHA 4EK4A 3KY2A 3WF6A 3F5PA 3AGLA 3QAME 4YSMA 5AP3A 3TV7A 1ND4A 4BCFA 4DT9A 4PNKA 3EQRA 5CQUA 4D0WA 2PMLX 4R5SA 4KB8A 4NZWB 4XH6A 4FZFB 3C9WA 5JGBA 5FM3A 3P7AA 3VULA 5KHXA 3C51A 3PWYA 2WMQA 4DTKA 5IA3A 3RNIA 3RALA 2GQSA 3AOXA 4RX7A 3VJNA 2QO9A 4KIPA 3PJ2A 3BZ3A 4BDIA 4AQCA 4EQUA 3AC8A 3W55A 1RW8A 3WZKA 3QKKA 4QT1A 5E1EA 5ANIA 4GFOA 1B39A 1JAMA 2H9VA 4L52A 3HRBA 2OIBA 4USEA 5E8ZA 4ASZA 4FEVA 1YDRE 1JOWB 1PXNA 3HDNA 3QZGA 1OL7A 3QYWA 4IVDA 4R1VA 3OWPA 4FTUA 5EW3A 4ZTHA 4DLIA 5AEPA 2XB7A 2FSLX 3BE9A 3LFEA 1YRPA 3F6XA 2WQMA 3TDVA 1ZOGA 5CTPA 3MN3A 2GMXA 3BU6A 2C1AA 3FZOA 3IK3A 4C4HA 3W1FA 4F6WA 5F4NA 1XHAA 3E5AA 3QTXA 4I3ZA 4V01A 3H9RA 3CTHA 4C2WA 3D83A 3NYXA 3LFSA 3IKAA 4O21A 4UX9A 4NK9A 1Y6AA 5BMMA 2OK1A 2PZPA 3BU3A 4FKTA 4AS0A 2UUEA 2JKQA 4ANOA 2C30A 3RAHA 5FWKK 5LVLA 3L9MA 3R04A 5AR3A 4PMMA 1Y57A 4O0SA 3VAPA 4X21A 2ITXA 3V5WA 3I1AA 2JIUA 3FSKA 3PVUA 4YJVA 4AOTA 5IA0A 1VYZA 3OY1A 3GNIB 2WU7A 3CCNA 5D9HA 3IO7A 4MBJA 2JBOA 2GDOA 2W96B 4HZRA 4TWPA 2IG7A 3LVPA 2EB2A 1OPJA 2OH0E 3ZBXA 1GZ8A 4D2PA 2VTPA 2PWLA 4HGLA 4YHTA 4AE6A 4UMQA 3D5XA 3HMNA 3PFQA 4D2RA 4W4WA 2UZLA 4DFZE 3RMFA 2PZ5A 4OTWA 3ORPA 1DAWA 4C4FA 3PP0A 4KRDA 3DBCA 3PJ8A 4EH4A 1SYKA 3R1NA 4I5PA 3TCPA 4CKRA 5KX8A 4IC8A 4UMPA 2E9UA 3VS1A 1QPDA 2OG8A 4LI5A 3EQIA 4OTDA 4MHAA 5JQ5A 4NTSA 4DHFA 3MH2A 5DH3A 5HICA 2WQEA 2VD5A 4O0YA 4RBLA 5J7HA 5KMJA 4O7ZA 2ZDUA 2ITQA 5D1JA 5ACBC 4EOPA 2WMVA 2B7AA 5AUUA 3DK7A 1YI6A 2ZJWA 4LUEA 4ACCA 2WZJA 2E2BA 3NUPA 1FQ1B 2W5HA 1O6LA 1FVRA 5EYMA 1BMKA 4PDOA 4E73A 4D4VA 1YI3A 2XK6A 3W16A 1FVVA 1UWJA 3GCQA 2DYLA 4FYOA 4IE9A 4LGDA 3UP7A 3WZDA 4NM0A 4GKHA 4BR3A 2WMSA 1U54B 4OUCA 4EZ5A 1V0PA 3B2TA 4FNXA 1YDSE 4LGGA 4YZDA 5EDQA 4RZWA 1NVSA 2PE0A 4NT4A 4FTAA 2X7OA 3SA0A 4CFNA 3TWJA 4UYAA 3UOKA 4RFYA 5ANGA 5KBQA 4L46A 2R2PA 3KRXA 2G15A 1O6KA 1URCA 5EM8A 2P4IA 3FYJX 4DBXA 3CEKA 2V55A 3ZEPA 4ASXA 1Z57A 2FB8A 5CS6A 5F20A 5CU3A 3QZHA 1H1QA 2H34A 3CIKA 3LCTA 4UWYA 5E1SA 4F1TA 4G3EA 3ANRA 4CCUA 5K9IA 4G9CA 2BIKB 4WNKA 1R3CA 2RF9A 4YC8A 2WTDA 1E1VA 1XBAA 4E93A 1TKIA 3BE2A 4OTIA 3W33A 3BEGA 3NVMB 4O7TA 1U59A 3TN8A 3R71A 2PU8A 2QLUA 2G01A 3OTUA 4DFNA 5C03A 3EKNA 5A6NA 3TEIA 3ZLYA 1SNXA 2P2IA 4M3QA 5FD2A 3CSVA 3ZM9A 1JKTA 2XIYA 2IW9A 3V6RA 5J9LA 4E26A 5BVNA 5EQEA 3O50A 3AG9A 4FL1A 3BRBA 5IA2A 3MFRA 4L7SA 5CANA 5CX9A 4XRLA 4WT6A 4IH8A 4MXOA 1K3AA 3PTGA 3MPTA 4LL5A 2E9PA 5HVJA 3QL8A 3NUSA 4DGOA 3DKCA 3VS5A 5BMSA 4ZY5A 3LFQA 1YWVA 3P0MA 4V04A 5IDNA 2ZV2A 3DDQA 1PYXA 2C3IB 4GL9A 2YM4A 3ORKA 4L8MA 3RPVA 4GIIA 3MTLA 2C6OA 4FT5A 1HCLA 4AG8A 4B8LA 2XVDA 3MIAA 5CSXA 3QA0A 3DAJA 4AP7A 1Q8WA 2VTAA 2VWXA 3QC9A 1ZXEA 4WG4A 5HG7A 2YISA 3BWFA 2W1IA 3UVRA 4B7TA 3Q6WA 3N9XA 2QOOA 3QCYA 4XV9A 2CHLA 3FWQA 1R1WA 4BDBA 3R8MA 4EH6A 3OWLA 4MBLA 4NCTC 4NKSA 2BRNA 5BX0A 3KXMA 4TWCA 1FMKA 4GT3A 3KMUA 4GT5A 5H8EA 1Y8GA 4PTCA 2I0YA 3RWPA 2BTRA 3NGAA 3HNGA 3PPJA 4LRJA 3S0OA 2J50A 3ZUUA 4O7VA 3LMIA 4QP9A 4AZTA 5DLSA 4Y5QA 3TI1A 4WG5A 3H9OA 1OKWA 2UZDA 1KE8A 4FV7A 4XOYA 4EYJA 4AN9A 3FI2A 4C61A 4KUJA 2IWIA 3T9IA 4FKWA 1KE6A 2BPMA 3IECA 1ZRZA 4FV5A 3II5A 3R8UA 4TPTA 3SOCA 3VJOA 4A7CA 1OI9A 4PY1A 5HE1A 3SXFA 4CMUA 3MY1A 1URWA 3A7GA 3U6HA 4AACA 3NYVA 3MWUA 4JL9A 4BHZA 3WF9A 4CFXA 2GU8A 4FX3A 4TN6A 3RZBA 3UQFA 3A4OX 1M52A 5KZIA 4AGDA 3LCDA 3KB7A 3KRWA 3VUIA 1Q8TA 3BYMA 2FUMA 4M69A 