2GTNA

Mutated map kinase p38 (mus musculus) in complex with inhbitor pg-951717
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title The development of novel C-2, C-8, and N-9 trisubstituted purines as inhibitors of TNF-alpha production.
pubmed doi rcsb
source organism Mus musculus
total genus 105
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gtnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gtnA01
5K5XA 3C50A 2WMRA 3LJ2A 4DGOA 3CTJA 4KB8A 2IJMA 3PZEA 5EFQA 4NKSA 2WTDA 3GOPA 4C62A 1BLXA 5ANJA 3VS6A 4GIHA 3P7CA 4GYGA 4ITIA 4JNWA 3FKOA 4CYJA 3C0IA 4L67A 2W05A 2VTRA 4TN6A 3PVBA 1H25A 4OTDA 4EBWA 5LQFA 3ZFMA 4NSTA 2WMUA 5JFXA 2PUIA 3QTIA 1YQJA 2F7ZE 3DLZA 5J5SA 1GIJA 4KBCA 2JGZA 3A61A 4WNOA 5AUYA 3LLTA 1U54A 3FLZA 3FE3A 5LMKA 3NSZA 3CGFA 4EOOA 1IASA 3FL5A 1OPKA 1P2AA 4IAYA 5BX0A 5JGAA 4YJQA 3OC1A 2A1AB 3GUBA 3DS6A 2BKZA 4I6FA 4DN5A 3E93A 2V7OA 2AC5A 2WTKC 3ZLYA 2XVDA 5IUIA 1ZMWA 1U5RA 2OKRA 2ZV2A 2QCSA 3QTXA 4ENYA 4ALVA 5CF4A 4RIXB 3EQFA 4R78A 2J7TA 4ZSGA 4R1YA 4DFBA 3IQ7A 5IPJA 3H3CA 2GQGA 2RF9A 4G2FA 4H58A 4OT6A 3KC3A 3BU5A 3G51A 2W1DA 3ZFYA 1VYWA 4ANOA 3U6IA 4FSRA 4NJDA 3SRVA 4QYFA 3I7BA 1PHKA 3QA0A 4KUJA 2CN5A 5KMNA 4JR3A 4E93A 3U6JA 3WF8A 2XKEA 3VUGA 2V22A 4BF2A 5I9YA 4ZS4A 2OJJA 3OTVA 3NUYA 3B8QA 4CZTA 4BWPA 2RL5A 4HYSA 4NM5A 4I20A 4QP3A 2C3IB 4BZOA 3CD3A 4XV3A 5KO1A 1PRYA 2HWPA 2REIA 3ZSHA 4MWIA 4BCKA 2GQRA 2XK3A 3IPHA 4Y5QA 4F7NA 2BILB 2HYYA 3C0GA 5K3YA 4MBJA 4DITA 2WMQA 4W8EA 2C3LA 3KRRA 4IEBA 4U45A 3MFUA 1W8CA 4H1MA 4M3QA 2IZTA 4D55A 2R4BA 4G9CA 1NT2A 3COMA 5HE0A 2RFSA 1FVTA 5IQDA 3F69A 4PQNA 4KA3A 3CC6A 4C58A 5FP6A 4HYIA 4NIFA 3OWKA 4TW9A 2FSLX 5IQCA 4DEIA 4EOPA 4W4VA 5AP7A 4BRXA 4WSYA 5HLNA 2OJIA 5A4QA 4ZSJA 5GJGA 4X3FA 4D5KA 5J7HA 3KRWA 3U9NA 1YXTA 5A4TA 2WO6A 2XJ0A 4XUFA 5HKMA 4X2NA 3RM7A 5E8TA 2VX0A 4O82A 3ORXA 4APCA 4BDGA 4YLKA 3VQHA 4FKGA 2GNLA 3ROYA 5LCKA 2XYNA 2YCFA 3HLLA 3KXHA 3PXKA 2CLXA 5DA3A 4F09A 3Q9WA 2ZV7A 3NUPA 3DNDA 3A7IA 3DT1A 2UW6A 3QKLA 3FMMA 4FKSA 3NRMA 2J2IB 2WTCA 3Q60A 3QHRA 1ZMVA 3NUUA 3RK5A 3NVMB 4CG8A 5D12A 4IQ6A 4C4EA 3CTQA 5BUJA 5FDPA 3ZYAA 3VS1A 3BYSA 3CY3A 1XHAA 3ALNA 3PIYA 2EXEA 2YCQA 4QYYA 2ZM3A 4Y72A 4XG6A 5IG1A 3HP5A 3JVRA 5TE0A 3WF9A 4X2KA 4AGCA 4XS2A 2YEXA 3G15A 1BUHA 4MD7E 4AZSA 5JH6A 4H1JA 3O7LD 4I4FA 4FEWA 2HY81 4B8MA 5JQ8A 5BVWA 3HVCA 4Y46A 4EYJA 1GY3A 2XNGA 3LFCA 2R3QA 3FMDA 3NNUA 3L8SA 3F3UA 4LRMA 2ITQA 2XEZA 3I1AA 3QALE 4DTBA 4TXCA 1NXKA 4UBAA 3R8LA 1H26A 2UZLA 3JXWA 3NPCA 4GJ3A 3FLNC 2A27A 4IX5A 4HVGA 5J5TA 3HGKA 3DBEA 2J9MA 4G31A 4F6WA 4L7FA 5BVDA 2FH9A 4W9XA 3QRJA 3DB6A 5D7AA 4WRSA 4U9AA 5DR9A 3B8RA 4AW1A 4KSQA 3ZSIA 2QO9A 3K3JA 5JKGA 3UPXA 3PVWA 1UNLA 2FB8A 3JPVA 4QP9A 3R9HA 3UG1A 3R1QA 4E7WA 3DU8A 3KULA 3W33A 3SVVA 3BU6A 1YHSA 4FKOA 5A46A 4MWHA 2O63A 3U54A 5I3OA 1MQBA 4XV9A 4BKYA 1BL6A 3I79A 4G6OA 3OEZA 4EBVA 5CALA 2YM3A 4FEXA 3LCSA 4PMMA 2RFNA 3WF7A 3W2QA 3DXPA 5ANKA 3A7JA 3H0ZA 3MH2A 3BGQA 3Q2MA 4LGGA 4PL5A 1PXIA 1Q97A 3LKMA 2R3FA 1CDKA 4E6CA 5M08A 5KBRA 3GENA 2I1MA 3EFWA 4RFMA 3RK9A 4ZLZA 4IX3A 3EYGA 5TF9A 4WUAA 5BUEA 2X6DA 4HZRA 5FG8A 2Q83A 2G2IA 3FI2A 5DH3A 3VF8A 3DZQA 3QCYA 2Z8CA 3ERKA 4HYHA 2EU9A 3GU7A 3M42A 4XCUA 5AR2A 3OMVA 3PA4A 4O27B 3RPYA 1WBNA 1W82A 3MTLA 4G3CA 4ERWA 5I3RA 3PXZA 2WOUA 3CQUA 1QPCA 3QXPA 4M68A 4ZTNA 4JBQA 2YCRA 5JRSA 3R1YA 3F2AA 3TKIA 3UNZA 2B0QA 3N51A 5CU4A 3Q4CA 2UZUE 3BWFA 4G5JA 3LCDA 4IWOA 3GBZA 4CFFA 4KIKA 2W17A 2EWAA 3TUCA 4DH1A 3PZHA 2W9FB 3LCKA 5C8NA 4FIHA 5IDPA 3AMBA 4AW2A 4RFZA 4WUNA 3F7WA 2HY0A 2CSNA 4FTQA 5CENA 2FSTX 3IW5A 3RAKA 2JEDA 3G0FA 4KKGA 3IGOA 2JBOA 5I9WA 5JSMA 4A9UA 1UVRA 1GNGA 2F4JA 5HX6A 4EOKA 4S30A 3L9NA 3KXMA 5EOBA 4HW7A 3I0QA 4HCUA 4WNMA 4ZLYA 3UBDA 4FVRA 4BWKA 1YOJA 3V3VA 3E88A 3V5WA 3WILA 3R9DA 3KVXA 4D5HA 5AIKA 5AFVA 4FKLA 1FVVA 3R7UA 5CI7A 3FZRA 1STCE 4ZMFA 3QTZA 4G6LA 2JIVA 4AN3A 5AV3A 2X0GA 2VO7A 5BVNA 3D2IA 4F0FA 4TYEA 2QR7A 3F3VA 2V55A 4U41A 4WIHA 4XMOA 3UQGA 1B6CB 2ONLC 3DTCA 3VS3A 3DAKA 3ZU7A 4XH6A 3HAMA 4QRCA 5HHWA 4PDOA 5FP5A 4O7VA 2OICA 3HUCA 5CZHA 5EI2A 3QZIA 4GRBA 2VTJA 3OFMA 2P3GX 4R3PA 2J0IA 5HIEA 4AP7A 4GEOA 4NWMA 2C3KA 3QWKA 3OWLA 5CXZA 3P4KA 4O86A 5KCVA 4RJ8A 4AZEA 5IA3A 4RWJA 2C6LA 1OKYA 2PY3A 1KV1A 3E7VA 4EOJA 5A4LA 3BKBA 3GOKA 2X8EA 3FXZA 4F65A 2UW7A 5CWZA 4LOPA 2I40A 1OUYA 4CZYB 4DBXA 3I60A 2GNIA 3D5WA 4L46A 4BDJA 2JDVA 2BRHA 2C6IA 3FZOA 4IJ9A 4A07A 3G90X 5L6OA 5ANOA 3QAME 3O8PA 3VJOA 4YZMA 2IZUA 4EH9A 2OF4A 3GCQA 4YNOA 4PL4A 4ZSLA 3DAJA 4QP8A 3C4CA 1OVEA 1G3NA 1QMZA 2W1GA 3NYOA 2XRUA 3QL8A 4QTBA 3RHXA 4ACDA 4P90A 2YJRA 5BQ0A 3R9NA 2VTIA 4NEUA 3SRVB 2ZYBA 2YLEA 4KBKA 1DI9A 1J7IA 4LRJA 3SGCA 4BDAA 4YBKA 4C36A 1Y57A 4RC2A 4QP1A 1KWPA 3A8XA 2QOQA 1MRUA 2PWLA 2DS1A 1ZWSA 3FZPA 4XP3A 3TACA 4QQTA 5CEPA 1PXJA 2C5NA 3DLSA 3QCXA 4YO6A 5AUUA 4O7RA 3KF4A 2PVRA 4I5PA 4YJPA 5AUWA 3JVSA 2CHLA 4F0GA 3SXSA 4IM2A 3LFSA 2DQ7X 3CQWA 4O0YA 4PNIA 2JKMA 3QTSA 3LCOA 3ZC6A 4CT1A 5IH5A 4L45A 1YHWA 2EUFB 4F63A 4YNEA 2R9SA 3G6HA 4PRJA 3TIYA 2Z02A 1UNHA 5F94A 4E6AA 3LXLA 4K9YA 3VHEA 2GNFA 