5E8UA 2HXQA 3VVHA 3WYYA 3ACKA 3IDCA 4FTIA 2X0GA 5A54A 3QQHA 1KUTA 3V51A 2VV9A 4CCBA 2UZUE 4RJ6A 1E1XA 4JQ7A 2J7TA 2BRBA 2HK5A 3P9JA 4I94A 3VS4A 2GHMA 3F3WA 1GJOA 4FIHA 3VUGA 3TTIA 4EH2A 4LGHA 4Z7GA 2R3NA 4ZSJA 4FVQA 4AWIA 4TYIA 3I6UA 4HYIA 4MVFA 2WB8A 4D2TA 5CAPA 5J95A 1ZOEA 2J0IA 3PIXA 4N6YA 4O1PA 3E63A 3MH3A 5CEOA 5EG3A 4S31A 3TXOA 2H96A 3ORMA 3C4CA 1JWHA 4YPDA 3TT0A 4XJ0A 4D0XA 4MWHA 1G5SA 1KE7A 3CGFA 3HKOA 3M42A 3H30A 4ZJIA 5E9EA 4BZOA 3OW4A 5J8IA 2G2FA 3MJ1A 4AUAA 4FEXA 4AXAA 5CQWA 5IQFA 3NCZA 1OL5A 2FSOX 1YXXA 2QG5A 4UN0C 3IW4A 3F3VA 3FMJA 4CTCA 2BKKA 2XCHA 5K5XA 5L6OA 4TL0A 4NEUA 2WQOA 3MBLA 3R63A 4K33A 5J87A 2O5KA 3EQHA 3VBWA 3QWKA 3TUDA 4C38A 1NW1A 3FHRA 4ANMA 4Q2AA 3MIYA 4IZYA 1YHSA 2GFSA 4FTCA 2ITWA 2HW6A 2IVUA 1NY3A 4PL3A 5TO8A 2PMIA 2Y4IC 2QLQA 3AMYA 4FV6A 4I4FA 4GUBA 3EQFA 4DT8A 3QXPA 2J0JA 4A06A 1ZMWA 2RGPA 3AC2A 4PQNA 4Z9LA 3SV0A 1GY3A 3QD3A 1V0BA 4FV8A 3LMHA 1WCCA 2WKMA 4H3BA 3TACA 3HP2A 5LMAA 3U87A 4BYIA 2BDJA 3BPRA 4J1RA 4U42A 2UZWE 5HEZA 1QPEA 3VS2A 3ZHPC 1WBPA 3UJGA 5KMKA 2BIYA 3ZC5A 1BL6A 4QMLA 3Q32A 4RFZA 4QMYA 5JZNA 3CKWA 2YWVA 4ZS4A 1VZOA 5FDPA 4BGGA 3U4UA 3D15A 4LUDA 2NP8A 5EW9A 3EQBA 1BI8A 3GCPA 4YZMA 4DBNA 5ANJA 2GFCA 2J5FA 4G3CA 2FO0A 4MXYA 3TM0A 1UU8A 1YKRA 4I5MA 1H25A 3VS0A 3CY2A 3WOWA 2PVKA 2J0LA 3JYAA 3NUUA 4CXAA 4ZLZA 3ALNA 3W10A 3ZFMA 2PVJA 3O71A 5EI6A 2PMNX 2BUJA 3CLYA 2X4ZA 5AUWA 4ASEA 4YNOA 4TT7A 2BHHA 4ZY4A 3EFJA 5EQYA 4BTMA 3KXNA 3F66A 5KHWA 4WRSA 2WXVA 4IM2A 4BDKA 3HMOA 3ITZA 1JNKA 4BCPA 3FMDA 1CKIA 2F7EE 4NWMA 2J5EA 2VNWA 3U6JA 4GYGA 4BYJA 4MD7E 2SRCA 3AMAA 3E7VA 4BKYA 5G6VA 3QTWA 3E62A 1ZWSA 5HCZA 3CQWA 2XIXA 4RLLA 2VWVA 3V5QA 4JXFA 5CSVA 3FLQA 3R9DA 4F6UA 1A48A 4R77A 1OL1A 3BYOA 3I4BA 4TW9A 2UW7A 4PDYA 5L8JA 5DR2A 2F9GA 2QHMA 5DRBA 3RHKA 3A60A 4TYJA 4DEBA 3PYYA 3C4XA 3E8CA 3FY2A 3E7OA 4JAJA 1W83A 2JC6A 2GHGA 3CTJA 3BHYA 3RI1A 5IH6A 2C6TA 3A4PA 4R7BA 3WF8A 3RGFA 3RK9A 3SX9A 1SZMA 4J71A 4PDPA 2DWBA 5CENA 3F5GA 3C4ZA 5E8YA 3VNTA 3G0FA 1NXKA 2WHBA 4L53A 1FPUA 3C0HA 3C50A 4FTMA 2WEVA 4IB0A 4W8EA 5L2IA 3VUMA 2V5QA 3A8XA 2EXEA 4BF2A 5AADA 1SVGA 4KSPA 4ZTNA 1GNGA 3ET7A 5TR6A 4C02A 4AGCA 2F2UA 3DQXA 2ITTA 1W0XC 1YXSA 2OWBA 4ZXTA 4C3FA 3W8QA 4RX8A 3GVUA 4L7FA 2GHLA 1UU7A 2UW5A 2DUVA 3Q6UA 3IW5A 3IW8A 2AUHA 3E92A 5HOAA 2J0MB 4S2ZA 1JSTA 2WEIA 5DFPA 5L3AA 3KN5A 3QXOA 3ZFXA 2EXMA 2YEXA 3CKXA 2BHEA 3TIZA 4QP8A 2EXCX 1XWSA 4X7QA 3TTJA 1YWRA 3EQGA 4AZEA 4EZ7A 3KRRA 4HJOA 2ZV9A 4BDDA 2B9JA 3QTUA 3HMIA 4X2FA 3HDMA 5AAEA 4EOSA 3VS7A 4YTHA 3LAUA 3WYXA 1YVJA 4E4XA 3FXXA 3PXFA 1YOJA 3RCDA 1IASA 4M14A 4EHZA 4QMMA 4I41A 4PMTA 4N0SA 2V7OA 3KXGA 4XRJA 5FGKA 2P33A 5FEEA 4BVUA 5HG9A 4I6FA 2JEDA 3D0EA 3RCJA 2R3KA 2YERA 3C4FA 3WIGA 4PMPA 5HZNA 3TKIA 2X2MA 4FT3A 5CSHA 4DH5A 4FNWA 4RC4A 4YSJA 3MVMA 3OF0A 5K4IA 1UVRA 3EWHA 3MI9A 4FIIA 4MX9A 5A4TA 2CKOA 3LKMA 4FKSA 3Q53A 2JAMA 4DA5A 3N4UA 2XM9A 4DCEA 3RJCA 2YN8A 5J9YA 3H3CA 3PA4A 4HW7A 2HY81 3FAAA 4QMWA 4RC3A 5EDRA 1BYGA 1OPKA 2WTKC 5AAGA 3DXPA 2B54A 3ENMA 5HO6A 5C01A 5JZJA 3Q9ZA 5CT0A 1J7IA 4FV1A 4JDJA 2RIOA 4S33A 1CSNA 5L6PA 5J79A 2OJJA 1OITA 3OT3A 4FV2A 3WZUA 4BCKA 2XJ1A 5A9UA 3OWJA 2XCKA 3Q4TA 4HYSA 3B8QA 2XNNA 3VUHA 3BX5A 3GC0A 5AR8A 3NZ0A 5IA1A 3BGZA 4O0XA 4F9BA 3W32A 4EC8A 2W1HA 4HNIA 5TOZA 4C4IA 1KOAA 4FTRA 4IM0A 4GUEA 4NM3A 4YJRA 5H8GA 3PWDA 3R9OA 4XBUA 3OBGA 4EL9A 2VU3A 3DB8A 4KIQA 4X0MA 3AD6A 4JIAA 4Y5HA 4JVGA 3F3ZA 5HGIA 3R7EA 4EK8A 1XH4A 2FYSA 4TTHB 5CU2A 5J5TA 2EUFB 3LCSA 3OT8A 1OB3A 5HTIA 2WQBA 2C0IA 4XG7A 2VTTA 4HZSA 3R7VA 1IEPA 3UNKA 2UVZA 3D7ZA 3P79A 3C5IA 3LXKA 2J9MA 4MQ1A 4K11A 5IZFA 3HMMA 4IVCA 4YJUA 4OTRA 5DA3A 4O7RA 1S9IA 1WBWA 3D5WA 5AR7A 1BKXA 3TZ8A 1OUYA 4A4XA 3H4JA 4B0GA 5HQ0A 5AUXA 4FYNA 5CEKA 1PMNA 4Z7HA 2Y9QA 4DEGA 4QP3A 2GNJA 4GS6A 3GQLA 3COIA 4LMNA 3NSZA 5H8BA 4E4NA 4F7SA 5CZIA 3W2PA 4U80A 2KULA 4A9UA 3I7CA 4XLVA 1F5QA 1OMWA 4FVRA 5EI8A 4IVAA 4QYEA 1H1SA 1SM2A 4E6AA 4EHVA 1NVRA 1TQIA 3VS6A 2OIDA 4TKSA 4AE9A 5D10A 5M06A 1U46A 3QTRA 3NVKI 4HVIA 2YIQA 4UYNA 4YZBA 2HYYA 3WF7A 4CD0A 3UZRA 4CFMA 4UZDA 3Q04A 3GOKA 2B52A 1MQ4A 2X6EA 4M0YA 2RG5A 3QTIA 3E87A 3QZFA 5I4NA 3NIZA 4G6NA 5GJDA 2VTIA 3I0QA 2WFYA 4NM7A 3RM6A 5AX9A 3SG8A 4O7LA 4CZYB 1HOWA 5A4QA 3NYNA 2C6LA 3PPZA 4DITA 3RINA 2X39A 4EZ3A 4FEQA 2GS7A 5AP0A 3KK9A 4DFYA 4G31A 1H1RA 2QC6A 5HE0A 4MXCA 2XF0A 4WUAA 3ROYA 4X6QC 2WU6A 4AOJA 2GPHA 3PXZA 2QNJA 4AGUA 4FGBA 3DJ6A 3UVQA 2QR7A 3VF8A 2CGXA 3AT4A 3LFFA 4EOIA 3FV8A 2PULA 2X6DA 2A2AA 4JX3A 3EYHA 4LOOA 5E8XA 3V8TA 1Q4LA 2QO7A 4BBEA 3Q5IA 4I6QA 4P4CA 4WD5A 4CLJA 4H1JA 5HE2A 1H00A 3OHTA 3R22A 1OGUA 3NEWA 3L9PA 4JRVA 4X2JA 2YABA 4ZMFA 5DVRA 2X1NA 4EH5A 3PXYA 3UNJA 3RKBA 3SVVA 4EYMA 4H3QA 4WBBB 2HZIA 3LCKA 3CGOA 3PDTA 4ZTLA 3T9TA 4JDHA 2VGOA 3HV5A 3LXLA 4L67A 3ZU7A 5HVKA 5JFVA 4PPAA 4XG8A 3GC9A 3FZSA 4XLIA 2A4LA 3G51A 4GG7A 4DGLC 5HLNA 2C68A 3VIDA 2UZEA 3DAEA 5J9ZA 4IB1A 3OVVA 2OXDA 2QQ7A 1ZOHA 2WQNA 2XYNA 4TY1A 3BYVA 2EB3A 4YP8A 4FSWA 1P4FA 4FT0A 4RMZA 1UWHA 2VX1A 4IX6A 3VHEA 1OBGA 2VRXA 4FI1A 4QMSA 4QD6A 3PVWA 4Y85A 3O8UA 4K8AA 2W1EA 5EHYA 2QD9A 4L3LA 4FF8A 5EOLA 3R8PA 4I6BA 4YMJA 5IPJA 5L4QA 4JG8A 3UO4A 4CFWA 1Q8YA 4OR5A 3UIBA 3VUDA 1Y8YA 3DPKA 4DGNA 3SAYA 4BI2A 3LE6A 4FSMA 2BDWA 3S00A 3KRJA 4NW5A 4D4SA 3R2BA 3IW7A 2C3LA 5FM2A 4QMOA 4FNYA 1H1WA 1IAHA 3DT1A 4DEEA 4IM3A 3KQ7A 1JPAA 3ZMMA 3HV6A 3QUDA 1H27A 2P3GX 3V6SA 1JKLA 4XYFA 3FMMA 3OCTA 4IZAA 4BTKA 1M2PA 4B4LA 4NM5A 2VTOA 5CU6A 5FUTA 5AR4A 3QU0A 2C69A 4UY9A 3BCEA 3F3TA 2W9FB 4OBQA 5GZAA 3A7IA 4M69B 1PXLA 3DV3A 4IX4A 4A4LA 5IH5A 4PP9A 5M57A 1ZY5A 2XKCA 1OKYA 2IO6A 1NT2A 3QQFA 4BCGA 5B2LA 2QOKA 5M44A 4ARKA 3DJ7A 1GZNA 4U43A 2H8HA 5AV4A 4IJ9A 2YITA 2W4KA 3SDJA 3OS3A 3COHA 1Q3DA 3D9VA 3N51A 2X8EA 3WF5A 2YCSA 3R9NA 2BVAA 2VTMA 4W9WA 4ANNA 3DFAA 3QCSA 1H07A 2YIRA 2X7FA 4IJPA 5A46A 4O0WA 3E8EA 2GNIA 2CLQA 3VF9A 2OF2A 2QOCA 1I44A 3PXQA 3TG1A 2JLDA 2QHNA 3FQHA 4U41A 4MCVA 4DTBA 2RFEA 4MXZA 3CPCA 3VHKA 1ZYDA 3LQ5A 2OFUA 2ZAZA 4UXLA 3GC7A 3NPCA 4RWJA 5DIAA 5ETIA 5HNIX 2VO6A 5HX6A 4IACA 4D5KA 5C8NA 3UO6A 4IFGA 3RK5A 4IWQA 3ZONA 3UYSA 3GFEA 3NUYA 4XNEA 3UBDA 4HVGA 2BROA 3LLAA 2HELA 3ZCLA 5CVHA 5CZHA 2IZUA 3QX4A 4TYGA 3CR0A 2ESMA 3RK7A 1XR1A 2XNOA 3R6XA 5HNGA 3C0GA 4RIWB 3BV3A 3A8WA 3KRLA 4DEIA 1PRYA 4FVPA 2KTYA 5L2SA 4CKJA 4ITHA 2XK7A 4QQJA 4C34A 2WIHA 3PXRA 5DGZA 4IB3A 4X6RA 1P4OA 5EYCA 3VW6A 3R8ZA 4ZSGA 1OBDA 3D94A 2R9SA 2R3LA 5ETAA 2XKFA 1KOBA 3QRIA 3MY5A 4APCA 5BVDA 2A0CX 3ZUTA 4BZNA 4TNBA 2YFXA 1WVXA 2XP2A 1EH4A 3CY3A 3QQLA 3R8LA 4GK3A 4M8TA 2OBJA 1H24A 2R3MA 2P55A 4UV0A 3P08A 3KF7A 3ZYAA 2W1FA 1ZYJA 3QTZA 4MEDA 2BZIB 4QMVA 4FEUA 5IF1A 3F3UA 2WTCA 2YLEA 1MUOA 3ULIA 4APPA 4CT1A 4EKKA 1SVHA 