3W32A 4DFZE 4JRNA 5GZAA 4NIFB 3FQHA 3KXGA 3P78A 3VUDA 4DEDA 1HOWA 2B9FA 4RBLA 5IEYA 3A99A 5FEQA 3R21A 4XLVA 2OW3A 5IZFA 5JFVA 4JG8A 3ORZA 3SG9A 2OO8X 4M15A 2EVAA 1Z57A 3IW6A 4DH3A 1IA8A 2XA4A 1WVWA 3RNYA 5L4QA 5DVRA 4K6ZA 3LMGA 2C6TA 4FV5A 3ET7A 4WHZA 3AQVA 3NYVA 4O2ZA 2R0IA 2YIXA 4FOBA 4MNFA 4RVMA 5K5NA 4D2RA 3PPJA 4FL2A 2X9EA 3EQBA 2E2BA 5D11A 1GAGA 4C3RA 5HU3A 4B8LA 5TOZA 2WU7A 5CEKA 1JOWB 1KOBA 3C9WA 3D2KA 3IW7A 4FG7A 4CCBA 1H1SA 2EB3A 3COHA 1JKKA 1WAKA 4IX4A 4YHJA 5B2LA 2W1HA 3AOXA 3PP0A 3EKNA 3W2PA 3ATTA 2XF0A 4A4XA 3TZ7A 5AV1A 3CGOA 3ZTXA 2PMLX 4I5CA 5CI6A 4XJ0A 1JKLA 3JS2A 4YHTA 3DJ7A 3E8CA 2FO0A 5CF8A 3THBA 2R3LA 1Q62A 2OSCA 3TL8A 2PVMA 4HVSA 4XBUA 3LFEA 1OZ1A 3M1SA 4CFUA 3L1SA 4CV9A 3L8XA 4ACHA 3QTQA 1XH8A 4BL1A 5CSWA 2CN8A 4YJSA 3V5QA 4DC2A 3NYXA 4ZMEA 2IG7A 3MPMA 4WG4A 5FTQA 3RAIA 1U59A 2PVKA 4JDHA 4LL0A 2W1FA 2YN8A 4JXFA 3DKFA 4ANSA 3UOJA 1S9IA 5IU2A 2B4SB 5JK3A 3C7QA 4GS6A 1SZMA 3PRFA 4HVIA 4FT5A 3TV7A 5DOSA 2VZ6A 1I44A 1G5SA 3EL8A 5HCXA 5AV4A 3MVJA 5F20A 2YLFA 4BCMA 3PWDA 4C4HA 5A3XA 2RFDA 2R2PA 2UW8A 3MN3A 2B1PA 3PJCA 3UNJA 3CBLA 5M06A 5FRIA 1ATPE 1PYEA 4O1OA 1LP4A 1HCLA 3IW4A 3KN6A 3Q6WA 4GVAA 5IQEA 5J87A 4IC7A 2YZLA 3WZKA 2C6KA 2JAMA 4E20A 1KV2A 3P23A 3BQCA 4O2PA 5AWMA 3UGCA 4RFYA 4QTCA 4AS0A 2R3NA 3OHTA 1PXNA 3V04A 2E9PA 3E3PA 4DG3E 5HTIA 3C4WA 3NYNA 3NEWA 5BVFA 1SNXA 3WYXA 5LCJA 3ALOA 4W8DA 4GG5A 3UODA 3KXXA 4FSQA 3MTFA 1H4LA 2QKRA 2HENA 4E6DA 3V8TA 4CLIA 1IAJA 2OH0E 3E62A 3KB7A 5HZNA 4O0XA 1T46A 4S32A 4HZSA 2QD9A 4WKQA 5G6VA 1H07A 1AGWA 2G2FA 3KRJA 2RFEA 3EQPA 1H27A 5I5ZA 4U3YA 2ITVA 4D28A 3WYYA 5HD4A 4QNYA 2J5EA 4FYNA 3KXZA 4H3BA 4RQKA 2QG5A 4FTLA 4C59A 4DG2E 4ENXA 5L2WA 4JS8A 4PV0A 3FWQA 3MA3A 4YGAA 4IAAA 2C5VA 5DGZA 5C27A 2QI8A 3R30A 5M4IA 3QD2B 1YWRA 1OL1A 2QOHA 3R2YA 4H3PA 4IZAA 3OCTA 4EEVA 1KUTA 5CSXA 3OXZA 2RGPA 4DBNA 1WZYA 5CZIA 4D2PA 2XIZA 4MQ1A 4NJ3A 5F4NA 2W5AA 3EFKA 2UVYA 4DEEA 1H1WA 4KSPA 2HZ4A 2I0YA 2XIYA 4M97A 5DEWA 3TDVA 4KRCA 5AR7A 2RG6A 3FZ1A 2OXYA 3ZO4A 2H9VA 2R3IA 1OBDA 3FY0A 2NRYA 3T9TA 3D4QA 4JAIA 4KS7A 3UVQA 4YSMA 2GS6A 3QUPA 4I21A 1F5QA 4IWQA 4NH1A 4E4LA 4ANMA 3QUEA 2JLDA 4D2SA 2OH4A 4U43A 3SD0A 4M67A 2J6MA 3HV7A 4FIEA 1KOAA 4P4CA 4ZS0A 4BYIA 3KREA 4C2VA 2R3RA 2R3OA 2VV9A 3K5VA 2CGXA 4DCAA 2IWIA 3BHUA 5EKNA 3LMHA 1WBOA 2VNWA 5E8UA 2XCHA 1O6YA 3ORTA 4H05A 1ZMUA 3HMPA 3TM0A 5D7VA 1VJYA 3ODYX 4FKJA 2GHGA 1WBSA 4FKTA 2QOOA 4ITHA 4O38A 5KMMA 4L00A 1PXOA 2XP2A 3DDQA 5M56A 4X2JA 5AEPA 3FLYA 4FF8A 2P2IA 4YURA 3T3UA 4PDPA 4BIDA 3C0HA 3PIXA 5IQIA 4O7NA 3ZM9A 1U46A 2ESMA 3AT3A 4BKJA 3CLYA 4ZTLA 3FSKA 3LJ1A 4K77A 2OJGA 3NR9A 3RALA 4HVDA 3NW6A 2W96B 2ZDUA 3GC9A 1VR2A 2R3KA 2J4ZA 3SW7A 1RE8A 1URCA 4FKUA 4G17A 2XBAA 5CX9A 5J95A 2XK6A 4EHVA 1WVYA 3DJ5A 4P5ZA 1BL7A 3DFCB 4LG4A 4Y95A 3R8PA 1IRKA 2WTIA 4D4YA 1PXLA 3C51A 2ITTA 2Y8OA 2XNEA 2ZAZA 4UYNA 3FEGA 1U5QA 1JSVA 2VWYA 4DYMA 2WTJA 4DEHA 2C5YA 2JFLA 5J9ZA 4NTTA 2KULA 4LL5A 3VBXA 5JFWA 3MYGA 3MB6A 5DR2A 3RINA 3AD6A 1YDRE 3FY2A 1XQZA 1ZLTA 5JZJA 3HMMA 4JR7A 4E4NA 3N4TA 4MF1A 4WBOA 3BIZA 3COKA 1R1WA 3E87A 4JJRA 4QMQA 4NK9A 3O23A 3Q5IA 4DFXE 4IW0A 4M13A 2PZIA 1P4OA 3MA6A 3OROA 5E92A 3IOPA 4IWPA 3O50A 4XOZA 5ETAA 3FPQA 2CCIA 3LQ8A 4ZZOA 1IA9A 2I6LA 5DBXA 1GIHA 4W4XA 4MXCA 5M4FA 2B9HA 1XH9A 5KMIA 3P79A 2WTWA 3NW7A 2HCKA 3FQSA 2NP8A 5AP3A 5CF6A 5DG5A 2CNVA 5FQDC 4KD1A 3P7BA 1RW8A 1R0EA 2BVAA 2WOTA 4J98A 3TKHA 2WXVA 1SM2A 4WNKA 4ZXTA 3RMFA 4BCJA 3HA8A 1FVRA 1PMNA 5HG9A 3UTOA 4M8TA 3GVUA 4BDKA 3POOA 4AFEA 3HV6A 5BMSA 3FMLA 3FZSA 3VWAA 4I5MA 3ZBFA 4PWNA 5HIDA 5AAFA 2XYUA 3G5DA 3Q9ZA 1ZAOA 2CMWA 2YM6A 4AE9A 4C33A 4FKIA 5AAEA 4DA5A 3Q53A 1BMKA 3ZXZA 1Z5MA 2X7FA 2PZRA 2XB7A 2GSFA 5H9BA 3CP9A 3OS3A 3VW6A 3H4JA 4ALWA 4FBXA 4ZEGA 3MH3A 4XP2A 4QTAA 5AV2A 2BIKB 2C5XA 4QQ5A 1RDQE 4JBOA 5CLPA 3C13A 4CGAA 4AZVA 3PRIA 4M69A 4BCFA 4DLIA 4XG7A 4E3CA 2Z7RA 1GZNA 1H8FA 4FTAA 3NUSA 3AMAA 3SW4A 3W55A 3MESA 4EQCA 2HELA 3ZRLA 1LUFA 4UMQA 5EI6A 3RGFA 5HGIA 3VJNA 5IQBA 1UWHA 2X4FA 3Q5ZA 3BEAA 4AA4A 5EQPA 2JKOA 2FA2A 4NW6A 3VN9A 1JVPP 3AD5A 3QGWA 4G34A 5H8EA 3KXNA 1V0OA 3ID6C 4F1MA 2OLCA 4FV6A 5IMXA 3NZ0A 3QQFA 3TTJA 2WTKB 2X6EA 2QOIA 4FMQA 2V62A 5F9EA 4M66A 4RLKA 1B38A 4HYUA 3RVGA 4TWPA 4YO4A 2UVXA 1UKHA 3QRKA 3FZTA 4GT4A 4RVLA 5CYIA 2QG7A 1ZARA 2X81A 4IBMA 4BGHA 3P9JA 4IM3A 4EQMA 5HBEA 3ZO3A 5GIOE 4DH5A 4IANA 5ETIA 4QO9A 5KMOA 2W06A 3V51A 4DH8A 2Y0AA 2OI4X 3ORMA 2GS2A 5DHJA 4JQEA 3OOGA 4R5SA 1BI7A 3TXOA 2XS0A 3C4XA 4DTAA 3ENHA 4AWIA 4L42A 5KHXA 4TRLA 5DN3A 1OL7A 3TZMA 4UXQA 4FC0A 2XZSA 5IQAA 1IR3A 3EQDA 2VWIA 3PSDA 4GJ2A 4IXPA 2QOKA 3OCGA 3WIGA 3Q9XA 3H30A 4BTFA 3RZBA 4YC8A 5IF1A 1NVQA 5IH4A 1FPUA 1BX6A 3HL7A 4GK4A 4QYHA 5GZ9A 3LFBA 1GOLA 4UMUA 3WIKA 3AC1A 3LZBA 4UMTA 2PMOX 3O8TA 2JBPA 4BTJA 2V7AA 3RPVA 5D10A 3F6XA 4CSVA 4ERKA 4NYEA 2A19B 1QL6A 3AD4A 4NKAA 4QT1A 3F3ZA 4U79A 2VTHA 4XYFA 5DEYA 3UOHA 3VS0A 2RIOA 5CS6A 4AQCA 5IISA 4IZ5A 2BPMA 1E9HA 2WMXA 1OI9A 4UX9A 3ULIA 4TWOA 4U44A 5KBQA 2P0CA 4R5YA 4QMLA 4MXAA 2VUWA 4R6VA 4QPSA 1XH4A 5T68A 2B55A 3O0GA 4BDFA 3MS9A 