4QMQA 1IAJA 4GU6A 3EN6A 1LUFA 4NKAA 5D41A 4F0GA 4M13A 4X3FC 4RWKA 3RAIA 4DEDA 2PYWA 3VBVA 3FXWA 4RVTA 3EN9A 4M67A 4ZZMA 5KMIA 3AT3A 1UV5A 4PTEA 4W4XA 3LCOA 3UQCA 1R0EA 5DR9A 5JT2A 5LMKC 2OF4A 2XJ2A 3I60A 2FA2A 1RQQA 5FQDC 4CRSA 3ZLSA 4S32A 3UG1A 1WBVA 2BKZA 2QKRA 5JRQA 5L8KA 3DGKA 3BBTB 4K1BA 4OGRA 5AR5A 4YJTA 3VC4A 2UZBA 2VTSA 1ATPE 2FGIA 4NIFB 3QC4A 3NDMA 1LP4A 4E1ZA 4FGRA 3KVXA 4ZSAA 1M17A 5BYYA 4HNFA 2BAQA 5FTQA 5E8SA 4ZIMA 4YBJA 3PSBA 4EBVA 4C4GA 1H26A 1XH8A 2VWWA 3L8VA 4MYGA 4DC2A 1Z5MA 2V7AA 4EQMA 1MRVA 3DK3A 1IA9A 3RPYA 3COMA 2OXYA 3VO3A 1XH9A 3MA3A 4EJNA 1UKHA 3P78A 4WUNA 5HNBA 4C4JA 5AIRA 5HG5A 4BKJA 4D2SA 4B8MA 3GP0A 4KWPA 2EVAA 5J5SA 3L9LA 5JQ8A 2BZKB 2R3JA 4OTGA 4K18A 5IMXA 2ZM3A 4FL3A 5AMNA 4M66A 4U81A 3WBLA 3ANQA 3PA3A 5KUPA 4KIKB 5DBXA 2YA9A 3R9HA 3DKGA 1LEWA 2ITPA 3SRVA 4FZ7A 5HO7A 1LEZA 1JVPP 3TDWA 3NW6A 2IZRA 4XG4A 4EC9A 4QQTA 3QQKA 4WNOA 5IQHA 5EK7A 2BCJA 2QODA 2X9FA 5DPVA 2C5OA 3QUPA 4L3JA 4RPVA 4C7TA 4IANA 4YZCA 3QRKA 3BYSA 1PKGA 1STCE 3QQJA 5IQEA 2ETMA 3O96A 3ALOA 2BFYA 3LFBA 4ACDA 4O83A 4JDKA 3HA8A 1WBTA 3UDBA 2BR1A 3G90X 4FTLA 3G33A 4U0IA 2I0HA 3JY0A 4MNEB 1XH7A 4BB4A 3O51A 3QGYA 5CASA 3VWAA 2IN6A 2UW4A 1Y6BA 2C0TA 3V5PA 3OBJA 5HLPA 4V0GA 2Q0NA 3WZJA 2C5VA 4D4RA 4DAWA 2W06A 4UXQA 4EJ7A 3PG1A 3CTQA 3F5UA 3ZO4A 4I20A 3A7JA 4L6QA 4XG2A 4QPMA 4EK3A 5JFWA 3TUBA 3LM5A 4O0TA 4ZSLA 2VN9A 1FINA 4UMTA 4C3PA 3ODZX 4BWPA 3FHIA 2BFXA 3G9NA 4RJ4A 3TKHA 1J3HA 3R8VA 4ZJJA 3CQUA 1Z9XA 5JSMA 3OOGA 2XEZA 4EK5A 2B1PA 4YJPA 2B4SB 2YCFA 2UV2A 3FKLA 2IW8A 2UW6A 3THBA 4RLKA 4HPUE 2CGWA 2PHKA 5HU3A 2UVXA 3ZFYA 2CN8A 1U4DA 3AMBA 3QA8A 4G5PA 4BIBA 3ORLA 3U9NA 2ZV7A 3QTSA 4F0FA 1OKVA 1JSVA 2HZNA 3N4VA 2IJMA 4Q5EA 4FIFA 5ANKA 3UC3A 2J4ZA 3DLZA 3P86A 4G9RA 5A3XA 2QG7A 3GXLA 1JBPE 3G2FA 5FG8A 4E5AX 4DF3A 4DFBA 2XZSA 3LFAA 3P23A 3BQRA 2ZMDA 2XK9A 1L8TA 1MRYA 4W9XA 4BDJA 2ITUA 5FP6A 4ZAUA 4QMXA 4FG8A 4OT6A 1REKA 3JXWA 2PUNA 5IEVA 1H28A 2PZYA 2RKUA 2VUWA 5JGDA 2HXLA 1JQHA 4KAOA 4NL0A 3QF9A 2HIWA 4OBPA 3LHJA 4TWNA 3ODYX 2PVYA 5BYLA 4V05A 2X8IA 3RTPA 3NR9A 4OTPA 4RIXB 2R64A 4ZSEA 2XH5A 3JVRA 3RZFA 4FZ6A 5FLFA 2ZVAA 5M4UA 3FLNC 4NSTA 4C4EA 4KKGA 4PPCA 4CTBA 3KXZA 2WTIA 4D58A 5DEWA 4YTCA 5C27A 4WOVA 5HO8A 4C59A 4IW0A 4J52A 1BL7A 4XHKB 2VO3A 4E8AA 1J1CA 3SKCA 3QFVA 5CEPA 2WTVA 4DG3E 2VZ6A 3F61A 3QD2B 4AAAA 1GIIA 4Y83A 4O7WA 1K2PA 2AC5A 3PXKA 4YURA 3VRZA 2IPXA 3VBTA 4I6HA 4FICA 4OTFA 4YO4A 5AA8A 3V5LA 4FSQA 4OAVB 1OVEA 3HV3A 3Q52A 4GVJA 1WBOA 2WO6A 3VRYA 4CLIA 2Y8OA 4GK4A 1Q99A 4IAFA 1T45A 1OIYA 2C3KA 2JKKA 4RIWA 5L8LA 2GQRA 5M08A 2R7IA 4JDIA 3WE8A 4AT4A 4UWCA 4H05A 3LMGA 5FEQA 4F9YA 5HVYA 2J0KA 2YIWA 4IWPA 4BCMA 2I0VA 1M2QA 5C26A 3KULA 4IEBA 3HMPA 4L42A 4MWIA 4FL2A 1J7LA 4Z55A 3S1HA 5M56A 3EMGA 2X81A 2XYUA 4KBCA 5FXSA 4J95A 5GZ9A 4NCTA 2CGVA 4RT7A 3CQEA 4PRJA 1A9UA 2WMTA 3PVBA 4FV4A 2VAGA 4Z3VA 3D2KA 5CLPA 3WI6A 5DE2A 2BAJA 4XX9A 5HTCA 3OP5A 1PF8A 2X9EA 4AGWA 2IVSA 2C1BA 4FSRA 4YTFA
chains in the Genus database with same CATH superfamily