3CEKA 4X3JA 2VO0A 3I0OA 1M14A 3PY0A 4KRDA 4LYNA 4DEAA 4B7TA 1H28A 1V0BA 3REPA 2AC3A 1A06A 1YXVA 3QKKA 3HNGA 2HWOA 2OXDA 4JIKA 3KMWA 1YVJA 2R64A 3DGKA 3PY1A 1BI8A 1LEZA 3ZRKA 2CNUA 2CGUA 2PVJA 3G33A 2PU8A 3MJ2A 1H24A 3W18A 4AXAA 2ITNA 3RAHA 3UOKA 4B99A 5M57A 4OAUC 4PMPA 5AUZA 2BZJA 3PY3A 4FKQA 4Y85A 5EW9A 3BI6A 3D5VA 3AC8A 1ZOHA 4KKHA 5LWMA 3PIZA 4MEDA 3H10A 3P5KA 5HBHA 3NUNA 4FNZA 5B2MA 5IDNA 4FEVA 4R77A 3TDWA 4WSQA 3VS2A 4YJTA 4J99A 4BTKA 3OY3A 2WMTA 4FODA 4EK4A 4RIYA 2O8YA 4EONA 4JIAA 1YI3A 2BAKA 1O6KA 3V8WA 1REKA 4LUEA 4HCTA 3RKBA 4OGRA 3PTGA 4GUBA 5DMZA 4TYJA 4D9TA 5IQFA 4KAOA 2YWPA 5EQYA 4J8MA 4GW8A 2E9OA 4O22A 5BUIA 5CNNA 3IECA 3HKOA 2UW5A 4NU1A 4RZVA 2BRMA 4FTUA 3JY9A 1FGIA 4O21A 3BYMA 5M53A 5FXSA 4JI9A 4FV3A 4EK5A 4EKLA 4JLCA 2WMAA 1TQMA 4ID7A 4EH5A 5A54A 4OTFA 1ZYDA 3RWQA 5IEVA 1M7NA 2NNWB 4G6NA 3IKAA 3FPMA 1YI6A 1E1VA 5HCYA 3T3VA 3L9PA 4B4LA 5FBNC 4C2WA 3ZCLA 2YITA 4YJNA 3ZH8A 2OZAA 4I1ZA 5CASA 1JAMA 3GB2A 5IA5A 4EUUA 5J9YA 2X2LA 4YTIA 4DFLA 1V1KA 3ORPA 2SRCA 5EI8A 3CR0A 3OBGA 2VRXA 1RJBA 2R3GA 2F49A 4J52A 3AC5A 4ZTMA 4F08A 3KK8A 4O0SA 3DA6A 5CEMA 2YIRA 3OW4A 2ZOQA 4FTCA 4MK0A 4L6QA 4PY1A 3ZHPC 2E9NA 3G9NA 4FZ6A 3IDBA 2WHBA 3EL7A 2PULA 4FZFB 2VTOA 4HOKA 2JIIA 5AJQA 4DCEA 1Q8ZA 1M2PA 3KEXA 2C6MA 4FEQA 4JBPA 5KZ0A 3BE2A 2VTMA 5E4HA 2YIQA 4R3RA 3TN8A 3G0EA 3RPSA 4F6UA 1KE5A 4Z55A 4FT7A 4EK6A 3PJ8A 3BBTB 5FXRA 3KCKA 5I9VA 3G2FA 4BZDA 4IACA 5E90A 3MH0A 4BDIA 3O8UA 4DLJA 5KX8A 3QX2A 3MBLA 4CFNA 3QYZA 3L8PA 3VC4A 5DLSA 2WELA 1XJDA 2XNMA 3UIUA 3QBNA 4UALA 4M12A 5EG3A 3BX5A 2JITA 3AXWA 3LFFA 3R9OA 4EUTA 2GPHA 2JDRA 2WEVA 3A60A 3LIJA 3O2MA 5B2KA 2X4ZA 4ANLA 2W1IA 3E63A 4DGNA 5GZ8A 2BALA 4Y83A 4ZOGA 4OUCA 5EW8A 2B53A 1LEWA 2ITUA 3HYHA 4RRVA 5GHVA 1GZKA 4RC3A 2PVLA 4F99A 3DNEA 3OUKA 5CQWA 3VUHA 4DFNA 3RJCA 4MD9E 2BDFA 3W8QA 2B54A 1Q24A 3GNIB 4QMZA 4TPTA 4Y8DA 3HUBA 4IZ7A 5EHLA 1A48A 3FDNA 4OTWA 1OPJA 5FD2A 2IN6A 3OF0A 4QP7A 3FV8A 2I0VA 4AOIA 5HTBA 4X6QC 2NPQA 3BLHA 3BU3A 4GFGA 4ORKA 3ORLA 3NWWA 4PTCA 1YDTE 2VAGA 5AP1A 3BLRA 4RJ5A 3D7TA 3DY7A 4FV9A 3D5UA 1PXKA 4FSUA 4JOAA 3EN4A 4OW8A 5AR4A 4HNFA 2YDJA 5G1XA 5M4UA 1YW2A 4A9RA 1KE9A 3QQJA 3PLAE 5CAVA 3MB7A 2P4IA 4MNEB 4WO5A 5CEOA 2Y4IC 3AGLA 4M14A 5JGDA 3A8WA 4I6HA 2YAAA 3I81A 3UC4A 2PVNA 4BCOA 4I22A 3WE8A 3R7EA 5LXMA 3FMHA 4AU8A 5FM3A 4OBOA 4GT5A 4UY9A 4IAZA 4EZ7A 3PG1A 4M69B 3R9RA 3V5TA 1OECA 3SAYA 4AW0A 1KE7A 2QNJA 2VX1A 4J8NA 2QLQA 2IW8A 5KNJA 5AP5A 1FINA 2CKOA 5BYLA 4HPUE 3R01A 3C4EA 4MCVA 3QWJA 5HLPA 3UJGA 4C4IA 3MFSA 4EHZA 4AGDA 1UA2A 2JDSA 2O2UA 2WQOA 3QYWA 5E1EA 2WGJA 3EN9A 3HDNA 4GIIA 3LFQA 4MHAA 3FMNA 3G9LX 4O0RA 4ACMA 1OKVA 5ACBC 4FI1A 5BYZA 3CJFA 4CXAA 1NA7A 3CCNA 5HVKA 5DRBA 3TT0A 4BHNA 1U54B 3P7AA 2O64A 3KF7A 4TNDA 4U8ZA 2XNOA 4YLLA 3U51A 3UO5A 4RJ6A 3S4QA 3BZ3A 3RI1A 2CDZA 3QTUA 2DYLA 4FUXA 5DI1A 4FTNA 3TV6A 4KNBA 5LWNA 5JN2A 3O7LB 2BZIB 3MY1A 2F7EE 4GSBA 4JT3A 5FDXA 2JKQA 3RZFA 3FKLA 3IGGA 3F2NA 3PE2A 4BKZA 4GCJA 1HCKA 3A7FA 3QRIA 4L68A 4A7CA 5IA1A 4O83A 1O9UA 2WD1A 3A7GA 3ZUUA 2BR1A 3MI9A 5GJDA 3AC2A 3U9CA 2GS7A 3OVVA 4QQCA 1ND4A 4RWIA 4YC6A 5GINE 1W84A 1J1BA 3SXRA 1XH6A 3CKWA 3COIA 3EQGA 5DT3A 5CEQA 3LXNA 5HOAA 3PA3A 3S0OA 3BLQA 3GFWA 4I24A 4I6BA 4FGBA 4F9CA 1NY3A 3VO3A 2UZOA 4I4EA 2A2AA 2HZNA 3DDPA 4FKRA 4EKKA 2UW4A 3KGAA 4C3FA 5C01A 3BYOA 1Q5KA 4UWYA 4C4GA 1YDSE 2C47A 3K2LA 5HIBA 3ZXTA 2IW6A 4O7LA 2ZDTA 2W1ZA 2ERZE 3BCEA 2PUPA 4I6QA 1PYXA 2XK8A 4FL1A 4RPVA 5E8VA 3FC2A 4FNWA 4AGWA 2F9GA 4BI1A 3R7VA 3IK3A 3SLSA 4AN9A 4I41A 3MPAA 5AUVA 2HIWA 3GC8A 3TUBA 1H01A 2EXMA 4R7BA 4ZJVA 4N70A 3FHRA 4Z3VA 4MD8E 1JNKA 2XNPA 3VBVA 4CT2A 5C03A 3HX4A 4OTHA 2ETKA 4ONAA 2VO3A 4S2ZA 1H0WA 5IEXA 1OBGA 3VF9A 4BI0A 5AADA 3DBFA 2IVTA 3PJ3A 3QRUA 4EC8A 3R1SA 4FVPA 4BWXA 3EB0A 4O7TA 2R3MA 3CE3A 3GGFA 4FIGA 5CEIA 3O51A 4FTOA 5AP4A 3BQRA 2I0HA 5KMLA 4IB5A 4QP4A 3KQ7A 4FV2A 4X3FB 3OOMA 2BAQA 3FMEA 3NAYA 3NX8A 4BB4A 4OTIA 2OIBA 5CY3A 1YWNA 4K2RA 3MH1A 1OKWA 2E9VA 4OLIA 5EYKA 4Z7HA 5HG5A 3U6HA 4WBBB 1REJA 4WG5A 3F88A 3VS5A 1SMHA 3WOWA 3QTWA 3QZHA 4ACCA 3C4FA 4BR3A 5HVYA 4AZFA 1XO2B 2PZYA 5A6OA 4UMPA 5E7RA 2C69A 4D9UA 5LVPA 4XV2A 4C3PA 4ZSAA 5HX8A 1APME 3ZM4A 4CMUA 4ZJIA 1IAHA 4DFUA 3PLSA 4W4WA 1AD5A 3CTHA 1TVOA 1Q8WA 5IH6A 4U5JA 5HG8A 2Y4PA 3F5PA 4HPTE 4QP2A 3GP0A 4BICA 2W4KA 4DE4A 5HEZA 1OL6A 2G15A 3QX4A 4FG8A 3ZZWA 4OR5A 4H36A 4X2FA 3CPCA 5AR8A 2IVUA 4YTFA 1XH5A 3T8OA 3UQCA 4YUQA 1CMKE 2YACA 4UZHA 3LFNA 5K0KA 5EHYA 5KKRC 4L3JA 4KS8A 2GDOA 3ZONA 2VO6A 3BBWA 4FSNA 4QP6A 5EYMA 2QU6A 2Y7JA 3EN5A 1G8SA 3VBQA 5ACKA 2BMCA 4AT4A 3SKCA 5LMBA 1CSNA 1OITA 2C0OA 2HW7A 4LRKA 1MUOA 1TQPA 4RJ4A 4WNPA 3D9VA 3SQQA 4ZTRA 2RKUA 5FXQA 3UOLA 4ASZA 4EI4A 4CG9A 2IZRA 2X2MA 2QURA 5AMNA 3R73A 3LM0A 4I0TA 4RIXA 5CVFA 1YWVA 4ZK5A 2JC6A 1VEBA 1JQHA 5HE1A 3UMWA 3U55A 2ZJWA 1ZYJA 3GXLA 4J71A 4JAJA 4BVUA 4J96A 2VGOA 3DXQA 4X21A 2W99B 3U4WA 4BDEA 2PVFA 1F3MC 2XRWA 3KULB 4HGLA 4GFMA 4L3PA 4APPA 2VTNA 4BBFA 5AUXA 5ANIA 1OM1A 2WB8A 3IO7A 4L3LA 4FZ7A 4BCGA 4TYHA 2ACXA 4K33A 5J1VA 2WZJA 3F9NA 3VQUA 4CRLA 3TNWA 4AA5A 4N6YA 2CGVA 4L8MA 3E92A 5CU6A 1H00A 3CKXA 3M2WA 1LPUA 3EZRA 3FI4A 3H0YA 4FX3A 3NNVA 4BHZA 5AAGA 4L52A 5M51A 2WPAA 4GYIA 3PG3A 5EQEA 3MV5A 4UWBA 4AT5A 5J7BA 4N57A 4O7WA 3VAPA 3AMYA 1FOTA 3EQIA 5A4EA 2IVSA 4CEGA 4FOCA 2ITZA 3ATSA 2B9JA 3NIEA 2A4LA 4EH4A 4EOQA 2V5QA 2ITYA 1K2PA 4FIJA 1VYZA 4A9TA 5M4CA 3E64A 4CD0A 2QHNA 4ZTSA 3WF5A 3FHIA 1IEPA 5CXHA 1A9UA 3KK9A 2A0CX 1W83A 5JRQA 4ASDA 4D0WA 4DAWA 1GIIA 1RQQA 2W5BA 2ZM4A 5AP6A 4C0TA 4B6LA 4JDIA 3MY0A 4NUSA 4OT5A 3PPKA 2G9XA 2VTTA 3H9OA 5CU2A 2UV2A 4IJPA 1OL5A 3NNWA 5HO8A 5HVJA 3FYJX 4AACA 4D0XA 5L2TA 2GNGA 5FWKK 4USDA 3QLGA 5KZIA 5EM8A 2QONA 2VD5A 4O81A 4EJNA 3WBLA 5CAPA 4KIKB 4FT0A 5L6PA 4XG4A 4YBJA 5GNKA 3ZEPA 4FSWA 2VGPA 3DKGA 3E5AA 4MH7A 3SXFA 4BCIA 5BPYA 5EDPA 4RVTA 2XIKA 4BDBA 2YFXA 4EC9A 3LPBA 2GFCA 4K0YA 3D7TB 2QOLA 5DPVA 2YM8A 1UU9A 1ZYSA 3EJ1A 3P0MA 4PP7A 1CTPE 4QMOA 4J97A 2P33A 4O84A 5C4KA 2P2HA 2VN9A 5AM6A 2YZAA 4QMUA 5E8WA 5CVGA 5AX3A 4LGDA 4YJVA 4EORA 1TQIA 4IX6A 3TG1A 1Q8YA 3PYYA 5TO8A 2X8DA 4YZBA 2PE0A 2WEIA 3G6GA 3ZOSA 1QCFA 2YWVA 3PA5A 4IDTA 4HJOA 5E8YA 1XBBA 3HRBA 3BGPA 3QCQA 2W0JA 3QQGA 4FSTA 4YLJA 4IADA 4O0WA 5DT4A 3UVRA 4D4VA 3UZTA 4U7ZA 5HICA 2XKFA 4A4OA 4A06A 3WI6A 3W10A 2Y6OA 2J5FA 3NCGA 2Z60A 4CV8A 4FVQA 2BHHA 4KIPA 3GU6A 4M0ZA 1OMWA 4BCHA 3F82A 1Q8UA 3F7ZA 2UZDA 5H8GA 5A9UA 2Q0BA 4EHGA 4PMSA 1IG1A 1JWHA 4FKWA 1WFCA 2BFXA 1V0PA 2BUJA 2W4OA 4HGEA 2G01A 1PMUA 3S95A 5EW3A 5J9LA 3BGZA 3HV5A 4DT8A 4FGRA 3HV4A 2OF2A 3AT4A 3PJ2A 5HD7A 3VUMA 3ZC5A 3ETAA 4USFA 2R3HA 5CNOA 5LJJA 4O0VA 2G1TA 3LMIA 2PVHA 3R28A 3A2CA 3FYKX 2DUVA 4EZ5A 3ORNA 2YM4A 3BV2A 1PF8A 2OGVA 1OPLA 3RAWA 3ZO2A 2AYPA 5BMMA 4AFJA 4RJ3A 4GVJA 3BEGA 4FTJA 5FEDA 4CTBA 2QLUA 4NFNA 4XEYA 5CF5A 3FJQE 4GL9A 5L6WL 2I0EA 2V0DA 1Q8TA 3BHHA 4OTGA 4GKHA 5EKOA 2YM7A 3WZEA 2HOGA 4WRGA 1KSWA 3LQ5A 3Q96A 5GJFA 3V6RA 3ZZEA 2WQNA 3O71A 2F2CB 3MVMA 3LJ0A 4W9WA 5I9UA 5T6KA 2H8HA 4P7EA 2XK4A 4TZRA 2UW0A 4NW5A 2QVSE 4CRSA 2GQSA 3F5UA 3ANQA 3VRYA 3ZDIA 5AIRA 4I0RA 4CVAA 5C8KA 3SC1A 3E7OA 2GNJA 2ZB1A 1GZOA 2YABA 1J91A 2VX3A 4V01A 3P86A 4IB1A 5EDRA 1S9JA 1ZZLA 5L2IA 5L3AA 4EWQA 3VBTA 2CKQA 5KHWA 3SX9A 1NVSA 3DK6A 3TKUA 4I94A 4U0IA 3ULZA 4QTDA 4ZP5A 4AAAA 2IZSA 4EK8A 3A62A 5FEEA 4FICA 1ZOEA 5HBJA 1DI8A 3K54A 3O96A 4G5PA 3R7IA 4F70A 4QMNA 4Z7GA 1ZRZA 4CMOA 5H3QA 5CTPA 1UU7A 4D2TA 1NVRA 3ZUVA 2HXQA 3ZDUA 5J79A 2I7QA 2X1NA 1QPJA 4IVCA 4C8BA 2JIUA 4NZWB 5IA4A 3PVGA 3PSCA 3SDJA 4ASEA 4O7SA 2BFYA 2QOCA 1J7LA 5FLFA 3K3IA 3Q9YA 5ETFA 1P14A 2KTYA 2XK9A 3QD3A 4TYIA 4F1OA 4USEA 3GFEA 2BROA 4GK2A 4BFMA 2R7BA 4IE9A 4GU9A 3L9LA 2BRNA 4LMUA 3H9FA 4CTCA 2BIYA 5HORA 3MIYA 5GIPE 2FVDA 2QR8A 4YTCA 3PJ1A 4LV5A 2J0JA 3VBYA 5DT0A 3VS7A 4XG2A 3F5XA 2PE2A 4QYEA 2BHEA 5I9XA 5EM5A 3LXPA 3SHEA 5DR6A 2UW3A 2X7OA 2X39A 3E8EA 3ELJA 3QD0A 4S34A 3SOCA 5TKDA 3Q3BA 4GMYA 4ZY5A 4DFYA 4GFOA 1ZYLA 2OFVA 4IFGA 4NM0A 4R7IA 3VUTA 4CQEA 3FQEA 3UYSA 5BVOA 2CNQA 4DG0E 3HEGA 1GJOA 2CKEA 5C8MA 4GU6A 2IO6A 4RWLA 4YP8A 5H2UA 4B9DA 4DEGA 4M0YA 2FGIA 3NUAA 4HGSA 3OEFX 2ZMCA 3I5ZA 5LVNA 2UZTA 3EFLA 3QF9A 3Q2JA 2PL0A 3DV3A 3UG2A 5HTCA 4P2KA 3JR1A 1UV5A 4TT7A 4EOSA 5JQ5A 1W98A 3GCVA 3PXQA 3AGMA 1ZY5A 4ZIMA 2ZM1A 4ZY6A 1MRVA 2WMBA 2WMWA 3EQRA 3FLWA 2JFMA 4PMTA 4AOTA 5LVMA 3C5IA 1EH4A 3QQHA 4WOVA 5TR6A 4YZCA 2GTMA 4RC4A 4BIBA 4UMRA 2XUUA 2FYSA 2HAKA 2ITXA 3LW0A 2UZNA 1YRPA 4BCQA 4O91A 3HMIA 4C61A 2WAJA 2J0MB 3GEQA 3MFRA 2J50A 1QPDA 3FAAA 3EN7A 2ERKA 3LFAA 2QOFA 4QNAA 4FV4A 3HP2A 2C6OA 3ZLWA 1I09A 4EOLA 4EYMA 4RX9A 4BC6A 3ROCA 3OTUA 2BRGA 4QPMA 3SA0A 3SV0A 3TI1A 3QRTA 1DAYA 4PTEA 1XBCA 3UZPA 1UU3A 2XEYA 5EH0A 1WCCA 3IG7A 5HNBA 5KMJA 5FM2A 4ARKA 2XCKA 1CKPA 4IB3A 4YR8A 5L8KA 3UZRA 3JY0A 4E5WA 2BCJA 3AG9A 4RX5A 3L9MA 4TNBA 1GZ8A 3OCBA 4XHKB 5BYYA 1PKGA 1ERKA 2WU6A 3Q4UA 4YTHA 3W2CA 4JRVA 3E8NA 4F9BA 4IB0A 4NCTC 4FTIA 3DKCA 5M55A 1SNUA 4IMYA 3DFAA 3D94A 3R00A 4N6ZA 4TYHB 4GKIA 4F7SA 4QPAA 4TWCA 1R3CA 3ZS5A 4K1BA 3DPKA 3ZRMA 3AT2A 4XP0A 4ZTHA 5CSVA 3PDTA 3B2TA 2C30A 4J53A 3NUXA 2YDIA 4GUEA 2PZPA 4JVGA 4OTPA 4EH6A 3NVKI 4FK3A 4O96A 4R7HA 5CT7A 3OW3A 3VULA 4RVKA 2WNTA 4CFVA 4AE6A 5AA8A 4F9YA 3BELA 2UZEA 2J0KA 2CKPA 5EM7A 3HV3A 2YDKA 3R22A 2XNBA 5BVEA 3HA6A 1AQ1A 3PFQA 2W4JA 1DS5A 4RLLA 3UPZA 4MF0A 3R0TA 5H8BA 3FI3A 3MVHA 3ZSGA 4AT3A 3ITZA 5IMEA 4TTHB 3KA0A 3M11A 4MXOA 4YPSA 3R8MA 4TY1A 4I5HA 4EOMA 3GQLA 2DWBA 1WBVA 3ORKA 2JDOA 4JG7A 4QMVA 3ZLSA 1XH7A 2R0UA 4OTQA 4BBEA 4E5BA 4AN2A 1YXSA 3R7GA 1W0XC 1XBAA 3CSVA 4CLJA 2PMIA 5JMSA 3A7HA 3R63A 4GK3A 4YZNA 3VVHA 4G3GA 2XNNA 3DKOA 3VUKA 2GTNA 2B7AA 3NNXA 3VIDA 4L53A 5AX9A 3EOCA 4A9SA 5FGKA 5HE2A 1YOLA 4WT6A 4D1ZA 2XJ2A 3U8WA 4YJUA 4AZTA 1FMOE 3H9RA 1H0VA 2HZIA 2LAVA 3UQFA 4J95A 4EH8A 2HK5A 1URWA 1KE8A 4O6EA 4F6SA 1NW1A 1W7HA 5DNRA 2LGCA 3QZFA 1SYKA 4U81A 4YHFA 4JBVA 2ITWA 1XR1A 4FSMA 4G9RA 3VNTA 4YMJA 1UNGA 2UUEA 5L8JA 2C0TA 3F5GA 3ACKA 5K4IA 4CFMA 1YKRA 3MIAA 4KIOA 4Q5HA 4RQVA 5IUGA 5K0XA 1PKDA 3F66A 3R8ZA 1M7QA 2B9IA 3V01A 4AX8A 3W1FA 2O65A 3S2PA 3DCVA 4L9IA 1ZXEA 3AC4A 4PDYA 1JLUE 1Q41A 3GT8A 4MXXA 4XG3A 3PE1A 