4IAIA 3QBNA 4QYFA 4UWBA 3ORIA 4G3DA 4HCTA 4PF4A 4QTEA 2R3PA 5HBJA 3CS9A 2C5YA 1HCKA 2OH4A 3BGQA 4U79A 5LJJA 5IQIA 5KKRC 4D4YA 4A9RA 2OZAB 4WSYA 5TT7A 4BCNA 4KNBA 4F09A 1ZMVA 4B99A 5ANDA 2O63A 1Y91A 3JPVA 5AM6A 3SG9A 2QOHA 3PA5A 1PXMA 4FK6A 2O0UA 3H0YA 3ORNA 5BVWA 2WMXA 1LPUA 3GBZA 3BQCA 3R73A 3LZBA 4X3FA 5AX3A 3CD3A 3ZC6A 3PUFC 3GCSA 4CNHA 2FSTX 3O5AA 1GOLA 2R0UA 5BVFA 4P7EA 5HIDA 4H39A 4MAOA 2AQXA 3W2RA 3W0MA 4JQEA 4JJRA 5FBNC 3RHXA 4D1XA 4RX5A 4Q9ZA 3LOKA 5LMKA 3OG7A 3O7LD 2C5XA 4PMSA 3QX2A 4KIOA 5J1WA 5LQFA 3FI4A 3QLFA 5IUGA 1B6CB 4EK6A 1NA7A 4GJ2A 4KBKA 5IKWA 4O82A 3UVRA 5CEMA 3FLYA 3AC4A 1TQPA 3NYOA 3ZBFA 3QQGA 3RVGA 3HAMA 1YXVA 3IDBA 3O8TA 3P7CA 4I4EA 3OC1A 4JBPA 5DG5A 1H01A 1A06A 1WBNA 4RQVA 4DH3A 4BKZA 1OZ1A 3C0IA 3SD0A 4PPBA 2BDFA 2OKRA 3CXWA 3GU8A 5KMLA 5AIKA 5M53A 3DXQA 2PVHA 2XNMA 3UE4A 1PXPA 2ZB1A 3E88A 3FKNA 3Q3BA 4O91A 4RC2A 4TRLA 1CTPE 4CQGA 3HRFA 1P2AA 1YW2A 3MSSA 4FZAB 3MGYA 4N4SA 1APME 3PPKA 5BYZA 4BCIA 2OFVA 3HZTA 3NMUF 3MPAA 3RM7A 1WFCA 3A7HA 3R01A 4DG0E 3FI8A 3F7WA 3KK8A 4QTBA 2O64A 4PL4A 3LFNA 3POZA 4JQ8A 5CEQA 2QOLA 3VBYA 2CSNA 4QYGA 4ZK5A 5EKNA 2VTLA 2CNVA 4CG8A 4NTTA 5DOSA 5EOBA 2BILB 3EZVA 1FBNA 3K2LA 3SQQA 4AW2A 3EZRA 5DMZA 5C4KA 2PY3A 3O17A 3ZM4A 2YIYA 3KVWA 4BZDA 4Y46A 2PPQA 3NCGA 3PIZA 4FR4A 3EL8A 5AP2A 4GIHA 2YDKA 1MQBA 3ZRMA 3EN7A 4AN3A 1H1PA 1G3NA 4WG3A 3AC3A 3M1SA 4FG7A 4FKOA 4KIKA 4YBKA 4UZHA 5D7AA 4FV0A 4DHIB 5E8TA 3NUXA 4F99A 3TYKA 1FGKA 4BIDA 2A27A 4XG6A 4FTOA 4MXXA 2I1MA 2HCKA 4FUXA 1QL6A 3S2PA 2WGJA 2V62A 3KL8A 3R30A 4RJ5A 5IEXA 4BIEA 2JKMA 4QMPA 4XEYA 3KA0A 4AT5A 3ZO3A 5T3QA 3ZDUA 2CKPA 4F4PA 1VR2A 4G3GA 3GT8A 4CYIA 1YXTA 4TYHB 3UOLA 4HVDA 4O0RA 4U7ZA 2YWPA 4M0ZA 1B38A 2R3IA 3MA6A 3R00A 4JT3A 1R78A 1V1KA 2JFMA 4L43A 4CMTA 4IDVA 4IAYA 3EJ1A 4C37A 2PSQA 2CCIA 5CF6A 1H4LA 4CGAA 4I23A 1UA2A 3BYUA 3FLWA 4FNZA 4IWOA 5DWRA 5C9CA 3R83A 4XV3A 3UVPA 5DRDA 4EQCA 4ANBA 1W7HA 5KE0A 2ZM4A 3FMEA 3HEGA 3EFKA 1YHWA 4J99A 2Y6MA 5EHOA 4PTGA 4GFGA 1RJBA 3NAXA 3OY3A 4I24A 2YJRA 4JNWA 4QTCA 4RIYA 3E3PA 4WHZA 2VNYA 2VWUA 3L8SA 3WARA 3FZ1A 4CT2A 4XOZA 3I79A 3TZMA 4E6CA 5LVPA 4RIOA 2CCHA 3GUBA 3FUPA 3ORXA 3NIEA 5EHLA 3WE4A 2ITNA 2YLFA 3GC8A 4DFXE 4F1OA 1T46A 2VWIA 5E92A 4B6LA 2GS2A 5LXMA 3MB7A 3E3BX 2BRMA 3G9LX 3MDYA 1R39A 4RWIA 4BL1A 4PP7A 4O7YA 3DLSA 2XJ0A 3LXNA 2C6MA 4ONAA 3OEZA 3L8PA 4FTJA 4G1WA 4D2VA 2QVSE 2ZMCA 4ZLYA 3LLTA 3IGGA 2HENA 4C3RA 2OJIA 1ZY4A 4KKEA 5ITAA 1DS5A 1U54A 3COKA 5B0XA 5DYJA 3PRIA 2C3JA 2F4JA 4RWLA 4F9AA 2Z60A 3KCFA 2J51A 4X2KA 2WTKB 1YOLA 3NW5A 3PZHA 3RPRA 4HVHA 3W0PA 4CFFA 4GSBA 5IG1A 3CE3A 4YR8A 3UQGA 4ANLA 4GU9A 2W9ZB 4IIRA 1OKZA 4FK3A 3BKBA 4FV9A 4KBAA 5I3OA 1G8AA 4LOPA 1XH5A 4CG9A 5DNRA 5L2WA 4G2FA 3IW6A 4K9YA 3VW8A 4BN1A 4C35A 5IQDA 3F9NA 3KULB 2X2LA 2IVVA 3Q96A 4FG9A 2W4JA 4IQ6A 4ITIA 3Q2MA 3CD8A 5CNOA 2J90A 4D55A 4QMTA 3QD4A 4ZEGA 4YTIA 4GYIA 4UMRA 1UNLA 4A4OA 2X7GA 3CJFA 3Q60A 4IZ7A 1FOTA 4BCHA 5IA4A 4GVAA 2C5NA 4F0IA 3V3VA 3ZO1A 4MNFA 2YZLA 2JAVA 4USDA 4GH2A 5CVFA 3MW1A 4H1MA 4UB7A 3GGFA 5K0KA 4U97A 4BFMA 3ETAA 1AD5A 3H0ZA 3T3VA 3I5NA 2NRUA 4FSTA 4O86A 4MXAA 4R5YA 4R8QA 4FKVA 2J6MA 4I93A 5CF5A 1PMVA 1WVYA 5CF8A 2XNBA 3K3IA 3AC1A 4B9DA 4CFVA 3DOGA 3FLSA 3QCXA 3F7ZA 3SOAA 3EB0A 4ZLOA 5F1ZA 5LWMA 2V22A 5M4IA 2X8DA 5LVOA 1XQZA 4AA4A 5IQCA 2VTRA 1Q97A 4XP3A 2Q83A 3HA6A 4AN2A 4CRLA 2DS1A 2C4GA 3CPBA 5EM6A 4ACMA 5E8WA 5EQPA 2VWBA 4KABA 4X2GA 3FXZA 3VBXA 3GQIA 2QOBA 4RFMA 4QYHA 3MYGA 3BLQA 2BRHA 5G1XA 4DG2E 3LIJA 2YM6A 5CAQA 4IB5A 3MV5A 1IRKA 5ICPA 3AT2A 3V5TA 4FIGA 5E91A 3R7YA 2YDJA 5BVKA 4OTQA 1XO2B 4XCUA 5CWZA 2PE1A 4FIJA 4I0TA 5HD7A 4DYMA 2PUIA 