4G3EA 4I0SA 4DT9A 3QQUA 3FLQA 4D4SA 3IOKA 5ANEA 3SOAA 3Q52A 2O0UA 5CAQA 2IVVA 2X8IA 4E4MA 1G8AA 2ETRA 1M17A 4YJOA 2XK7A 4O0UA 4FK6A 5JGBA 1UU8A 2J90A 4D58A 5B0XA 3TJDA 4JQ7A 2W1CA 3AC3A 3HDMA 4I93A 4C38A 3GCUA 3RCJA 4DF3A 1PXMA 2YAKA 4DINA 2Q0NA 5I4NA 3FBVA 4LGHA 5E8XA 4ZLOA 5E91A 3UVPA 3UIBA 3WZJA 3ZMMA 4DGGA 1SVGA 2WTVA 3LCTA 4HVHA 4RWKA 2GU8A 4IAFA 2R3JA 3HRCA 2FSMX 4L43A 4E5AX 4AW5A 4DHFA 1U4DA 4YU2A 4JDKA 3JUHA 3VRZA 4M7IA 3NS9A 3GQIA 4AUAA 4ASXA 1JSUA 3PXRA 3TZ9A 4FZAB 3EMGA 5BNJA 2RSVA 2HW6A 4ANNA 3EQCA 3Q04A 3R04A 1R78A 1BKXA 3R02A 3W2RA 3C5UA 4J7BA 3BHTA 3ZBXA 3I6UA 1JKSA 2CGWA 2ITPA 4Q9ZA 3OWPA 1Y91A 3QXOA 3UNKA 4E4XA 3DQXA 3FXXA 5L2SA 2VU3A 3QQKA 1PY5A 4V05A 3KRLA 2BRBA 3D5XA 3UO4A 4OTRA 3RBWA 4G16A 4NT4A 2QQ7A 3OY1A 4UYAA 1J7UA 3I6WA 4FYOA 3HMOA 2OIQA 3BHYA 4C02A 2IPXA 2X2KA 3DBQA 5CU3A 4FV0A 4CKJA 3I7CA 4F0IA 4XG8A 3D7ZA 4FKPA 4IVAA 5E9EA 4EZ3A 3PVUA 3RK7A 2OIDA 2XH5A 5CQUA 4U42A 5KE0A 2B52A 2Y4IB 3CD8A 2NO3A 2BKKA 2W9ZB 3UP2A 4QMXA 4MBLA 1Q3DA 2VWXA 3Q32A 4KINA 3MSSA 3MW1A 5HQ0A 4TWNA 5E8SA 3V5JA 2C5OA 3U87A 4J1RA 3QU0A 1YI4A 2CPKE 2PK9A 2VTAA 4ZSEA 2WQMA 2XJ1A 5I0BA 5EDQA 3N9XA 4R1VA 3E3BX 4RIWA 4PX6A 2QC6A 4FZDB 5HG7A 2VTLA 2J0LA 4V0GA 4D4RA 1MP8A 1MRYA 4IVDA 4YSJA 3NCZA 3UO6A 4O7YA 3TZ8A 2OZOA 1OUKA 2HZ0A 4IIRA 4GG7A 3CQEA 4MQ2A 4X7QA 3UYTA 5A14A 4EJ7A 3S00A 3C4ZA 3DTWA 3VBWA 3UDBA 3O17A 4BYJA 2XIRA 2AUHA 1H1PA 3QC4A 3QKMA 4W4YA 5EOLA 5J1WA 3BHVA 1CKJA 4G1WA 4RMZA 2PMNX 3GC0A 4HCVA 5BVKA 5B7VA 2BDJA 3CS9A 3JYAA 3MY5A 1XKKA 1SVEA 5ANDA 5HO6A 2VNYA 5L8LA 2OWBA 3D0EA 4XLIA 5AA9A 4MYGA 4B0GA 4D2WA 4E6QA 3DK7A 5EM6A 2XM9A 3OXTA 4GH2A 4AF3A 3HECA 3NW5A 3TIZA 5DFPA 3R7OA 4C37A 5K9IA 2WIHA 4FTMA 5KMKA 2JAVA 3ZO1A 4QTEA 3CXWA 4RSSA 2VWBA 4IWDA 2EB2A 4A4LA 2H96A 4BGGA 1J1CA 1PMVA 2R5TA 5CU0A 4PTGA 4QOXA 3W8LA 4EWHA 4M84A 1K9AA 4LQMA 4C57A 4ZAUA 5HU9A 5LARA 4FR4A 3DZOA 5HCZA 4EOIA 5A6NA 4F7JA 3MWUA 1FBNA 4QMPA 5TT7A 2GNHA 4FV8A 1Y8GA 3ANRA 2YJSA 3R71A 4O0TA 4LMNA 2C6EA 2Z7LA 3BRBA 2X7GA 4YZ9A 4XG9A 4YZDA 4ZZMA 4Q2AA 4UEUA 4S31A 4RJ7A 3NDMA 4EHEA 2QHMA 1H1QA 2QODA 4EL9A 3ZFXA 4DTKA 5IUHA 2W1EA 2OJFE 4CKIA 3QFVA 4JQ8A 4U97A 1SVHA 2W5HA 4C4JA 5CSHA 5LMAA 3W2SA 5LMKC 3KFAA 3DXNA 2PUNA 4OBPA 4DEBA 3ACJA 4LOQA 4U80A 4R3CA 3WARA 4BZNA 4MBIA 4F7LA 4PPCA 1L3RE 3WZUA 5D1JA 3OG7A 4EH3A 3IDPA 4XV1A 3ZEWA 3FC1X 2O3PA 4XRLA 3IW8A 3PSBA 4RA5A 3ORIA 2WMVA 4RX7A 5DYJA 1E1XA 4FIIA 3EWHA 1B39A 5T3QA 3RHKA 4H3QA 2GFSA 4LM5A 4F64A 2ZV9A 1Q99A 5AP0A 5D9HA 4D2VA 3S1HA 2IW9A 3OXIA 3RP9A 3IONA 4QMYA 2QO7A 3BE9A 4ZJJA 3F2RA 3NMUF 4FIFA 2YIYA 5F95A 4YPDA 3RM6A 1PJKA 3CPBA 2PZ5A 3OBJA 3FI8A 3KVWA 1VZOA 3WZDA 4O6LA 4D1SA 5HE3A 1ZYCA 3BYUA 5C4LA 5IKWA 3MVLA 3GU5A 3GI3A 5JZNA 3V6SA 4FKVA 2UZWE 4PL3A 3SG8A 5CAUA 4GV1A 2JD5A 3MFTA 3FLSA 5M44A 2G2HA 4JG6A 1QPEA 5E8ZA 5F1ZA 3KU2A 3CIKA 1WBTA 2YCSA 3DQWA 4FT3A 4RIYB 2BZHB 3OWJA 4ITJA 3KMUA 4BDDA 5E1SA 4KKEA 2EXCX 2BAJA 3LAUA 3OT3A 3QLFA 3TCPA 2QKWB 4BY9E 2ITOA 2BDWA 4FTKA 1PW2A 3R2BA 1Y8YA 3TTIA 5JFSA 2O5KA 2QOBA 3R1NA 3V5LA 4BDHA 2YA9A 5KKRB 3S3IA 4RIOA 2OJ9A 2WQEA 3N4UA 3Q4ZA 2ETMA 2Z2WA 4N4SA 3QHWA 4X3FC 3C1XA 3VUIA 1OKZA 2W7XA 3LE6A 4L01A 3FXWA 4PPAA 3MJ1A 5AP2A 5L2QA 4XX9A 3TNPC 2ZV8A 5FBOA 3OZ6A 5HI2A 5LVOA 3N4VA 3QGYA 3EFJA 4HGTA 1H08A 2CCHA 4K8AA 4QMWA 3EZVA 3IS5A 2XIXA 3QQLA 1R39A 4AOJA 4AZWA 2OZAB 4QD6A 3GCPA 1JPAA 4FNYA 5ITAA 4OBQA 4Y5HA 4RA4A 4LFIA 3PPZA 5DIAA 3BYVA 5IQHA 3F3TA 3FKNA 2YIWA 4BGQA 2C4GA 4BDCA 4NCTA 2PTKA 4BN1A 1BYGA 4IM0A 4F4PA 1WVXA 2F2UA 3TNHA 4KBAA 4NM3A 4UWCA 3BPRA 2XMYA 3EKKA 4I3ZA 3LM5A 1O6LA 5CANA 3OP5A 2RG5A 4CKRA 3TJCA 3P1AA 1KE6A 1OL2A 5EHOA 3OT8A 3ZLXA 4C35A 1M52A 3R8UA 1Q3WA 5IA2A 5I9ZA 4QMSA 2C1BA 2XBJA 3KCFA 3PWYA 3TNIA 5JEBA 4EQUA 2VWUA 3DBDA 5AUTA 3OD6X 4ZZNA 1ZZ2A 2CLQA 4FSYA 4FT9A 4BTMA 4QQJA 2YISA 4QMMA 1H1RA 2VWZA 5ETCA 3LQ3A 1UKIA 1M2RA 3LXKA 1YOMA 4BIEA 3TUDA 4IHPA 3V8SA 4CFXA 5AR5A 2C6DA 4PNKA 3I4BA 4LV8A 1FGKA 3RTPA 5JT2A 3E8DA 3RPOA 3HMNA 2C3JA 4C34A 4FUYA 5EYDA 4I92A 4K18A 4BCPA 4FE2A 4MX9A 2NRUA 4WD5A 4H39A 2OK1A 3UP7A 4Q9SA 3DJ6A 4S33A 3QZGA 2BZKB 3PXFA 3RNIA 4MVFA 4EK3A 3D15A 3W16A 4NL0A 4CCUA 4A9YA 4TL0A 2UVZA 5ICPA 3DK3A 3F61A 3KN5A 1WBWA 3TNQB 4ALUA 4ANBA 2WKMA 4DH7A 3LHJA 4PDSA 3FSFA 4KWPA 4YC3A 5D41A 4YJRA 3POZA 2GCDA 4QYGA 3KY2A 1P4FA 4EH7A 2Z7SA 3GC7A 3QD4A 4FNXA 4Q5EA 1Q61A 4Y73A 4IDVA 5J8IA 4E26A 3MDYA 2PVYA 3MPTA 4TKSA 5LOHA 1JBPE 4GT3A 3F3WA 5C9CA 3TWJA 4L44A 1DAWA 2VTQA 2YM5A 3K5UA 3B2WA 4ACGA 4CQGA 4WG3A 4JL9A 4DGMA 4LI5A 4FG9A 1OIUA 5HO7A 1ZY4A 4JDJA 1OIQA 3V5PA 2C0IA 2VWWA 3UE4A 1OIRA 5AR3A 4X6RA 4EH2A 1DM2A 4V04A 3ODZX 2H34A 3PUPA 5CSPA 2BTRA 4IFCA 1MQ4A 4U3ZA 1PXPA 5CVHA 1T45A 3D14A 4MXYA 2VTSA 3UMXA 1Q4LA 4FA2A 2Y6MA 4FSZA 2J51A 4O1PA 3BV3A 5ANGA 4RZWA 4RIWB 5HESA 3UC3A 1FMKA 3LVPA 4V0GB 3OUNB 2GHMA 3NIZA 2R7IA 4LUDA 4UB7A 4MXZA 5AM7A 2XKDA 3DAEA 4RT7A 5M07A 3T9IA 4OAVB 3HZTA 2JDTA 2PUUA 4Z9LA 4AG8A 4X0MA 1M2QA 3KMMA 4NFMA 5HLWA 3PP1A 3HAVA 3EQHA 5IQGA 2F57A 4E8AA 4FV1A 4IC8A 4II5A 5LVLA 4UN0C 2X9FA 5K4JA 5DE2A 1XWSA 