3T3UA 2DQ7X 5M07A 4FTTA 4EI4A 4LQMA 3ZLWA 4ZTMA 3S95A 3JVSA 4IXPA 3MH1A 4K6ZA 2WD1A 3SXSA 1QPJA 3ERKA 2CN5A 3A99A 3OUNB 4HGEA 3EN5A 4DN5A 4ZY6A 3PE1A 4YC3A 4ALUA 4FV3A 3AKKA 3FL5A 3JR1A 2C0OA 1H0WA 2RL5A 4YZNA 3GU5A 2H6DA 4M7IA 5AP1A 4BI0A 3DTWA 1GIHA 2R5TA 3NNVA 4R3CA 4FKJA 4FT7A 4IX3A 3U8WA 1FMOE 3UMXA 4YU2A 3KGAA 3BV2A 2A19B 2JITA 1S9JA 4FSNA 4BCQA 3O0GA 4YUQA 4ZMEA 4BICA 1OUKA 4IMYA 4F9CA 3KF4A 4RX9A 1REJA 3BU5A 3NS9A 5FXRA 3W0RA 2VX3A 5AR2A 3V5JA 4KA3A 4BWXA 5E4HA 3HUCA 3AD4A 3B8RA 3OWKA 4BI1A 4BTJA 3FSFA 4LYNA 3EHAA 4JRNA 5K5NA 3L8XA 3NNUA 5CU0A 4O84A 2WNTA 3LXPA 1KSWA 3IG7A 4NFMA 4BGHA 4C36A 4G17A 5AP7A 3UG2A 3VQUA 4AA5A 2YM3A 5IUHA 3QALE 5DI1A 1ZYLA 4QP6A 4FIEA 2HOGA 4HCVA 4G16A 4O4FA 3SW4A 2ERKA 2WTJA 3QRTA 1KV2A 4GCJA 4ORKA 2YM8A 3IQ7A 3GU6A 4DCAA 5H2UA 2ZV8A 3DS6A 4GK2A 3Q4UA 2G2HA 2XKDA 4CV8A 2GTNA 4M68A 4FOCA 4UALA 2XIZA 1W84A 4FOBA 2Y7JA 2GSFA 3I7BA 4HPTE 4YLKA 1UNGA 2HZ0A 5J7BA 4HGSA 3GENA 3R02A 5I9UA 4FEWA 2YAAA 4L01A 4Q5HA 4NJ3A 1VJYA 4PL5A 4WKQA 4HVSA 4RIXA 3TNWA 4IAZA 5IQGA 2RG6A 4MD8E 2XKEA 3OZ6A 2VWYA 2ZB0A 4NIFA 4W4VA 3UC4A 1ZARA 2JDSA 1GZKA 4R6VA 2O8YA 4P2KA 1BUHA 4KS8A 2CNQA 2UVYA 4WO5A 2C6EA 5I0BA 4GJ3A 3GU7A 3R28A 4JIKA 3RWQA 2ITVA 4TYEA 3C4WA 4FTQA 3I5ZA 3BWJA 3K5UA 2QO2A 3BHVA 5H9BA 2WMWA 2Z7SA 3TJCA 4FZDB 4YPSA 2O65A 3KCKA 5EH0A 4MBIA 3QGWA 3EQPA 1O9UA 4L9IA 3PLSA 3JY9A 3QUEA 2RFNA 3KFAA 4P90A 1W82A 3PUPA 5GINE 3PE2A 1H08A 4JG7A 4KSQA 5AWMA 2XS0A 2W5BA 4U3YA 3S3IA 3UMWA 4EH7A 4EHEA 5GJGA 5ANOA 3D7TB 4QNYA 4BTFA 3D2IA 4EWQA 4BCOA 3P1AA 2IZSA 1GZOA 3C4EA 2CDZA 1JLUE 3B2WA 3OCBA 4QP4A 1M2RA 4KD1A 4DH7A 4J7BA 5CEIA 3BHUA 2I7QA 2W5AA 3NAYA 4QRCA 3N4TA 1E9HA 1YDTE 1ZYSA 2OJGA 3VUKA 4FE2A 4LM5A 5FTGA 4NH1A 2YACA 2CLXA 3LJ1A 4RJ3A 3QZIA 3D14A 2ZDTA 3EOCA 3BEAA 3NLBA 4IVBA 5I9WA 2W0JA 2VTHA 1IR3A 1YWNA 4I5HA 4WRGA 3G5DA 1ZAOA 4ZTQA 3DTCA 3ULZA 5CI7A 5B7VA 4O38A 2EWAA 1F3MC 3PRFA 3R7IA 2XUUA 2CGUA 1AGWA 3EYGA 2F49A 3PJ1A 4BDCA 5JKGA 2BTSA 3I0OA 3R1SA 2C6KA 3BI6A 4RZVA 4AXEA 2XARA 5I9XA 4BBMA 2YAKA 3ZRLA 4YJSA 1DM2A 3MS9A 4AF3A 4YNEA 5CAUA 3NRMA 5CNNA 3F2RA 3RAWA 4Y73A 1SMHA 4FKRA 5JRSA 4RA4A 3FEGA 2WELA 2X0PA 4R7IA 4OLIA 5AJQA 3FZPA 1XMLA 4D9UA 4O4BB 4FA2A 3OD6X 5I3RA 5KCVA 4FODA 2YIXA 3RBWA 2XBJA 5CY3A 4QP2A 3V01A 3UTOA 5K4JA 2XK4A 4WBOA 5JFXA 3E8NA 2PL0A 5HHWA 4GMYA 2YM5A 5GZ8A 3POOA 4KINA 4K2RA 4RGJA 3TIYA 5D11A 4DH8A 1XMMA 1XBCA 3F5XA 5CXZA 1TVOA 2FVDA 5JH6A 4FKQA 1I09A 1M7NA 3FQEA 2G2IA 4QMNA 4IC7A 3FC2A 4H3PA 1RDQE 3IPHA 3U54A 2GTMA 5KNJA 5EYDA 5KZ0A 3HECA 4LFIA 3BL7A 3PZEA 4ACGA 4Y95A 1CKPA 5TF9A 2XK3A 2IF8A 4J97A 5EM5A 2UW0A 3F69A 5DR6A 5CF4A 1VLRA 1CKJA 2WMAA 3OUKA 2ONLC 3OCGA 1DAYA 1CDKA 3KKVA 2YCQA 3EIDA 4XG3A 4O27B 4AXDA 3ACJA 3V8SA 1Q61A 2BALA 3KN6A 4F7NA 4ITJA 2Y0AA 4WA9A 2VTJA 4CKIA 5DT0A 4OT5A 3LPBA 2XNGA 4O96A 3KEXA 3OXZA 3LQ3A 2BZJA 5KO1A 3PSCA 3IS5A 4E7WA 4AQKA 1PJKA 3BBWA 5AV1A 3DZOA 3GFWA 3C7QA 4OTHA 4QPSA 5F95A 5HI2A 4S30A 2HZ4A 1YQJA 2C6IA 2W17A 3EFLA 2P2HA 2PVNA 2V0DA 3MB6A 4FKGA 4J8NA 2GS6A 4BCJA 4ANQA 4AW1A 3VUTA 2UZNA 5DT4A 5IISA 2ETRA 4EH3A 2ERZE 3AGMA 5I9ZA 3NX8A 4EOKA 5HCYA 5L2QA 2PVLA 2R3QA 5LCJA 4JMQA 3LFCA 2Z7QA 3QYZA 3UIXA 4C0TA 3ZH8A 3JS2A 4BBFA 4NYEA 5IA5A 1AQ1A 4OW8A 5HLWA 4HCUA 3RAKA 2GNGA 4FKLA 4CMOA 4HOKA 2QKWB 3G6HA 4J8MA 4L45A 4FSYA 4U5JA 3V8WA 1PXOA 4GRBA 4ZP5A 5HX8A 1G8SA 4MH7A 3Q9YA 4CFUA 2VWZA 3E93A 4X3FB 3KC3A 4QOXA 2QU5A 4PDSA 5LWNA 4L3PA 4I92A 4ZOGA 3UOJA 3DNEA 2BAKA 3SXRA 4O7NA 4K0YA 3P7BA 4JG6A 2VTQA 5LVNA 2IW6A 1PKDA 4IAKA 5I9YA 2ZOQA 5CYIA 2HWOA 4ENYA 3ZDIA 4AU8A 1QPCA 4CV9A 4TWOA 3WZEA 3BLHA 4DINA 3AXWA 3OXIA 5HORA 3R9RA 3R0TA 2JKOA 4XV1A 5EI2A 2WIPA 4JS8A 3GU4A 4IWDA 3RNYA 5HIEA 3LM0A 5AUZA 4G34A 5C8KA 3KMWA 4BY9E 4YHFA 1ZMUA 1MRUA 1H8FA 5A4CA 4NW6A 2I40A 4O7SA 2EU9A 3ZS5A 4FC0A 2YDIA 3W0OA 3FL4A 4USFA 2QCSA 4AOIA 4X3JA 4Q9SA 4XS2A 4UBAA 2YHVA 4O0UA 1W8CA 2ITYA 3ZSIA 4QPAA 5AUTA 3H10A 4QMUA 4L44A 1GAGA 3H9FA 3VBQA 1YHVA 2W05A 3P5KA 1PY5A 4BWKA 4AZFA 3U4WA 3W2SA 4H58A 4DEHA 3BHHA 4QTAA 3G6GA 2R3FA 4FBXA 3GI3A 1JKKA 4MF0A 4XP2A 3SC1A 5F9EA 4E6QA 3NFGB 1M7QA 3HGKA 5B2KA 3P4KA 1WBSA 4LV8A 4GEOA 5K0XA 3QD0A 3MTFA 1ZLTA 2QURA 2JIIA 4O6LA 4R3PA 5EW8A 1PMEA 1CMKE 2PZIA 3W0NA 3FMNA 1YXUA 3R1YA 4ENXA 2B9HA 4V0GB 3QRUA 3E64A 3DAKA 4AXCA 4DH1A 1WVWA 2BMCA 4F63A 4RJ7A 5E8VA 3C13A 2C47A 4M97A 3L1SA 4IADA 2PVMA 5AA9A 1TZDA 1QCFA 3EKKA 3OTVA 5HESA 2VTNA 3FPQA 2NRYA 3MFTA 4E4MA 3HL7A 1KV1A 1Q62A 2W4OA 4BDGA 4CVAA 1OIUA 3LJ2A 4UMUA 5CAOA 5GNKA 3U6IA 2FSMX 2XM8A 3ORTA 4G3FA 3UPXA 2PVFA 2XK8A 3A2CA 3MH0A 4E5BA 4NJDA 4QMZA 4LV7A 4MKCA 4DLJA 4F1MA 2ITOA 3HVCA 4NU1A 5TE0A 4F7JA 5DEYA 3OFMA 5HKMA 5M09A 4XV2A 4O1OA 3FY0A 5IUIA 3K54A 4O81A 2W7XA 5JFSA 4GG5A 2OJ9A 4QP1A 4FKUA 4RRVA 5JK3A 3UPZA 3DK6A 3L9NA 4S34A 3QRJA 4D2WA 2JDOA 4O2PA 2O2UA 3QLGA 4I22A 4XBRA 2J2IB 1U5RA 3TJDA 1WMKA 3PP1A 4MNEA 2PUUA 4CQEA 2GNHA 2WMUA 2B0QA 3UNZA 1SNUA 3FI3A 2Z2WA 3EN4A 3IOPA 4Y72A 5HG8A 3UOHA 1YI4A 5GJFA 5K3YA 2NNWB 3HLLA 1Q5KA 2B9IA 3QKMA 1ZZ2A 5M4FA 4HGTA 5ETCA 1UU9A 4WIHA 1VYWA 4BC6A 2Z8CA 5LARA 4BRXA 5B2MA 3QHWA 3WIKA 5JGAA 3NWWA 5CSWA 4AT3A 3I6WA 3HRCA 1Q3WA 4U45A 2OGVA 4QTDA 3W18A 2NYAA 4LRKA 5BPYA 3CJGA 4JAIA 4NUSA 4AZWA 3FKOA 2YZAA 2F7XE 3DBQA 4F64A 2OJFE 3DNDA 4GFMA 4RIYB 2CKEA 3T8OA 1OPLA 4JR7A 5EDPA 5KMOA 3FMHA 3D5VA 2UW3A 4EEVA 4YO6A 5M51A 3MVLA 4II5A 3IGOA 2QOIA 3MY0A 3ZTXA 4EOLA 4DEAA 3TKUA 5J1VA 3FDNA 4Z16A 4R3RA 3LJ0A 5CI6A 5A6OA 2JDRA 5HCXA 4R7HA 5CU4A 5DN3A 1XJDA 4RVKA 1JKSA 3DXNA 5FRIA 1RE8A 2F2CB 4PUZA 5BUEA 1M14A 4AZVA 5A14A 2ETKA 4QDVA 5HBHA 3DBFA 2E9VA 4G5JA 5L6WL 3NUNA 4DDGA 4N6ZA 1Q8ZA 2W1GA 2XNPA 3F2AA 5F94A 5DHJA 1Q8UA 2RFDA 4EHGA 2G1TA 5ETFA 2Q0BA 1SVEA 4ANSA 2XIKA 5T6KA 3FMLA 5EM7A 4C2VA 5ACKA 2Z02A 2Y4IB 1ST0A 3Q4CA 5L2TA 2B55A 3FC1X 5BUJA 3GCVA 5BVOA 5FXQA 2YM7A 3BHTA 2OSCA 4DFLA 4EORA 3MFSA 5EFQA 4YJOA 5FEDA 3DBDA 3HAVA 3R7GA 1O6YA 5D12A 2OIQA 2Z7RA 1Q24A 4BDEA 3BGPA 2VO7A 2GNFA 4YLLA 4RVMA 3PY3A 5TKDA 3GEQA 3PJCA 4EOQA 4E20A 3ORZA 5I9VA 2QOFA 2R0IA 4M12A 4QP7A 5H3QA 4D9TA 4F6SA 2Y4PA 2XNEA 4M84A 4DFUA 5CXHA 4PWNA 3KMMA 2CJMA 4U44A 4DE4A 5D7VA 3K3JA 1KE9A 5HIBA 4F70A 5EYKA 4OBOA 2W1DA 4RG0A 4C57A 2XA4A 3I81A 5AP5A 3HX4A 4W4YA 5A4LA 4A9SA 3QTQA 2JBPA 2XMYA 4I0RA 3FMKA 5FBOA 4XUFA 4XG9A 4DGMA 2I0EA 2F7ZE 3IDPA 3W8LA 5A4EA 3IOKA 4YGAA 3UYTA 1NVQA 5JN2A 4I5CA 4W8DA 2UW9A 1OIRA 3TNIA 3LQ8A 3FQSA 4P5ZA 1DI8A 4AX8A 3U55A 3CC6A 4FMQA 1PXJA 3DQWA 3LFDA 3F2NA 4IFCA 4IBMA 3U9CA 5IEYA 3OROA 4J53A 4TZRA 2VX0A 1K9AA 3DDPA 4MF1A 4GKIA 3PSDA 4AZSA 4CEGA 4KRCA 4EOJA 2PK9A 4FTNA 3KXHA 1UNHA 4UEUA 3REPA 4BGQA 4CZUA 3PVGA 5KMMA 4YJQA 4E3CA 3ZRKA 3NUAA 2ACXA 4CYJA 2R3OA 