3UIXA 4AGUA 4NTSA 3VS4A 2C1AA 3ZUTA 2VWVA 2PHKA 2UW9A 3KKVA 2GMXA 4Z16A 4IZYA 3I5NA 2GHLA 5C26A 4XNEA 3PXYA 4XBRA 3R8VA 4E73A 1J3HA 3II5A 5CAOA 3KL8A 1PMEA 1F0QA 1ZOGA 3D83A 3EHAA 3GU8A 4ZY4A 2OG8A 3NGAA 1Z9XA 2E9UA 1YXUA 4P5QA 2F7XE 2PSQA 1YHVA 3DB8A 3DBCA 3LLAA 2HXLA 3TEIA 4CFWA 4BCNA 4R8QA 1OB3A 4BI2A 4IVBA 4PF4A 4N0SA 2WMSA 2XM8A 3OCSA 3RWPA 2YERA 1JKTA 4RGJA 3QCSA 4MAOA 4NM7A 4FV7A 4I23A 1TKIA 2OXXA 1CKIA 4AA0A 4XRJA 5DRDA 4FTTA 4FL3A 5EYCA 4K11A 4DGLC 4IH8A 3QUDA 4FEUA 3QC9A 5AV0A 4IAIA 4F1TA 4KIQA 2PYWA 5DWRA 2JKKA 3P08A 1L8TA 3EYHA 2CJMA 3ENMA 1YXXA 4ANQA 4U40A 3L8VA 1LR4A 4U6RA 3HRFA 2UZBA 4D1XA 3W2OA 3GCSA 3R83A 4UV0A 4RG0A 2VTPA 4G3FA 4KABA 4O7ZA 3Q6UA 4IAKA 3NAXA 4PPBA 3QA8A 2C68A 4TYGA 1Y6BA 4UZDA 3R6XA 2ZB0A 3RPRA 1OGUA 1OIYA 3DOGA 2OFUA 4WA9A 2P55A 2ZMDA 3CJGA 5KUPA 5FUTA 4JX3A 2PPQA 1P5EA 2QO2A 3RCDA 5C1QB 5IA0A 3FL4A 2FUMA 3Q4TA 4G3DA 3LFDA 2R3PA 4JX7A 4MKCA 4C4FA 4E1ZA 4LOOA 1X8BA 4FTRA 4QMTA 3UIMA 3QTRA 4PUZA 5HNGA 2QU5A 1UWJA 3KRXA 3LOKA 2ZVAA 4L7SA 2UZVA 5A4CA 5M09A 3GU4A 3EN6A 3EIDA 3VW8A 3WF6A 3FUPA 2FSOX 4C7TA 4CNHA 2PE1A 1R0PA 1WMKA 3NLBA 3A4PA 3FMKA 4F9AA 3TV4A 2OBJA 4HNIA 2BTSA 2H6DA 3MGYA 2YHVA 2WFYA 3IDCA 4UXLA 4CYIA 3EH9A 3WE4A 3U4UA 3CY2A 2Z7QA 5CT0A 2WIPA 4ZTQA 4MTAA 4CMTA 4F9WA 4X2GA 1WBPA 1Y6AA 4MNEA 4RX8A 5FTGA 4BBMA 2WQBA 3BWJA 4CZUA 1K3AA 1FQ1B 4PP9A 3VHKA 2ONLA 3R7YA 3FMJA 5HNIX 2Y9QA 1JSTA 3A4OX 4XOYA 5EK7A 5FTOA 1CM8A 2OU7A 2XKCA
chains in the Genus database with same CATH superfamily
5K5XA 3C50A 2WMRA 3LJ2A 4DGOA 3CTJA 4KB8A 2IJMA 3PZEA 5EFQA 4NKSA 2WTDA 3GOPA 4C62A 1BLXA 5ANJA 3VS6A 4GIHA 3P7CA 4GYGA 4ITIA 4JNWA 3FKOA 4CYJA 3C0IA 4L67A 2W05A 2VTRA 4TN6A 3PVBA 1H25A 4OTDA 4EBWA 5LQFA 3ZFMA 4NSTA 2WMUA 5JFXA 2PUIA 3QTIA 1YQJA 2F7ZE 3DLZA 5J5SA 1GIJA 4KBCA 2JGZA 3A61A 4WNOA 5AUYA 3LLTA 1U54A 3FLZA 3FE3A 5LMKA 3NSZA 3CGFA 4EOOA 1IASA 3FL5A 3TMOA 1OPKA 1P2AA 4IAYA 5BX0A 5JGAA 4YJQA 3OC1A 2A1AB 3GUBA 3DS6A 2BKZA 4FRFA 4I6FA 3E93A 2V7OA 4DN5A 2AC5A 2WTKC 3ZLYA 2XVDA 5IUIA 1ZMWA 1U5RA 2OKRA 2ZV2A 2QCSA 3QTXA 4ENYA 4ALVA 5CF4A 4RIXB 3EQFA 4R78A 2J7TA 4ZSGA 4R1YA 4DFBA 3IQ7A 5IPJA 3H3CA 2GQGA 2RF9A 4G2FA 4H58A 4OT6A 3KC3A 3BU5A 3G51A 2W1DA 3ZFYA 1VYWA 4ANOA 3U6IA 4FSRA 4NJDA 3SRVA 4QYFA 3I7BA 1PHKA 3QA0A 4KUJA 2CN5A 5KMNA 4JR3A 4E93A 3U6JA 3WF8A 2XKEA 3VUGA 2V22A 4BF2A 5I9YA 4ZS4A 2OJJA 3OTVA 3NUYA 3B8QA 4CZTA 4BWPA 2RL5A 4HYSA 4NM5A 4I20A 4QP3A 2C3IB 4BZOA 3CD3A 4XV3A 5KO1A 1PRYA 2HWPA 2REIA 3ZSHA 4MWIA 4BCKA 2GQRA 2XK3A 3IPHA 4Y5QA 4F7NA 2BILB 2HYYA 3C0GA 4O4FA 5K3YA 4MBJA 4DITA 2WMQA 4W8EA 2C3LA 3KRRA 4IEBA 4U45A 3MFUA 1W8CA 4H1MA 4M3QA 2IZTA 4D55A 2R4BA 4G9CA 1NT2A 3COMA 5HE0A 2RFSA 1FVTA 5IQDA 3F69A 4PQNA 4KA3A 3CC6A 4C58A 5FP6A 4HYIA 4NIFA 3OWKA 4TW9A 2FSLX 5IQCA 4DEIA 4EOPA 4W4VA 5AP7A 4BRXA 4WSYA 5HLNA 2OJIA 5A4QA 4ZSJA 5GJGA 4X3FA 4D5KA 5J7HA 3KRWA 3U9NA 1YXTA 5A4TA 2WO6A 2XJ0A 4XUFA 5HKMA 4X2NA 3RM7A 5E8TA 2VX0A 4O82A 3ORXA 4APCA 4BDGA 4YLKA 3VQHA 4FKGA 2GNLA 3ROYA 5LCKA 2XYNA 2YCFA 3HLLA 3KXHA 3PXKA 2CLXA 5DA3A 4F09A 3Q9WA 2ZV7A 3NUPA 3DNDA 3A7IA 3DT1A 2UW6A 3QKLA 3FMMA 4FKSA 3NRMA 2J2IB 2WTCA 3Q60A 3QHRA 1ZMVA 3NUUA 3RK5A 3NVMB 4CG8A 5D12A 4IQ6A 4C4EA 3CTQA 5BUJA 5FDPA 3ZYAA 3VS1A 3BYSA 3CY3A 1XHAA 3ALNA 3PIYA 2EXEA 2YCQA 4QYYA 2ZM3A 4Y72A 4XG6A 5IG1A 3HP5A 3JVRA 5TE0A 3WF9A 4X2KA 4AGCA 4XS2A 1XMLA 2YEXA 3G15A 1BUHA 4MD7E 4AZSA 5JH6A 4H1JA 3O7LD 4I4FA 4FEWA 2HY81 4B8MA 5JQ8A 5BVWA 3HVCA 4Y46A 4EYJA 1GY3A 2XNGA 3LFCA 2R3QA 3FMDA 3NNUA 3L8SA 3F3UA 4LRMA 2ITQA 2XEZA 3I1AA 3QALE 4DTBA 4TXCA 1NXKA 4UBAA 3R8LA 1H26A 2UZLA 3JXWA 3NPCA 4GJ3A 3FLNC 2A27A 4IX5A 4HVGA 5J5TA 3HGKA 3DBEA 2J9MA 4G31A 4F6WA 4L7FA 5BVDA 2FH9A 4W9XA 3QRJA 3DB6A 5D7AA 4WRSA 4U9AA 5DR9A 3B8RA 4AW1A 4KSQA 3ZSIA 2QO9A 3K3JA 5JKGA 3UPXA 3PVWA 1UNLA 2FB8A 3JPVA 4QP9A 3R9HA 3UG1A 3R1QA 4E7WA 3DU8A 3KULA 3W33A 3SVVA 4DDIA 3BU6A 1YHSA 4FKOA 5A46A 4MWHA 2O63A 3U54A 5I3OA 1MQBA 4XV9A 4BKYA 1BL6A 3I79A 4G6OA 3OEZA 4EBVA 5CALA 2YM3A 4FEXA 3LCSA 4PMMA 2RFNA 3WF7A 3W2QA 3DXPA 5ANKA 3A7JA 3H0ZA 3MH2A 3BGQA 3Q2MA 4LGGA 4PL5A 1PXIA 1Q97A 3LKMA 2R3FA 1CDKA 4E6CA 5M08A 5KBRA 3GENA 2I1MA 3EFWA 4RFMA 3RK9A 4ZLZA 4IX3A 3EYGA 5TF9A 4WUAA 5BUEA 2X6DA 4HZRA 5FG8A 2Q83A 2G2IA 3FI2A 5DH3A 3VF8A 3DZQA 3QCYA 2Z8CA 3ERKA 4HYHA 2EU9A 3GU7A 3M42A 4XCUA 5AR2A 3OMVA 3PA4A 4O27B 3RPYA 1WBNA 1W82A 3MTLA 4G3CA 4ERWA 5I3RA 3PXZA 2WOUA 1QPCA 3CQUA 3QXPA 4M68A 4ZTNA 4JBQA 2YCRA 5JRSA 3R1YA 3F2AA 3TKIA 3UNZA 2B0QA 3N51A 5CU4A 3Q4CA 2UZUE 3BWFA 4G5JA 3LCDA 4IWOA 3GBZA 4CFFA 4KIKA 2W17A 2EWAA 3TUCA 4DH1A 3PZHA 2W9FB 3LCKA 5C8NA 4FIHA 5IDPA 3AMBA 4AW2A 4RFZA 4WUNA 3F7WA 4O4CA 2HY0A 2CSNA 4FTQA 5CENA 2FSTX 1W2DA 3IW5A 3RAKA 2JEDA 3G0FA 4KKGA 3IGOA 2JBOA 5I9WA 5JSMA 4AXCA 4A9UA 1UVRA 1GNGA 2F4JA 5HX6A 4EOKA 4S30A 3L9NA 3KXMA 5EOBA 4HW7A 3I0QA 4HCUA 4WNMA 4ZLYA 3UDTA 3UBDA 4FVRA 4BWKA 1YOJA 3V3VA 3E88A 3V5WA 3WILA 3R9DA 3KVXA 4D5HA 5AIKA 5AFVA 4FKLA 1FVVA 3R7UA 5CI7A 3FZRA 1STCE 4ZMFA 3QTZA 4G6LA 2JIVA 4AN3A 5AV3A 2X0GA 2VO7A 5BVNA 3D2IA 4F0FA 4TYEA 