3KU2A 5FP5A 4EKLA 5KMNA 3DCVA 3OXTA 2YJSA 1J7UA 3VN9A 3UO5A 3NNXA 2RSVA 5FTOA 5LVMA 3BELA 4YHJA 2R3HA 1GIJA 4TNDA 2NO3A 4N70A 2QI8A 5E7RA 3ATTA 3EQDA 3OEFX 4FT9A 4R1YA 4A9YA 2OZAA 4EONA 5AFVA 4F9WA 4F08A 2CPKE 4IAAA 3TZ7A 4CSVA 1LR4A 3FZTA 4E6DA 2BZHB 2ONLA 2WMBA 4U3ZA 5AV3A 3KXXA 5AUYA 3DB6A 4LOQA 3W2OA 5BNJA 2C6DA 2W1CA 4L68A 3SGCA 3AKLA 4YLJA 4L00A 1CM8A 1PHKA 1KWPA 2YCRA 4H36A 3F82A 2PUPA 1X8BA 1W98A 2OXXA 2REIA 2JFLA 3EH9A 4HYUA 4ID7A 5DT3A 2I6LA 4DTAA 3TZ9A 3Q9WA 3WILA 3JUHA 1TFFA 3PY0A 1P5EA 4I1ZA 4JX7A 2LAVA 5IDPA 1PMUA 1KE5A 4N57A 2UZTA 3RP9A 2OLCA 1PW2A 4RQKA 3UGCA 2HW7A 2P0CA 4OAUC 4FSZA 3UODA 1QMZA 4I0SA 3MJ2A 4D28A 3C5UA 3IONA 5JMSA 1FVTA 2WAJA 3DJ5A 2QU6A 2OU7A 1R0PA 5HBEA 3R7UA 1XKKA 4ZTSA 2LGCA 2PE2A 2XRUA 4D5HA 2QOQA 4IDTA 5C4LA 3O2MA 4MTAA 3ZOSA 4BDHA 4ERKA 3OW3A 5LOHA 1V0OA 3R1QA 3MFUA 3ZZEA 1U5QA 2GCDA 2O3PA 1BLXA 1WZYA 1OGYA 3GCUA 3W2QA 2VO0A 4ALWA 2A1AB 2F57A 2OZOA 4U6RA 3ML1A 4MUQA 1OL6A 5E90A 1ZYCA 2ZM1A 2R3RA 3UP2A 4IZ5A 4ZTRA 5CALA 3D4QA 4YC6A 3FYKX 2OO8X 4C8BA 2AC3A 3FPMA 1ZZLA 3HYHA 3DY7A 1OL2A 3ATSA 3ZXTA 3GOPA 4FKIA 4RJ8A 5I5ZA 4EUTA 3DKFA 5BQ0A 5IH4A 3QCQA 4F65A 1J91A 4DGGA 4JBQA 2JDTA 3QKLA 3K5VA 5KKRB 3HP5A 3ID6C 2FH9A 3FLZA 5LCKA 4BHNA 2JD5A 2OW3A 2IZTA 4CZTA 3O7LB 2HAKA 2W99B 2NPQA 3DKOA 4HYHA 3Q5ZA 4PX6A 3OOMA 4M15A 5HU9A 1PXIA 2PTKA 4ERWA 3EFWA 3G0EA 4AFEA 4U40A 4E5WA 3CBLA 2IEWA 4O4EA 3FJQE 3NW7A 4GT4A 5KBRA 3BIZA 4Y8DA 5T68A 3GB2A 4C33A 2WOTA 3DFCB 4GV1A 4EWHA 4I21A 4P5QA 3ELJA 4F7LA 5IU2A 3OCSA 3RPOA 4FUYA 1Q41A 4ZJVA 3UDSA 3SRVB 4U8ZA 4YJNA 4FSUA 4C62A 2PZRA 2RFSA 4C58A 4G6OA 5GIOE 2JIVA 4IHPA 4AA0A 2XRWA 3DA6A 4QQCA 4ASDA 3SLSA 4RA5A 5AV0A 3UIMA 4E4LA 4WNMA 5JEBA 3EL7A 2PMOX 3SHEA 3G15A 3PY1A 4R78A 5CVGA 3AD5A 5AP6A 3HV7A 4JOAA 1IG1A 2UZOA 4ZS0A 5HE3A 4ACHA 5AP4A 3U51A 4MD9E 3ZO2A 3ZUVA 5IMEA 1DI9A 5CAVA 4J96A 4ALVA 1H0VA 5C8MA 3O8PA 2OICA 3MESA 4JBOA 4RSSA 4D1ZA 3A62A 3E8DA 5LMBA 4TXCA 4BDFA 1L3RE 3DU8A 4EH8A 2E9OA 3R21A 4O22A 5AV2A 4EH9A 1WAKA 2CKQA 2R7BA 2ITZA 3PIYA 1MP8A 3KREA 5GHVA 3TUCA 4QO9A 1BI7A 1TQMA 4LMUA 4PV0A 3ENHA 3W2CA 1ERKA 2WTWA 4KS7A 5AUVA 3ZSGA 3AQVA 4J98A 5IQAA 2WOUA 3ZLXA 1BX6A 4QQ5A 5ANEA 3DBEA 3Q4ZA 4A07A 5CT7A 1UU3A 5CSPA 3Q2JA 1J1BA 2R3GA 3LW0A 3UZTA 4FKPA 1W2CA 3MVJA 2XBAA 3BLRA 3ZZWA 3NNWA 3QWJA 1UKIA 3S4QA 4BDAA 4U9AA 4AW0A 2CNUA 4F78A 2X2KA 5GIPE 1IA8A 3PJ3A 3ZSHA 3R7OA 4JI9A 3VS3A 2XALA 2GQGA 3QHRA 2WMRA 4LG4A 3M2WA 4A9TA 4WNPA 4PNIA 3ROCA 4JBVA 4WSQA 3FBVA 2HY0A 1XBBA 3PG3A 4JR3A 1OIQA 4G6LA 4D1SA 2Z7LA 3OMVA 2B9FA 1PYEA 4EOOA 1XH6A 2UW8A 1OM1A 2HWPA 1YOMA 3MVHA 2X4FA 4RVLA 5FDXA 2XAMA 2XIRA 3D5UA 4XP0A 2B53A 2JDVA 4KKHA 4O4CA 3DZQA 3O23A 4NFNA 2UZVA 4QYYA 2IVTA 4AW5A 3AC5A 4ZZNA 1PXKA 3TL8A 4FTKA 3TV6A 4LL0A 2G9XA 2QR8A 2R4BA 3FZRA 3PLAE 2GNLA 5M4CA 3D7TA 1FGIA 3V04A 1OECA 2BRGA 3TNQB 2QONA 4XMOA 2OI4X 3TNHA 5BVEA 4O0VA 4MK0A 5AM7A 3UZPA 3HV4A 4MQ2A 5AAFA 3MPMA 4QNAA 4LV5A 3RPSA 3UIUA 3ZXZA 4EBWA 2PVRA 5C1QB 5HTBA 3QQUA 4X2NA 3EQCA 3F88A 3HUBA 3A7FA 5IQBA 3CP9A 1VEBA 4TYHA 4O6EA 4IX5A 4YZ9A 2Y6OA 2WPAA 3A61A 5M55A 2AYPA 2W1ZA 4K77A 5BUIA 4LRMA 2E9NA 4O2ZA 4EUUA 3TNPC 5HD4A 3R2YA 4GW8A 3C1XA 4EOMA 2VGPA 2XEYA 1JSUA 3ZEWA 2ZYBA 3FE3A 5EKOA 4JLCA 1F0QA 1P14A 3TV4A 2CMWA 2JGZA 3M11A 4AFJA 3SW7A 4ZZOA 3Q9XA 3VQHA 4EK4A 3KY2A 3WF6A 3F5PA 3AGLA