2QR7A 3F3VA 2V55A 4U41A 4WIHA 4XMOA 3UQGA 1B6CB 2ONLC 3DTCA 3VS3A 3DAKA 3ZU7A 4XH6A 3HAMA 4QRCA 5HHWA 4PDOA 5FP5A 4O7VA 2OICA 3HUCA 5CZHA 5EI2A 3QZIA 4GRBA 2VTJA 3OFMA 2P3GX 4R3PA 2J0IA 5HIEA 4AP7A 4GEOA 4NWMA 2C3KA 3QWKA 3OWLA 5CXZA 3P4KA 4O86A 5KCVA 4RJ8A 4AZEA 5IA3A 4RWJA 2C6LA 1OKYA 2PY3A 1KV1A 3E7VA 4EOJA 5A4LA 3BKBA 3GOKA 2X8EA 3FXZA 4F65A 2UW7A 5CWZA 4LOPA 2I40A 1OUYA 4CZYB 4DBXA 3I60A 2GNIA 3D5WA 4L46A 4BDJA 2JDVA 2BRHA 2C6IA 3FZOA 4IJ9A 4A07A 3G90X 5L6OA 5ANOA 3QAME 3O8PA 3VJOA 4YZMA 2IZUA 4EH9A 2OF4A 3GCQA 4YNOA 4PL4A 4ZSLA 3DAJA 4QP8A 3C4CA 1OVEA 1G3NA 1QMZA 2W1GA 3NYOA 2XRUA 3QL8A 4QTBA 3RHXA 4ACDA 4P90A 2YJRA 5BQ0A 3R9NA 2VTIA 4NEUA 3SRVB 2ZYBA 2YLEA 4KBKA 1DI9A 1J7IA 4LRJA 3SGCA 4BDAA 4YBKA 4C36A 1Y57A 4RC2A 4QP1A 1KWPA 3A8XA 2QOQA 1MRUA 2PWLA 2DS1A 1ZWSA 3FZPA 4XP3A 3TACA 4QQTA 5CEPA 1PXJA 2C5NA 3DLSA 3QCXA 4YO6A 5AUUA 4O7RA 3KF4A 2PVRA 4I5PA 4YJPA 5AUWA 3JVSA 2CHLA 4F0GA 3SXSA 4IM2A 3LFSA 2DQ7X 3CQWA 4O0YA 4PNIA 2JKMA 3QTSA 3LCOA 3ZC6A 4CT1A 5IH5A 4L45A 1YHWA 2EUFB 4F63A 4YNEA 2R9SA 3G6HA 4PRJA 2XAOA 3TIYA 2Z02A 1UNHA 5F94A 4E6AA 3LXLA 4K9YA 3VHEA 2GNFA 3W32A 4DFZE 4JRNA 5GZAA 4NIFB 3FQHA 3KXGA 3P78A 3VUDA 4DEDA 1HOWA 2B9FA 4RBLA 5IEYA 3A99A 5FEQA 3R21A 4XLVA 2OW3A 5IZFA 5JFVA 4JG8A 3ORZA 3SG9A 2OO8X 4M15A 2EVAA 1Z57A 3IW6A 4DH3A 1IA8A 2XA4A 1WVWA 3RNYA 5L4QA 5DVRA 4K6ZA 3LMGA 2C6TA 4FV5A 3ET7A 4WHZA 3AQVA 3NYVA 4O2ZA 2R0IA 2YIXA 4FOBA 4MNFA 4RVMA 5K5NA 4D2RA 3PPJA 4FL2A 2X9EA 3EQBA 2E2BA 5D11A 1GAGA 4C3RA 5HU3A 4B8LA 5TOZA 2WU7A 5CEKA 1JOWB 1KOBA 3C9WA 3D2KA 3IW7A 4FG7A 4CCBA 1H1SA 1W2CA 2EB3A 3COHA 1JKKA 1WAKA 4IX4A 4YHJA 5B2LA 2W1HA 3AKLA 3AOXA 3PP0A 3EKNA 3W2PA 3ATTA 2XF0A 4A4XA 3TZ7A 5AV1A 3CGOA 3ZTXA 2PMLX 4I5CA 5CI6A 4XJ0A 1JKLA 3JS2A 4YHTA 3DJ7A 3E8CA 2FO0A 5CF8A 3THBA 2R3LA 1Q62A 2OSCA 4AXEA 3TL8A 2PVMA 4HVSA 4XBUA 3LFEA 1OZ1A 3M1SA 4CFUA 3L1SA 4CV9A 1XMMA 3L8XA 4ACHA 3QTQA 1XH8A 4BL1A 5CSWA 2CN8A 4YJSA 3V5QA 4DC2A 3NYXA 4ZMEA 2IG7A 3MPMA 4WG4A 5FTQA 3RAIA 1U59A 2PVKA 4JDHA 4LL0A 2W1FA 2YN8A 4JXFA 3DKFA 4ANSA 3UOJA 1S9IA 5IU2A 2B4SB 5JK3A 3C7QA 4GS6A 1SZMA 3PRFA 4HVIA 4FT5A 3TV7A 5DOSA 2VZ6A 1I44A 1G5SA 3EL8A 5HCXA 5AV4A 3MVJA 5F20A 2YLFA 4BCMA 3PWDA 4C4HA 5A3XA 2RFDA 2R2PA 2UW8A 3MN3A 2B1PA 3PJCA 3UNJA 3CBLA 5M06A 5FRIA 1ATPE 1PYEA 4O1OA 1LP4A 1HCLA 3IW4A 3KN6A 3Q6WA 4GVAA 5IQEA 5J87A 4IC7A 2YZLA 3WZKA 2C6KA 2JAMA 4E20A 1KV2A 3P23A 3BQCA 4O2PA 5AWMA 3UGCA 4RFYA 4QTCA 4AS0A 2R3NA 3OHTA 1PXNA 3V04A 2E9PA 3E3PA 4DG3E 5HTIA 3C4WA 3NYNA 3NEWA 5BVFA 1SNXA 3WYXA 5LCJA 3ALOA 4W8DA 4GG5A 3UODA 3KXXA 4FSQA 3MTFA 1H4LA 2QKRA 2HENA 4E6DA 3V8TA 4CLIA 1IAJA 2OH0E 3E62A 2AEGA 3AKJA 3KB7A 2XAMA 5HZNA 4O0XA 1T46A 4S32A 4HZSA 2QD9A 4WKQA 5G6VA 1H07A 1AGWA 2G2FA 3KRJA 2RFEA 3EQPA 1H27A 5I5ZA 4U3YA 2ITVA 4D28A 3WYYA 5HD4A 4QNYA 2J5EA 4FYNA 3KXZA 4H3BA 4RQKA 2QG5A 4FTLA 4C59A 4DG2E 4ENXA 5L2WA 4JS8A 4PV0A 3FWQA 3MA3A 4YGAA 2X0QA 4IAAA 2C5VA 5DGZA 5C27A 2QI8A 3R30A 5M4IA 3QD2B 1YWRA 1OL1A 2QOHA 3R2YA 4H3PA 4IZAA 3OCTA 4EEVA 1KUTA 5CSXA 3OXZA 2RGPA 4DBNA 1WZYA 5CZIA 4D2PA 2XIZA 4MQ1A 4NJ3A 5F4NA 2W5AA 3EFKA 2UVYA 4DEEA 1H1WA 4KSPA 2HZ4A 2I0YA 2XIYA 4M97A 5DEWA 3TDVA 4KRCA 5AR7A 2RG6A 3FZ1A 2OXYA 3ZO4A 4DDGA 2H9VA 2R3IA 1OBDA 3FY0A 2NRYA 3T9TA 3D4QA 4JAIA 4KS7A 3UVQA 4YSMA 2GS6A 3QUPA 4I21A 1F5QA 4IWQA 4NH1A 4E4LA 4ANMA 3QUEA 2JLDA 4D2SA 2OH4A 4U43A 3SD0A 4M67A 2J6MA 3HV7A 4FIEA 1KOAA 4P4CA 4ZS0A 4BYIA 3KREA 4C2VA 2R3RA 2R3OA 4AAYA 2VV9A 3K5VA 2CGXA 5BV3A 4DCAA 2IWIA 3BHUA 5EKNA 3LMHA 1WBOA 2VNWA 5E8UA 2XCHA 1O6YA 3ORTA 4H05A 1ZMUA 3HMPA 3TM0A 5D7VA 1VJYA 3ODYX 4FKJA 2GHGA 1WBSA 4FKTA 2QOOA 4ITHA 4O38A 5KMMA 4L00A 1PXOA 2XP2A 3DDQA 5M56A 4X2JA 5AEPA 3FLYA 4FF8A 2P2IA 4YURA 3T3UA 4QDEA 4PDPA 4BIDA 3C0HA 3PIXA 5IQIA 4O7NA 3ZM9A 1U46A 2ESMA 3AT3A 4BKJA 3CLYA 4ZTLA 3FSKA 3LJ1A 4K77A 2OJGA 3NR9A 3RALA 4HVDA 3NW6A 2W96B 2ZDUA 3GC9A 1VR2A 2R3KA 2J4ZA 3SW7A 4AQKA 1RE8A 1URCA 4FKUA 4G17A 2XBAA 5CX9A 5J95A 2XK6A 4EHVA 1WVYA 3DJ5A 4P5ZA 1BL7A 3DFCB 4LG4A 4Y95A 3R8PA 1IRKA 2WTIA 4D4YA 1PXLA 3C51A 2ITTA 2Y8OA 2XNEA 2ZAZA 4UYNA 3FEGA 1U5QA 1JSVA 2VWYA 4DYMA 2WTJA 4DEHA 2C5YA 2JFLA 5J9ZA 4NTTA 2KULA 4LL5A 3VBXA 5JFWA 3MYGA 3MB6A 5DR2A 3RINA 3AD6A 1YDRE 3FY2A 4FJVA 1XQZA 1ZLTA 5JZJA 3HMMA 4JR7A 4E4NA 3N4TA 4MF1A 4WBOA 3BIZA 3COKA 1R1WA 3E87A 4JJRA 4QMQA 4NK9A 3O23A 3Q5IA 4DFXE 4IW0A 4M13A 2PZIA 1P4OA 3MA6A 3OROA 5E92A 3IOPA 4IWPA 3O50A 4XOZA 5ETAA 3FPQA 2CCIA 3LQ8A 4ZZOA 1IA9A 2I6LA 5DBXA 1GIHA 4W4XA 4MXCA 5M4FA 2B9HA 1XH9A 5KMIA 3P79A 2WTWA 3NW7A 2HCKA 3FQSA 2NP8A 5AP3A 5CF6A 5DG5A 2CNVA 5FQDC 4KD1A 3P7BA 1RW8A 1R0EA 2BVAA 2WOTA 4J98A 1W2FA 3TKHA 2WXVA 1SM2A 4WNKA 4ZXTA 3RMFA 4BCJA 3HA8A 1FVRA 1PMNA 5HG9A 3UTOA 4M8TA 3GVUA 4BDKA 3POOA 4AFEA 3HV6A 5BMSA 3FMLA 3FZSA 3VWAA 4I5MA 3ZBFA 4PWNA 5HIDA 5AAFA 2XYUA 3G5DA 3Q9ZA 1ZAOA 2CMWA 2YM6A 4AE9A 4C33A 4FKIA 5AAEA 4DA5A 3Q53A 1BMKA 3ZXZA 1Z5MA 2X0PA 2X7FA 2PZRA 2XB7A 2GSFA 5H9BA 3CP9A 3OS3A 3VW6A 3H4JA 4ALWA 4FBXA 4ZEGA 3MH3A 4XP2A 4QTAA 5AV2A 2BIKB 2C5XA 4QQ5A 1RDQE 4JBOA 5CLPA 3C13A 4CGAA 4AZVA 3PRIA 4M69A 4BCFA 4DLIA 4QEBA 4XG7A 4E3CA 2Z7RA 1GZNA 1H8FA 4FTAA 3NUSA 3AMAA 3SW4A 3W55A 3MESA 4EQCA 2HELA 3ZRLA 1LUFA 4UMQA 5EI6A 3RGFA 5HGIA 3VJNA 5IQBA 1UWHA 2X4FA 3Q5ZA 3BEAA 4AA4A 5EQPA 2JKOA 2FA2A 4NW6A 3VN9A 1JVPP 3AD5A 3QGWA 4G34A 5H8EA 3KXNA 1V0OA 3ID6C 4F1MA 2OLCA 4FV6A 5IMXA 3NZ0A 3QQFA 3TTJA 2WTKB 2X6EA 2QOIA 4FMQA 2V62A 5F9EA 4M66A 4RLKA 1B38A 4HYUA 3RVGA 4TWPA 4YO4A 2UVXA 1UKHA 3QRKA 3FZTA 4GT4A 4RVLA 5CYIA 2QG7A 1ZARA 2X81A 4IBMA 4BGHA 3P9JA 4IM3A 4EQMA 5HBEA 3ZO3A 5GIOE 4DH5A 4IANA 5ETIA 4QO9A 5KMOA 2W06A 2XANA 3V51A 4DH8A 2Y0AA 2OI4X 3ORMA 2GS2A 5DHJA 4JQEA 3OOGA 4R5SA 1BI7A 3TXOA 2XS0A 3C4XA 4DTAA 3ENHA 4AWIA 4L42A 5KHXA 4TRLA 5DN3A 1OL7A 3TZMA 4UXQA 4FC0A 2XZSA 5IQAA 1IR3A 3EQDA 2VWIA 3PSDA 4GJ2A 4IXPA 2QOKA 3OCGA 3WIGA 3Q9XA 3H30A 4BTFA 3RZBA 4YC8A 5IF1A 1NVQA 5IH4A 1FPUA 1BX6A 3HL7A 4GK4A 4QYHA 5GZ9A 3LFBA 1GOLA 4UMUA 3WIKA 3AC1A 3LZBA 4UMTA 2PMOX 3O8TA 2JBPA 4BTJA 2V7AA 3RPVA 3VONA 2A98A 5D10A 3F6XA 4CSVA 4ERKA 4NYEA 2A19B 1QL6A 3AD4A 4NKAA 4QT1A 3F3ZA 4U79A 2VTHA 4XYFA 5DEYA 3UOHA 3VS0A 2RIOA 5CS6A 4AQCA 5IISA 4IZ5A 2BPMA 1E9HA 2WMXA 1OI9A 4UX9A 3ULIA 4TWOA 4U44A 5KBQA 2P0CA 4R5YA 4QMLA 4MXAA 2VUWA 4R6VA 4QPSA 1XH4A 5T68A 2B55A 3O0GA 4BDFA 3MS9A 3CEKA 4X3JA 2VO0A 3I0OA 1M14A 3PY0A 4KRDA 4LYNA 4DEAA 4BJJA 4B7TA 1H28A 1V0BA 3REPA 2AC3A 1A06A 1YXVA 3QKKA 3HNGA 2HWOA 2OXDA 4JIKA 3KMWA 1YVJA 2R64A 3DGKA 3PY1A 1BI8A 1LEZA 3ZRKA 2CNUA 2CGUA 2PVJA 3G33A 2PU8A 3MJ2A 1H24A 3W18A 4AXAA 2ITNA 3RAHA 3UOKA 4B99A 5M57A 4OAUC 3O5AA 4PMPA 5AUZA 2BZJA 3PY3A 4FKQA 4Y85A 5EW9A 3BI6A 3D5VA 3AC8A 1ZOHA 4KKHA 5LWMA 3PIZA 4MEDA 3H10A 3P5KA 5HBHA 2X0OA 3NUNA 4FNZA 5B2MA 5IDNA 4FEVA 4R77A 4WSQA 3VS2A 4YJTA 4J99A 4BTKA 3OY3A 3TDWA 2WMTA 4FODA 4EK4A 4RIYA 2O8YA 4EONA 4JIAA 1YI3A 2BAKA 1O6KA 3V8WA 1REKA 4LUEA 4HCTA 3RKBA 4OGRA 3PTGA 4GUBA 5DMZA 4TYJA 4D9TA 5IQFA 4KAOA 2YWPA 5EQYA 4J8MA 4GW8A 2E9OA 4O22A 5BUIA 5CNNA 3IECA 3HKOA 2UW5A 4NU1A 4RZVA 2BRMA 4FTUA 3JY9A 1FGIA 4O21A 3BYMA 5M53A 5FXSA 4JI9A 4FV3A 4EK5A 4EKLA 4JLCA 2WMAA 1TQMA 4ID7A 4EH5A 5A54A 4OTFA 1ZYDA 3RWQA 5IEVA 1M7NA 2NNWB 4G6NA 3BL7A 3IKAA 3FPMA 1YI6A 1E1VA 5HCYA 3T3VA 3L9PA 4B4LA 5FBNC 4C2WA 3ZCLA 2YITA 4YJNA 3ZH8A 2OZAA 4I1ZA 5CASA 1JAMA 3GB2A 5IA5A 4EUUA 5J9YA 2X2LA 4YTIA 4DFLA 1V1KA 3ORPA 2SRCA 5EI8A 3CR0A 3OBGA 2VRXA 1RJBA 2R3GA 2F49A 4J52A 3AC5A 4ZTMA 4F08A 3KK8A 4O0SA 3DA6A 5CEMA 2YIRA 3OW4A 2ZOQA 4FTCA 4MK0A 4L6QA 4PY1A 3ZHPC 2E9NA 3G9NA 4FZ6A 3IDBA 2NYAA 2WHBA 3EL7A 2PULA 4FZFB 2VTOA 3BL9A 4HOKA 2JIIA 5AJQA 4DCEA 1Q8ZA 1M2PA 3KEXA 2C6MA 4FEQA 4JBPA 5KZ0A 3BE2A 2VTMA 2IEWA 2YIQA 4R3RA 3TN8A 5E4HA 3G0EA 3RPSA 4F6UA 1KE5A 4Z55A 4FT7A 4EK6A 3PJ8A 3BBTB 5FXRA 3KCKA 5I9VA 3G2FA 4BZDA 4IACA 5E90A 3MH0A 4BDIA 3O8UA 4DLJA 5KX8A 3QX2A 3MBLA 4CFNA 3QYZA 3L8PA 3VC4A 5DLSA 2WELA 1XJDA 2XNMA 3UIUA 3QBNA 4UALA 4M12A 5EG3A 3BX5A 2JITA 3AXWA 3LFFA 3R9OA 4EUTA 2GPHA 2JDRA 2WEVA 3A60A 3LIJA 3O2MA 5B2KA 2X4ZA 4ANLA 2W1IA 3E63A 4DGNA 5GZ8A 2BALA 4Y83A 4ZOGA 4OUCA 5EW8A 2B53A 1LEWA 2ITUA 3HYHA 4RRVA 5GHVA 1GZKA 4RC3A 2PVLA 4F99A 3DNEA 3OUKA 5CQWA 3VUHA 4DFNA 3RJCA 4MD9E 2BDFA 3W8QA 1ST4A 2B54A 1Q24A 3GNIB 4QMZA 4TPTA 4Y8DA 3HUBA 4IZ7A 5EHLA 1A48A 3FDNA 4OTWA 1OPJA 5FD2A 2IN6A 3OF0A 4QP7A 3FV8A 2I0VA 4AOIA 5HTBA 4X6QC 2NPQA 3BLHA 3BU3A 4GFGA 4ORKA 3ORLA 3NWWA 4PTCA 1YDTE 2VAGA 5AP1A 3BLRA 4RJ5A 3D7TA 3DY7A 4FV9A 3D5UA 1PXKA 4FSUA 4JOAA 3EN4A 4OW8A 5AR4A 4HNFA 2YDJA 5G1XA 3P5JC 5M4UA 1YW2A 4A9RA 1KE9A 3QQJA 3PLAE 5CAVA 3MB7A 2P4IA 4MNEB 4WO5A 5CEOA 2Y4IC 3AGLA 4M14A 5JGDA 3A8WA 4I6HA 2YAAA 3I81A 3UC4A 2PVNA 4BCOA 4I22A 3WE8A 3R7EA 5LXMA 3FMHA 4AU8A 5FM3A 4OBOA 4GT5A 4UY9A 4IAZA 4EZ7A 3PG1A 4M69B 3R9RA 3V5TA 1OECA 3SAYA 4AW0A 1KE7A 2QNJA 2VX1A 4J8NA 2QLQA 2IW8A 5KNJA 5AP5A 1FINA 2CKOA 5BYLA 4HPUE 3R01A 3C4EA 4MCVA 3QWJA 5HLPA 3UJGA 4C4IA 3MFSA 3UDSA 4EHZA 4AGDA 1UA2A 2JDSA 2O2UA 2WQOA 3QYWA 5E1EA 2WGJA 3EN9A 3HDNA 4GIIA 3LFQA 4MHAA 3FMNA 3G9LX 4O0RA 4ACMA 1OKVA 5ACBC 4FI1A 5BYZA 3CJFA 4CXAA 1NA7A 3CCNA 5HVKA 5DRBA 3TT0A 4BHNA 1U54B 3P7AA 2O64A 3KF7A 4TNDA 4U8ZA 2XNOA 4YLLA 3U51A 3UO5A 4RJ6A 3S4QA 3BZ3A 3RI1A 2CDZA 3QTUA 2DYLA 4FUXA 5DI1A 4FTNA 3TV6A 4KNBA 5LWNA 5JN2A 3O7LB 2BZIB 3MY1A 2F7EE 4GSBA 4JT3A 5FDXA 2JKQA 3RZFA 3FKLA 3IGGA 3F2NA 3PE2A 4BKZA 4GCJA 1HCKA 3A7FA 3QRIA 4L68A 4A7CA 5IA1A 4O83A 1O9UA 2WD1A 3A7GA 3ZUUA 2BR1A 3MI9A 5GJDA 3AC2A 3U9CA 2GS7A 3OVVA 4QQCA 1ND4A 4RWIA 4YC6A 5GINE 1W84A 1J1BA 3SXRA 1XH6A 3CKWA 3COIA 3EQGA 5DT3A 5CEQA 1TFFA 3LXNA 5HOAA 3PA3A 3S0OA 3BLQA 3GFWA 4I24A 4I6BA 4FGBA 4F9CA 1NY3A 3VO3A 2UZOA 4I4EA 2A2AA 2HZNA 3DDPA 4FKRA 4EKKA 2UW4A 3KGAA 4C3FA 5C01A 3BYOA 1Q5KA 4UWYA 4C4GA 1YDSE 2C47A 3K2LA 5HIBA 3ZXTA 2IW6A 4O7LA 2ZDTA 2W1ZA 2ERZE 3BCEA 2PUPA 4I6QA 1PYXA 2XK8A 4FL1A 4RPVA 5E8VA 3FC2A 4FNWA 4AGWA 2F9GA 4BI1A 3R7VA 3IK3A 3SLSA 4AN9A 3W0RA 4I41A 3MPAA 5AUVA 2HIWA 3GC8A 3TUBA 1H01A 2EXMA 4R7BA 4ZJVA 4N70A 3FHRA 4Z3VA 4MD8E 1JNKA 2XNPA 3VBVA 4CT2A 5C03A 3HX4A 4OTHA 2ETKA 4ONAA 2VO3A 4S2ZA 1H0WA 5IEXA 1OBGA 3VF9A 4BI0A